3THBA

Structure of plk1 kinase domain in complex with a benzolactam-derived inhibitor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
287
structure length
287
Chain Sequence
EVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKVLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PLK1
publication title Discovery of a Potent and Orally Bioavailable Benzolactam-Derived Inhibitor of Polo-Like Kinase 1 (MLN0905).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 78
structure length 287
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2011-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3thbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3thbA01
1UWJA 3PVWA 2WTWA 3Q32A 5ITAA 5HI2A 4FZDB 4QMWA 3FMMA 4H39A 4EH8A 4IFCA 5GJDA 1K2PA 3FAAA 3KN6A 4M67A 4RVMA 4FVQA 2G2IA 5T3QA 4BZDA 4AZVA 2DQ7X 5KE0A 3VS0A 2XKFA 5HU9A 2ZYBA 4Y72A 4G6OA 2W5HA 2VTLA 2QC6A 1GZKA 4X3FB 3MFUA 1Q5KA 3QGYA 4BZNA 3ET7A 4ANOA 3LCDA 3FE3A 2QR7A 3EN6A 4O6EA 3OTVA 2WOTA 5F1ZA 5ANJA 2C68A 2NRYA 3KRXA 3BBTB 3WIKA 2JIVA 3C0GA 4PL4A 2VD5A 4J99A 5HNBA 3FQHA 3UC3A 4CT1A 4DGGA 3VS1A 4FEVA 5HVYA 2V55A 3BV3A 4KA3A 2YLFA 2IN6A 3M42A 2C6LA 2A1AB 4OW8A 3A8WA 2C6KA 3F7ZA 4XG4A 4NK9A 1FVVA 4PP7A 4YSMA 2B55A 3A7GA 4RRVA 1IEPA 1CSNA 3ETAA 3UG1A 4A9UA 4FNXA 2UZOA 3ZZEA 2JDSA 2RSVA 3P7CA 2WU6A 2RKUA 2X8IA 3HV5A 2XNOA 4EKKA 4BN1A 3QX2A 2WGJA 5E1EA 4E5BA 4ZTLA 4BZOA 3L9NA 3PFQA 5ETFA 4CD0A 2ZJWA 3KXGA 4BGHA 4DITA 4BBFA 4X3JA 2YZAA 3ELJA 5HNGA 4FV8A 4GL9A 5CU3A 4FV0A 3MPMA 3MBLA 5CXHA 3R7VA 2C6EA 3ZEWA 2XK9A 5K0KA 4K0YA 5HVJA 3DXPA 3SW4A 3E8NA 2EWAA 4JDJA 4Q9ZA 2ITXA 5CAVA 3DJ6A 4F9WA 4FKUA 4RC2A 5B0XA 3LMHA 3KXNA 4V0GB 3FUPA 3QCQA 1Q4LA 4RZVA 1H24A 3NW5A 4RFYA 4A7CA 2CLQA 2WTDA 3NNWA 3PIYA 4RLKA 1MQ4A 2XK6A 2Y9QA 4YZDA 4JOAA 4ZXTA 4NUSA 1FBNA 1G8SA 1QCFA 2PVFA 3CCNA 4HPTE 2BVAA 3PVBA 3V04A 5EHLA 3G2FA 4KBKA 4AQCA 4FV6A 3IS5A 5IDNA 3NVMB 4OTHA 4U6RA 4TNDA 5AWMA 2VWIA 2J2IB 4F08A 4YJVA 4FIEA 3F9NA 3FY2A 3QU0A 3RI1A 2VZ6A 1JNKA 4LGHA 3QCXA 2A4LA 4TNBA 3TJCA 3TNIA 3GVUA 3NIZA 1PXPA 4ZTNA 3OY3A 5DFPA 1OPJA 5CEMA 2Y4IC 2Y4PA 1DM2A 2I1MA 3JUHA 5CENA 5IQDA 4OBOA 3VBQA 3IOPA 1YHSA 4USEA 3MIYA 4RIYA 3G5DA 5E92A 4BCQA 5J7HA 2BRGA 3PLAE 2NPQA 1OZ1A 3R6XA 1GOLA 3PG3A 1H4LA 4NZWB 4Y5HA 4BDIA 3MVMA 2XIYA 3HLLA 2W0JA 2XNEA 3COHA 4IX3A 4F64A 1VZOA 1F3MC 3PP0A 4JL9A 2UW4A 5CAPA 2YM8A 2RFDA 4EH6A 4PQNA 4UZHA 1BYGA 2XK3A 4IB5A 2ITOA 2XRWA 4Y73A 2I6LA 5ANDA 5CALA 4I24A 4FKSA 2WQOA 3R8UA 4AGWA 4YO4A 5CWZA 4WHZA 4WNKA 1X8BA 4PRJA 5LCJA 1IASA 1VR2A 5HZNA 2F9GA 3LXLA 2VTSA 3OOMA 3R7UA 5EW3A 4U81A 2BHHA 2C6DA 2CNVA 4USFA 4YURA 3FLYA 5M4IA 1U5QA 3S2PA 3O2MA 2PU8A 3AQVA 3VN9A 3W2CA 5HOAA 4U80A 5KMLA 1Y6BA 4E4LA 4ZJIA 3SRVA 5J79A 3U6HA 3UMXA 3V8SA 4O81A 3SG9A 4LGDA 4C3FA 4DYMA 5JFWA 2R5TA 4F1TA 2X9EA 2PMNX 4QMUA 4LUEA 4U5JA 2OO8X 3DKCA 4MKCA 1GJOA 4YTHA 4GU9A 4BKYA 3DY7A 3BHTA 4D55A 4DGNA 4OAUC 1ZOGA 2VWUA 2Y4IB 5EM8A 5C9CA 5CY3A 2G1TA 1FQ1B 5M07A 2J51A 2QO9A 3COIA 4FV3A 4DFZE 4MXCA 4C3RA 3FPQA 4B6LA 5EW8A 2F7ZE 2JDTA 3DLSA 3ZM9A 4EYJA 3KU2A 3UYTA 3F3TA 3MW1A 3Q5ZA 4HYUA 4FT7A 4OTRA 4E93A 4PTEA 1URWA 3S1HA 1O9UA 4BI2A 3ZRLA 3D5VA 4O7YA 1ZYCA 4I92A 3Q5IA 3PG1A 5IA5A 4FSYA 4B99A 4K8AA 3P78A 4LMNA 3HX4A 3C4ZA 3QFVA 5LMKC 1A06A 3LFCA 3QZGA 5J87A 1OPLA 3FLWA 4IAKA 4O27B 4KUJA 1REJA 4FEUA 1SYKA 3LFNA 3P7AA 3CR0A 3QKMA 4G3FA 4IANA 4YLLA 3KRLA 4GFMA 3C0IA 3V51A 3AD6A 4C8BA 2AYPA 3GB2A 3U9NA 3DBFA 4K1BA 4DN5A 4JLCA 4LI5A 5FEQA 4XG9A 3E93A 4YC6A 5HHWA 5IEXA 3Q3BA 5LVMA 2VNWA 3UO4A 2REIA 4WBOA 3O51A 4EK8A 4XHKB 4FT9A 4HCVA 1GAGA 5AUZA 1FVTA 4E1ZA 3UQCA 3PY3A 5FLFA 5I9ZA 5M53A 4YMJA 3VIDA 3AMYA 3I7CA 4M3QA 4FSNA 4BYJA 1B38A 2F7EE 4CZUA 4MD8E 1SVEA 2OJGA 4UMRA 4GRBA 3ZM4A 4IFGA 2NO3A 4W4YA 1PY5A 4YC8A 1CKPA 4HVHA 3WYYA 3FZOA 4FNYA 4V05A 5AUUA 4AE9A 2HELA 1QPJA 3O0GA 3TNQB 4Q5EA 3AC3A 3UP7A 4LYNA 1J1CA 2W7XA 3R0TA 4FVPA 2VTJA 1UKIA 5IKWA 4BWKA 2QO7A 1Q3WA 2ONLC 2OJJA 1IAHA 4MD9E 1YDSE 4L6QA 5D10A 3KMMA 4IVCA 2VU3A 4FEQA 4DEIA 1BX6A 3AC2A 3E88A 3WBLA 3QALE 1YXVA 4BCGA 2YZLA 2YDJA 3ZH8A 4EOSA 3E3PA 2WMBA 4XX9A 1IG1A 2XIZA 4J97A 3E64A 2CGXA 3LJ0A 5EFQA 3LFEA 2HW7A 5EW9A 4NCTC 2R3OA 5A9UA 5IISA 3HA6A 3TNWA 3AG9A 4IC8A 3EOCA 1H0WA 3W10A 4JBQA 4TXCA 5M56A 4USDA 3RNIA 4C02A 4DH1A 2JDRA 4RJ8A 4O0SA 4TWCA 3IW8A 5FXSA 4BCOA 3ZLYA 3RBWA 3ZSHA 4PWNA 3EQBA 4JG8A 4DFXE 4WD5A 2JKOA 4FYNA 5EH0A 3ZSGA 4YZMA 3TTIA 4G16A 3HP2A 2Z7QA 3WZDA 3EFKA 3PYYA 3ORLA 4RIYB 5FM2A 4U3YA 4FA2A 3ZRMA 4FUYA 2VTOA 3BI6A 3TV4A 4RJ5A 4CTBA 4LMUA 4GG5A 3ZO1A 4UN0C 5C27A 2BRHA 5AMNA 4AOIA 1H07A 5KKRB 4J95A 2CKQA 4DAWA 4HYIA 2ITVA 3FJQE 1Q8TA 1OL1A 3H3CA 4FMQA 4I6QA 1XBBA 2XIXA 4G3GA 2WEIA 1H8FA 4L52A 4F6WA 2W96B 3OCSA 3LQ5A 2EB3A 1WBPA 3UVQA 4BRXA 5IEYA 4MH7A 2UW5A 3NNXA 3QQJA 1J91A 2WXVA 5DEYA 3WI6A 1HOWA 3PLSA 4FKOA 2QLUA 4CMOA 2ZM3A 4IM3A 2QOLA 3AXWA 1U54A 4CT2A 3GCQA 2XF0A 3WYXA 3WZKA 3LXNA 3ZLXA 1REKA 3VBXA 3ZUVA 2PWLA 2Y6OA 2J9MA 4CV9A 3UIXA 4X6QC 4ZIMA 4DEAA 3V5QA 4C0TA 4CGAA 4WOVA 4IM0A 4DTAA 4YC3A 4C34A 5HBEA 1HCKA 4B8LA 5M4FA 4WO5A 5AP5A 3NAYA 5IQEA 3SRVB 4C58A 3V3VA 5AEPA 3MH3A 4TYGA 3HZTA 1NXKA 2PHKA 4FNZA 2C47A 1ZWSA 1J3HA 3BHHA 4AOTA 5HTIA 1ZLTA 2IVTA 3PA4A 5BVOA 1Q97A 1W8CA 4UWBA 4CRSA 5AFVA 3NYXA 3JR1A 1OL7A 4RVLA 4YJPA 5C4KA 4XG2A 4L7SA 3G9NA 4IVAA 4AN3A 5ETIA 3TIZA 2C6TA 2H8HA 3CPCA 3DKOA 2C5XA 1Q8WA 2UZVA 3IW6A 1PXNA 4EORA 2RF9A 3LKMA 2OBJA 4I6BA 4YUQA 1F5QA 4BIDA 2R9SA 4QOXA 2UZWE 3PPJA 4EHEA 1OM1A 2GHMA 1OIUA 5AAEA 4R7BA 2X2LA 2WKMA 1KSWA 4I1ZA 1U59A 2QOOA 4O22A 3TKUA 3QCSA 4IWOA 2PVJA 1QPDA 4GVAA 4PL3A 3ZO2A 3DBQA 2X8EA 4RWLA 3AMAA 2YLEA 4CNHA 4EK6A 3L9LA 5ETCA 4ZK5A 5B7VA 1XH5A 2WHBA 1HCLA 4GK4A 2R3FA 1KOBA 2X6EA 3NIEA 5AV0A 4BDJA 2PZIA 4EOJA 4PF4A 5IQFA 4QTDA 4D9TA 2VWVA 4X2KA 3HMIA 4DH3A 2EB2A 3Q60A 1NW1A 4PUZA 2YCRA 4FL2A 4QMVA 3Q4TA 4A9SA 4TL0A 2GS7A 3PZEA 3EFJA 5IEVA 4EC8A 4AE6A 1VYZA 4ZSAA 4E26A 4WSQA 4G6LA 4F9YA 4EJ7A 5B2LA 2VO6A 2GNGA 3GBZA 3Q04A 4FZ7A 2ZVAA 2WMXA 3OWPA 2UVXA 4KIKA 2XYUA 3VAPA 4ENYA 1JSUA 1WFCA 2IW6A 2UZBA 4MX9A 4CFFA 1UU7A 5D41A 4E4XA 2R3NA 5KX8A 1AQ1A 2OWBA 5E8SA 3F5GA 2PVYA 3ENHA 4LL0A 3T9TA 4AP7A 3KC3A 2FVDA 1ZARA 3TXOA 5M06A 1KE8A 3BHVA 4UYNA 3UNKA 2ZDUA 5LWMA 4MK0A 4D4RA 2XEYA 3TDVA 3EN7A 1DAWA 4JS8A 3UC4A 5A46A 3FV8A 4ONAA 5J95A 3FMNA 4ACDA 4PDOA 1M17A 3OROA 3R1SA 5J5SA 4QMPA 1MQBA 2ZAZA 4GU6A 4D2TA 3OBJA 2WTCA 4FKRA 2J90A 5CQUA 1RW8A 1V1KA 1W98A 4EC9A 5LMAA 4CEGA 5HX6A 4HOKA 5EYCA 2F2CB 3VWAA 4MBLA 4BYIA 2V7OA 2BROA 1OL6A 1SMHA 3LQ8A 4JDIA 2WQMA 4BDGA 3RVGA 3A7JA 3UG2A 3I5NA 4FSZA 4DT9A 5HESA 4IM2A 4IAFA 5DG5A 3CBLA 3O17A 1M2RA 3DA6A 5AP0A 5CXZA 5KHWA 3FEGA 1YWRA 5I9YA 4MYGA 4M8TA 4LQMA 5HG8A 3OW3A 2HY81 4ID7A 1E1XA 2ETRA 2WFYA 4V04A 5T68A 3EQGA 2YIRA 4AZEA 2BALA 2LAVA 3A99A 4F0FA 2FH9A 5CU0A 3QTSA 1AD5A 3BRBA 2R3MA 5J9YA 5JFSA 5AUVA 3WIGA 4OR5A 4RQKA 3QTZA 3M1SA 3OS3A 2O2UA 2QOBA 4JVGA 4R3RA 5HG9A 3SC1A 3FZTA 2E9UA 3KRWA 5IQIA 2QOIA 4W4XA 3TV7A 3KF4A 1W0XC 2OSCA 2EVAA 2W1HA 4HZSA 4IDTA 5EI2A 4DFYA 3NYOA 4IADA 2YIWA 4O0RA 2YWPA 4LUDA 4QP3A 2WO6A 3B2WA 4IAAA 1LR4A 2UZDA 4D2PA 4FTAA 4ZSGA 5IH5A 2XCKA 1E1VA 2C6MA 5HIDA 4ZLZA 2X9FA 3TNHA 1WVWA 2J7TA 3ANRA 4DLJA 4E6CA 2OH4A 3ZFYA 4NFMA 2JBOA 4IZYA 5DR9A 4FTKA 5BPYA 3F2AA 1O6KA 4MXXA 1YOMA 3VS2A 3LVPA 3FC1X 4BI0A 5C03A 3CTHA 5D9HA 3VNTA 1Q62A 1U54B 4DFBA 4F70A 4IJ9A 3TG1A 2XJ0A 4JDHA 3KVXA 4XRJA 2JIUA 4O0TA 4O7WA 5CU2A 4ORKA 2OJIA 3GOPA 1PKGA 4IXPA 3C4WA 4IBMA 3UDBA 3DXQA 2XEZA 1LP4A 5HCXA 3U4WA 4QQTA 3WOWA 1YQJA 3IOKA 1OKVA 4OUCA 4YP8A 3A7IA 3SXRA 2ITUA 4FKLA 4DHFA 3C5IA 4HGEA 2HZ4A 3GNIB 3R01A 2JITA 3A62A 5A4CA 4QQJA 2CCIA 4QNAA 2PZPA 3S4QA 4EBWA 3HYHA 4B4LA 4EUTA 5IA3A 3R7YA 4HYSA 2OF4A 3VVHA 2UW8A 3C1XA 4IZ5A 2QG7A 2QG5A 4CYIA 5FDPA 1H27A 2X6DA 4QP1A 3O71A 4AW1A 3KXXA 4Y8DA 5DGZA 3OT3A 1QL6A 4FT0A 5E8VA 2YWVA 1OMWA 4ZS0A 3H0ZA 3ATTA 5AX3A 2FSMX 4L3LA 3ZEPA 3GCUA 4IX4A 4LGGA 4ERKA 1ZZLA 1H25A 2B54A 2ZOQA 4MWIA 5FWKK 3WF9A 2CKOA 4O7RA 2G2FA 5ANKA 3OWLA 1OL5A 2OW3A 2YM6A 4RVTA 2UW9A 4U97A 5CSWA 3TACA 2X2KA 1ZOHA 4D0XA 4NH1A 4YJOA 4QMZA 3DAJA 2JBPA 5A6OA 3W8QA 4RQVA 5AP2A 3RCDA 1YOJA 4OBQA 5L6OA 4HZRA 1Z9XA 3E7VA 3DGKA 4O7ZA 1UA2A 4BY9E 2QVSE 3CIKA 2GS2A 5AR7A 5AP1A 4CG9A 3PXYA 2C5VA 4IE9A 4IMYA 4L3JA 5TR6A 4BDEA 1Q99A 3SG8A 3MTLA 2HWPA 1U46A 3ORKA 2QU6A 3FSKA 4O21A 4MBIA 5EHOA 4BKJA 4WG5A 4KIKB 2YIQA 5HEZA 3LLAA 2P55A 4AX8A 4ANLA 5KMKA 4ZTRA 1UVRA 3OHTA 1ND4A 4J8MA 3QRUA 4CLJA 1FVRA 3NZ0A 3LCSA 4YTIA 4BVUA 4O38A 4W4VA 2ZMDA 3E5AA 5BVWA 3AD5A 1L8TA 5IUGA 4FUXA 4MEDA 3FMHA 5IH6A 5AV4A 2V22A 4OAVB 3ULIA 1WVYA 4IAIA 4MXAA 5F94A 3PIXA 3IGOA 1W84A 1LEWA 4KB8A 4L00A 4U3ZA 3RAHA 4E4NA 3MPAA 4WT6A 3R2YA 2ESMA 1Y57A 2WD1A 4ITIA 1Y8YA 4WRSA 3PIZA 3RHKA 1JAMA 3PJ3A 2GHGA 3QWJA 2B0QA 3HVCA 3RCJA 5BVNA 3WF7A 4I5PA 3ORMA 1FMKA 3G0FA 1A9UA 4PMTA 2J0IA 2O64A 1U5RA 3ZONA 3UO5A 4S30A 4S33A 4TYIA 3QRKA 2JKQA 5BMMA 3R83A 4O6LA 2ZV7A 3OBGA 3DDQA 4AW0A 2X4ZA 4KINA 4OTWA 3KVWA 4BDFA 5CF5A 4ALVA 4N4SA 3UIUA 3CD8A 5HQ0A 4FKPA 4FV2A 1GIIA 5C1QB 3P1AA 5DE2A 4PNIA 4APCA 3ODYX 2I0HA 3F5XA 4G5PA 3BYOA 4KIOA 5LVLA 4C36A 3DPKA 3PXQA 4IX5A 4R3CA 4ITJA 4YZCA 3MJ1A 5EM7A 4AF3A 4YBJA 3R02A 1YWNA 3MSSA 5CEKA 2CGVA 4CRLA 3R04A 2GHLA 3A4PA 3ENMA 3AGMA 4FV5A 4EH5A 4MD7E 4KRDA 3S95A 4YTCA 2PUNA 3MA3A 4X7QA 5EDRA 3MESA 4B7TA 3GXLA 1CM8A 4YHTA 4FTRA 3R8MA 3UOHA 2CHLA 4N6ZA 3ZC6A 4GJ3A 5JN2A 4Z16A 4FL3A 2OIBA 5E8WA 3BGQA 1Q8ZA 1Q8YA 4RBLA 5EKNA 3ZXZA 3GP0A 4FV7A 2G9XA 5M51A 3NW6A 5C26A 4RLLA 4P4CA 4DA5A 2OI4X 3DKGA 1OBDA 2JEDA 3RPYA 3PTGA 1UV5A 4DG0E 4X2JA 5AUXA 1YHWA 3D7TB 3R22A 4AT4A 4N57A 3ALOA 1BI8A 2WU7A 5DBXA 4BTFA 4L3PA 1FGKA 2HW6A 3DTCA 2DWBA 4EWQA 5H3QA 4H1JA 4A9RA 3QXOA 2VTHA 3IG7A 4GUEA 3NVKI 3FZSA 4YU2A 2GS6A 2YISA 2XIKA 3QWKA 4CZTA 3PVUA 4BCMA 3DCVA 3KK8A 5A4EA 4E7WA 3SHEA 2ZV9A 5CSPA 4CXAA 4BDDA 5LXMA 2CPKE 2QLQA 3FLSA 4R1YA 3BLQA 3OCTA 3MDYA 1JKKA 2PVKA 4ZMFA 4YJTA 3QQUA 3B8QA 3BV2A 3G90X 4X2GA 3MY1A 4PDYA 4ALWA 3G33A 2VUWA 1JKTA 3DBCA 1XKKA 4O0YA 5T6KA 4GS6A 5F20A 3P86A 1CKIA 3FXXA 4CKJA 3F2RA 3HMOA 3CLYA 2QO2A 2QODA 3KK9A 3MVHA 2VTNA 4U9AA 5EDQA 4BWPA 4DEDA 3TM0A 2IWIA 1JSTA 5CQWA 5EM6A 3VS3A 4RWIA 1DAYA 4L42A 3UOJA 4IEBA 3OP5A 2I40A 5IDPA 3O7LD 1UWHA 2ETMA 3EN5A 4TWNA 3TUBA 4BGQA 2CKEA 4GMYA 4ANBA 4WG3A 3U9CA 4FIGA 4KIPA 2PVMA 4RVKA 4C4JA 3OCGA 2WTJA 3HMMA 4I94A 5EHYA 5JMSA 2QOCA 3ZBFA 4E20A 2BRNA 1KE9A 2Y0AA 3RMFA 2DS1A 3PVGA 4JQEA 4QMTA 4BTKA 3SA0A 3N9XA 4TPTA 4EK3A 3RKBA 2B4SB 2QONA 4YZBA 1YXTA 4BB4A 3FKOA 2VGOA 2R3JA 5LMKA 5ACBC 2IJMA 4EOIA 2W9ZB 2JAVA 3NR9A 3ZU7A 3LIJA 5DT4A 3WF8A 3O8TA 4G34A 4F6UA 4LOOA 5DHJA 4LOPA 4ASEA 3D9VA 4EL9A 1GZOA 3HMPA 4AS0A 4XH6A 1M7NA 4YNOA 3OWKA 4Y95A 5F4NA 2JKKA 4MF0A 3NYVA 3LFBA 2PVHA 2UZNA 3EQHA 3BEAA 1WZYA 3R63A 4EOKA 4OGRA 3FKLA 3HP5A 4RPVA 1CKJA 3REPA 4EUUA 3ZHPC 2OU7A 3RAKA 3P9JA 3TUCA 4YO6A 5AR5A 4FSWA 2O8YA 2VNYA 3ACKA 3PPZA 5DNRA 2FUMA 2ERKA 4GKHA 2XJ2A 1PJKA 1JBPE 2PY3A 2QHNA 3ORTA 5TE0A 4D1SA 4I21A 3R7OA 4J96A 5GHVA 4ZLYA 5FTOA 2A0CX 3MPTA 5EI8A 3R7EA 2PUPA 2Q83A 3C9WA 2YDKA 3R8PA 2PZYA 3G51A 2R3IA 2CJMA 3UGCA 4G17A 5I5ZA 5KNJA 2BZKB 2GMXA 1UNLA 2ONLA 4F4PA 1Q8UA 3CP9A 1RJBA 4RIOA 1Y6AA 2ITWA 4FK3A 3UIMA 3EH9A 3ITZA 5LCKA 4ZZOA 4H1MA 4A4LA 3JXWA 5B2KA 4FKTA 3QUDA 3S00A 3EN4A 4FIFA 3DQXA 3UPZA 1QPEA 5GZ9A 3T9IA 4FTUA 5FQDC 4JBPA 4GIIA 1H28A 2C4GA 4NCTA 5K5NA 4UMTA 3JVSA 5A3XA 2DYLA 3K5UA 5HD4A 1PKDA 3DDPA 2PE1A 3DK6A 3LFAA 4QTBA 5K4IA 1GY3A 2W17A 5DPVA 3R1YA 3AMBA 3QTIA 1ZYDA 2R64A 4YJNA 3HV3A 1G5SA 3DFAA 5DR6A 5J1WA 3CKWA 3R71A 3FLQA 2CGUA 3R30A 5HG7A 4IVDA 1YOLA 3OF0A 3HL7A 2GDOA 3MTFA 4DCAA 4PDSA 2HY0A 4G3EA 3KEXA 4K9YA 4R77A 4JRVA 4Y46A 2JKMA 5A54A 3BLHA 2PUUA 4KKHA 3ZFMA 4YPDA 5KCVA 4TY1A 4FIHA 5HCYA 1OKZA 3II5A 4D2VA 2VTRA 4A06A 5EKOA 3IW4A 3RP9A 2Q0NA 3KFAA 3TEIA 3R73A 4M84A 2WB8A 4DEBA 3RK5A 5KUPA 4FSUA 3NCGA 2VO3A 4QTCA 5DOSA 3EN9A 3QL8A 3VS4A 4CLIA 4R1VA 2YJSA 3Q9XA 3PE2A 3TI1A 4D2RA 4U79A 4AU8A 5ANOA 1MRVA 2BKKA 5FBNC 2OLCA 1U4DA 2BMCA 4FT5A 4J8NA 5LVOA 2GQSA 5EG3A 3ODZX 3C5UA 4F09A 1L3RE 3QZHA 4K2RA 5JZNA 1NT2A 4WNPA 4ZTSA 3ACJA 4I6FA 4BL1A 3BU5A 3JVRA 3DZQA 3QRIA 5GIOE 4RMZA 5HKMA 2IVVA 3I79A 4R5YA 4MF1A 4H36A 2GTMA 2UV2A 3BYMA 2R3KA 3CY3A 2XM9A 4FV1A 3VBVA 4AN9A 2AC3A 4RWJA 2YCSA 5M08A 3CD3A 1PRYA 3AGLA 1YWVA 5DN3A 2YERA 3MFSA 4C61A 4M69A 2W06A 3Q4CA 2HOGA 5KZIA 1YW2A 2C3KA 2R0UA 4KSQA 1XH8A 3I5ZA 5EOBA 2HZIA 1DI8A 1Q3DA 4ASXA 5M4UA 5M09A 5F95A 3Q6WA 2W1DA 3NRMA 1YI3A 4L46A 2WPAA 3GT8A 4AGUA 1H08A 3TNPC 2E2BA 3EZRA 5BQ0A 2X81A 2CN5A 1PYEA 5IMEA 4XEYA 3TV6A 4NYEA 2QKRA 3NUAA 2HENA 3KRJA 3VQUA 4FL1A 3IDBA 3VUDA 4HW7A 3BEGA 5CVHA 4X21A 3F3WA 1FINA 4A4XA 3E3BX 3ORIA 5DYJA 5AUWA 5IQHA 2VWWA 4EEVA 3BZ3A 4R3PA 1KUTA 2BDJA 1ZRZA 1H0VA 3R9OA 4DINA 5CS6A 5EYMA 4BTMA 5A4QA 4ASZA 4M12A 3QKKA 4JRNA 5L6WL 3MH2A 2R3RA 1Z57A 3WE8A 3GQLA 2OGVA 1S9JA 5GJFA 3A60A 3FMKA 2R0IA 4Z7HA 2BR1A 4FSMA 3PY1A 4OTIA 4BBEA 1R78A 4BWXA 4XOZA 2W1EA 3D5WA 1M14A 4RC4A 5ANGA 2WMRA 5EI6A 3BWJA 5E8XA 4DBNA 5G6VA 4S34A 3HAVA 4O2ZA 4BFMA 4O0XA 5FRIA 5IA2A 3O96A 4HGLA 4NSTA 5AX9A 2OJFE 3OZ6A 2WTIA 3L8XA 1ZYLA 4XUFA 4CFXA 4CG8A 4JG6A 2J0KA 5DA3A 3U4UA 2VWBA 1Y8GA 2O63A 4IWPA 3DZOA 5AUYA 3PXFA 5IA0A 3FI2A 2F57A 2YN8A 4FG9A 1O6YA 3H10A 3MB7A 4DCEA 2XBJA 3ZBXA 4AT3A 3PDTA 4I22A 1EH4A 5JGAA 3DOGA 3F3ZA 1UNHA 4ZSEA 4ZSJA 3UIBA 2P3GX 3HGKA 3GCPA 5KMMA 4Z55A 4GK3A 4EZ5A 3V6RA 3D94A 3C4EA 3QCYA 3R9DA 4CKIA 3LZBA 3U6JA 2FGIA 3WZJA 3N4TA 3BX5A 5CVGA 3QUEA 3TKHA 4FTMA 4DE4A 4AGCA 2H96A 2Q0BA 5HE0A 4C2VA 3T8OA 4YSJA 3LW0A 2WAJA 4UZDA 3MGYA 4O1PA 5IUIA 5L2SA 4DFUA 5L2WA 3V8TA 5HIBA 4C33A 4LG4A 4K11A 3UPXA 1KV2A 5CAUA 2R4BA 5E4HA 3U6IA 4TYHA 3R8VA 5JKGA 4PPAA 2WTKC 2WQEA 2GQGA 3NDMA 1WBWA 2ZDTA 3FDNA 2QOFA 4FKJA 3C51A 5I9XA 2YM3A 4BGGA 5KMNA 3RPVA 4GV1A 1XJDA 2JFLA 3G0EA 3KCFA 3SV0A 2JGZA 1YI4A 3C0HA 3L8VA 5FXQA 2IZRA 1OECA 4I0RA 4J98A 3Q52A 3BYUA 4C4IA 5LJJA 5HVKA 1JPAA 3ZO3A 4BCPA 5D11A 4FTQA 2IW9A 3EIDA 3MB6A 5HGIA 4L8MA 2Z8CA 4QRCA 2PE2A 3EL8A 3ORZA 4IQ6A 5KZ0A 3GU7A 4WIHA 4XJ0A 4GT3A 3OW4A 1XH7A 4I93A 4FTOA 5CZHA 3LXPA 4U44A 4DH5A 2GFCA 3LFSA 5CEOA 3OY1A 2GPHA 2VTPA 1H26A 2QCSA 4H3PA 4FEWA 4BTJA 3VUIA 4FSTA 3BKBA 4QP6A 1DS5A 3WZUA 3FHRA 2KULA 3A7HA 3QXPA 5L6PA 2QI8A 2Y7JA 4Y5QA 1OUYA 4O96A 3ZLWA 2XRUA 1R1WA 3EMGA 1APME 2WZJA 3RM6A 3VC4A 3IK3A 3QYZA 3R9RA 3AT2A 3PXRA 3ZMMA 3GC9A 2FSOX 3BYSA 2ZV2A 2LGCA 4QP9A 5BUJA 4CVAA 3WARA 4IAZA 3PXKA 2IPXA 5AV1A 4D4YA 5BVKA 3AC1A 3DB6A 4QYGA 3NEWA 5JRSA 4GIHA 3Q4UA 4R8QA 5BVEA 2JDOA 4AFJA 5LQFA 2X7FA 3VW8A 3UZTA 1IAJA 2GNIA 3TZ9A 3UTOA 1FOTA 1O6LA 3PP1A 4AAAA 1ERKA 3WF6A 5KBQA 4WSYA 3Q2MA 3ATSA 4KKGA 4MNEA 3LMGA 4M69B 2BRBA 4TWPA 5J9LA 2B9IA 2RGPA 3D2KA 3ORPA 4LFIA 4WNMA 1WBOA 3R8LA 1IR3A 5DVRA 2J0LA 4XV2A 1PHKA 2O65A 1JWHA 4RGJA 3THBA 2W4KA 2YAKA 4I23A 3RGFA 3IQ7A 3QLGA 3NW7A 1FMOE 2BIKB 3PWYA 3UODA 3UVRA 4MAOA 5BYZA 4O82A 3DLZA 4KIQA 4WNOA 5HLNA 3F82A 3FQSA 2NP8A 3EJ1A 1Q24A 2XNPA 5K3YA 3RPRA 3KULA 3V5WA 5FDXA 2YACA 3C50A 3D5UA 3R28A 4XLVA 4D5KA 5CF4A 4GKIA 2WIPA 2J0MB 4X0MA 4NEUA 4FR4A 3QAME 3UVPA 1MRYA 2WIHA 4KBAA 3IW5A 3RK9A 1J1BA 2JFMA 4BCIA 2VWYA 3ORNA 3A61A 4AACA 5FP5A 4YHJA 3ZS5A 5CZIA 3HAMA 3CGFA 2A19B 2UZLA 5ETAA 3ZFXA 5C8NA 3TN8A 3EWHA 3OXIA 1WBVA 3VW6A 2XJ1A 1YHVA 4ALUA 4NWMA 4FKWA 4JR3A 2GNLA 4JQ8A 2A2AA 4Z3VA 5FTGA 4L9IA 3DAEA 3LFQA 3QZFA 1OUKA 2R3PA 2VWZA 3FMEA 3K3JA 2W1CA 3BE9A 2GNFA 2W1GA 4FBXA 2BTSA 4Q9SA 3SXSA 3ZCLA 5DR2A 5FEEA 3R1NA 3ANQA 4PMPA 3FMJA 4NU1A 1QPCA 2RFSA 5A4TA 2JIIA 5B2MA 1UU8A 2VO0A 2CSNA 2PSQA 1BKXA 4PMMA 5C4LA 3POOA 4O2PA 5CNNA 2V0DA 3VS7A 3UMWA 1XHAA 4FGBA 5CU6A 3TJDA 5A6NA 3MFRA 3EYGA 5CSXA 1NVSA 5EYKA 1G8AA 4I3ZA 3P08A 4I5MA 3NSZA 3RNYA 4D2WA 3KXMA 2R3LA 3QD4A 5AIRA 4QYYA 4MNFA 3D7TA 3OEFX 4RX9A 4D5HA 4ZEGA 3PZHA 4AZFA 4EBVA 3RWQA 4CCBA 4ZLOA 1WBNA 2HIWA 4GK2A 3ZSIA 5LWNA 3G6HA 3LMIA 3ZRKA 3KXZA 4S32A 2J5FA 5FEDA 4GCJA 4U41A 3DTWA 4IZAA 3IKAA 3UZRA 3EQFA 3UJGA 3V5TA 3AD4A 4I0TA 1W83A 4BI1A 3SD0A 3HA8A 4J7BA 4XMOA 4EK5A 4NM5A 2XUUA 4C3PA 3FI4A 1J7UA 3I6WA 3QZIA 4ITHA 4A4OA 3CGOA 3HDMA 4PL5A 4JX3A 1YXXA 2YIXA 3RAIA 5I9VA 2VX3A 2PZ5A 4CQEA 4G9RA 2VO7A 4TYHB 4AOJA 1SZMA 1H1QA 5CEQA 5CANA 4C2WA 1PXMA 3BYVA 4IHPA 4GYGA 4O84A 3OVVA 4IJPA 4TYEA 4FTNA 5H2UA 3P7BA 3R8ZA 4I20A 3V01A 5TF9A 5C01A 3D15A 4C38A 2I0EA 4ZZNA 5L2IA 5IF1A 5IQCA 2EUFB 4DH7A 1NY3A 5AR3A 3HRBA 2IZTA 3RPSA 5H8BA 2RL5A 4AZWA 1H1WA 2OXDA 5H9BA 5C8KA 2EXMA 2O5KA 4KRCA 3FI8A 4I41A 3RTPA 3HV6A 3JS2A 3Q9YA 4MTAA 4LRJA 4EQCA 4E73A 4I5CA 5D7AA 3HRFA 4J71A 4OT6A 2W5AA 2WMAA 5TKDA 2PUIA 5GIPE 4N6YA 3DT1A 4D2SA 3FSFA 3UNZA 4HVDA 2IW8A 2BPMA 4D9UA 1P14A 1VEBA 2CDZA 3BQRA 4RX8A 3FL4A 4F7SA 2BCJA 3SKCA 4NL0A 4DLIA 2E9OA 2JC6A 2GNJA 4UEUA 4C7TA 4M97A 2G15A 3H30A 4NIFA 3FL5A 4PMSA 4X2NA 3ZXTA 3M2WA 4BDAA 2VTQA 3DXNA 3NAXA 3TT0A 4CMTA 2OIQA 3VBYA 2W1FA 4AXAA 4A9YA 2ITTA 3K5VA 3ERKA 3QQLA 5GINE 3NS9A 2R3HA 4FYOA 3NWWA 3ZLSA 2QU5A 3BGPA 2XK4A 1SM2A 3KXHA 3PSCA 4ZY6A 4EHZA 5A4LA 4E6AA 2CN8A 5CSHA 3N4VA 4GVJA 3HV7A 4JR7A 5BVDA 3KY2A 3P23A 1I09A 2XBAA 4CTCA 5K4JA 4KNBA 3KF7A 4P5ZA 2PVRA 5CT0A 2B1PA 2YJRA 4UB7A 4MNEB 1JLUE 4U8ZA 3R9HA 1GZNA 2GCDA 2WMUA 3VUKA 5CASA 4BDHA 2X39A 3MY5A 3GU6A 2E9NA 3F88A 4M7IA 5DWRA 1J7LA 5KO1A 4RJ4A 4G9CA 2BKZA 2OK1A 4XG7A 4EOPA 3L1SA 3OUNB 3GC0A 4XNEA 3R2BA 4WA9A 4OT5A 2FSTX 4TN6A 5EQEA 3ZUTA 1YVJA 4IACA 4EK4A 2B9HA 2OFUA 4IAYA 1I44A 4JDKA 5DLSA 3CJGA 3IO7A 5HLPA 3UOLA 4XYFA 3KA0A 1YXSA 5ANEA 4O7LA 3V6SA 4D4SA 4F63A 2OKRA 1OIRA 5LVNA 3KULB 2HCKA 3E87A 3NNVA 4CFUA 5JQ5A 4XBRA 3UBDA 2C0TA 4XS2A 4YLKA 3MV5A 5HCZA 4JG7A 3PJ1A 1YXUA 2V5QA 2BZHB 4QYEA 3E7OA 4P7EA 2XNMA 4C57A 4IZ7A 4CKRA 4HYHA 1CMKE 4ZP5A 4ANSA 1T45A 3VQHA 2BZIB 1GZ8A 2OICA 3QQFA 4BIBA 3CJFA 4P5QA 5AP3A 3RINA 4XP3A 4JXFA 3P79A 4H3BA 5CT7A 2XKCA 4NM7A 4K18A 3V8WA 5FUTA 2F4JA 4CFNA 3BIZA 4RFZA 4D1XA 4FG8A 3HUBA 4QD6A 4A9TA 1ZOEA 5E7RA 4ZY5A 4BHNA 5IMXA 4UMUA 3EQIA 2HYYA 2JDVA 3FLNC 4S2ZA 4RJ7A 4E4MA 3QHWA 4O7VA 1XR1A 2J6MA 2WEVA 4YBKA 4RZWA 1XBAA 2B52A 2G2HA 4MBJA 4HNIA 4BCHA 2PZRA 5I3RA 4NM3A 4DFLA 2PVLA 1FGIA 2OH0E 3OTUA 3QLFA 4GG7A 4AW2A 4EOLA 4O86A 5AR2A 3W32A 2ITNA 3TZ8A 4ZTMA 4F1MA 3GC7A 3QD2B 3KL8A 3CC6A 3ZO4A 3EFWA 3PSBA 4QO9A 5DRBA 3W2RA 3SGCA 2GQRA 3CKXA 3QQHA 2B9FA 4HGSA 3W18A 4FTJA 1V0PA 3PRFA 3QTQA 3KREA 3CY2A 2BDFA 3BELA 4FSRA 4LM5A 1NVQA 2YCFA 2BFYA 1YDTE 4JBOA 3ID6C 4LL5A 3DB8A 2BZJA 4KABA 4UXQA 1A48A 3QBNA 2CCHA 5FM3A 2UUEA 2EXCX 3POZA 4ZS4A 3LHJA 1GIJA 4EQMA 5HNIX 5HE1A 2HZNA 4OLIA 5CF6A 5JRQA 5KBRA 3C13A 1ZMVA 3C4FA 3DBEA 3FZ1A 4NJ3A 4OTQA 5IZFA 4IWDA 4ZMEA 3O7LB 3CXWA 5HO6A 4YHFA 4EH3A 2JAMA 3RM7A 4F99A 3FMLA 4QTEA 4QQCA 4LRKA 1OIQA 3AC5A 4L7FA 5AP7A 3VBTA 3UYSA 2C69A 4TZRA 4HGTA 3RWPA 4DG2E 1W82A 1K3AA 4FODA 2HAKA 4YJUA 4JI9A 5K0XA 5HBJA 5FG8A 5DEWA 3UZPA 3TIYA 4LOQA 3MI9A 1KV1A 3OCBA 1OL2A 3CTJA 2ACXA 2PVNA 2XKEA 3IW7A 3U55A 5TT7A 4ACCA 5BUEA 3PJCA 4IWQA 4O0VA 4YJSA 1OIYA 4ANMA 4QP4A 2C5YA 2WMTA 3F69A 3F3VA 3VF8A 4UWCA 3Q9ZA 4BDKA 2UVYA 4CFWA 4O7NA 3TZ7A 5AAFA 1BUHA 2R7IA 2YDIA 3JY9A 3PXZA 4FI1A 1OKWA 4I6HA 4NIFB 4O0UA 4F65A 3UQFA 2OXXA 4FX3A 2JLDA 2UZTA 2QURA 4EJNA 2XYNA 1SNUA 3O50A 2UW3A 3C4CA 5CU4A 3MY0A 2XM8A 3RHXA 4BCJA 5HIEA 2YABA 4FEXA 4FIIA 2BHEA 2DUVA 4V01A 3VF9A 4C4HA 3AC4A 4ZAUA 4PDPA 4RIXA 1ZYJA 2H34A 4O7TA 3MN3A 2H6DA 4QMXA 3PE1A 3U51A 1ZZ2A 4KAOA 3RZFA 4GYIA 2WNTA 4JT3A 4E5AX 4AN2A 2O3PA 5JZJA 2WMWA 1SVGA 3FXWA 2X0GA 5GZ8A 3A2CA 4IB1A 3P5KA 1MUOA 4O83A 2XZSA 5TO8A 4M13A 1YRPA 1VYWA 1PMEA 4QMOA 4XV1A 4TYJA 3CQUA 3R00A 3MWUA 4YZ9A 1G3NA 5LVPA 2XKDA 2OXYA 4FTCA 3EKNA 1K9AA 3BCEA 3E92A 3LCOA 3QTRA 4S31A 5E1SA 4RWKA 4AG8A 4ASDA 1YDRE 3ZDUA 3R9NA 4RG0A 3FXZA 4QMNA 1LEZA 4FTIA 1BL7A 3FYJX 4M15A 3ZYAA 2WQNA 4RT7A 3L8SA 1KE6A 4R78A 5AA9A 3E63A 5AV2A 5K9IA 1ZYSA 3CPBA 1ATPE 2YCQA 1TQMA 3DV3A 4GFOA 3HRCA 5J8IA 5AV3A 1F0QA 1NA7A 5BVFA 3VUHA 5HTCA 4X6RA 4FICA 3LAUA 3EQDA 2UW6A 4PNKA 3Q2JA 2J5EA 3VBWA 3WE4A 5CTPA 2R7BA 3WZEA 2AC5A 4J1RA 4H3QA 5J9ZA 3VUTA 4EYMA 2NNWB 5E8YA 3SAYA 3Q9WA 3VHEA 4O1OA 5JQ8A 3NUXA 4HVIA 4FVRA 3NUSA 2FB8A 5KHXA 2BAKA 4J52A 3EHAA 3MJ2A 3PRIA 2PYWA 1DI9A 3DJ5A 5D12A 2WMQA 1RDQE 2P2HA 3FI3A 4Q2AA 3PJ2A 4L53A 3QRJA 4C4EA 3NUNA 4Z7GA 1H1RA 4JBVA 3SLSA 2XMYA 4FE2A 1WAKA 2EU9A 4U42A 4LV8A 5AP6A 4UYAA 4NW5A 4C37A 2AUHA 3O8UA 5AR4A 1KWPA 4AGDA 4DTKA 1PMUA 3C7QA 2Z60A 2PMOX 1OI9A 3FKNA 3TTJA 4QPAA 2P0CA 4AA4A 2ITYA 4AZTA 3NMUF 3IDCA 3NNUA 4UALA 3KGAA 2WMSA 5TOZA 2ZM1A 4DC2A 3D2IA 4U40A 4QQ5A 3Q6UA 3BHYA 2C3LA 3BU6A 3IGGA 5AP4A 4XV3A 5I4NA 5JEBA 1PMNA 5IQGA 3GFWA 5IQBA 5EM5A 4HVGA 3GUBA 4MCVA 3HEGA 4OTDA 4QP2A 2HXQA 3BE2A 3F5UA 3H9FA 4ANQA 1XH6A 1OBGA 3FC2A 3P4KA 4ZZMA 3E62A 3MFTA 1BL6A 4PPBA 5JGBA 1WBSA 4C4FA 4C59A 3EQPA 4PP9A 4UWYA 2BTRA 1PYXA 4FNWA 4GH2A 5IUHA 4NW6A 3F5PA 2V7AA 2YM7A 1LPUA 5LARA 3LE6A 4P90A 2B9JA 4AA0A 5BUIA 3NLBA 4WUNA 2W5BA 3LCTA 3IECA 4NTSA 4YJQA 4ZTQA 3CS9A 3QYWA 3VUMA 1SNXA 3CQWA 3FWQA 4XRLA 1YKRA 4M68A 2W05A 4WG4A 2OJ9A 3B2TA 3LM5A 5CEPA 3H0YA 3D14A 3QD0A 5K5XA 3D4QA 4B9DA 1KE7A 4NFNA 3DK7A 3KCKA 4U43A 1S9IA 2X4FA 4FTTA 5CAOA 2R3GA 2VX0A 4XP0A 2PTKA 4IB3A 4FGRA 5HG5A 3VHKA 4XV9A 1UU9A 4M0ZA 2YEXA 4G2FA 3RK7A 5EQPA 3SXFA 3SOAA 4TW9A 3I6UA 2IZUA 2VTTA 3I1AA 3P0MA 3MS9A 2C6OA 2XIRA 4KWPA 2ITPA 5IQAA 4DG3E 3BPRA 2WTVA 3KMUA 3MVJA 3EFLA 3BU3A 5CF8A 1ZMWA 2ZM4A 2CNQA 3ALNA 3GFEA 2C1BA 4Z9LA 4GJ2A 2ZV8A 3VJNA 2ERZE 3BGZA 4M66A 3VO3A 2P4IA 2QKWB 3PA3A 1UNGA 2BDWA 4MQ2A 4P2KA 4F0IA 1PXIA 2YIYA 3PWDA 3NYNA 4D4VA 2XB7A 5I3OA 4QP7A 3OXZA 4IB0A 2W1ZA 1WCCA 2VN9A 4ZOGA 3NUYA 4EOMA 4RX5A 2XNNA 3HMNA 5FBOA 4R7IA 5KKRC 1T46A 5CX9A 2X2MA 2XVDA 4G6NA 3FLZA 4QMYA 5AM7A 5L4QA 2OF2A 4RA5A 4FKGA 5JSMA 4RIXB 2C5NA 2VAGA 4F9CA 3N4UA 2VX1A 4PY1A 4XP2A 3PUPA 2CKPA 5KMJA 4DEEA 4TKSA 3UP2A 2FO0A 4CFMA 1V0BA 3FQEA 5GZAA 5M44A 3E8EA 3KQ7A 4NM0A 2RFNA 3FHIA 1XH9A 4HPUE 3BBWA 5AR8A 5CYIA 4AA5A 2YFXA 2I0VA 2YM4A 4EZ3A 4F7NA 2YHVA 3MIAA 2QR8A 3UQGA 2W4JA 3VJOA 3W1FA 3NPCA 3TKIA 2YA9A 4I0SA 4L44A 2PE0A 4QMLA 3M11A 4JX7A 4H05A 5DT3A 4FZFB 4YJRA 3OG7A 3PJ8A 4GEOA 1P2AA 4CV8A 1TQIA 4JIKA 4U0IA 2XK7A 1TKIA 3SOCA 2QOHA 4XCUA 1STCE 4B8MA 2VWXA 1TQPA 2A27A 5IU2A 3LLTA 3QC4A 2I0YA 3CE3A 4UBAA 3NUPA 3QGWA 4MWHA 3OOGA 4ACMA 4C4GA 2X8DA 4QMSA 3BQCA 4R5SA 1H00A 3ZDIA 4EHGA 3FYKX 4K33A 3QF9A 5JT2A 3SQQA 3OWJA 1B39A 1M2PA 1WMKA 3V5LA 4XG8A 3DJ7A 1Q41A 3SX9A 4Y83A 4UMQA 5KMOA 3QQKA 3V5PA 3JPVA 3FMDA 4W4WA 3L9MA 5E91A 5HE2A 1ZMUA 2VTMA 5AUTA 3VULA 5HE3A 2Y8OA 4UV0A 5BMSA 4W9XA 1JVPP 5HBHA 4JAJA 5L3AA 3I0OA 4NT4A 5CEIA 3MYGA 2C0IA 5EYDA 3UE4A 2IZSA 3CQEA 4RIWA 1OB3A 3I0QA 5E9EA 3ULZA 4U7ZA 4CFVA 4FSQA 3SDJA 4YGAA 4ZY4A 5LOHA 1R3CA 1URCA 2RG5A 2PMIA 1XH4A 2ETKA 4AUAA 3IDPA 4QP8A 2ITQA 4G3CA 4PTCA 4N0SA 2R2PA 4FOBA 2QOQA 3MA6A 3QA8A 4E6QA 4NTTA 4DT8A 4UX9A 4F6SA 3DS6A 4EI4A 2GTNA 2C1AA 3COKA 3LOKA 4G31A 4GT4A 4ERWA 4RX7A 3OC1A 2Z02A 2ZB1A 5AJQA 2W1IA 1QMZA 2IO6A 3DAKA 4DFNA 4NKAA 5IA4A 2BIYA 5DMZA 4BCNA 3RZBA 5FP6A 3I81A 3LFDA 4CCUA 5HO8A 3R7IA 4DEGA 3GU5A 3C4XA 1PMVA 4M0YA 2YAAA 4WRGA 2YITA 4KSPA 3LJ2A 4L45A 4ACHA 4XOYA 2BAQA 3G9LX 1H1SA 3MVLA 1JOWB 4PX6A 5DT0A 3W16A 5KMIA 3F2NA 3NX8A 2VV9A 3S0OA 4OBPA 3QD3A 4IDVA 4MXZA 5J7BA 3PY0A 3ZUUA 4TT7A 4YPSA 1OITA 2UVZA 1IRKA 2UZEA 3FY0A 4PPCA 4YNEA 3F6XA 2ITZA 3GCVA 3GC8A 3GEQA 1P4OA 2RIOA 3UNJA 4X2FA 2W99B 2ZB0A 4C62A 5JK3A 3KKVA 4HCTA 4D58A 2O0UA 3GENA 3GOKA 4APPA 5JH6A 3COMA 2I7QA 4TWOA 3ORXA 5L2QA 4KS7A 2VTAA 3GCSA 4QT1A 5IA1A 3ZOSA 3D5XA 1J7IA 4WUAA 4DH8A 1GNGA 3EL7A 2PL0A 4IX6A 5HX8A 2WTKB 3GI3A 1MP8A 2VGPA 3W55A 4BDCA 3QTUA 4E3CA 4QMQA 5H8EA 5JFVA 3VUGA 4EH2A 2GSFA 4BDBA 2Z7LA 2CLXA 3O8PA 3G15A 1PW2A 4MQ1A 4HNFA 1M7QA 2FSLX 4MVFA 4DBXA 4ANNA 4FIJA 4IVBA 4EOQA 2GNHA 3TZMA 2E9PA 2P33A 4W8DA 4UXLA 5DI1A 2P2IA 4CYJA 4AWIA 4N70A 2UW0A 3HV4A 4FF8A 3QQGA 4GT5A 5BYYA 4C35A 2BUJA 1Z5MA 1R0PA 3ZC5A 3N51A 4WKQA 1LUFA 2OIDA 4XG6A 1XBCA 4I4FA 4L43A 3K54A 2C5OA 4L67A 2XH5A 3MH0A 3RAWA 4RJ6A 2F7XE 4FZAB 4XLIA 3SW7A 3HUCA 3H9OA 5D1JA 4M14A 4EZ7A 5L8LA 3DU8A 3IONA 4F7LA 3QC9A 3CSVA 4DF3A 2BAJA 4FG7A 2Y6MA 2E9VA 2GU8A 3U87A 4G1WA 1R39A 3ZZWA 4R7HA 1YI6A 4KD1A 4XBUA 5IH4A 4I5HA 1AGWA 3TCPA 1E9HA 2OZOA 4EQUA 4K6ZA 4CZYB 2W9FB 5HTBA 4RSSA 4DGOA 4L68A 5I0BA 4ZSLA 3FZPA 1RQQA 4K77A 4QTAA 5DRDA 2C6IA 5E8UA 5CLPA 4QYFA 2QOKA 3DBDA 1UU3A 4BCKA 3T3VA 5HORA 1GIHA 2HK5A 3LQ3A 1Q61A 2EXEA 2XA4A 5LMBA 1ZY5A 3TWJA 4BR3A 5M55A 2HZ0A 4BICA 4II5A 5AAGA 2UW7A 3EQRA 3K3IA 5FXRA 4UY9A 5FGKA 3R1QA 4QPSA 1KOAA 5E90A 4HVSA 3DFCB 2J50A 3IPHA 2HXLA 1W7HA 2OZAA 3HECA 3MH1A 4BHZA 4DTBA 2QHMA 5CI7A 5H8GA 4YR8A 4DGMA 4J53A 4FC0A 3AC8A 5DH3A 3A8XA 3HKOA 3RALA 5IG1A 5JGDA 5EOLA 2FA2A 4O91A 2C3IB 2X1NA 4QNYA 4YLJA 4CSVA 3ROCA 4RFMA 4L01A 4F7JA 4WBBB 4HCUA 4D28A 1PXKA 2WMVA 3G6GA 3LPBA 3H9RA 1XQZA 3TL8A 2B53A 3VRZA 3DNEA 3VS5A 5F9EA 2PPQA 4PV0A 1Y91A 4BKZA 3Q96A 4FKQA 1IA8A 2F2UA 3U54A 1BMKA 1PXOA 5CVFA 5CAQA 3K2LA 1JSVA 5HU3A 4AT5A 4BIEA 3QA0A 4RJ3A 4YZNA 2V62A 5EDPA 3D0EA 1V0OA 4RIWB 5ANIA 5CI6A 2FYSA 3S3IA 5G1XA 3KRRA 4IH8A 3WILA 4BC6A 3GGFA 4BF2A 5BX0A 4TRLA 2G01A 3GQIA 3LJ1A 3W2OA 1SVHA 5L8KA 3L8PA 3QX4A 2SRCA 3VS6A 2VTIA 3DK3A 3QHRA 3EKKA 4NKSA 4X3FA 5AM6A 1VJYA 4EOOA 5DIAA 5CNOA 3QUPA 4XG3A 4EH4A 5ICPA 2XNBA 3W8LA 4JAIA 4FOCA 1WBTA 4DEHA 2BILB 4BCFA 1CTPE 3JY0A 1H01A 3HDNA 3LCKA 4O0WA 2YM5A 3E8CA 1OGUA 3EB0A 4EONA 3DNDA 4IIRA 2PK9A 4RC3A 5FD2A 5J1VA 3FZRA 1R0EA 3JYAA 2F49A 2R3QA 2WQBA 4W9WA 1ZAOA 2X7OA 3LXKA 4NJDA 1FPUA 4AW5A 2PULA 5I9UA 4MXYA 4UMPA 2Z7RA 3TUDA 2WOUA 3F66A 3D83A 4GUBA 4R6VA 3TDWA 2QNJA 5JFXA 3W33A 4JNWA 3I4BA 2J4ZA 4G5JA 4TTHB 3KN5A 1PF8A 3OFMA 5HICA 2Z7SA 2XS0A 1RE8A 2IG7A 1B6CB 4ENXA 2NRUA 2UZUE 3BLRA 3CTQA 2OG8A 4JQ7A 4GSBA 3AOXA 3PSDA 2BRMA 4JIAA 1KE5A 1ZY4A 3FPMA 3R7GA 5L8JA 2C30A 5BNJA 3ROYA 1OPKA 4O7SA 4ARKA 3WF5A 4E8AA 2IVSA 4F0GA 1PXLA 3LM0A 1XO2B 4PTGA 4EKLA 4H58A 5AIKA 4Q5HA 1XWSA 3OMVA 4V0GA 4QYHA 3F61A 3BHUA 2B7AA 3DQWA 1OVEA 4F1OA 2X7GA 4FKIA 4YTFA 3NGAA 4W8EA 4FV4A 2KTYA 4EH7A 5AA8A 4OTPA 3A4OX 5A14A 2WELA 5J5TA 2XNGA 2JD5A 2VRXA 5ACKA 3QTXA 3SVVA 2C3JA 3KMWA 1JQHA 4FZ6A 1NVRA 4G3DA 3AT3A 4KKEA 3W2PA 4LV5A 5FTQA 1BLXA 5HD7A 2RG6A 3CEKA 2Z2WA 3BWFA 3B8RA 3GU8A 3R21A 4FKVA 5AADA 2CMWA 1P5EA 2GFSA 2J0JA 3RJCA 2BFXA 3A7FA 3OEZA 4FT3A 4DGLC 3F7WA 2HWOA 3OT8A 4FK6A 4OTGA 4KS8A 4MXOA 5L2TA 5HLWA 1M2QA 2H9VA 2W4OA 4HJOA 1PXJA 3Q53A 5EK7A 2QD9A 5GNKA 5CSVA 5E8TA 3KB7A 5IPJA 3EZVA 4ACGA 3I60A 4EH9A 4I4EA 4EWHA 5M57A 3LFFA 4U45A 2XP2A 2CGWA 1P4FA 3RPOA 5I9WA 4E5WA 4F9AA 2RFEA 1OKYA 2PMLX 3UO6A 3HNGA 4JJRA 3QTWA 3U8WA 1JKSA 1M52A 4ZJJA 1BI7A 3PPKA 3DKFA 3NCZA 3UOKA 4X3FC 1ZXEA 4IW0A 3PA5A 3I7BA 4BBMA 3D7ZA 3NUUA 1MRUA 4ZTHA 3OD6X 3T3UA 4A07A 5BYLA 2CNUA 4OTFA 4E6DA 3H4JA 1WVXA 4EHVA 5HO7A 2C0OA 3AT4A 3EYHA 4D0WA 2OZAB 1UKHA 3QKLA 2QQ7A 3FBVA 5C8MA 5GJGA 3VRYA 4QPMA 1CDKA 2OFVA 4KBCA 1JKLA 3OXTA 4IC7A 3F3UA 3W2QA 4RA4A 2IVUA 4LRMA 4F9BA 2ZMCA 4FV9A 3E8DA 4Y85A 4MHAA 3W2SA 3O23A 3QRTA 4AZSA 1TVOA 5EQYA 3OUKA 4GW8A 4D1ZA 2XCHA 3Q4ZA 4GFGA 4ZJVA 4QMMA 4B0GA 3EQCA 3L9PA 3V5JA 1H1PA 2XK8A 5E8ZA 3GU4A 3ZTXA 5M4CA 4FTLA 5D7VA 1IA9A 4CMUA 4CQGA 4AFEA
chains in the Genus database with same CATH superfamily
1UWJA 3PVWA 2WTWA 3Q32A 5ITAA 5HI2A 4FZDB 4QMWA 3FMMA 4H39A 4EH8A 4IFCA 4DDGA 5GJDA 1K2PA 3FAAA 3KN6A 4M67A 4RVMA 4FVQA 2G2IA 5T3QA 4BZDA 4AZVA 2DQ7X 5KE0A 3VS0A 2XKFA 5HU9A 2ZYBA 4Y72A 4G6OA 2W5HA 2VTLA 2QC6A 1GZKA 4X3FB 3MFUA 1Q5KA 3QGYA 4BZNA 3ET7A 4ANOA 3LCDA 3FE3A 2QR7A 3EN6A 4O6EA 3OTVA 2WOTA 5F1ZA 5ANJA 2C68A 2NRYA 3KRXA 3BBTB 3WIKA 2JIVA 3C0GA 4PL4A 2VD5A 4J99A 5HNBA 3FQHA 3UC3A 4CT1A 4DGGA 3VS1A 4FEVA 5HVYA 2V55A 3BV3A 4KA3A 2YLFA 2IN6A 3M42A 2C6LA 2A1AB 4OW8A 3A8WA 2C6KA 3F7ZA 4XG4A 4NK9A 1FVVA 4PP7A 4YSMA 2B55A 3A7GA 4RRVA 1IEPA 1CSNA 3ETAA 3UG1A 4A9UA 4FNXA 2UZOA 3ZZEA 2JDSA 2RSVA 3P7CA 2WU6A 2RKUA 2X8IA 3HV5A 2XNOA 4EKKA 4BN1A 3QX2A 2WGJA 5E1EA 4E5BA 4ZTLA 4BZOA 3L9NA 3PFQA 5ETFA 4CD0A 2ZJWA 3KXGA 4BGHA 4DITA 4BBFA 4X3JA 2YZAA 3ELJA 5HNGA 4FV8A 4GL9A 5CU3A 4FV0A 3MPMA 3MBLA 5CXHA 3R7VA 2C6EA 3ZEWA 2XK9A 5K0KA 4K0YA 5HVJA 3DXPA 3SW4A 3E8NA 2EWAA 4JDJA 4Q9ZA 2ITXA 5CAVA 3DJ6A 4F9WA 4FKUA 4RC2A 5B0XA 3LMHA 3KXNA 4V0GB 3FUPA 3QCQA 1Q4LA 4RZVA 3W0PA 1H24A 3NW5A 4RFYA 4A7CA 2CLQA 2WTDA 3NNWA 3PIYA 4RLKA 1MQ4A 2XK6A 2Y9QA 4YZDA 4JOAA 4ZXTA 4NUSA 1FBNA 1G8SA 1QCFA 2PVFA 3CCNA 4HPTE 2BVAA 3PVBA 3V04A 5EHLA 3G2FA 4KBKA 4AQCA 4FV6A 3IS5A 5IDNA 3NVMB 4OTHA 4U6RA 4TNDA 5AWMA 2VWIA 2J2IB 4F08A 4YJVA 4FIEA 3F9NA 3FY2A 3QU0A 3RI1A 2VZ6A 1JNKA 4LGHA 3QCXA 2A4LA 4TNBA 3TJCA 3TNIA 3GVUA 3NIZA 1PXPA 4ZTNA 3OY3A 5DFPA 1OPJA 5CEMA 2Y4IC 2Y4PA 1DM2A 2I1MA 3JUHA 5CENA 5IQDA 4OBOA 3VBQA 3IOPA 1YHSA 4USEA 3MIYA 4RIYA 3G5DA 5E92A 4BCQA 5J7HA 2BRGA 4DDIA 3PLAE 2NPQA 1OZ1A 3R6XA 1GOLA 3PG3A 1H4LA 4NZWB 4Y5HA 4BDIA 3MVMA 2XIYA 3HLLA 2W0JA 2XNEA 3COHA 4IX3A 4F64A 1VZOA 1F3MC 3PP0A 4JL9A 2UW4A 5CAPA 2YM8A 2RFDA 4EH6A 4PQNA 4UZHA 1BYGA 2XK3A 4IB5A 2ITOA 2XRWA 4Y73A 2I6LA 5ANDA 5CALA 4I24A 4FKSA 2WQOA 3R8UA 4AGWA 4YO4A 5CWZA 4WHZA 4WNKA 1X8BA 4PRJA 5LCJA 1IASA 1VR2A 5HZNA 2F9GA 3LXLA 2VTSA 3OOMA 3R7UA 5EW3A 4U81A 2BHHA 2C6DA 2CNVA 4USFA 4YURA 3FLYA 5M4IA 1U5QA 3S2PA 3O2MA 2PU8A 3AQVA 3VN9A 3W2CA 5HOAA 4U80A 5KMLA 1Y6BA 4E4LA 4ZJIA 3SRVA 5J79A 3U6HA 3UMXA 3V8SA 4O81A 3SG9A 4LGDA 4C3FA 4DYMA 5JFWA 2R5TA 4F1TA 2X9EA 2PMNX 4QMUA 4LUEA 4U5JA 2OO8X 3DKCA 4MKCA 1GJOA 4YTHA 4GU9A 4BKYA 3DY7A 3BHTA 4D55A 4DGNA 4OAUC 1ZOGA 2VWUA 2Y4IB 5EM8A 5C9CA 5CY3A 2G1TA 1FQ1B 5M07A 2J51A 2QO9A 3COIA 4FV3A 4DFZE 4MXCA 4C3RA 3FPQA 4B6LA 5EW8A 2F7ZE 2JDTA 1W2CA 3DLSA 3ZM9A 4EYJA 3KU2A 3UYTA 3F3TA 3MW1A 3Q5ZA 4HYUA 4FT7A 4OTRA 4E93A 4PTEA 1URWA 3S1HA 1O9UA 4BI2A 3ZRLA 3D5VA 4O7YA 1ZYCA 4I92A 3Q5IA 3PG1A 5IA5A 4FSYA 4B99A 4K8AA 3P78A 4LMNA 3HX4A 3C4ZA 3QFVA 5LMKC 1A06A 3LFCA 3QZGA 5J87A 3W0RA 1OPLA 3FLWA 4IAKA 4O27B 4KUJA 1REJA 4FEUA 3W1FA 1SYKA 3LFNA 3P7AA 3CR0A 3QKMA 4G3FA 4IANA 4YLLA 3KRLA 4GFMA 3C0IA 3V51A 3AD6A 4C8BA 2AYPA 3GB2A 3U9NA 3DBFA 4K1BA 4DN5A 4JLCA 4LI5A 1G8KA 5FEQA 4XG9A 3E93A 4YC6A 5HHWA 5IEXA 3Q3BA 5LVMA 2VNWA 3UO4A 2REIA 4WBOA 3O51A 4EK8A 4XHKB 4FT9A 4HCVA 1GAGA 5AUZA 1FVTA 4E1ZA 3UQCA 3PY3A 5FLFA 5I9ZA 5M53A 4YMJA 3VIDA 3AMYA 3I7CA 4M3QA 4FSNA 4BYJA 1B38A 2F7EE 4CZUA 4MD8E 1SVEA 2OJGA 4UMRA 4GRBA 3ZM4A 4IFGA 2NO3A 4W4YA 1PY5A 4YC8A 1CKPA 4HVHA 3WYYA 3FZOA 4FNYA 4V05A 5AUUA 4AE9A 2HELA 1QPJA 3O0GA 3TNQB 4Q5EA 3AC3A 3UP7A 4LYNA 1J1CA 2W7XA 3R0TA 4FVPA 2VTJA 1UKIA 5IKWA 4BWKA 2QO7A 1Q3WA 2ONLC 2OJJA 1IAHA 4MD9E 1YDSE 4L6QA 5D10A 3KMMA 4IVCA 2VU3A 4FEQA 4DEIA 5BV3A 1BX6A 3AC2A 3E88A 3WBLA 3QALE 1YXVA 4BCGA 2YZLA 2YDJA 3ZH8A 4EOSA 3E3PA 2WMBA 4XX9A 1IG1A 2XIZA 4J97A 3E64A 2CGXA 3LJ0A 5EFQA 3LFEA 2HW7A 5EW9A 4NCTC 2R3OA 5A9UA 5IISA 3HA6A 3TNWA 3AG9A 4IC8A 3EOCA 1H0WA 3W10A 4JBQA 4TXCA 5M56A 4USDA 3RNIA 4C02A 4DH1A 2JDRA 4RJ8A 4O0SA 4TWCA 3IW8A 5FXSA 4BCOA 3ZLYA 3RBWA 3ZSHA 4PWNA 3EQBA 4JG8A 4DFXE 4WD5A 2JKOA 4FYNA 5EH0A 3ZSGA 4YZMA 3TTIA 4G16A 3HP2A 2Z7QA 3WZDA 3EFKA 3PYYA 3ORLA 4RIYB 5FM2A 4U3YA 4FA2A 3ZRMA 4FUYA 2VTOA 3BI6A 3TV4A 4RJ5A 4CTBA 4LMUA 4GG5A 3ZO1A 4UN0C 5C27A 2BRHA 5AMNA 4AOIA 1H07A 5KKRB 4J95A 2CKQA 4DAWA 4HYIA 2ITVA 3FJQE 1Q8TA 1OL1A 3H3CA 4FMQA 4I6QA 1XBBA 2XIXA 4G3GA 2WEIA 1H8FA 4L52A 4F6WA 2W96B 3OCSA 3LQ5A 2EB3A 1WBPA 3UVQA 4BRXA 5IEYA 4MH7A 2UW5A 3NNXA 3BL9A 3QQJA 1J91A 2WXVA 5DEYA 3WI6A 1HOWA 3PLSA 4FKOA 2QLUA 1TZDA 4CMOA 2ZM3A 4IM3A 2QOLA 3AXWA 1U54A 4CT2A 3GCQA 2XF0A 3WYXA 3WZKA 3LXNA 3ZLXA 1REKA 3VBXA 3ZUVA 2PWLA 2Y6OA 2J9MA 4CV9A 3UIXA 4X6QC 4ZIMA 4DEAA 3V5QA 4C0TA 4CGAA 4WOVA 4IM0A 4DTAA 4YC3A 4C34A 5HBEA 1HCKA 4B8LA 5M4FA 4WO5A 5AP5A 3NAYA 5IQEA 3SRVB 4C58A 3V3VA 5AEPA 3MH3A 4TYGA 3HZTA 1NXKA 2PHKA 4FNZA 2C47A 1ZWSA 1J3HA 3BHHA 4AOTA 5HTIA 1ZLTA 2IVTA 3PA4A 5BVOA 1Q97A 2NYAA 1W8CA 4UWBA 4CRSA 5AFVA 3NYXA 3JR1A 1OL7A 4RVLA 4YJPA 5C4KA 4XG2A 4L7SA 3G9NA 4IVAA 4AN3A 5ETIA 3TIZA 2C6TA 2H8HA 3CPCA 3DKOA 4O4CA 2C5XA 1Q8WA 2UZVA 3IW6A 1PXNA 4EORA 2RF9A 3LKMA 2OBJA 4I6BA 4YUQA 1F5QA 4BIDA 2R9SA 4QOXA 2UZWE 3PPJA 4EHEA 1OM1A 2GHMA 1OIUA 5AAEA 4R7BA 2X2LA 2WKMA 1KSWA 4I1ZA 1U59A 2QOOA 4O22A 3TKUA 3QCSA 4IWOA 2PVJA 1QPDA 4GVAA 4PL3A 3ZO2A 3DBQA 2X8EA 4RWLA 3AMAA 2YLEA 4CNHA 4EK6A 3L9LA 5ETCA 4ZK5A 5B7VA 1XH5A 2WHBA 1HCLA 4GK4A 2R3FA 1KOBA 2X6EA 3NIEA 5AV0A 4BDJA 2PZIA 4EOJA 4PF4A 5IQFA 4QTDA 4D9TA 2VWVA 4X2KA 3HMIA 4DH3A 2EB2A 3Q60A 1NW1A 4PUZA 2YCRA 4FL2A 4QMVA 3Q4TA 4A9SA 4TL0A 2GS7A 3PZEA 3EFJA 5IEVA 4EC8A 4AE6A 1VYZA 4ZSAA 4E26A 4WSQA 4G6LA 4F9YA 4EJ7A 5B2LA 2VO6A 2GNGA 3GBZA 3Q04A 4FZ7A 2ZVAA 2WMXA 3OWPA 2UVXA 4KIKA 2XYUA 3VAPA 4ENYA 1JSUA 1WFCA 2IW6A 2UZBA 4MX9A 4CFFA 1UU7A 5D41A 4E4XA 2R3NA 5KX8A 1AQ1A 2OWBA 5E8SA 3F5GA 2PVYA 3ENHA 4LL0A 3T9TA 4AP7A 3KC3A 2FVDA 1ZARA 3TXOA 5M06A 1KE8A 3BHVA 4UYNA 3UNKA 2ZDUA 5LWMA 4MK0A 4D4RA 2XEYA 3TDVA 3EN7A 1DAWA 4JS8A 3UC4A 5A46A 3FV8A 4ONAA 5J95A 3FMNA 4ACDA 4PDOA 1M17A 3OROA 3R1SA 5J5SA 4QMPA 1MQBA 2ZAZA 4GU6A 4D2TA 3OBJA 2WTCA 4FKRA 2J90A 5CQUA 1RW8A 1V1KA 1W98A 4EC9A 5LMAA 4CEGA 5HX6A 4HOKA 5EYCA 2F2CB 3VWAA 4MBLA 4BYIA 2V7OA 2BROA 1OL6A 1SMHA 3LQ8A 4JDIA 2WQMA 4BDGA 3RVGA 3A7JA 3UG2A 3I5NA 4FSZA 4DT9A 5HESA 4IM2A 4IAFA 5DG5A 3CBLA 3O17A 1M2RA 3DA6A 5AP0A 5CXZA 5KHWA 3FEGA 1YWRA 5I9YA 4MYGA 4M8TA 4LQMA 5HG8A 3OW3A 2HY81 4ID7A 1E1XA 2ETRA 2WFYA 4V04A 5T68A 3EQGA 2YIRA 4AZEA 2BALA 2LAVA 4JMQA 3A99A 4F0FA 2FH9A 5CU0A 3QTSA 1AD5A 3BRBA 2R3MA 5J9YA 5JFSA 5AUVA 3WIGA 4OR5A 4RQKA 3QTZA 3M1SA 3OS3A 2O2UA 2QOBA 4JVGA 4R3RA 5HG9A 3SC1A 3FZTA 2E9UA 3KRWA 5IQIA 2QOIA 4W4XA 3TV7A 3KF4A 1W0XC 2OSCA 2EVAA 2W1HA 4HZSA 4IDTA 5EI2A 4DFYA 3NYOA 4IADA 2YIWA 4O0RA 2YWPA 4LUDA 4QP3A 2WO6A 3B2WA 4IAAA 1LR4A 2UZDA 4D2PA 4FTAA 4ZSGA 5IH5A 2XCKA 1E1VA 2C6MA 5HIDA 4ZLZA 2X9FA 3TNHA 1WVWA 2J7TA 3ANRA 4DLJA 4E6CA 2OH4A 3ZFYA 4NFMA 2JBOA 4IZYA 5DR9A 4FTKA 5BPYA 3F2AA 1O6KA 4MXXA 1YOMA 3VS2A 3LVPA 3FC1X 4BI0A 5C03A 3CTHA 5D9HA 3VNTA 1Q62A 1U54B 4DFBA 4F70A 4IJ9A 3TG1A 2XJ0A 4JDHA 3KVXA 4XRJA 2JIUA 4O0TA 4O7WA 5CU2A 4ORKA 2OJIA 3GOPA 1PKGA 4IXPA 3C4WA 4IBMA 3UDBA 3DXQA 2XEZA 1LP4A 5HCXA 3U4WA 4QQTA 3WOWA 1YQJA 3IOKA 1OKVA 4OUCA 4YP8A 3A7IA 3SXRA 2ITUA 4FKLA 4DHFA 3C5IA 4HGEA 2HZ4A 3GNIB 3R01A 2JITA 3A62A 5A4CA 4QQJA 2CCIA 4QNAA 2PZPA 3S4QA 4EBWA 3HYHA 4B4LA 4EUTA 5IA3A 3R7YA 4HYSA 2OF4A 3VVHA 2UW8A 3C1XA 4IZ5A 2QG7A 2QG5A 4CYIA 5FDPA 1H27A 2X6DA 4QP1A 3O71A 4AW1A 3KXXA 4Y8DA 5DGZA 2XARA 3OT3A 1QL6A 4FT0A 5E8VA 2YWVA 1OMWA 4ZS0A 3H0ZA 3ATTA 5AX3A 3UDZA 2FSMX 4L3LA 3ZEPA 3GCUA 4IX4A 4LGGA 4ERKA 1ZZLA 1H25A 2B54A 2ZOQA 4MWIA 5FWKK 3WF9A 2CKOA 4O7RA 2G2FA 5ANKA 3OWLA 1OL5A 2OW3A 2YM6A 4RVTA 2UW9A 4U97A 5CSWA 3TACA 2X2KA 1ZOHA 4D0XA 4NH1A 4YJOA 4QMZA 3DAJA 2JBPA 5A6OA 3W8QA 4RQVA 5AP2A 3RCDA 1YOJA 4OBQA 5L6OA 4HZRA 1Z9XA 3E7VA 3DGKA 4O7ZA 1UA2A 4BY9E 2QVSE 3CIKA 2GS2A 5AR7A 5AP1A 4CG9A 3PXYA 2C5VA 4IE9A 4IMYA 4L3JA 5TR6A 4BDEA 1Q99A 3SG8A 3MTLA 2HWPA 1U46A 3ORKA 2QU6A 3FSKA 4AXDA 4O21A 4MBIA 5EHOA 4BKJA 4WG5A 4KIKB 2YIQA 5HEZA 3LLAA 2P55A 4AX8A 4ANLA 5KMKA 4ZTRA 1UVRA 3OHTA 1ND4A 4J8MA 3QRUA 4CLJA 1FVRA 3NZ0A 3LCSA 4YTIA 4BVUA 4O38A 4W4VA 2ZMDA 3E5AA 5BVWA 3AD5A 1L8TA 5IUGA 4FUXA 4MEDA 3FMHA 5IH6A 5AV4A 2V22A 4OAVB 1ST0A 3ULIA 1WVYA 4IAIA 4MXAA 5F94A 3PIXA 3IGOA 1W84A 1LEWA 4KB8A 4L00A 4U3ZA 3RAHA 4E4NA 3MPAA 4WT6A 3R2YA 2ESMA 1Y57A 3O5AA 2WD1A 4ITIA 1Y8YA 4WRSA 3PIZA 3RHKA 1JAMA 3PJ3A 2GHGA 3QWJA 2B0QA 3HVCA 3RCJA 5BVNA 3WF7A 4I5PA 3ORMA 1FMKA 3G0FA 1A9UA 4PMTA 2J0IA 2O64A 1U5RA 3ZONA 3UO5A 4S30A 4S33A 4TYIA 3QRKA 2JKQA 5BMMA 3R83A 4O6LA 2ZV7A 3OBGA 3DDQA 4AW0A 2X4ZA 4KINA 4OTWA 3TYKA 3KVWA 4BDFA 5CF5A 4ALVA 4N4SA 3UIUA 3CD8A 5HQ0A 4FKPA 4FV2A 1GIIA 5C1QB 3P1AA 5DE2A 4PNIA 4APCA 3ODYX 2I0HA 3F5XA 4G5PA 3BYOA 4KIOA 5LVLA 4C36A 3DPKA 3PXQA 4IX5A 4R3CA 4ITJA 4YZCA 3MJ1A 5EM7A 4AF3A 4YBJA 3R02A 1YWNA 3MSSA 5CEKA 2CGVA 4CRLA 3R04A 2GHLA 3A4PA 3ENMA 3AGMA 4FV5A 4EH5A 4MD7E 4KRDA 3S95A 4YTCA 2PUNA 3MA3A 4X7QA 5EDRA 3MESA 4B7TA 3GXLA 1CM8A 4YHTA 4FTRA 3R8MA 3UOHA 2CHLA 4N6ZA 3ZC6A 4GJ3A 5JN2A 4Z16A 4FL3A 2OIBA 5E8WA 3BGQA 1Q8ZA 1Q8YA 4RBLA 5EKNA 3ZXZA 3GP0A 4FV7A 2G9XA 5M51A 3NW6A 5C26A 4RLLA 4P4CA 4DA5A 2OI4X 3DKGA 1OBDA 2JEDA 3RPYA 3PTGA 1UV5A 4DG0E 4X2JA 5AUXA 1YHWA 3D7TB 3R22A 4AT4A 4N57A 3ALOA 1BI8A 2WU7A 5DBXA 4BTFA 4L3PA 1FGKA 2HW6A 3DTCA 2DWBA 4EWQA 5H3QA 4H1JA 4A9RA 3QXOA 2VTHA 3IG7A 4GUEA 3NVKI 3FZSA 4YU2A 2GS6A 2YISA 2XIKA 3QWKA 2X0OA 4CZTA 3PVUA 4BCMA 3DCVA 3KK8A 5A4EA 4E7WA 3SHEA 2ZV9A 5CSPA 4CXAA 4BDDA 5LXMA 2CPKE 2QLQA 3FLSA 4R1YA 3BLQA 3OCTA 3MDYA 1JKKA 2PVKA 4ZMFA 4YJTA 3QQUA 3B8QA 3BV2A 3G90X 4O4BB 4X2GA 3MY1A 4PDYA 4ALWA 3G33A 2VUWA 1JKTA 3DBCA 1XKKA 4O0YA 5T6KA 4GS6A 5F20A 4DHJA 3P86A 1CKIA 3FXXA 4CKJA 3F2RA 3HMOA 3CLYA 2QO2A 2QODA 3KK9A 3MVHA 2VTNA 4U9AA 5EDQA 4BWPA 4DEDA 3TM0A 2IWIA 1JSTA 5CQWA 5EM6A 3VS3A 4RWIA 1DAYA 4L42A 3UOJA 4IEBA 3OP5A 2I40A 5IDPA 3O7LD 1UWHA 2ETMA 3EN5A 4TWNA 3TUBA 4BGQA 2CKEA 4GMYA 4ANBA 4WG3A 3U9CA 4FIGA 4KIPA 2PVMA 4RVKA 4C4JA 3OCGA 2WTJA 3HMMA 4I94A 5EHYA 5JMSA 2QOCA 3ZBFA 4E20A 2BRNA 1KE9A 2Y0AA 3RMFA 2DS1A 3PVGA 4JQEA 4QMTA 4BTKA 3SA0A 3N9XA 4TPTA 4EK3A 3RKBA 2B4SB 2QONA 4YZBA 1YXTA 4BB4A 3FKOA 2VGOA 2R3JA 5LMKA 5ACBC 2IJMA 4EOIA 2W9ZB 2JAVA 3NR9A 3ZU7A 3LIJA 4O4EA 5DT4A 3WF8A 3O8TA 4G34A 4F6UA 4LOOA 5DHJA 4LOPA 4ASEA 3D9VA 4EL9A 1GZOA 3HMPA 4AS0A 4XH6A 1M7NA 4YNOA 3OWKA 4Y95A 5F4NA 2JKKA 4MF0A 3NYVA 3LFBA 2PVHA 2UZNA 3EQHA 3BEAA 1WZYA 3R63A 4EOKA 4OGRA 3FKLA 3HP5A 4RPVA 1CKJA 3REPA 4EUUA 3ZHPC 2OU7A 3RAKA 3P9JA 3TUCA 4MUQA 3ML1A 4YO6A 5AR5A 4FSWA 2O8YA 2VNYA 3ACKA 3PPZA 5DNRA 2FUMA 2ERKA 4GKHA 2XJ2A 1PJKA 1JBPE 2PY3A 2QHNA 3ORTA 5TE0A 4D1SA 4I21A 3R7OA 4J96A 5GHVA 4ZLYA 5FTOA 2A0CX 3MPTA 5EI8A 3VONA 3R7EA 2PUPA 2Q83A 3C9WA 2YDKA 3R8PA 2PZYA 3G51A 2R3IA 2CJMA 3UGCA 4G17A 5I5ZA 5KNJA 2BZKB 2GMXA 1UNLA 2ONLA 4F4PA 1Q8UA 3CP9A 1RJBA 4RIOA 1Y6AA 2ITWA 4FK3A 3UIMA 3EH9A 3ITZA 5LCKA 4ZZOA 4H1MA 4A4LA 3JXWA 5B2KA 4FKTA 3QUDA 3S00A 3EN4A 4FIFA 3DQXA 3UPZA 1QPEA 5GZ9A 3T9IA 4FTUA 5FQDC 4JBPA 4GIIA 1H28A 2C4GA 4NCTA 5K5NA 4UMTA 3JVSA 5A3XA 2DYLA 3K5UA 5HD4A 1PKDA 3DDPA 2PE1A 3DK6A 3LFAA 4QTBA 5K4IA 1GY3A 2W17A 5DPVA 3R1YA 3AMBA 3QTIA 1ZYDA 2R64A 4YJNA 3HV3A 1G5SA 3DFAA 5DR6A 5J1WA 1ST4A 3CKWA 3R71A 3FLQA 2CGUA 3R30A 5HG7A 4IVDA 1YOLA 3OF0A 3HL7A 2GDOA 3MTFA 4DCAA 4PDSA 2HY0A 4G3EA 3KEXA 4K9YA 4R77A 4JRVA 4Y46A 2JKMA 5A54A 3BLHA 2PUUA 4KKHA 3ZFMA 4YPDA 5KCVA 4TY1A 4FIHA 5HCYA 1OKZA 3II5A 4D2VA 2VTRA 4A06A 5EKOA 3IW4A 3RP9A 2Q0NA 3KFAA 3TEIA 3R73A 4M84A 2WB8A 4DEBA 3RK5A 5KUPA 4FSUA 3NCGA 2VO3A 4QTCA 5DOSA 3EN9A 3QL8A 3VS4A 4CLIA 4R1VA 2YJSA 3Q9XA 3PE2A 3TI1A 4D2RA 4U79A 4AU8A 5ANOA 1MRVA 2BKKA 5FBNC 2OLCA 1U4DA 2BMCA 4FT5A 4J8NA 5LVOA 2GQSA 5EG3A 3ODZX 3C5UA 4F09A 1L3RE 3QZHA 4K2RA 5JZNA 1NT2A 4F78A 4WNPA 4ZTSA 3ACJA 4I6FA 4BL1A 3BU5A 3JVRA 3DZQA 3QRIA 1VLRA 1TFFA 5GIOE 3PUFC 4RMZA 5HKMA 2IVVA 3I79A 4R5YA 4MF1A 4H36A 2GTMA 2UV2A 3BYMA 2R3KA 2XM9A 3CY3A 4FV1A 3VBVA 4AN9A 2AC3A 4RWJA 2YCSA 5M08A 3CD3A 1PRYA 3AGLA 1YWVA 5DN3A 2YERA 3MFSA 4C61A 4M69A 2W06A 3Q4CA 2HOGA 5KZIA 1YW2A 2C3KA 2R0UA 4KSQA 1XH8A 3I5ZA 5EOBA 2HZIA 1DI8A 1Q3DA 4ASXA 5M4UA 5M09A 5F95A 3Q6WA 2W1DA 3NRMA 1YI3A 4L46A 2WPAA 3GT8A 4AGUA 1H08A 3TNPC 2E2BA 3EZRA 5BQ0A 2X81A 2CN5A 1PYEA 5IMEA 4XEYA 3TV6A 4NYEA 2QKRA 3NUAA 2HENA 3KRJA 3VQUA 4FL1A 3IDBA 3VUDA 4HW7A 3BEGA 5CVHA 4X21A 3F3WA 1FINA 4A4XA 3E3BX 3ORIA 5DYJA 4BJJA 5AUWA 5IQHA 2VWWA 4EEVA 3BZ3A 4R3PA 1KUTA 2BDJA 1ZRZA 1H0VA 3R9OA 4DINA 5CS6A 5EYMA 4BTMA 5A4QA 4ASZA 4M12A 3QKKA 4JRNA 5L6WL 3MH2A 2R3RA 1Z57A 3WE8A 3GQLA 2OGVA 1S9JA 5GJFA 3A60A 3FMKA 2R0IA 4Z7HA 2BR1A 4FSMA 3PY1A 4OTIA 4BBEA 1R78A 4BWXA 4XOZA 2W1EA 3D5WA 1M14A 4RC4A 5ANGA 2WMRA 5EI6A 3BWJA 5E8XA 4DBNA 5G6VA 4S34A 3HAVA 4O2ZA 4BFMA 4O0XA 5FRIA 5IA2A 3O96A 4HGLA 4NSTA 5AX9A 2OJFE 3OZ6A 2WTIA 3L8XA 1ZYLA 4XUFA 4CFXA 4CG8A 4JG6A 2J0KA 5DA3A 3U4UA 2VWBA 4LV7A 1Y8GA 2O63A 4IWPA 3DZOA 5AUYA 3PXFA 1W2FA 5IA0A 3FI2A 2F57A 2YN8A 4FG9A 1O6YA 3H10A 3MB7A 4DCEA 2XBJA 3ZBXA 4AT3A 3PDTA 4I22A 1EH4A 5JGAA 3DOGA 3F3ZA 1UNHA 4ZSEA 4ZSJA 3UIBA 2P3GX 3HGKA 3GCPA 5KMMA 4Z55A 2IF8A 4GK3A 4EZ5A 3V6RA 3D94A 3C4EA 3QCYA 3R9DA 4O4FA 4CKIA 3LZBA 3U6JA 2FGIA 3WZJA 3N4TA 3BX5A 5CVGA 3QUEA 3TKHA 4FTMA 4DE4A 4AGCA 2H96A 2Q0BA 5HE0A 4C2VA 3T8OA 4YSJA 3LW0A 2WAJA 4UZDA 3MGYA 4O1PA 5IUIA 5L2SA 4DFUA 5L2WA 3V8TA 5HIBA 4C33A 4LG4A 4K11A 3UPXA 1KV2A 5CAUA 2R4BA 5E4HA 3U6IA 4TYHA 3R8VA 5JKGA 4PPAA 2WTKC 2WQEA 2GQGA 3NDMA 1WBWA 2ZDTA 3FDNA 2QOFA 4FKJA 3C51A 5I9XA 2YM3A 4BGGA 5KMNA 3RPVA 4GV1A 3UDSA 1XJDA 2JFLA 3G0EA 3KCFA 3SV0A 4AXFA 2JGZA 1YI4A 3C0HA 3L8VA 5FXQA 2IZRA 1OECA 4I0RA 4J98A 3Q52A 3BYUA 4C4IA 5LJJA 5HVKA 1JPAA 3ZO3A 4BCPA 5D11A 4FTQA 2IW9A 3EIDA 3MB6A 5HGIA 4L8MA 2Z8CA 4QRCA 2PE2A 3EL8A 3ORZA 4IQ6A 5KZ0A 3GU7A 4WIHA 4XJ0A 4GT3A 3OW4A 1XH7A 4I93A 4FTOA 5CZHA 3LXPA 4U44A 4DH5A 2GFCA 3LFSA 5CEOA 3OY1A 2GPHA 2VTPA 1H26A 2QCSA 4H3PA