3THBA

Structure of plk1 kinase domain in complex with a benzolactam-derived inhibitor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
287
structure length
287
Chain Sequence
EVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKVLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a Potent and Orally Bioavailable Benzolactam-Derived Inhibitor of Polo-Like Kinase 1 (MLN0905).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PLK1
total genus 78
structure length 287
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2011-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3thbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3thbA01
1CKIA 2JDRA 3QCQA 3RPYA 4EJ7A 4FV5A 4FSQA 2FSOX 2PTKA 3MIYA 4PPBA 3ITZA 3FZ1A 4L00A 1CM8A 4IVBA 4BDDA 3WZJA 3P86A 5LWNA 2ZYBA 1PXNA 3EL8A 3NGAA 4JG8A 4U97A 2YAKA 4HVIA 4E26A 3R63A 3UNKA 4O38A 5CI6A 3DLZA 3ZH8A 4P5QA 4D1XA 4LUDA 5CVHA 4F7JA 3RZBA 3PUPA 4CMUA 3TKHA 4TYHA 4FL3A 4FGRA 3ZYAA 3PY0A 3FDNA 4G5JA 4OBPA 1EH4A 3WF8A 1UKIA 3LFEA 2NRUA 2YACA 4NW6A 1NT2A 3RTPA 1KE9A 4TL0A 4K2RA 2C0TA 2XYUA 3E62A 3FHIA 3LCDA 2UW3A 3FMEA 4ZSEA 5A46A 3QWJA 3VS4A 2UW6A 5CU2A 4DBNA 3FMLA 3FQHA 1S9JA 2XK9A 3CY3A 5FEEA 5BMSA 4YTHA 3GFEA 3NNXA 3W2PA 2ONLC 4CMOA 1P14A 3EB0A 5E8UA 3QL8A 4JT3A 4ANQA 4D0WA 3DTCA 3UQFA 4AN9A 3ANQA 2XNMA 3OVVA 3P1AA 2GS6A 4J53A 3QQJA 2V5QA 4JDKA 5IQGA 1XH6A 4EYJA 5CSHA 5AFVA 4L3JA 3PWYA 1IAJA 4DT9A 4QQTA 3DAEA 3SW7A 3EHAA 4M13A 4ZY4A 4JQ7A 4U5JA 3TEIA 3COHA 4I5HA 4O0UA 4BKYA 5EG3A 2FYSA 4ZXTA 2XBAA 3DQWA 3R6XA 3QZFA 2BFXA 4MBLA 2LAVA 5JFXA 2NO3A 3HV3A 3VUGA 4DE4A 2P4IA 2YCRA 3C4WA 3B2TA 4EOPA 3RPVA 2PL0A 2YIXA 4QOXA 2R3RA 3KXXA 3MPAA 5FBNC 3PZHA 4CYJA 4FTAA 1U4DA 5K0KA 3T9IA 1IA9A 3RBWA 2X7FA 4LV5A 2XS0A 2FSMX 2IWIA 2J5FA 4RFMA 4I5CA 4JBPA 1OL6A 5ACKA 3ZO1A 5JKGA 1BL7A 5C8NA 4Y83A 2C6TA 4YJOA 5AP0A 2XJ2A 3KXMA 2WMRA 2W06A 4MXCA 4ACGA 3HUBA 3MH2A 2BDFA 1JKTA 3EYGA 4JLCA 4QMLA 2QOCA 5KUPA 1U5RA 2WGJA 3V8SA 5HCZA 2ETMA 2CNVA 4R77A 4F0IA 4IAFA 3EOCA 1GZKA 2C69A 4FBXA 4FSRA 1H27A 4HVDA 4KUJA 3RNYA 3S00A 4WSYA 3TACA 3HA8A 5TKDA 3JXWA 5EQPA 3C13A 4QYFA 2R2PA 3PVGA 5L4QA 4CTCA 2C6LA 2XH5A 3R83A 2XA4A 5DYJA 2WD1A 4BN1A 4CCBA 3S1HA 1GZNA 3BYOA 4D4YA 4DT8A 3UTOA 3GU6A 4GSBA 2QODA 2Z7QA 4IM0A 4AOJA 3RALA 1LUFA 2GHLA 3CP9A 4O2PA 5ANIA 3G90X 3MH1A 1M17A 2JEDA 3BEGA 2JKKA 4LL0A 3ULIA 1PXIA 3BHVA 5C4KA 2PHKA 2WTKB 4I6HA 5DR2A 5E91A 5M51A 4F09A 2F2CB 4UXQA 3PTGA 5HX6A 2QOHA 3RINA 1W0XC 4OUCA 4QMWA 4EQCA 5HBHA 5CZHA 4UWBA 3DTWA 3FLQA 1BUHA 4ITJA 4W9WA 1YI3A 1OIQA 4MD9E 4EUUA 3SC1A 3LFQA 1JKKA 1OL1A 4R3RA 2WO6A 5KHXA 3B8QA 2PK9A 2ZM3A 3GUBA 5IH4A 3MFRA 4C4FA 4CZUA 2Y8OA 3FLNC 4E5BA 1PKGA 4PL4A 5EKOA 4M66A 5H8GA 4GT3A 4M97A 2XZSA 2DQ7X 4EI4A 1HOWA 4EORA 2C6OA 5JN2A 4O82A 4IMYA 4MEDA 1OUYA 3GCSA 2QURA 3GQLA 3HV4A 3MA6A 4KKHA 4PMMA 4WNMA 4D5KA 4AN3A 4HGTA 5JFVA 4ZTQA 1XH8A 5DT4A 1H24A 1S9IA 4KWPA 2NNWB 3E63A 1GJOA 1UA2A 4G1WA 3SXRA 5M56A 1LPUA 3FKNA 3A62A 4FTNA 5BUJA 2BUJA 4HNFA 3SOAA 4G3GA 4FTQA 1OUKA 2CGXA 3C50A 1OL5A 2O3PA 4Z55A 3NW7A 3Q4UA 4IVAA 4E4LA 5I3RA 3DGKA 2JAMA 5L2QA 1XH5A 4GS6A 3L9LA 4BDHA 1NVQA 3KFAA 5AV4A 1A48A 3HLLA 1OL7A 4Y95A 3F7WA 3OW3A 4APCA 2Y4IB 3PXFA 5ACBC 2RSVA 1E1XA 5CYIA 4WRSA 2QC6A 4FIGA 1FVVA 2QKRA 5ANDA 3S95A 2F7EE 4I22A 3E3BX 2BDWA 5H2UA 3FSKA 3P7CA 1V0OA 3K5UA 4F63A 4IADA 3F3TA 1OZ1A 3PP0A 5EI8A 5JGAA 3ATSA 3G5DA 5CEOA 2QD9A 4B99A 3PLSA 4GV1A 4CSVA 4EC9A 2ITTA 2OH0E 4U81A 5DE2A 1YXUA 1FMKA 1QCFA 3VS3A 5IA3A 5L8LA 4L8MA 3VBWA 4DEDA 3EIDA 3P7BA 4QMSA 5E8YA 3NUPA 3Q4ZA 4IWDA 4BKZA 2O2UA 3Q2JA 3VS0A 4C4JA 4IVDA 4XG4A 2JKMA 4O91A 2JFMA 5HEZA 4E73A 2BFYA 5KMMA 3GU4A 4RRVA 5HVJA 3OUKA 4QP1A 4CEGA 2B9FA 3L1SA 4DGOA 3C0IA 4EOMA 4AZSA 2VTIA 5AWMA 3OWKA 2Z7SA 1JSTA 4ZAUA 4B4LA 5IA4A 3NRMA 4YHTA 3V5TA 3GC7A 4C7TA 4QNAA 5GZ8A 3UIUA 2JAVA 5KE0A 4E1ZA 3BLRA 3FZPA 4XG8A 5BVOA 2ZMDA 3ALOA 3HAVA 2XNBA 2XK7A 2IN6A 3O50A 3IW7A 4EH8A 5M07A 1CSNA 1ZRZA 2Z02A 4DFNA 3DK7A 4OT6A 4YPSA 3EH9A 2QHNA 4IHPA 3KULA 3HGKA 1CKPA 4EZ5A 4YLJA 5EOBA 4NT4A 2W5HA 4PF4A 4LFIA 2J9MA 3VF8A 2EXMA 4TNDA 3ZM9A 1NVRA 5IQHA 4BGGA 3V5JA 3FMKA 1REKA 5DI1A 5H8EA 1OVEA 4Y85A 4AUAA 4E6CA 4FSZA 3D5XA 3PRIA 1Y91A 1BI7A 4U8ZA 4QPMA 1ZXEA 3VUDA 3BYMA 5L6PA 4QP3A 4YR8A 4BRXA 4O7WA 2VGPA 3HNGA 3QX2A 4ALUA 4XH6A 4ANNA 2EVAA 3MBLA 2F7XE 3NEWA 4XP3A 5FUTA 4C3PA 3H10A 4FKSA 4Y46A 4RWJA 4ZTLA 2OU7A 2CKOA 4L52A 2WZJA 4P5ZA 4GRBA 1ZYLA 2Y7JA 4O0XA 3BHUA 5DFPA 3AC4A 3R9NA 3KXHA 3NW5A 3ZONA 4D1SA 1Q8UA 1PKDA 4AQCA 4NM0A 4F0FA 2WQEA 2DUVA 3O17A 3Q6WA 3PZEA 5F20A 4GIHA 3DDPA 1Y57A 4P7EA 2CN8A 4YJQA 3KC3A 2RF9A 4O7YA 2OW3A 4M84A 3HX4A 5D11A 4F6UA 3QTUA 4RX5A 2UW4A 3K3IA 3MVHA 3W55A 4EOJA 3ZSIA 5LWMA 4RJ3A 1CMKE 1HCLA 2BZIB 2EB2A 3OXZA 4GIIA 3DY7A 4C57A 3UQGA 2BMCA 3DA6A 3PA5A 4GFGA 2W4OA 1YXXA 4RIXA 4AGDA 4QTEA 3N4TA 3VBQA 1QPDA 4MXAA 4E8AA 4DCAA 2UVZA 3WARA 4TY1A 3BEAA 5KMIA 4QP4A 4RJ4A 4AA5A 4NSTA 1YVJA 3POOA 3QGYA 5IDPA 1T45A 4EOSA 1QPEA 3DT1A 2Y9QA 4BCJA 2CLQA 3VO3A 3FC2A 3H3CA 4EOIA 4YSJA 2E9UA 2UZTA 4MTAA 4PPCA 2AYPA 3QD2B 2BRGA 4QMNA 2R3QA 2VTRA 4PP9A 4IEBA 3WE8A 5HO7A 2BR1A 3JY0A 3ACJA 4JL9A 4UZHA 3UMWA 3W2RA 2H34A 4PP7A 4J71A 5CNNA 2EU9A 4DEIA 4F9CA 1YKRA 4ANSA 3FLSA 2JBPA 2OJFE 1XBCA 2JLDA 4U43A 3UC4A 2P2HA 5HLNA 2FO0A 4BCNA 2OLCA 2PYWA 4JDHA 4J98A 4BCOA 2WTDA 2XEZA 3UQCA 4QTCA 5ETIA 3ZRKA 3LFDA 3AC3A 2QU6A 4H39A 4JVGA 1OIRA 4XMOA 2VX0A 3FWQA 3W2OA 2WQMA 1H07A 3C51A 1QMZA 5FQDC 5ICPA 2VWZA 4O1PA 4F1MA 2OICA 1Z5MA 2UZNA 1IEPA 3EKNA 4U44A 3VUHA 2W1IA 2CJMA 4P90A 4H3PA 5K9IA 5KHWA 3DB8A 1YDSE 4PX6A 4J52A 4M12A 4G3FA 3MESA 3RWQA 2HZNA 4DFYA 3UJGA 3W8QA 4O0YA 3VVHA 1MP8A 2OGVA 4EH9A 4FIFA 4F7NA 2HYYA 4P2KA 4DEBA 2ITQA 5HI2A 3EJ1A 4J8MA 4R6VA 5AUVA 3HA6A 4I6BA 4RX7A 1ZYDA 1DS5A 2CLXA 3QQFA 3SX9A 3ELJA 3RI1A 4AFEA 3R7EA 4FEWA 4HGSA 3NMUF 5CF8A 3PXRA 5AX9A 2ERKA 3E8CA 2VV9A 1GNGA 3BGQA 3LCSA 3VNTA 4MXOA 3S2PA 1WBNA 2QOIA 4OAUC 4IZYA 3RK7A 4MQ1A 2EWAA 4R5YA 2XK3A 1PXJA 2WTKC 1UU9A 2R3IA 3T8OA 3MPMA 3OG7A 5BYZA 4B0GA 4ERKA 3P78A 4RVKA 3PJ2A 2OG8A 4I92A 4DAWA 4KABA 3R9OA 2R3OA 1ZWSA 4A9TA 3D2IA 3RMFA 2C5YA 3TTIA 3EWHA 3BU5A 3U9NA 4BIDA 3MS9A 3WF6A 3OEZA 2GFSA 2OZAB 3I4BA 3L8PA 1GIJA 2VTSA 5AR8A 2QO2A 2VWWA 3M11A 2YIRA 4NJDA 2J2IB 3Q53A 4RIYB 4DH7A 5LMBA 2UZUE 4QTAA 1FOTA 4B8MA 3OXTA 2YFXA 5GJGA 3MI9A 4KIKA 3NYOA 4Y8DA 4C38A 2OIDA 3MJ2A 1FVRA 4IWOA 1YI6A 5AP5A 5AR3A 3CD8A 1YHSA 5LARA 4XOYA 5KMNA 3BWJA 2IVUA 4IX3A 2Q0NA 4ORKA 3D5VA 4IM2A 3VF9A 4FTRA 5HE3A 2GDOA 4XP2A 4CD0A 3WE4A 2WEIA 3VIDA 5AADA 3VW6A 4Z9LA 4EUTA 3WZDA 2RG5A 5E92A 1WZYA 3U6IA 1UWJA 3HRCA 4FKPA 4GU9A 5CEQA 4APPA 5JQ8A 2YHVA 2XKEA 4HNIA 4L67A 4NTSA 3PSBA 4O0TA 3C4CA 2I0VA 1TKIA 3O51A 4EQUA 4KINA 4O7SA 2YCFA 4EK4A 4CQGA 5HVKA 3I0OA 1J1CA 4FT5A 1REJA 5EDRA 3MYGA 2XCKA 1BI8A 2QLUA 3GVUA 4HCUA 4JR7A 2GTNA 2XF0A 4C35A 2GNFA 2YEXA 3HP5A 2BZJA 5HTCA 3HMOA 3IW5A 3UIMA 1ZOGA 3F61A 1WVYA 1JQHA 1M7NA 4BDKA 5IPJA 3HKOA 3P0MA 3E7OA 5KNJA 3UIXA 1E1VA 4FKQA 5EYMA 2F2UA 5EFQA 4MF0A 2RFEA 1U54A 5HHWA 3I79A 4AS0A 3QF9A 4YNEA 3ZUVA 4HYIA 4OAVB 4F6WA 3IS5A 3IECA 3O96A 1P4OA 3PLAE 3EQBA 2BDJA 4LRJA 3KY2A 2X4ZA 4FE2A 3EZVA 1J1BA 2H6DA 4MKCA 3KMMA 5EK7A 3QAME 3R2BA 1FMOE 4A7CA 2P55A 1O6LA 1LEWA 5D7VA 4D2TA 2CGUA 4FT0A 1SVHA 5J9ZA 3IDBA 3Q5IA 2W99B 5CY3A 2ZMCA 3BWFA 4E6QA 3ODYX 4D4RA 1G8AA 4BCGA 3L9MA 3VW8A 4EKLA 2WPAA 5FXSA 5CSVA 2YWPA 3ORNA 1UU8A 2C6IA 2ITUA 3FI8A 5A4LA 2QG7A 4F9YA 3VUKA 2GNJA 2J51A 4ACDA 4DGGA 3EQRA 4WT6A 5CF6A 4ASDA 2G2FA 3GC8A 2JITA 3COMA 3WYXA 5ANEA 2OXYA 2HCKA 2B9IA 5AP6A 4BF2A 2WQBA 3LFAA 5CAPA 2VU3A 3Q4CA 3VC4A 3A8XA 4C33A 3O7LD 2I0YA 3BBWA 4MQ2A 5CXHA 2PVMA 4O6LA 4DCEA 2X7OA 3QQKA 2XK4A 3RHXA 3VS5A 3OP5A 3NVKI 5DT0A 4OBQA 4YUQA 3LQ3A 4IVCA 1GAGA 4YLKA 5JMSA 4D5HA 5K4JA 4EKKA 3KRWA 3QCXA 4XNEA 4BZDA 3SQQA 2JDTA 2O65A 4X0MA 3JVRA 4I5MA 4Z7GA 3P7AA 4W4WA 3LFBA 3ZC5A 3IONA 4U6RA 3NUSA 2A2AA 1KV1A 3ALNA 4LMNA 2ZM4A 2VO6A 2FSLX 4W8DA 3V6SA 5J9YA 4LM5A 2IVSA 2WFYA 3MSSA 1O6YA 3NUUA 2F49A 2HIWA 5ANJA 1ZY4A 2UZVA 4U0IA 2IW9A 2BTRA 2IW6A 3DAKA 3TM0A 2R9SA 4WKQA 2Z60A 3AXWA 5DR9A 2QQ7A 3JUHA 4ZP5A 1A06A 4FG8A 3Q9XA 1RJBA 2F9GA 4IQ6A 4AT5A 4E4XA 5C8KA 3JR1A 3OEFX 4N0SA 4EEVA 4CCUA 4F4PA 4AP7A 4HCVA 2YABA 3MJ1A 5J7HA 4ACHA 4HYUA 4MNEB 3IDCA 3ZHPC 4FT7A 4U3YA 2C1AA 3C0HA 3Q4TA 1BYGA 2XYNA 3EN7A 3QLFA 3K2LA 4DFLA 4B6LA 4KRDA 4MXXA 4QP6A 4LUEA 3F3WA 3P79A 5L6WL 4PUZA 3CEKA 2Y0AA 3E8EA 3BZ3A 3QYZA 3PG1A 3ZSGA 2ZDUA 3KK9A 5AV0A 5J5TA 2JKQA 4MK0A 4AT3A 3JY9A 4XUFA 5AR7A 4FV4A 1LEZA 3EL7A 5CT0A 2QU5A 3ENMA 4TWPA 3KU2A 3DFCB 3AC1A 2WXVA 3AD6A 4FNWA 2OIBA 4FKGA 5I9WA 2W5AA 3GU5A 4A4LA 2HZIA 5E9EA 3QTXA 4HZSA 4X6RA 2NPQA 3P08A 4ZZMA 3S4QA 4E7WA 4ZLOA 4JQEA 4FVPA 4YBJA 3OD6X 2JKOA 5GINE 4CG8A 2REIA 2W7XA 3DBQA 3DJ6A 5DRBA 3SDJA 4C37A 5IUGA 2WMSA 4USEA 1YOMA 2FUMA 3R22A 3QA0A 1YOLA 5B2KA 4L3PA 3ZFMA 3R7GA 4NTTA 4QMPA 1U59A 3OCTA 4MF1A 4QYHA 4AW1A 1Q5KA 5TO8A 4CFFA 4D2PA 5IDNA 2G2IA 1IASA 2J0JA 3WF9A 4EOOA 3ZCLA 3ZTXA 1VR2A 4ASEA 4AW2A 3EN5A 1O6KA 2WNTA 4V05A 4JR3A 2JD5A 5D41A 5IUHA 1PXLA 2B4SB 3DJ5A 4IWQA 4XV1A 5GJDA 4Q9ZA 3KREA 3M42A 3UZPA 2XKDA 3D7ZA 5JZJA 2GQRA 2PULA 3MVLA 3SGCA 2HZ4A 5KBQA 5FEDA 4KA3A 2PE2A 4CLIA 2C0OA 4D9TA 1T46A 2XK6A 4CFUA 4H05A 4BDBA 3RPSA 2UVXA 3GCQA 1ND4A 3FXZA 2JIIA 4FT3A 5EI2A 1Q62A 4ZEGA 3FY0A 3OS3A 3LM0A 4ZY6A 4MD7E 3W2QA 3LXLA 3RAHA 2YCSA 5B2LA 3EKKA 4QMYA 4B7TA 3FXXA 5HTIA 4G9CA 1F5QA 1U54B 4K6ZA 4ASXA 3UVRA 2OFVA 4BI0A 1PHKA 3KN5A 4KIKB 5IQCA 1FGIA 2OZOA 4LOOA 3Q96A 5L8JA 5JH6A 4X2FA 3TDVA 2WMQA 4MVFA 1OPLA 3BE2A 1ATPE 3LFFA 4MXZA 2ZM1A 4J7BA 2PVLA 3WZUA 4C02A 5CSWA 3HMMA 4KBKA 4GT4A 1IA8A 5BMMA 4C59A 2PVFA 3HZTA 5C03A 4TWCA 5D1JA 5AAGA 3R01A 4OW8A 1Q61A 4UMTA 4YHJA 1L3RE 3I5NA 3R8ZA 2QVSE 2R3FA 3QFVA 3ENHA 3EFWA 5HBEA 3F66A 3CJGA 2F4JA 2WKMA 4FTKA 4FUXA 5DOSA 5TR6A 4FG9A 5CWZA 4RA5A 3IG7A 4S33A 4FMQA 3DBFA 3RHKA 4EHGA 2I6LA 4KAOA 4E6DA 4W4YA 4N57A 3CPBA 4CFXA 2B9JA 3QRUA 4FKIA 3ORMA 4QMUA 4RGJA 4RX8A 4DBXA 2QKWB 2V55A 3TIYA 2NP8A 3EQFA 4L42A 3GU8A 4FV9A 3QTIA 4ZOGA 4EYMA 3V5LA 2XNOA 3R02A 2PMLX 1QL6A 3PE1A 4CVAA 5CU0A 4FZDB 4L6QA 4PTGA 4ZS4A 3LPBA 4GK3A 2HY81 4BTJA 2J7TA 4NFNA 4RMZA 4JOAA 2C6MA 2OIQA 3EQDA 1OPKA 2CCHA 3A7HA 5BQ0A 1K2PA 2X39A 3QZGA 4O0WA 4QTDA 3AD4A 3CLYA 1TQIA 4FUYA 4BCHA 5K4IA 2W1EA 2BHHA 2HOGA 2WELA 3MN3A 4RBLA 4ZJIA 3DV3A 3ORPA 4LGDA 5J5SA 1U5QA 4MAOA 4KIOA 5M06A 1PYXA 4EK8A 2BPMA 3RM7A 3DOGA 2CSNA 3Q9WA 4AW5A 4XG2A 3LAUA 5HG9A 1URCA 1GY3A 2O5KA 4GW8A 3ZRLA 5HVYA 5FTGA 3UGCA 3U54A 5D9HA 3NUAA 4EH2A 5AIKA 2B52A 2E9PA 4ITIA 3N51A 3MTFA 3PRFA 4EH4A 3EQGA 5I5ZA 4D4VA 3UZRA 3U87A 4IFGA 1AGWA 2W1DA 3FI2A 3R0TA 5M44A 5K5XA 3DKFA 3GC0A 3NUNA 3LFNA 2PVYA 4TKSA 4MNEA 4YGAA 1YOJA 2ZV8A 4BZOA 2ITXA 4F64A 2Z2WA 3ORXA 4YZCA 2OJIA 4FV8A 2R3NA 4FZ6A 3PVWA 3HP2A 4X2GA 4H3QA 1M14A 4WG4A 3MB6A 4PMPA 2C47A 4LRKA 3DAJA 2BAJA 4L3LA 1G5SA 2G01A 3MTLA 5CSXA 4IAAA 2VRXA 3BU3A 4DFZE 3ZM4A 2BCJA 3BHYA 3BGZA 3QC4A 4AZFA 4IDTA 4RJ8A 4QP9A 2B1PA 1PXKA 4E93A 1OKZA 5AP7A 3F5PA 3D4QA 3TZ9A 3BIZA 4IAIA 1ZAOA 4BTKA 5TE0A 1Q97A 4RZWA 1P5EA 5DGZA 5T6KA 3GOKA 5AR2A 3MH3A 3O8TA 5LQFA 3QRKA 4FKRA 3VN9A 2OWBA 5AP3A 3FZTA 4A9UA 3LJ1A 4G34A 4L45A 4XHKB 4U7ZA 1Q8TA 4ZTHA 5AUTA 5LVPA 5C8MA 3H4JA 4O96A 4YJVA 5EW8A 4BWXA 3ZLXA 1Z9XA 2X0GA 4QMOA 4ZSJA 3KMWA 5DN3A 5CEPA 1UU3A 5AV2A 1KUTA 2QHMA 5AMNA 3VRZA 1W7HA 4BCMA 2UV2A 1JLUE 2YCQA 5CVGA 3WIGA 2UW0A 3OT3A 3QHWA 3DK3A 3KXNA 4HZRA 4HVGA 3LQ8A 5KMKA 5AR4A 1KE7A 1ZYCA 3OZ6A 3O71A 3GC9A 3S3IA 5HIEA 5J8IA 1M2RA 3F9NA 3ZEPA 1GIIA 1V0BA 3R1YA 4HVSA 4M15A 4RIWB 5FBOA 3HAMA 2YLEA 5A4QA 4I94A 3FI4A 3ROYA 3Q04A 3PPZA 2QR8A 3TWJA 4EH7A 3LIJA 4I23A 4M69A 4C3FA 4DGNA 3FMMA 3W32A 1J7LA 3TUBA 3W18A 3G2FA 3O7LB 2XBJA 2VTQA 3AMBA 4ZTNA 3H30A 4WBOA 2GS2A 2GNHA 4IJ9A 4UB7A 1XBAA 5ANOA 2PMOX 3CE3A 4V0GA 4USFA 1YQJA 4M3QA 3HUCA 5FTQA 3LFCA 3GT8A 2VNYA 3II5A 3UNJA 3R7IA 4M7IA 4E20A 4PL5A 2VTMA 2QI8A 3FPQA 3FHRA 5IH6A 2VWXA 2H9VA 3WBLA 5BUIA 4O7ZA 3QQGA 2BROA 1V1KA 1MQ4A 3QCYA 1OM1A 5DHJA 3HRFA 3PXKA 2IW8A 2WU6A 4EH6A 4IC8A 4UWCA 4PDOA 3RAKA 3R30A 2CKPA 2YZLA 3QA8A 3TNPC 4OTHA 1PMNA 5IG1A 5CVFA 4J8NA 4AE6A 4N6YA 4BCFA 3GCUA 4I21A 4Y73A 2YDKA 5EQEA 3ZO4A 1J7IA 4IX4A 3TV7A 3NVMB 2WOUA 4FK6A 4AGUA 3RCJA 4XRLA 4FL2A 4L9IA 1ZMUA 3QGWA 3IKAA 5BPYA 1WBOA 3C4ZA 1YXSA 3QD3A 2G1TA 5IEXA 5C1QB 2YM8A 5HGIA 5TF9A 4G9RA 4RG0A 3ZRMA 3UOJA 2ZV2A 1OKVA 2Y4PA 4UEUA 4XRJA 5H9BA 3AMAA 4K77A 3LMGA 3LOKA 5DIAA 2EUFB 3LFSA 4C8BA 4EHEA 1WVWA 1PMEA 2C6EA 4S32A 3FLYA 3FZOA 5M55A 5AAFA 2QLQA 1BKXA 1Q41A 3F5UA 3BLHA 4AWIA 2YDIA 2VAGA 5KCVA 1PXPA 4QMZA 3G0EA 5FM3A 3IK3A 2W4KA 3LHJA 5D10A 3MFUA 4A9RA 5DRDA 1WBTA 2ITYA 2ITVA 4LYNA 3H0ZA 2BRHA 1XJDA 3AMYA 3R7UA 2J90A 4BTMA 4AZTA 3A4OX 3ZZEA 5HESA 3HDMA 2O64A 5DNRA 4C2WA 3QUEA 4D58A 2BHEA 5CEIA 4C4EA 2W1GA 4UMUA 4IAYA 1XKKA 5IZFA 3VJNA 2QOKA 2IZTA 4NIFB 3TUCA 2XB7A 3FL4A 3LE6A 3A4PA 4K33A 4P4CA 4UYAA 2X1NA 5GHVA 4DN5A 3D7TB 3NX8A 1JPAA 5IUIA 3IW6A 5AJQA 2C0IA 3ROCA 5M57A 2PUNA 4XS2A 2RKUA 2VNWA 4OR5A 3NAYA 1YWVA 5FEQA 1KWPA 4TZRA 4D2RA 4AACA 4S2ZA 2RFSA 2ZOQA 3MDYA 4IW0A 1ZZ2A 4I0TA 3W16A 3I7CA 5IQFA 5A6OA 2E9NA 2CKQA 4O81A 4XOZA 2ITZA 2Y4IC 5HLWA 4DG2E 3FQSA 4OTPA 5CZIA 4FSTA 2WB8A 1R0EA 3L8VA 1DI8A 4FT9A 1PJKA 3QRTA 3TJDA 4BCQA 2VTNA 3TN8A 5EHOA 3DBEA 1H08A 2PE1A 3PIXA 4FSWA 1ERKA 2W1CA 5FGKA 3GXLA 3RP9A 3UVQA 3AC8A 2AC5A 3OY1A 3DK6A 4R5SA 3A7JA 2Z7RA 4FTOA 4NYEA 2Q83A 4TT7A 3AG9A 3U4WA 3C4EA 2OF4A 3ZU7A 3QTQA 4EH5A 1WAKA 2OF2A 3R9DA 3U9CA 2YWVA 2XKFA 2XJ0A 4GCJA 4L7SA 2O63A 4EBVA 3NR9A 3E5AA 4DTKA 5HBJA 2B0QA 5IA2A 4D1ZA 5K0XA 4FV1A 3UPZA 3ZEWA 2QOOA 1BMKA 4HPTE 2E9VA 1JSVA 2UZDA 4DHFA 3QUDA 2LGCA 3UYSA 4DFXE 4CRSA 3OOMA 3Q9YA 4YC8A 1K3AA 3RPOA 3NSZA 4M14A 3VJOA 3FMNA 4CGAA 2YM5A 1YI4A 3F88A 4JG6A 3TZ7A 3UE4A 5TOZA 3AGLA 4AGWA 4FODA 4BFMA 3GI3A 3DBDA 3H9OA 3H9RA 4ZZOA 3O23A 4O86A 3OBJA 2EXEA 4JJRA 4QYEA 4ALVA 5LVMA 4YLLA 3PY3A 2ITNA 5A14A 3NWWA 3EQHA 4UXLA 3I6WA 3HMNA 3QC9A 3QTSA 3GCVA 3PJ1A 4WHZA 3VAPA 3RZFA 1WCCA 2R64A 4K18A 4I24A 4DLJA 4O84A 1ZMWA 4FVRA 3QKLA 2QOFA 1WBSA 2H8HA 4WNPA 4ERWA 3QTRA 3CXWA 3ZO3A 1YHWA 4G2FA 1M2PA 4X3FC 2VX1A 3LCKA 1PYEA 3ZZWA 5A4EA 3UG1A 1V0PA 4F9BA 1UWHA 1UKHA 4A9YA 2R0UA 4DH3A 4M68A 2WTJA 1Y8YA 3ZSHA 4CTBA 2OXXA 3C4XA 3E92A 4K0YA 3RWPA 3AT3A 4FKJA 2C5NA 4QP8A 5A3XA 5EYCA 3CPCA 2FVDA 4LV8A 2P2IA 4YJUA 4Q5EA 3CJFA 4XEYA 4F99A 1MRUA 4MXYA 3GB2A 2W4JA 3CSVA 4Y5QA 3DU8A 3SA0A 3V6RA 3C5IA 2E2BA 3FI3A 4KBAA 4O27B 4AA0A 2RL5A 4BYJA 2X9EA 3NCGA 3FLWA 4PQNA 3DQXA 4AZWA 4IBMA 3ZS5A 2PMNX 5LMKC 5M4FA 3SG9A 3EYHA 5ANKA 4BCKA 4DEAA 2KTYA 4UYNA 3D7TA 5JSMA 2GSFA 4L43A 4R7HA 4IB0A 4YC6A 5T3QA 5M53A 4ID7A 2PVNA 4EOKA 1OIYA 4UV0A 2XM9A 4ONAA 4RJ7A 1SZMA 2XNNA 3MV5A 4O22A 2JIVA 3TUDA 3A60A 3E93A 2YIWA 3FJQE 5EDPA 3PDTA 2PZPA 2FGIA 5HKMA 4RC3A 5BYYA 2C3IB 4W8EA 4ZS0A 3R9RA 3JS2A 3LMIA 3ZXZA 2B53A 2VTHA 3R7OA 2WQOA 1VYWA 5HTBA 4JBQA 3MY5A 4F7SA 2GFCA 4EWHA 5CQUA 3DKGA 2CMWA 3PA4A 2XUUA 4A06A 3QU0A 4FYNA 2ITOA 2VTOA 2QO9A 3AC5A 2OXDA 5F4NA 4OTQA 4FZ7A 4KRCA 4TXCA 5GIOE 2X9FA 4GYGA 4U41A 4U9AA 4XLVA 4XBUA 3THBA 3TI1A 3NZ0A 2VO3A 1CDKA 1UV5A 2WIPA 3GNIB 5LJJA 5AUXA 4EHVA 4J96A 4DTAA 2J50A 4R3PA 4TYHB 5J95A 4XG7A 4LOQA 2HY0A 3VBTA 4GVJA 5HU9A 2ZV7A 2HAKA 5HE2A 2VGOA 4YO4A 4HYSA 3MA3A 3EN9A 4YHFA 4DA5A 1E9HA 1F0QA 4I41A 3UO6A 4EZ3A 4NCTA 3AT4A 2B7AA 4BBEA 3VUIA 2GMXA 4FGBA 5CENA 3LXNA 2X8EA 4S31A 3CTHA 2IZUA 5G6VA 1DI9A 4NH1A 3CKXA 2HWPA 4PPAA 5AUWA 5HCXA 5JGBA 4PDPA 2X2KA 4BVUA 5IQIA 2CGWA 3PFQA 3FYJX 2UZWE 2A1AB 3JYAA 3PPKA 4JQ8A 4ZK5A 4U40A 3E88A 2OSCA 2R7IA 3TIZA 2VTTA 4QYYA 3CTJA 3PG3A 3R00A 5CEMA 1Q3WA 2OZAA 2OK1A 4CYIA 4YURA 3G9NA 5FDPA 4Z3VA 3O8PA 3VUMA 3QCSA 3UP2A 4AZEA 4C3RA 4OLIA 3I60A 2YJSA 2BIKB 4F0GA 5I9XA 3CD3A 3VS7A 3G6HA 3P9JA 1I09A 3BHTA 4RWKA 4Q2AA 4ACCA 3ORKA 2QCSA 1R1WA 4DEGA 3UO5A 2AC3A 3POZA 1ZZLA 3BV2A 5GZ9A 5KMJA 3R1SA 4FC0A 4DFBA 1U46A 5C4LA 4H3BA 3F3UA 3UOLA 4BDJA 1XQZA 3A7IA 3VS2A 5K5NA 2CCIA 4WG5A 4AOTA 3MPTA 5BYLA 3G33A 3R2YA 4IAKA 4ZTRA 4KNBA 3KL8A 4M69B 1W84A 2PUIA 4II5A 4OTRA 5IQBA 4M0ZA 1H1WA 4O7RA 2JDSA 3FC1X 5HO6A 2BRNA 4NWMA 4FV0A 2YM6A 5BX0A 4CG9A 4BHZA 3BV3A 3IQ7A 4FR4A 4DTBA 3GOPA 2XKCA 3NNUA 3OWPA 3VS6A 5BVWA 5CAOA 5EOLA 2ETKA 2XEYA 4N6ZA 4KBCA 1L8TA 2VTAA 4EK3A 4GG7A 5CT7A 3R9HA 4YU2A 3QD4A 5DLSA 3C0GA 5A54A 5IISA 4IWPA 3DFAA 2HZ0A 4HYHA 5CU3A 4MWIA 3SXSA 5DBXA 2XIXA 3ATTA 4GU6A 4ZMFA 1B38A 3DZOA 3C7QA 4ZSLA 3PY1A 4YZDA 1RW8A 4AAAA 1IRKA 2GS7A 2YIQA 4YZ9A 2IVVA 5AP1A 4ARKA 5F94A 3QD0A 3FZSA 5IMEA 4LQMA 3LMHA 2H96A 4QMVA 4CXAA 5EQYA 2PE0A 2XIZA 3TT0A 3MIAA 5IQAA 4YSMA 4R7BA 3EQPA 4RC4A 4CZYB 1KE5A 3IGOA 2WMXA 1H1PA 3SV0A 3V51A 3AQVA 4RVMA 3M2WA 4ZSGA 3E64A 2C5OA 3OROA 4WG3A 3QXOA 4IX5A 3BYVA 3RKBA 3AD5A 3F2RA 4G6OA 4EBWA 2ONLA 2PSQA 3F3VA 3QYWA 3QALE 3C1XA 3OXIA 4GJ2A 4L53A 5J87A 3ZUTA 2PZYA 2BKZA 5AUUA 3FYKX 4ALWA 4GG5A 1SVEA 3WF7A 5KMLA 3D2KA 3DNDA 4C4GA 2F57A 3Q32A 1NW1A 4Y72A 5EH0A 5FDXA 5KBRA 3RNIA 2I0EA 3KXGA 4BIBA 4EK6A 4IJPA 2JDVA 1YW2A 2A4LA 4JI9A 1WVXA 3BGPA 3OTVA 3TL8A 2R3MA 5C27A 5LVLA 2R3LA 3DKOA 3WI6A 2QG5A 4JBVA 3G6GA 5I3OA 3F7ZA 3MY1A 3KRJA 3D15A 4RWIA 4WBBB 4WO5A 5HD7A 5CNOA 3PWDA 3PE2A 2R4BA 3TV4A 1GZOA 2WMBA 3BBTB 3F5XA 4YJTA 4ZJVA 3BYUA 3KULB 4B9DA 2VD5A 4XV9A 5HE0A 3EZRA 2RFNA 3PA3A 4YZBA 5DEYA 5E8VA 5IQDA 4FV2A 3TDWA 2BZKB 4UX9A 3LCOA 4RIWA 5KMOA 2VWYA 3OW4A 1JKSA 3E3PA 5BVDA 4N4SA 1IAHA 2XIYA 4JIAA 1DAWA 5JK3A 3QHRA 1WFCA 3AGMA 2CN5A 3BPRA 4V04A 5FP6A 4GT5A 4I6FA 5A4TA 1G3NA 4UMQA 2XJ1A 3IW4A 4NUSA 4BDGA 4FVQA 4YTCA 3OMVA 4R78A 5B7VA 3WZEA 3NNWA 4ZJJA 2W05A 3L8SA 4FEUA 2YISA 1Q8YA 4FZAB 3HMPA 5T68A 2ITPA 4QQ5A 5DPVA 1IR3A 4A07A 4NEUA 4TYIA 4EONA 5J7BA 1K9AA 4GKIA 1CTPE 2UZBA 4FIIA 2WTCA 4K1BA 4E4MA 1JWHA 3KN6A 3PIYA 4FKLA 2HW7A 4KSPA 4S34A 4PNKA 3CQUA 1MUOA 2RIOA 4IM3A 5BNJA 1ZOHA 3R1QA 4BL1A 2PVJA 5HQ0A 3I1AA 5KKRC 2C5VA 4X3JA 4PDYA 4W9XA 2C3JA 3E7VA 2DWBA 2O8YA 3GGFA 1H4LA 3O2MA 3Q2MA 4RQKA 3DBCA 5E8WA 2SRCA 3ERKA 4EOQA 3UVPA 4D4SA 4DG3E 4ZSAA 4DC2A 3V01A 3PVUA 2J4ZA 4J95A 3SD0A 5IF1A 4QQCA 4XBRA 2O0UA 4X2NA 2IZSA 3ZDUA 2VTLA 2XMYA 1WBVA 3B8RA 2ZB1A 2YDJA 4LL5A 3WILA 4D2SA 4HOKA 2R3HA 4OTIA 3DB6A 4KIQA 4PV0A 1OL2A 3FMDA 5AX3A 4DLIA 3Q3BA 4R8QA 5HNIX 4RJ6A 3PP1A 4O21A 4IAZA 5I9UA 2BAKA 2R3PA 3G9LX 4FOBA 3Q6UA 4IACA 3TKUA 1OKWA 3CTQA 1VJYA 1OKYA 4NKAA 3QRJA 4RFYA 2R3KA 5CU6A 5KKRB 4GYIA 3DDQA 5ITAA 5LMAA 5JQ5A 3E8NA 4MHAA 3PJCA 3VULA 3UP7A 3F6XA 3TXOA 3D5WA 3BKBA 4XG6A 5AA8A 3NNVA 4D2VA 4U42A 5BVFA 4FIEA 4ZZNA 5L2TA 4HCTA 5KZIA 2VO0A 5A9UA 2VUWA 2VWIA 4BBMA 3ZXTA 4YBKA 1FPUA 1H1QA 3U6HA 2QOQA 2V62A 5ETCA 4FKUA 3G0FA 5GIPE 3QTWA 2PVHA 5FP5A 2W17A 3FKLA 4H1MA 5GJFA 3UOHA 5AEPA 3MFSA 3OTUA 3ZFYA 2PZ5A 1YRPA 3EFJA 3KF7A 5DVRA 1X8BA 1XH9A 3UIBA 4C2VA 4CFWA 4I6QA 4O0RA 1A9UA 3LVPA 1H8FA 3Q60A 4U80A 5FWKK 4I4EA 5LCJA 4X7QA 4EL9A 3UDBA 3FKOA 4KKEA 2YN8A 2C30A 5FD2A 2VZ6A 5L8KA 3O8UA 3PIZA 1JNKA 3GP0A 4G6NA 3D94A 2OH4A 5DEWA 5L2WA 4XCUA 5A4CA 3F2AA 2XNPA 3I5ZA 5I9VA 2RGPA 1H1SA 4BCPA 4UN0C 3R8MA 2PVRA 3UNZA 4C34A 3TCPA 5AAEA 1XH7A 3HL7A 2GNLA 2X8DA 4TNBA 4IZ5A 3TKIA 3VRYA 5L3AA 3GEQA 3R1NA 5FRIA 3GCPA 3KCFA 4EOLA 2J0MB 4FV6A 5AP2A 3SXFA 4MWHA 3TG1A 4GFOA 4RLKA 4K11A 2B54A 4BIEA 3PSDA 1OBGA 4IB1A 1XBBA 4DGLC 1M2QA 5JRQA 4XLIA 3U4UA 3RM6A 2J0IA 4JDJA 4LI5A 4GH2A 1NY3A 4JG7A 3REPA 4FL1A 4FX3A 1DAYA 5L2IA 1R39A 4TYJA 2BALA 2CDZA 5B0XA 4PMTA 3P4KA 2JGZA 3PYYA 4IZ7A 4GKHA 2IJMA 2UW7A 3HV6A 4R7IA 2W9FB 5CF4A 3QRIA 3UBDA 2HW6A 3N9XA 4YTIA 3GENA 4AFJA 3CGOA 5EM5A 1J91A 4AGCA 2RG6A 5JFSA 4YO6A 1OMWA 4LGHA 3VHEA 1W82A 3R73A 3LCTA 2C3KA 4R3CA 3UOKA 2JBOA 2C1BA 2PVKA 4NM7A 4GK4A 2YAAA 3TJCA 5M4IA 2WAJA 1BX6A 3KRLA 4D9UA 3NYXA 4E3CA 2XM8A 3KK8A 4Q5HA 5I9YA 3F5GA 1TQPA 2YERA 5FXRA 3W2SA 4UMRA 4WSQA 3IOKA 4AZVA 3OF0A 4FOCA 1JVPP 3UMXA 3QX4A 1XHAA 2I1MA 4F08A 2UW5A 4HJOA 3W10A 4YPDA 4NJ3A 4FNYA 5IEYA 5D12A 4CFMA 4MX9A 3DXPA 3ORIA 4RIOA 2J0LA 2XP2A 2XNEA 2V22A 3T9TA 4BBFA 4FTUA 3IPHA 5BVKA 1KV2A 4FF8A 4RJ5A 4FG7A 4FSYA 4U79A 2WTIA 4FNXA 2GU8A 4NFMA 4OTGA 4OTDA 4RPVA 2ACXA 1PRYA 2ZB0A 2A0CX 4RVTA 3NIEA 3MVJA 4I3ZA 3IO7A 4Y5HA 2YM3A 2QOBA 1ZOEA 2GHMA 3TTJA 2PUPA 2WU7A 4YJSA 1FQ1B 4CKIA 5EW9A 4A4OA 1Q8ZA 1DM2A 2FA2A 1RDQE 2F7ZE 2C6DA 4J99A 1OITA 4KS7A 4I4FA 4LOPA 4QMMA 4AU8A 1PXOA 4F65A 5F9EA 4CLJA 1SNXA 3QBNA 5IU2A 3DJ7A 3OCBA 1WMKA 1Q24A 5HIBA 3U6JA 3HVCA 4X3FB 4CT1A 5CXZA 1ZARA 2BRBA 5BVNA 4X21A 1JOWB 3R8VA 5CANA 3WOWA 4NCTC 4UZDA 5E8XA 1H0WA 1OI9A 1R0PA 5I0BA 5H3QA 3I7BA 4XG9A 4FSUA 3B2WA 4ENYA 2GQGA 3Q52A 4X2KA 4ZLZA 4F1OA 3DZQA 3H0YA 2VX3A 4EK5A 5AV3A 4AE9A 2J0KA 3Q5ZA 4O0VA 4FTIA 1H0VA 3K3JA 3F82A 4L46A 4NKSA 4AA4A 4AG8A 3CIKA 3UO4A 3NPCA 4WUAA 3QZHA 2P33A 2R7BA 3BQCA 3DS6A 3LLTA 5IA1A 3NDMA 1H26A 3ORTA 4I20A 4PRJA 1Q3DA 4JAJA 4KSQA 1SNUA 3RK9A 3TNIA 4V0GB 3VBXA 4IZAA 3ZLSA 4PY1A 3ZOSA 2KULA 4M67A 2WMUA 2RFDA 1KSWA 1NA7A 2X6EA 1R78A 4D28A 4F7LA 4CZTA 1BLXA 4M8TA 3SLSA 3U51A 5CTPA 2OI4X 3PSCA 5AM7A 3WIKA 4RT7A 4UMPA 4U3ZA 4I0RA 5FM2A 4OBOA 1SVGA 5FTOA 3JPVA 3H9FA 3BLQA 2J5EA 1H25A 3A99A 2QONA 4D55A 3LM5A 2GPHA 4ZY5A 4GMYA 4BDCA 3ZC6A 2YLFA 2ZAZA 4IDVA 4O1OA 4UY9A 4JNWA 5IA0A 1WBPA 4LMUA 4NM5A 4C4IA 4U45A 3SRVB 2J6MA 5H8BA 4HW7A 3NIZA 2XNGA 2OBJA 3C5UA 3AOXA 5B2MA 2WIHA 5CASA 4QQJA 3FMJA 5AM6A 5BVEA 1YXTA 3KVWA 3G51A 3LXPA 4CQEA 3M1SA 4RA4A 3FSFA 4IX6A 2OKRA 3MY0A 4HGEA 4BDIA 2BIYA 4AN2A 4CKRA 3HEGA 3SOCA 2IG7A 2ITWA 3DLSA 4O7TA 2A19B 4UALA 4YMJA 4FKOA 4MBIA 3UPXA 3NW6A 3SRVA 3MWUA 4NZWB 4BZNA 2HXQA 3R7YA 4BB4A 1OB3A 4EWQA 1M52A 2B55A 1W8CA 2EB3A 3V04A 1AQ1A 2OJJA 3BI6A 4FYOA 3ZBXA 5JEBA 4X2JA 1G8SA 3PJ3A 2B9HA 2YZAA 3SHEA 5BUEA 3SVVA 4Z16A 2PY3A 3GU7A 4FI1A 3FAAA 1YWNA 5CF5A 2WHBA 4K9YA 3FMHA 1H00A 3QKMA 1NVSA 3MW1A 3LXKA 1B39A 1UNLA 3NCZA 5LVOA 1PY5A 4BYIA 4QPAA 4UBAA 4FEVA 3U55A 5HNBA 4DGMA 4F9AA 5A6NA 4C36A 1UU7A 4G17A 4TWNA 3CBLA 4WRGA 4RWLA 4KB8A 4CKJA 1R3CA 2JFLA 2WMTA 2DYLA 4QP7A 5AUZA 3U8WA 3UYTA 3FEGA 5CAQA 3PJ8A 1TQMA 1OGUA 2W1FA 4I0SA 4IE9A 3KVXA 2BRMA 4XP0A 2W9ZB 4J1RA 5C01A 4FV7A 4QTBA 1PF8A 4R1YA 4WOVA 3R71A 2G9XA 3R04A 2C3LA 4GL9A 1HCKA 4DITA 3BU6A 1UNGA 3R8PA 3VBVA 2CNQA 2ERZE 4JDIA 2HXLA 4O0SA 4I1ZA 5FLFA 3RAIA 5LVNA 2OO8X 2WTWA 5EW3A 4QMQA 4ZLYA 4GUBA 2FB8A 3BELA 2PMIA 4IANA 5K3YA 3UZTA 4ENXA 2WMAA 4BY9E 1OPJA 2X8IA 4QD6A 4ANBA 2PUUA 5L2SA 4GFMA 4YC3A 2CKEA 2BVAA 2WQNA 4PMSA 4CMTA 3UC3A 4RIXB 5IKWA 3QTZA 2NRYA 1ZMVA 4YJRA 4IB3A 3P23A 4O6EA 3EFKA 2EXCX 3VS1A 1O9UA 4I93A 4TRLA 5KZ0A 1GZ8A 3V3VA 1Z57A 2OFUA 4IXPA 3WZKA 4ASZA 4BCIA 5HO8A 1XH4A 1XR1A 5AUYA 2CHLA 3K54A 4MYGA 4BR3A 5IEVA 2UUEA 3MVMA 2PPQA 5EI6A 3CC6A 3PXQA 4YJNA 5M4CA 4JIKA 3PVBA 4DH5A 5HX8A 4XJ0A 2P3GX 5AV1A 4DEHA 3ZMMA 1JSUA 3FXWA 2OJGA 2W0JA 5CX9A 4CV8A 4X3FA 5JRSA 4YNOA 3ORLA 4DG0E 5F1ZA 2HENA 2W5BA 4ZMEA 1W98A 3CQWA 1YHVA 1NXKA 4H58A 1YDTE 3IOPA 3O0GA 4RIYA 2BILB 3F2NA 4AW0A 3S0OA 3AT2A 5CU4A 5E7RA 5CEKA 5IMXA 1UVRA 2VWBA 4FTCA 4IC7A 4FKVA 4QT1A 3ZLYA 4L44A 4G16A 4S30A 5E1EA 2FSTX 3V8TA 3QUPA 4FEXA 2CPKE 5CI7A 4CNHA 4F70A 3GQIA 3KXZA 3SG8A 2GTMA 2X81A 4A4XA 4G3CA 3VBYA 3MGYA 4EC8A 4ZTSA 5CAUA 3RPRA 5LMKA 4TWOA 2GNIA 4LRMA 5HNGA 3KB7A 2UVYA 3HYHA 2JDOA 1I44A 3SW4A 1Q4LA 2Q0BA 3D83A 2XK8A 3ODZX 4QMXA 4K8AA 4C61A 3R21A 2VTJA 4YZMA 3D0EA 4JRNA 4IIRA 4LG4A 4L68A 4RX9A 2YIYA 3TZMA 4PTEA 5E8SA 1URWA 2ZV9A 4QRCA 5EYDA 2VTPA 5IH5A 3ORZA 4V01A 1J3HA 3LQ5A 1GOLA 4DEEA 4E5WA 1KOBA 3W1FA 3FQEA 3W8LA 4O7VA 1SM2A 2ESMA 5HICA 4BI2A 3IW8A 4C4HA 3Q9ZA 5E90A 5HIDA 5I9ZA 1GIHA 3NUYA 4FSNA 1XO2B 3MFTA 3ACKA 3R28A 5EKNA 5HU3A 5TT7A 2I0HA 1MRVA 4QP2A 3L9PA 3D5UA 4NK9A 4TPTA 3E8DA 4FKWA 5CS6A 3N4VA 3DCVA 2FH9A 1IG1A 4IFCA 3F69A 3KKVA 5HCYA 2XRWA 2G2HA 3BYSA 3WYYA 3V8WA 2ETRA 4D2WA 5DH3A 4DINA 5J1VA 1FGKA 4RC2A 2JIUA 3OOGA 2G15A 1Q8WA 5IQEA 4RZVA 3LLAA 3VWAA 3KEXA 3IGGA 4J97A 4C62A 2R3JA 1F3MC 1KE6A 1PXMA 3CR0A 4FTJA 1VEBA 2C5XA 4WIHA 3UODA 5KO1A 5M09A 3OCGA 4XX9A 3R7VA 4KIPA 4F1TA 3NYNA 4ZIMA 4AXAA 4W4VA 3RAWA 4CV9A 4BWPA 2X2MA 2UZOA 5HD4A 5EHLA 4Q9SA 4Z7HA 3I81A 4H1JA 5HG7A 2XVDA 3BQRA 4MH7A 5EHYA 4YP8A 2IZRA 4RQVA 3R8LA 4NL0A 3MH0A 3OUNB 3WF5A 4C0TA 3W2CA 1ZYSA 3KRXA 5AA9A 4FICA 3FZRA 3V5QA 5EM8A 4TN6A 4BDFA 2X7GA 3KCKA 3RCDA 4IB5A 3ZFXA 3A7FA 4MD8E 3CGFA 4NIFA 4LGGA 3QQLA 2C6KA 4KS8A 2HELA 3QLGA 4WUNA 2WMVA 3EQIA 3RGFA 5LCKA 2YITA 4MCVA 4EQMA 3ZO2A 3A61A 4WNKA 3DXQA 3EN6A 3P5KA 5AIRA 3ZBFA 1PW2A 1VZOA 2X4FA 5HOAA 1FBNA 3FPMA 4O7LA 3EFLA 4XYFA 1P4FA 3KF4A 5DT3A 1OBDA 1ZYJA 3CS9A 2UW8A 2BTSA 3K5VA 5DWRA 3W33A 1YXVA 5HZNA 2PZIA 5FG8A 3OY3A 4AX8A 3OFMA 5JFWA 2JC6A 4FNZA 2HK5A 5DMZA 4XV2A 3LZBA 3AC2A 5JZNA 3MB7A 3D14A 4RVLA 4OTFA 3ZUUA 4BTFA 3CCNA 2QO7A 3NLBA 4FTTA 4PTCA 1PMVA 2C68A 1H01A 4XV3A 1ZY5A 4O7NA 5HORA 4L7FA 1ZLTA 3QQHA 3EMGA 3SAYA 4DFUA 4QMTA 3QXPA 3HECA 1UNHA 4IH8A 5C9CA 5CSPA 2W1HA 3COIA 4TTHB 3HRBA 5EM6A 3V5PA 1JBPE 4B8LA 3FLZA 5M08A 3DNEA 4O83A 5ETAA 3HDNA 3BE9A 2C4GA 4QYGA 4E5AX 5EM7A 4BI1A 3TZ8A 3ID6C 1SMHA 1YDRE 3KGAA 3NYVA 2CGVA 3CQEA 4GEOA 3CKWA 4PNIA 5C26A 4I5PA 5J9LA 3ZDIA 2R0IA 3BRBA 1APME 4BDEA 5J1WA 3QZIA 4GUEA 4FK3A 3COKA 5D7AA 3VUTA 1JAMA 2IO6A 4G3DA 1QPCA 3T3UA 4BGQA 3DXNA 4USDA 4AOIA 2I7QA 1LP4A 3KRRA 2R5TA 2VO7A 3FE3A 4DH1A 4JAIA 4ZTMA 5JGDA 4FTLA 4TW9A 4FSMA 2QNJA 2W1ZA 1OECA 4FKTA 4L01A 3LKMA 2YA9A 3I6UA 3OT8A 3QWKA 2OJ9A 1J7UA 4X6QC 2XIKA 2VWUA 2E9OA 2YM7A 3TNHA 5CQWA 4NU1A 3EN4A 3HMIA 4DF3A 3NS9A 2A27A 3C9WA 4ANOA 4FZFB 4EJNA 3GBZA 1AD5A 4WD5A 3OWLA 1Y6AA 4QO9A 4JX7A 3SKCA 3GFWA 5DA3A 3VQUA 1MQBA 5F95A 2QOLA 5HLPA 3ULZA 1W83A 3ET7A 2QR7A 5GZAA 3KA0A 5HG5A 3L9NA 4PDSA 3D9VA 3FL5A 4GK2A 4PWNA 4RFZA 4TYEA 2WTVA 3ANRA 3LJ2A 5E8ZA 5FXQA 3PXZA 4UWYA 5CAVA 2Z7LA 2WEVA 4QNYA 4BWKA 3KQ7A 4NM3A 4D0XA 1RQQA 4H36A 2Y6MA 1Q99A 2V0DA 3ZLWA 5HE1A 3BX5A 4NW5A 1XWSA 3FV8A 3F3ZA 3IDPA 4JRVA 4AF3A 3G15A 5E1SA 3NAXA 4FTMA 4AT4A 2BZHB 4BKJA 5ETFA 4JS8A 4CFVA 3PXYA 3A7GA 4XG3A 5E8TA 2DS1A 1SYKA 4KD1A 4YTFA 3TNWA 3TV6A 3FUPA 4JX3A 5DG5A 3RK5A 2Y6OA 4YJPA 2CNUA 5LXMA 1B6CB 2ZVAA 3FY2A 5LOHA 4YZNA 4EZ7A 4MNFA 2BKKA 4JBOA 2XCHA 1Y6BA 2W96B 2WMWA 2UZLA 3BCEA 3PPJA 4BHNA 4OGRA 2UZEA 4HVHA 3QQUA 2ZJWA 4F9WA 4EH3A 4PL3A 4ANMA 5IA5A 3RJCA 2IVTA 4CFNA 4DH8A 1VYZA 2GNGA 1STCE 2AUHA 3L8XA 2P0CA 4FIJA 4R1VA 4W4XA 1FINA 4BC6A 4BDAA 3OC1A 3TNQB 5I4NA 1YWRA 2Z8CA 2PZRA 1H1RA 1RE8A 4M0YA 2R3GA 1P2AA 4TYGA 3BHHA 3OHTA 4OTWA 5HG8A 2XRUA 4MBJA 1QPJA 1TVOA 4ITHA 4KKGA 4WNOA 4BGHA 2GHGA 1KOAA 3LJ0A 5DR6A 3ETAA 1CKJA 4FEQA 5EDQA 3T3VA 3QKKA 3OCSA 4ACMA 4BICA 4E6AA 5EYKA 3HV7A 3JVSA 4FV3A 2VWVA 4G31A 4O2ZA 4E4NA 1Y8GA 4N70A 4HGLA 1FVTA 1PMUA 4OT5A 3NUXA 4G3EA 2BAQA 1BL6A 2UW9A 1OIUA 4GVAA 5CLPA 4FA2A 4A9SA 3RVGA 2PU8A 1WBWA 3LW0A 4HPUE 3DPKA 4GJ3A 3E87A 1H28A 3HV5A 2ZDTA 5AR5A 3UG2A 2GQSA 4CT2A 2V7AA 4RLLA 2YM4A 3OBGA 5KX8A 4QPSA 5E4HA 4RSSA 4FIHA 3V5WA 3OWJA 4WA9A 3R8UA 3DKCA 2I40A 1KE8A 2YJRA 4DYMA 2WOTA 1JKLA 4G5PA 2GCDA 5J79A 2X6DA 5AP4A 5L6OA 2V7OA 3N4UA 5M4UA 5GNKA 5G1XA 4C58A 4CRLA 3A2CA 2HWOA 3FBVA 2IPXA 1M7QA 2PWLA 5CALA 2XIRA 5JT2A 2VN9A 1LR4A 3CY2A 3I0QA 4G6LA 4F6SA 3EQCA 4ANLA 3A8WA 4JXFA 3VHKA 2X2LA 5ANGA 3VQHA 1MRYA 4EHZA 3KMUA 3C4FA
chains in the Genus database with same CATH superfamily
1CKIA 2JDRA 3QCQA 3RPYA 4EJ7A 4FV5A 4FSQA 2FSOX 2PTKA 3MIYA 4PPBA 3ITZA 3FZ1A 4L00A 1CM8A 4IVBA 4BDDA 3WZJA 3P86A 5LWNA 2ZYBA 1PXNA 3EL8A 3NGAA 4JG8A 4U97A 2YAKA 4HVIA 4E26A 3R63A 3UNKA 4O38A 5CI6A 3DLZA 3ZH8A 4P5QA 4D1XA 4LUDA 5CVHA 4F7JA 3RZBA 3PUPA 4CMUA 3TKHA 4TYHA 4FL3A 4FGRA 3ZYAA 3PY0A 3FDNA 4G5JA 4OBPA 1EH4A 3WF8A 1UKIA 3LFEA 2NRUA 2YACA 4NW6A 1NT2A 3RTPA 1KE9A 4TL0A 4K2RA 2C0TA 2XYUA 3E62A 3FHIA 3LCDA 2UW3A 3FMEA 4ZSEA 5A46A 3QWJA 3VS4A 2UW6A 5CU2A 4DBNA 3FMLA 3FQHA 1S9JA 2XK9A 3CY3A 5FEEA 5BMSA 4YTHA 3GFEA 3NNXA 3W2PA 2ONLC 4CMOA 1P14A 3EB0A 5E8UA 3QL8A 4JT3A 4ANQA 4D0WA 3DTCA 3UQFA 4AN9A 3ANQA 2XNMA 3OVVA 3P1AA 2GS6A 4J53A 3QQJA 2V5QA 4JDKA 5IQGA 1XH6A 4EYJA 5CSHA 5AFVA 4L3JA 3PWYA 1IAJA 4DT9A 4QQTA 3DAEA 3SW7A 3EHAA 4M13A 4ZY4A 4JQ7A 4U5JA 3TEIA 3COHA 4I5HA 4O0UA 4BKYA 5EG3A 2FYSA 4ZXTA 2XBAA 3DQWA 3R6XA 3QZFA 2BFXA 4MBLA 2LAVA 5JFXA 2NO3A 3HV3A 3VUGA 4DE4A 2P4IA 2YCRA 3C4WA 3B2TA 4EOPA 3RPVA 2PL0A 2YIXA 4QOXA 2R3RA 3KXXA 3MPAA 5FBNC 3PZHA 4CYJA 4FTAA 1U4DA 5K0KA 3T9IA 1IA9A 3RBWA 2X7FA 4LV5A 2XS0A 2FSMX 2IWIA 2J5FA 4RFMA 4I5CA 4JBPA 1OL6A 5ACKA 3ZO1A 5JKGA 1BL7A 5C8NA 4Y83A 2C6TA 4YJOA 5AP0A 2XJ2A 3KXMA 2WMRA 2W06A 4MXCA 4ACGA 3HUBA 3MH2A 2BDFA 1JKTA 3EYGA 4JLCA 4QMLA 2QOCA 5KUPA 1U5RA 2WGJA 3V8SA 5HCZA 2ETMA 2CNVA 4R77A 4F0IA 4IAFA 3EOCA 1GZKA 2C69A 1TZDA 4FBXA 1H27A 4FSRA 4HVDA 4KUJA 3RNYA 3S00A 4WSYA 3TACA 3HA8A 5TKDA 3JXWA 5EQPA 3C13A 4QYFA 2R2PA 3PVGA 2IF8A 5BV3A 5L4QA 4CTCA 2C6LA 2XH5A 3R83A 2XA4A 5DYJA 2WD1A 4BN1A 4CCBA 3S1HA 1GZNA 3BYOA 4D4YA 4DT8A 3UTOA 3GU6A 4GSBA 2QODA 2Z7QA 4IM0A 4AOJA 3RALA 1LUFA 2GHLA 3CP9A 4O2PA 5ANIA 3G90X 3MH1A 1M17A 2JEDA 3BEGA 2JKKA 4LL0A 3ULIA 1PXIA 3BHVA 5C4KA 2PHKA 2WTKB 4I6HA 5DR2A 5E91A 5M51A 4F09A 2F2CB 4UXQA 3PTGA 5HX6A 2QOHA 3RINA 1W0XC 4OUCA 4QMWA 4EQCA 5HBHA 5CZHA 4UWBA 3DTWA 3FLQA 1BUHA 4ITJA 4W9WA 1YI3A 1OIQA 4MD9E 4EUUA 3SC1A 3LFQA 4DHIB 1JKKA 1W2CA 1OL1A 4R3RA 2WO6A 5KHXA 3B8QA 2PK9A 2ZM3A 3GUBA 5IH4A 3MFRA 4C4FA 4CZUA 2Y8OA 3FLNC 4E5BA 1PKGA 4PL4A 5EKOA 4M66A 5H8GA 4GT3A 4M97A 2XZSA 2DQ7X 4EI4A 1HOWA 4EORA 3AKKA 2C6OA 5JN2A 4O82A 4IMYA 4MEDA 1OUYA 3GCSA 2QURA 3GQLA 3HV4A 3MA6A 4KKHA 4PMMA 4WNMA 4D5KA 4AN3A 4HGTA 5JFVA 4ZTQA 1XH8A 5DT4A 1H24A 1S9IA 4KWPA 2NNWB 3E63A 1GJOA 1UA2A 4G1WA 3SXRA 5M56A 1LPUA 3FKNA 3A62A 4FTNA 5BUJA 2BUJA 4HNFA 3SOAA 4G3GA 4FTQA 1OUKA 2CGXA 3C50A 1OL5A 2O3PA 4Z55A 3NW7A 3Q4UA 4IVAA 4E4LA 5I3RA 3DGKA 2JAMA 5L2QA 1XH5A 4GS6A 3L9LA 4BDHA 1NVQA 3KFAA 5AV4A 1A48A 3HLLA 1OL7A 4Y95A 3F7WA 3OW3A 4APCA 2Y4IB 3PXFA 5ACBC 2RSVA 1E1XA 5CYIA 4WRSA 2QC6A 4FIGA 1FVVA 2QKRA 5ANDA 3S95A 2F7EE 4I22A 3E3BX 2BDWA 5H2UA 3FSKA 3P7CA 1V0OA 3K5UA 4F63A 4DDIA 4IADA 3F3TA 1OZ1A 3PP0A 5EI8A 5JGAA 3ATSA 3G5DA 5CEOA 2QD9A 4B99A 3PLSA 4GV1A 4CSVA 4EC9A 2ITTA 2OH0E 4U81A 5DE2A 1YXUA 1FMKA 1QCFA 3VS3A 4MUQA 5IA3A 5L8LA 4L8MA 3VBWA 4DEDA 3EIDA 3P7BA 4QMSA 5E8YA 2XANA 3NUPA 3Q4ZA 4IWDA 4BKZA 2O2UA 3Q2JA 3VS0A 4C4JA 4IVDA 4XG4A 2JKMA 4O91A 2JFMA 5HEZA 4E73A 2BFYA 5KMMA 3GU4A 4RRVA 5HVJA 3OUKA 4QP1A 4CEGA 2B9FA 3L1SA 4DGOA 3C0IA 4EOMA 4AZSA 2VTIA 5AWMA 3OWKA 2Z7SA 1JSTA 4ZAUA 4B4LA 5IA4A 3NRMA 4YHTA 3V5TA 3GC7A 4C7TA 4QNAA 5GZ8A 2XALA 3UIUA 2JAVA 5KE0A 4E1ZA 3BLRA 3FZPA 4XG8A 5BVOA 2ZMDA 3ALOA 3HAVA 2XNBA 2XK7A 2IN6A 3O50A 3IW7A 4EH8A 5M07A 1CSNA 4O4BB 1ZRZA 2Z02A 4DFNA 3DK7A 4OT6A 4YPSA 3EH9A 2QHNA 4IHPA 4DHJA 3KULA 3HGKA 1CKPA 4EZ5A 4YLJA 5EOBA 4NT4A 2W5HA 4PF4A 4LFIA 2J9MA 3VF8A 2EXMA 4TNDA 3ZM9A 1NVRA 5IQHA 4BGGA 3V5JA 3FMKA 1REKA 5DI1A 5H8EA 1OVEA 4Y85A 4AUAA 4E6CA 4FSZA 3D5XA 3PRIA 1Y91A 1BI7A 4U8ZA 4QPMA 1ZXEA 3VUDA 3BYMA 5L6PA 4QP3A 4YR8A 4BRXA 4O7WA 2VGPA 3HNGA 3QX2A 4FRFA 4ALUA 4XH6A 4ANNA 2EVAA 3MBLA 2F7XE 3NEWA 4XP3A 5FUTA 4C3PA 3H10A 4FKSA 4Y46A 4RWJA 4ZTLA 2OU7A 2CKOA 4L52A 2WZJA 4P5ZA 4GRBA 3AKLA 1ZYLA 2Y7JA 4O0XA 3BHUA 5DFPA 3AC4A 3R9NA 3KXHA 3NW5A 3ZONA 4D1SA 1Q8UA 1PKDA 4AQCA 4NM0A 3BL7A 4F0FA 2WQEA 2DUVA 3O17A 3Q6WA 3PZEA 5F20A 4GIHA 3DDPA 1Y57A 4P7EA 2CN8A 4YJQA 3KC3A 2RF9A 4O7YA 2OW3A 4LV7A 4M84A 3HX4A 5D11A 4F6UA 3QTUA 4RX5A 2UW4A 3K3IA 3MVHA 3W55A 4EOJA 3ZSIA 5LWMA 4RJ3A 1CMKE 1HCLA 2BZIB 2EB2A 3OXZA 4GIIA 3DY7A 4C57A 3UQGA 2BMCA 3DA6A 3PA5A 4GFGA 2W4OA 1YXXA 4RIXA 4AGDA 4QTEA 3N4TA 3VBQA 1QPDA 4MXAA 4E8AA 4DCAA 2UVZA 3WARA 4TY1A 3BEAA 5KMIA 4QP4A 4RJ4A 4AA5A 4NSTA 1YVJA 3POOA 3QGYA 5IDPA 1T45A 4EOSA 4F78A 1QPEA 3DT1A 2Y9QA 4BCJA 2CLQA 3UDTA 3VO3A 3FC2A 3H3CA 4EOIA 4YSJA 2E9UA 2UZTA 4MTAA 4PPCA 2AYPA 3QD2B 2BRGA 4QMNA 2R3QA 2VTRA 4PP9A 4IEBA 3WE8A 5HO7A 2BR1A 3JY0A 3ACJA 4JL9A 4UZHA 3UMWA 3W2RA 2H34A 4PP7A 4J71A 5CNNA 2EU9A 4DEIA 4F9CA 1YKRA 4ANSA 3FLSA 2JBPA 2OJFE 1XBCA 2JLDA 4U43A 3UC4A 2P2HA 5HLNA 2FO0A 4BCNA 2OLCA 2PYWA 4JDHA 4J98A 4BCOA 2WTDA 2XEZA 3UQCA 4QTCA 5ETIA 3ZRKA 3W0NA 3LFDA 3AC3A 2QU6A 4H39A 4JVGA 1OIRA 4XMOA 2VX0A 3FWQA 3W2OA 2WQMA 1H07A 3C51A 1QMZA 5FQDC 4QDEA 5ICPA 2VWZA 4O1PA 4F1MA 2OICA 1Z5MA 2UZNA 1IEPA 3EKNA 4U44A 3VUHA 2W1IA 2CJMA 4P90A 4H3PA 5K9IA 5KHWA 3DB8A 1YDSE 4PX6A 4J52A 4M12A 4G3FA 3MESA 3RWQA 2HZNA 4DFYA 3UJGA 3W8QA 4O0YA 3VVHA 1MP8A 2OGVA 4EH9A 4FIFA 4F7NA 2HYYA 4P2KA 4DEBA 2ITQA 5HI2A 3EJ1A 4J8MA 4R6VA 5AUVA 3HA6A 4I6BA 4RX7A 1ZYDA 1DS5A 2CLXA 3QQFA 3SX9A 1VLRA 3ELJA 3RI1A 4AFEA 3R7EA 4FEWA 4HGSA 3NMUF 5CF8A 3PXRA 5AX9A 2ERKA 3E8CA 2VV9A 1GNGA 3BGQA 3LCSA 3VNTA 4MXOA 3S2PA 1WBNA 2QOIA 4OAUC 4IZYA 3RK7A 4MQ1A 2EWAA 4R5YA 2XK3A 1PXJA 3BLAA 2WTKC 1UU9A 2R3IA 3T8OA 3MPMA 3OG7A 5BYZA 4B0GA 4ERKA 3P78A 4RVKA 3PJ2A 2OG8A 4I92A 4DAWA 4KABA 3R9OA 2R3OA 1ZWSA 4A9TA 3D2IA 3RMFA 2C5YA 3TTIA 3EWHA 3BU5A 3U9NA 4BIDA 3MS9A 3WF6A 3OEZA 2GFSA 2OZAB 3I4BA 3L8PA 1GIJA 2VTSA 2X0PA 2QO2A 2VWWA 3M11A 2YIRA 4NJDA 5AR8A 4AXEA 2J2IB 3Q53A 4RIYB 4DH7A 5LMBA 2UZUE 4QTAA 1FOTA 4B8MA 3OXTA 2YFXA 5GJGA 3MI9A 4KIKA 3NYOA 4Y8DA 4C38A 2OIDA 3MJ2A 1FVRA 4IWOA 1YI6A 5AP5A 5AR3A 3CD8A 1YHSA 5LARA 4XOYA 5KMNA 3BWJA 2IVUA 4IX3A 2Q0NA 4ORKA 3D5VA 4IM2A 3VF9A 4FTRA 5HE3A 2GDOA 4XP2A 4CD0A 3WE4A 2WEIA 3VIDA 5AADA 3VW6A 4Z9LA 4EUTA 3WZDA 2RG5A 5E92A 1WZYA 3U6IA 1UWJA 3HRCA 4FKPA 4GU9A 5CEQA 4APPA 5JQ8A 2YHVA 2XKEA 4HNIA 4L67A 4NTSA 3PSBA 4O0TA 3C4CA 2I0VA 1TKIA 3O51A 4EQUA 4KINA 4O7SA 2YCFA 4EK4A 4CQGA 5HVKA 3I0OA 1J1CA 4FT5A 1REJA 5EDRA 3MYGA 2XCKA 1BI8A 2QLUA 3GVUA 4HCUA 4JR7A 2GTNA 2XF0A 4C35A 2GNFA 2YEXA 3HP5A 2BZJA 5HTCA 3HMOA 3IW5A 3UIMA 1ZOGA 1WVYA 1JQHA 3F61A 1M7NA 4BDKA 5IPJA 3HKOA 3P0MA 3E7OA 5KNJA 3UIXA 1E1VA 4FKQA 5EYMA 2F2UA 5EFQA 4MF0A 2RFEA 1U54A 5HHWA 3I79A 4AS0A 3QF9A 4YNEA 3ZUVA 4HYIA 4OAVB 4F6WA 3IS5A 3IECA 3O96A 1P4OA 3PLAE 3EQBA 2BDJA 4LRJA 3KY2A 2X4ZA 4FE2A 3EZVA 1J1BA 2H6DA 4MKCA 3KMMA 5EK7A 3QAME 3R2BA 1FMOE 4A7CA 2P55A 1O6LA 1LEWA 5D7VA 4D2TA 2CGUA 4FT0A 1SVHA 5J9ZA 3IDBA 3Q5IA 2W99B 5CY3A 2ZMCA 3BWFA 4E6QA 3ODYX 4D4RA 1G8AA 4BCGA 3L9MA 3VW8A 4EKLA 2WPAA 5FXSA 5CSVA 2YWPA 3ORNA 1UU8A 2C6IA 2ITUA 3FI8A 5A4LA 2QG7A 4F9YA 3VUKA 2GNJA 2J51A 4ACDA 4DGGA 3EQRA 4WT6A 5CF6A 4ASDA 2G2FA 3GC8A 2JITA 3COMA 3WYXA 5ANEA 2OXYA 2HCKA 2B9IA 5AP6A 4BF2A 2WQBA 3LFAA 5CAPA 2VU3A 3Q4CA 3VC4A 3A8XA 4C33A 3O7LD 2I0YA 3BBWA 4MQ2A 5CXHA 2PVMA 4O6LA 4DCEA 2X7OA 3QQKA 2XK4A 3RHXA 3VS5A 3OP5A 3NVKI 5DT0A 4OBQA 4YUQA 3LQ3A 4IVCA 1GAGA 4YLKA 5JMSA 4D5HA 5K4JA 4EKKA 3KRWA 3QCXA 4XNEA 4BZDA 3SQQA 2JDTA 2O65A 4X0MA 3JVRA 4I5MA 4Z7GA 3P7AA 4W4WA 3LFBA 3ZC5A 3IONA 4U6RA 3NUSA 2A2AA 1KV1A 3ALNA 4LMNA 2ZM4A 2VO6A 2FSLX 4W8DA 3V6SA 5J9YA 4LM5A 2IVSA 2WFYA 3MSSA 1O6YA 3NUUA 2F49A 2HIWA 5ANJA 1ZY4A 2UZVA 4U0IA 2IW9A 2BTRA 2IW6A 3DAKA 3TM0A 2R9SA 4WKQA 2Z60A 3AXWA 5DR9A 2QQ7A 3JUHA 4ZP5A 1A06A 4FG8A 3Q9XA 1RJBA 2F9GA 4IQ6A 4AT5A 4E4XA 5C8KA 3JR1A 3OEFX 4N0SA 4EEVA 4CCUA 4F4PA 4AP7A 4HCVA 2YABA 3MJ1A 5J7HA 4DDGA 4ACHA 4HYUA 4MNEB 3IDCA 3ZHPC 4FT7A 4U3YA 2C1AA 3C0HA 3Q4TA 1BYGA 2XYNA 3EN7A 3QLFA 3K2LA 4DFLA 4B6LA 4KRDA 4MXXA 4QP6A 4LUEA 3F3WA 3P79A 5L6WL 4PUZA 3CEKA 2Y0AA 3E8EA 3BZ3A 3QYZA 2X0OA 3PG1A 3ZSGA 2ZDUA 3KK9A 5AV0A 5J5TA 2JKQA 4MK0A 4AT3A 3JY9A 4XUFA 5AR7A 4FV4A 1LEZA 3EL7A 5CT0A 2QU5A 3ENMA 4TWPA 3KU2A 4BJJB 3DFCB 3AC1A 2WXVA 3AD6A 4FNWA 2OIBA 4FKGA 5I9WA 2W5AA 3GU5A 4A4LA 2HZIA 5E9EA 3QTXA 4HZSA 4X6RA 2NPQA 3P08A 4ZZMA 3S4QA 4E7WA 4ZLOA 4JQEA 4FVPA 4YBJA 3OD6X 2JKOA 5GINE 4CG8A 2REIA 2W7XA 3DBQA 3DJ6A 5DRBA 3SDJA 4C37A 5IUGA 2WMSA 4USEA 1YOMA 2FUMA 3R22A 3QA0A 1YOLA 5B2KA 4L3PA 1XMMA 3ZFMA 3R7GA 4NTTA 4QMPA 1U59A 3OCTA 4MF1A 4QYHA 4AW1A 1Q5KA 5TO8A 4CFFA 4D2PA 5IDNA 2G2IA 1IASA 2J0JA 3WF9A 4EOOA 3ZCLA 3ZTXA 1VR2A 4ASEA 4AW2A 3EN5A 1O6KA 2WNTA 4V05A 4JR3A 2JD5A 5D41A 5IUHA 1PXLA 2B4SB 3DJ5A 4IWQA 4XV1A 5GJDA 4Q9ZA 3KREA 3M42A 3UZPA 2XKDA 3D7ZA 5JZJA 2GQRA 2PULA 4QDVA 3MVLA 3SGCA 2HZ4A 5KBQA 5FEDA 4KA3A 2PE2A 4CLIA 2C0OA 4D9TA 1T46A 2XK6A 4CFUA 4H05A 4BDBA 3RPSA 2UVXA 3GCQA 1ND4A 3FXZA 2JIIA 4FT3A 5EI2A 1Q62A 4ZEGA 3FY0A 3OS3A 3LM0A 4ZY6A 4MD7E 3W2QA 3LXLA 3RAHA 2YCSA 5B2LA 3EKKA 4QMYA 4B7TA 3FXXA 5HTIA 4G9CA 1F5QA 1U54B 4K6ZA 4ASXA 3UVRA 2OFVA 4BI0A 1PHKA 3KN5A 4KIKB 5IQCA 1FGIA 2OZOA 4LOOA 3Q96A 5L8JA 5JH6A 4X2FA 3TDVA 2WMQA 4MVFA 1OPLA 3BE2A 1ATPE 3LFFA 4MXZA 2ZM1A 4J7BA 2PVLA 3WZUA 4C02A 5CSWA 3HMMA 4KBKA 4GT4A 1IA8A 5BMMA 4C59A 2PVFA 3HZTA 5C03A 4TWCA 5D1JA 5AAGA 4LDTA 3R01A 4OW8A 1Q61A 4UMTA 4YHJA 1L3RE 3I5NA 3R8ZA 2QVSE 2R3FA 3QFVA 3ENHA 3EFWA 5HBEA 3F66A 3W0SA 3CJGA 2F4JA 2WKMA 4FTKA 4FUXA 5DOSA 5TR6A 3BL9A 4FG9A 5CWZA 4RA5A 3IG7A 4S33A 4FMQA 3DBFA 3RHKA 4EHGA 2I6LA 4KAOA 4E6DA 4W4YA 4N57A 3CPBA 4CFXA 2B9JA 3QRUA 4FKIA 3ORMA 4QMUA 4RGJA 4RX8A 4DBXA 2QKWB 2V55A 3TIYA 2NP8A 3EQFA 4L42A 3GU8A 4FV9A 3QTIA 4ZOGA 4EYMA 3V5LA 2XNOA 3R02A 2PMLX 1QL6A 3PE1A 4CVAA 5CU0A 4FZDB 4L6QA 4PTGA 4ZS4A 3LPBA 4GK3A 2HY81 4BTJA 2J7TA 4NFNA 4RMZA 4JOAA 2C6MA 2OIQA 3EQDA 1OPKA 2CCHA 3A7HA 5BQ0A 1K2PA 2X39A 3QZGA 4O0WA 4QTDA 3AD4A 3CLYA 1TQIA 4FUYA 4BCHA 5K4IA 2W1EA 2BHHA 2HOGA 2WELA 3MN3A 4RBLA 4ZJIA 3DV3A 3ORPA 4LGDA 5J5SA 1U5QA 4MAOA 4KIOA 5M06A 1PYXA 4EK8A 2BPMA 3RM7A 3DOGA 2CSNA 3Q9WA 4AW5A 4XG2A 3LAUA 5HG9A 1URCA 1GY3A 2O5KA 4GW8A 3ZRLA 5HVYA 5FTGA 3UGCA 3U54A 5D9HA 3NUAA 4EH2A 5AIKA 2B52A 2E9PA 4ITIA 3N51A 3MTFA 3PRFA 4EH4A 3EQGA 5I5ZA 4D4VA 3UZRA 3U87A 4IFGA 1AGWA 2W1DA 3FI2A 3R0TA 5M44A 5K5XA 3DKFA 3GC0A 3NUNA 3LFNA 2PVYA 4TKSA 4MNEA 4YGAA 1YOJA 2ZV8A 4BZOA 2ITXA 4F64A 2Z2WA 3ORXA 4YZCA 2OJIA 4FV8A 2R3NA 4FZ6A 3TMOA 3PVWA 3HP2A 1W2FA 4H3QA 4X2GA 1M14A 4WG4A 3MB6A 4PMPA 2C47A 4LRKA 3DAJA 2BAJA 4L3LA 1G5SA 2G01A 3MTLA 5CSXA 4IAAA 2VRXA 3BU3A 4DFZE 1ST4A 3ZM4A 2BCJA 3BHYA 3BGZA 3QC4A 4AZFA 4IDTA 4RJ8A 4QP9A 2B1PA 1PXKA 4E93A 1OKZA 5AP7A 3F5PA 3D4QA 3TZ9A 3BIZA 4IAIA 1ZAOA 4BTKA 5TE0A 1Q97A 4RZWA 1P5EA 5DGZA 5T6KA 3GOKA 5AR2A 3MH3A 3O8TA 5LQFA 3QRKA 4FKRA 3VN9A 2OWBA 2X0QA 5AP3A 3FZTA 4A9UA 3LJ1A 4G34A 4L45A 4XHKB 4U7ZA 1Q8TA 4ZTHA 5AUTA 5LVPA 5C8MA 4I6LA 3H4JA 4O96A 4YJVA 5EW8A 4BWXA 3ZLXA 1Z9XA 2X0GA 4QMOA 4ZSJA 3KMWA 5DN3A 5CEPA 1UU3A 5AV2A 1KUTA 2QHMA 5AMNA 3VRZA 1W7HA 4BCMA 2UV2A 1JLUE 2YCQA 5CVGA 3WIGA 2UW0A 3OT3A 3QHWA 3DK3A 3KXNA 4HZRA 4HVGA 3LQ8A 5KMKA 5AR4A 1KE7A 1ZYCA 3OZ6A 3O71A 3GC9A 3S3IA 5HIEA 5J8IA 1M2RA 3F9NA 3ZEPA 1GIIA 1V0BA 3R1YA 4HVSA 4M15A 4RIWB 5FBOA 3HAMA 2YLEA 5A4QA 4I94A 3FI4A 3ROYA 3Q04A 3PPZA 2QR8A 3TWJA 4EH7A 3LIJA 4I23A 4M69A 4C3FA 4DGNA 3FMMA 3W32A 1J7LA 3TUBA 3W18A 3G2FA 3O7LB 2XBJA 2VTQA 3AMBA 4O4FA 3H30A 4ZTNA 4WBOA 2GS2A 2GNHA 4IJ9A 4UB7A 1XBAA 5ANOA 2PMOX 3CE3A 4V0GA 4USFA 1YQJA 4M3QA 3HUCA 5FTQA 3LFCA 3GT8A 2VNYA 3II5A 3UNJA 3R7IA 4M7IA 4E20A 4PL5A 2VTMA 2QI8A 3FPQA 3FHRA 5IH6A 2VWXA 2H9VA 3WBLA 5BUIA 4O7ZA 3QQGA 2BROA 1V1KA 1MQ4A 3QCYA 1OM1A 5DHJA 3HRFA 3PXKA 2IW8A 2WU6A 4EH6A 4IC8A 4UWCA 4PDOA 3RAKA 3R30A 2CKPA 2YZLA 3QA8A 3TNPC 4OTHA 1PMNA 5IG1A 5CVFA 4J8NA 4AE6A 4N6YA 4BCFA 3GCUA 4I21A 4Y73A 2YDKA 5EQEA 3ZO4A 1J7IA 4IX4A 3TV7A 3NVMB 2WOUA 4FK6A 4AGUA 3RCJA 4AXFA 4XRLA 4FL2A 4L9IA 1ZMUA 3QGWA 3IKAA 5BPYA 1WBOA 3C4ZA 1YXSA 3QD3A 2G1TA 5IEXA 5C1QB 2YM8A 5HGIA 5TF9A 4G9RA 4RG0A 3ZRMA 3UOJA 2ZV2A 1OKVA 2Y4PA 4UEUA 4XRJA 5H9BA 3AMAA 4K77A 3LMGA 3LOKA 5DIAA 2EUFB 3LFSA 4C8BA 4EHEA 1WVWA 1PMEA 2C6EA 4S32A 3FLYA 3FZOA 5M55A 5AAFA 1OGYA 2QLQA 1BKXA 1Q41A 3F5UA 3BLHA 4AWIA 2YDIA 2VAGA 5KCVA 1PXPA 4QMZA 3G0EA 5FM3A 3IK3A 2W4KA 3LHJA 5D10A 3MFUA 4A9RA 5DRDA 1WBTA 2ITYA 2ITVA 4LYNA 3H0ZA 2BRHA 1XJDA 3AMYA 3R7UA 2J90A 4BTMA 4AZTA 3A4OX 3ZZEA 5HESA 3HDMA 2O64A 5DNRA 4C2WA 3QUEA 4D58A 2BHEA 5CEIA 4C4EA 2W1GA 4UMUA 4IAYA 1XKKA 5IZFA 3VJNA 2QOKA 2IZTA 4NIFB 3TUCA 2XB7A 3FL4A 3LE6A 3A4PA 4K33A 4P4CA 4UYAA 2X1NA 5GHVA 4DN5A 3D7TB 3NX8A 1JPAA 5IUIA 3AKJA 3IW6A 5AJQA 2C0IA 3ROCA 5M57A 2PUNA 4XS2A 2RKUA 2VNWA 4OR5A 3NAYA 1YWVA 5FEQA 1KWPA 4TZRA 4D2RA 4AACA 4S2ZA 2RFSA 2ZOQA 3MDYA 4IW0A 1ZZ2A 4I0TA 4JMQA 3W16A 3I7CA 5IQFA 5A6OA 2E9NA 2CKQA 4O81A 4XOZA 2ITZA 2Y4IC 5HLWA 4DG2E 3FQSA 4OTPA 5CZIA 4FSTA 2WB8A 1R0EA 3L8VA 1DI8A 4FT9A 1PJKA 3QRTA 3TJDA 4BCQA 2VTNA 3TN8A 5EHOA 3DBEA 1H08A 2PE1A 3PIXA 4FSWA 1ERKA 2W1CA 5FGKA 3GXLA 3RP9A 3UVQA 3AC8A 2AC5A 3OY1A 3DK6A 4R5SA 3A7JA 2Z7RA 4FTOA 4NYEA 2Q83A 4TT7A 3AG9A 3U4WA 3C4EA 2OF4A 3ZU7A 3QTQA 4EH5A 1WAKA 2OF2A 3R9DA 3U9CA 2YWVA 2XKFA 2XJ0A 4GCJA 4L7SA 2O63A 4EBVA 3NR9A 3E5AA 4DTKA 5HBJA 2B0QA 5IA2A 4D1ZA 5K0XA 4FV1A 3UPZA 3ZEWA 2QOOA 1BMKA 4HPTE 2E9VA 1JSVA 2UZDA 4DHFA 3QUDA 2LGCA 3UYSA 4DFXE 4CRSA 3OOMA 3Q9YA 4YC8A 1K3AA 3RPOA 3NSZA 4M14A 3VJOA 3FMNA 4CGAA 2YM5A 1YI4A 3F88A 4JG6A 3TZ7A 3UE4A 5TOZA 3AGLA 4AGWA 4FODA 4BFMA 3GI3A 3DBDA 3H9OA 3H9RA 4ZZOA 3O23A 4O86A 3OBJA 2EXEA 4JJRA 4QYEA 4ALVA 5LVMA 4YLLA 3PY3A 2ITNA 5A14A 3NWWA 3EQHA 4UXLA 3I6WA 3HMNA 3QC9A 3QTSA 3GCVA 3PJ1A 4WHZA 3VAPA 3RZFA 1WCCA 2R64A 4K18A 4I24A 4DLJA 4O84A 1ZMWA 4FVRA 3QKLA 2QOFA 1WBSA 2H8HA 4WNPA 4ERWA 3QTRA 3CXWA 3ZO3A 1YHWA 4G2FA