3THBA

Structure of plk1 kinase domain in complex with a benzolactam-derived inhibitor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
287
structure length
287
Chain Sequence
EVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKVLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PLK1
publication title Discovery of a Potent and Orally Bioavailable Benzolactam-Derived Inhibitor of Polo-Like Kinase 1 (MLN0905).
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 287
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2011-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3thbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3thbA01
2CLQA 3FMLA 5FD2A 3NIZA 3MH3A 4J8MA 3A2CA 5J7HA 4EHZA 4YP8A 5DYJA 3AT4A 2GFCA 4ZLYA 3QCXA 4EOKA 5M09A 3MPMA 4CMUA 4RIOA 4EHGA 4F7NA 4O6LA 4GK2A 4N4SA 5E90A 3PSCA 4IDTA 2XKEA 5I0BA 1OBGA 1U59A 2BFXA 4IWDA 4D9TA 3MTFA 3BEGA 1O6YA 4DCEA 5CXHA 4A4LA 1YWNA 5EHYA 5HHWA 3VS4A 4H1JA 3ZBFA 2BFYA 5HNBA 2R3RA 3SX9A 3D5UA 2JKQA 5EYKA 2QOBA 1XBBA 4DGNA 3NZ0A 3GXLA 5CF6A 2R9SA 5T6KA 3MA3A 3PFQA 3UOKA 4MX9A 4RWKA 5C8NA 5ANJA 3UVPA 2CPKE 2E9PA 2H9VA 3QGWA 4F7SA 3CD8A 3PE2A 3POOA 3OD6X 3PPKA 3ZBXA 3DKOA 4R3RA 5IUGA 5KMLA 2YM8A 1BKXA 1R0EA 4UV0A 5I3RA 3S00A 3GNIB 5EKNA 4K77A 4AAAA 5M07A 4K0YA 1YHVA 4RIYA 4AN3A 3NAYA 4BDKA 5J1VA 4W9WA 4G6LA 4CFMA 4O2ZA 4AU8A 1OECA 3PWDA 3R83A 4L43A 4DFBA 2YDIA 2ZM1A 3H30A 1H00A 1OIQA 3BQCA 4JQ7A 4RJ3A 2VO6A 4IX3A 3VQHA 3PYYA 5CTPA 2WTWA 4R7BA 3O8TA 3L8VA 4TYEA 3OTVA 4D9UA 3ORZA 1KV2A 3BPRA 3EQPA 3E8EA 4NW5A 2C1AA 3OXIA 3DB8A 2QCSA 3ZC6A 4F0GA 4DGMA 1GIHA 2EXMA 1UVRA 4NZWB 4Y85A 1GZNA 3OXZA 3EQBA 4JOAA 1RE8A 2Z02A 4JG7A 4BBEA 4PDOA 1WVYA 4MKCA 2IN6A 3AMBA 4EOSA 3E87A 3QA8A 3LLAA 5M55A 4BI0A 5BX0A 2OIBA 5IH4A 1B39A 3M11A 2E2BA 3DY7A 4R6VA 4TYHB 4CFVA 2FYSA 3PJ1A 4E8AA 4ZXTA 5M51A 3NAXA 5CVGA 1ND4A 1PMEA 2G15A 4BZNA 4BTFA 4MAOA 4BDHA 1H08A 4YPDA 3MH1A 5IUHA 4FTLA 4P90A 5TF9A 3SRVB 4O7SA 3FL4A 4OBOA 3ACJA 3HDMA 3ORIA 3E62A 2CGWA 4MH7A 3FPMA 1Q8WA 4FKGA 4NEUA 4X6QC 1BLXA 5EK7A 5LVLA 3DKFA 3HV3A 3TL8A 1UNLA 3LOKA 5CQUA 4PPCA 3E7OA 3L9LA 3EQGA 3KK9A 2UV2A 3QRIA 4JDKA 2YCFA 4ACMA 4BI1A 2CNVA 3KA0A 1ZMUA 2JFMA 4FKTA 4GU9A 4LGHA 4IB3A 3RPSA 3I1AA 3DQWA 3R73A 4KBCA 5F95A 5BNJA 3R8LA 4TZRA 4D4SA 4N6YA 3EYHA 3MVJA 4LV8A 3R7EA 4FV4A 3HA6A 4YTHA 3CQUA 4IFGA 1PMNA 5D7VA 1YVJA 2WTJA 1KV1A 1Y8YA 1DAWA 1W83A 2ZOQA 5EM6A 5C03A 3LMHA 3FMNA 1YDTE 1JSTA 3PIZA 5HD7A 1XBAA 3UOLA 2YM6A 2R7BA 4Q5EA 3FQSA 1FVTA 1TQPA 1HCKA 3GC7A 4G9CA 4IANA 5AV2A 2FH9A 3WZJA 2BZIB 4MVFA 3UBDA 4IX5A 3AC4A 3F7WA 4WNKA 3D7TA 3F5XA 5AP4A 1ZYJA 4J98A 4CRSA 3FHIA 4EOMA 3CS9A 2PUPA 5EQEA 3PLAE 4P5QA 4FG8A 1MRVA 3R8ZA 3QXPA 2YCSA 2XS0A 2WMQA 2XBAA 3DZOA 3IG7A 2WPAA 2PE1A 4XG9A 3OCSA 4ACHA 3TUDA 3SC1A 3QC4A 1SVGA 3MFSA 3QLFA 2J0IA 3C0GA 4RZWA 2HAKA 4GEOA 3BBTB 2RFNA 4GG5A 3SD0A 3TNWA 1Q62A 1U4DA 4DH7A 4FEXA 5ACKA 4XG7A 3OXTA 2WNTA 4RIXA 5DN3A 2WO6A 4EEVA 3FMEA 3FXWA 3GC8A 1NVSA 3R8UA 4XEYA 3WF6A 4UWBA 1UKIA 3KMMA 1J3HA 4RLKA 2X81A 3TZMA 3LAUA 3PPZA 4N6ZA 4E7WA 2BKKA 2PUIA 5C01A 5B2KA 4CXAA 5IEYA 3QD4A 1U5RA 3DU8A 2J51A 2YACA 1YRPA 3UNZA 4ZZMA 3ZLSA 4D2RA 4E73A 4EH8A 1JKLA 2XEYA 2VRXA 5FM2A 3VS7A 3EB0A 3KFAA 4FSZA 2CSNA 3FI4A 4MK0A 2NRUA 2Q0NA 3FKLA 5HO7A 3QHWA 3QQGA 2ESMA 2H8HA 4C62A 2VTJA 5CNNA 3QQLA 2B52A 2YN8A 2WOTA 3C7QA 4E5AX 1M2QA 4E4MA 4WO5A 2V62A 3Q5IA 5GZAA 4F9WA 5T3QA 4FKIA 3KU2A 2DQ7X 4RC3A 4BBMA 3DBQA 5AADA 4UBAA 2W5HA 2XK3A 2QLUA 4PWNA 4X6RA 4XLVA 3GCPA 2W5AA 4YO4A 3HEGA 4QTAA 4GKHA 2H34A 3OUKA 4GJ3A 1M2PA 4UYNA 4MD7E 3ZXZA 3UE4A 4AZTA 4D55A 4YTCA 4WOVA 5DG5A 4NW6A 2W96B 5GINE 4YMJA 5FDPA 4JBQA 1BI7A 2BRHA 2WFYA 2X2MA 3D5XA 4C3PA 5FRIA 4L00A 2IZRA 3E8DA 3KF4A 4XOYA 3VS6A 1WAKA 3L8PA 1NY3A 3MS9A 3BWJA 3KULB 4JDJA 2CDZA 3MFTA 3V5WA 4P5ZA 4EH6A 4QP8A 1Q97A 5FP6A 4IVAA 2E9UA 2VNWA 3JY0A 4ZTQA 2OU7A 4C3RA 4YZDA 3CQWA 4C33A 5CEQA 5DRDA 5AUZA 4JBOA 5AR8A 5HIEA 5JFVA 4PY1A 5HESA 3V5TA 3PG1A 2F7EE 2YIXA 5D1JA 1GZ8A 3I4BA 3WIGA 4XHKB 2C1BA 4FTRA 2HZIA 3HMOA 3LZBA 2C5VA 3PJCA 2OXXA 5IQIA 3A62A 4EK5A 3NW5A 4DFNA 3C4CA 1XH9A 2O65A 3RHXA 2BTSA 1YOMA 3F82A 1BL6A 4RPVA 2JD5A 2JKKA 2W4OA 5BMMA 3ZM9A 4BTMA 3RCJA 2HYYA 4LV5A 5E8YA 4I5HA 5AP7A 3CY2A 4BCNA 1JWHA 1K9AA 2VO3A 3MFRA 3GT8A 1M7QA 4CZYB 3II5A 5A4QA 5JZJA 1NXKA 2Q83A 5H3QA 3UMWA 4A7CA 3FJQE 4ZMFA 2ONLA 4TWNA 4IZ7A 3G0EA 2C3JA 2I0HA 2H6DA 2FSLX 3H0YA 4AACA 4FODA 4RVLA 5CU3A 4EH2A 5DNRA 1ZAOA 4O0VA 4U80A 4PV0A 4EC8A 1KE6A 1JBPE 3BI6A 5A4CA 4MXCA 1JOWB 3GU7A 3PJ8A 4HGSA 3MIAA 3QWKA 4QD6A 5A46A 4U6RA 3WI6A 2ITYA 3DK6A 3BX5A 3F3VA 2B53A 4FBXA 3TM0A 5FTQA 5LMBA 3W33A 3W2PA 3CGOA 4JNWA 2OIQA 2CCIA 2F7ZE 2X4FA 4GVAA 3TDVA 3COIA 2W1IA 3GCQA 2XUUA 4EZ5A 4CKJA 2ONLC 4MXYA 2YAKA 2O8YA 4TWPA 3VUHA 1WBWA 4Q5HA 5HKMA 3VS3A 4ZTMA 4EL9A 3MY1A 5TO8A 3I5NA 1V0PA 2X6DA 3Q52A 4CFXA 1MQBA 4ZAUA 5HNGA 4I0RA 3ZDIA 5HBHA 4BB4A 2WHBA 1OBDA 4FZ6A 5K5XA 3V5JA 1YI4A 3EQRA 5GNKA 1FVVA 4Y95A 5DR2A 3D2IA 4AQCA 5HBEA 3RGFA 1LUFA 2HXLA 2F49A 2QONA 4EKLA 3D83A 4O7VA 5CAOA 2BZKB 4Z16A 4PNKA 3DAKA 2R3IA 2YIWA 3PVWA 4G2FA 2OXYA 5AA8A 2YWVA 1GZOA 1CKIA 2REIA 3FMHA 5JT2A 1WZYA 4YJNA 4I5PA 3OEZA 3QL8A 2SRCA 1G8SA 2W1ZA 3MV5A 4C4FA 4O7WA 5GIOE 5HCXA 2YZAA 4Y72A 2PU8A 5E7RA 5H9BA 3SA0A 2BILB 3IOPA 2IZUA 4YZBA 3K5VA 2IVVA 2VWVA 3UO6A 4UMUA 4CFWA 4HVSA 2GMXA 3TKIA 1ZYCA 4BDAA 2VTAA 3IW8A 3NX8A 5EYMA 2YM7A 2OH4A 4H58A 4AT4A 4CNHA 3QQJA 1PKDA 4C8BA 5IA3A 1E1VA 3FZ1A 2XK7A 3LXNA 5HU3A 5IA0A 5C26A 4I0TA 4QP6A 2GNIA 4M0YA 4LG4A 4ZZNA 1DI8A 4LOOA 4V0GB 2PMIA 4NKAA 3BYSA 3LJ2A 4R5YA 4B99A 4RX8A 1Q8TA 3F3UA 4QMSA 3R7UA 3N4UA 4BCHA 4EOOA 5HEZA 4K18A 5IA4A 2R2PA 3W2OA 2UZEA 3V01A 3O2MA 4BYIA 3RAWA 4FEUA 5BVNA 4F09A 1ZZ2A 2R3NA 4RSSA 4XV3A 3FLZA 4R5SA 4LYNA 3HYHA 4AT5A 5J5SA 2ZVAA 4FUYA 5J7BA 3NLBA 2Z8CA 4XG3A 3FMMA 3OEFX 3OWKA 4IJ9A 4DFYA 3VUKA 3R28A 3DXNA 3A7GA 4QTDA 1LP4A 4O0SA 4RVTA 4LGGA 4NCTC 5J5TA 2WD1A 4XG6A 5H8EA 4RG0A 1PXLA 2OW3A 2ZV9A 3O7LD 5AEPA 4FOCA 4IWOA 3RPRA 4JLCA 1XO2B 3KVWA 3Q4UA 1PHKA 2JIIA 3GU6A 4AGWA 5IG1A 3QTSA 3Q2MA 2XH5A 1CMKE 4ITJA 3HV7A 4IFCA 3QQFA 1PJKA 4RX7A 3KMWA 1X8BA 5AIKA 2ITUA 5FGKA 4O84A 5IQEA 3DTWA 3R1NA 4FIFA 2YFXA 3DAEA 3GFEA 4F08A 5DMZA 1KOAA 4QOXA 1IR3A 5AM7A 3TUCA 1PKGA 3EMGA 1XH7A 2PY3A 2WTCA 2XJ0A 2RIOA 2X7OA 3MI9A 3NS9A 4RQKA 4QYYA 5EM7A 5KMJA 4J97A 4XP2A 3OG7A 5TKDA 2OG8A 3RM6A 3IONA 3MH2A 3QQHA 1P14A 3ZRMA 4DEGA 4AZWA 3UQCA 4J8NA 1GIIA 3QCYA 1H26A 1ZXEA 2VO0A 3O8PA 4C4JA 4B0GA 4TRLA 5HG5A 2DS1A 3W1FA 4C37A 3HV6A 2ZDUA 4E5WA 1Q4LA 3LFSA 1FMKA 2XK8A 4MF0A 5AP5A 4EOJA 3TUBA 5L2IA 2QURA 4FKSA 3HGKA 4JAJA 4JDHA 4CSVA 1MUOA 2OK1A 4I92A 1SVEA 2VTQA 4ZLZA 4FF8A 4TYHA 2XIKA 2QOOA 4FVQA 5EI6A 5JZNA 5KKRC 3I7CA 3LFQA 3PA3A 3QRKA 3Q6UA 4F1TA 3CD3A 2PZIA 3TNPC 3CCNA 2WIPA 4FNWA 4AA0A 4C59A 2QVSE 3BWFA 2GNLA 2J5FA 2Y7JA 2RFSA 1YXUA 4V04A 2ITNA 3DNDA 3UIMA 1OIRA 1ZOEA 4XG2A 3A4OX 3KXZA 4E5BA 2WMWA 2O2UA 1FINA 2QU5A 3H3CA 1VYWA 4C2WA 2YM5A 3HMIA 5JMSA 3TV4A 3DXQA 2RGPA 4UXLA 4D4VA 4G3CA 4GUEA 1P2AA 3OS3A 1GZKA 3EKKA 2AUHA 2FSMX 1H1SA 4GW8A 3FI8A 3RALA 4RVKA 2Q0BA 2WMRA 3ELJA 1WBNA 3IDBA 4ACCA 4C35A 3NVMB 4YGAA 4FSYA 3R1YA 4UMRA 3BHYA 2WQOA 3HP5A 1OPKA 3QHRA 3RHKA 3QQKA 3ERKA 3Q2JA 2WELA 3UIBA 1LEWA 1PXOA 1TVOA 3KK8A 3ZLWA 3KGAA 4J53A 4MQ1A 4S34A 3RWQA 4XX9A 4HZSA 2F4JA 5L2QA 5IEXA 4TYGA 1JPAA 3VUDA 3JY9A 4ANBA 2WKMA 1QPEA 1W84A 2V7OA 3OWLA 4HYUA 1APME 1KE8A 5CZIA 5IUIA 2HXQA 2C0OA 4KS8A 1PXNA 3U4UA 4PPBA 5K0KA 4EOIA 4QP3A 4R77A 1KE7A 3AGMA 4QNAA 4EOLA 3LM5A 4FGBA 1SNUA 3N4TA 2UUEA 4FV7A 2V5QA 3UDBA 4O7TA 3UPXA 2W9ZB 5ANGA 5J9LA 3M42A 3ZSHA 5IQGA 1OVEA 4CMTA 4I20A 4NM3A 5DEYA 4EWQA 1YXXA 2UZNA 3UIXA 4D4RA 4BKJA 1XH4A 3FXZA 2YWPA 4JRNA 3WF5A 4BYJA 5HNIX 4LMUA 1UNHA 3L1SA 3DS6A 3TZ9A 3D14A 4QPAA 3U4WA 3PY1A 5F94A 1Z57A 4CT2A 4JVGA 4BDBA 4PDSA 2OXDA 2UW7A 2J5EA 4BCMA 3KCKA 4X3FB 5IQDA 1FBNA 2XZSA 3FDNA 4RBLA 4DBXA 5L2TA 4XH6A 2P55A 3LFAA 5CU6A 2X9EA 2C4GA 1YI6A 5CF8A 3E3BX 4QTEA 2IZSA 4V01A 4DAWA 2HWPA 5AUYA 3E7VA 4RIWA 2J0JA 4RJ4A 4USDA 3KVXA 3SVVA 3MESA 3BE2A 2J2IB 2GSFA 3I79A 5JKGA 4I6BA 4E4XA 2G1TA 1O6LA 3CY3A 3COMA 3DNEA 3A7IA 2HOGA 4GV1A 4FL2A 2X39A 3O50A 2OJJA 3DT1A 1H1QA 1BX6A 3MVLA 3C5IA 1XBCA 3AT3A 5H8GA 3QF9A 5DPVA 4FX3A 2JBPA 3BLHA 5ETAA 4BF2A 3EN4A 4NIFA 3PXKA 3F3WA 4O1PA 4X2GA 5A6OA 3N4VA 2W99B 5KZ0A 3NCZA 4R7IA 4BR3A 4BCOA 4I94A 4DG0E 2QODA 2PZ5A 3ZYAA 2OZOA 4GKIA 2OZAB 5IQHA 4FSTA 4QYGA 1F3MC 3OCGA 4YJOA 1REJA 1OL2A 4MHAA 4BGQA 2XIYA 2GFSA 3F5PA 4F0IA 5FTOA 3JVRA 3SOCA 3Q04A 4YZNA 1VYZA 4G1WA 4UALA 5CU2A 3W32A 4PL4A 2HW6A 3EJ1A 3IPHA 2P3GX 4WA9A 3BE9A 1FPUA 3BLRA 3H4JA 3WOWA 3ZU7A 4D1XA 5JH6A 3KF7A 3HV4A 4I24A 2C6LA 2UW6A 4LFIA 4AGCA 4DEHA 4F63A 2HW7A 3KEXA 2Y8OA 4N0SA 3SW7A 4IACA 3R7OA 4H39A 2ZM3A 3GVUA 1XH8A 3KULA 4WNMA 2Z7RA 4ZSJA 2ITOA 4EH4A 5AV3A 3G6GA 2CN8A 4AZVA 4CQEA 4NU1A 4QTCA 4DEBA 4PMMA 5JEBA 2KULA 1OL6A 3QKMA 4BFMA 3LM0A 5CEIA 3AD4A 4BRXA 3EHAA 1J7LA 2P2IA 2Y6OA 5IDPA 4G31A 4PMSA 1WFCA 5AP3A 3RMFA 4YSJA 1J7IA 2HENA 3G15A 4X3JA 1FQ1B 5E1SA 3I0OA 4D1ZA 3ATSA 4WD5A 4QPMA 4WUNA 3TCPA 3SW4A 2PZRA 3DB6A 3V5QA 5BUIA 5GJDA 3CIKA 1KE5A 3FSKA 3PXFA 4NL0A 1ZY5A 3CGFA 4GT4A 4EH7A 4DGLC 4U81A 4OR5A 4YZ9A 4Y5HA 3F88A 3THBA 4PP7A 1RJBA 1VZOA 4BIBA 4F9BA 4L42A 3UQGA 3UIUA 2VWXA 1R39A 3P78A 4FUXA 4I0SA 3KMUA 5HE0A 3VUMA 4I93A 5HIDA 5K4IA 3LQ5A 1JKTA 2WMTA 4R1VA 3JUHA 5F9EA 4QQTA 3UJGA 3JPVA 4ALUA 3ORXA 4X0MA 3NUNA 4EQUA 5HTBA 4JG6A 4AZSA 3K5UA 2OJFE 5LMKC 3HLLA 4EK8A 2FO0A 1E9HA 5EM5A 3VRYA 3QTXA 4FZ7A 4IQ6A 5LVPA 3GBZA 5KUPA 4BDJA 3BU5A 1JSUA 2FSTX 2W0JA 2QOLA 4ID7A 3W16A 4A9YA 5CSWA 1IG1A 2JAMA 4I1ZA 3Q4TA 5C8KA 3CKXA 4L53A 4CMOA 2B0QA 5AV1A 4MCVA 1PXIA 3AC2A 4ALWA 3HUBA 3VHKA 4D58A 4YNOA 2V55A 4MEDA 4UB7A 2YABA 3GENA 4F6UA 2WEVA 1TQIA 4JT3A 5FBOA 4U97A 3UMXA 1KSWA 2IVUA 3GFWA 1QPJA 3AG9A 4M68A 3ZSGA 3V3VA 1JSVA 1XH5A 2EB3A 5JFSA 2C6KA 4HNIA 3KXNA 5CAVA 4ZK5A 4F6SA 3R8PA 3ORKA 4QQJA 4U7ZA 4WBBB 5LWMA 4C7TA 5HG7A 2ITWA 4ERWA 3VUTA 1JNKA 3FMJA 3A4PA 3B2WA 1H4LA 2QLQA 3EQFA 3QZGA 3PY3A 4OTIA 3BYUA 5AIRA 4PDPA 5DIAA 5LMAA 2R3LA 2XM9A 4G9RA 3VS2A 5CEMA 1ZY4A 3MVHA 1Q99A 3MB6A 2JKMA 3U6HA 1FVRA 3BGZA 5AAFA 3NRMA 3NYNA 3V51A 3C0IA 1TKIA 2E9VA 1S9JA 3TIZA 2NNWB 4JQEA 3UPZA 1OL7A 3BRBA 4TKSA 3Q53A 3LQ8A 2WQEA 3TKUA 5EHOA 3ZCLA 2CKQA 3GU8A 1Q61A 3G0FA 3KC3A 3F66A 4EWHA 5M56A 5FUTA 4DGGA 4C36A 3E3PA 4NYEA 4C3FA 2EUFB 2B54A 2YIQA 4FTOA 4FV8A 4YURA 3BHVA 3D7ZA 4I41A 1LPUA 4KBAA 3EFLA 3QZHA 3G33A 2XB7A 3R2BA 4FTMA 3UO4A 3RAIA 1OUYA 4O22A 2I0EA 3Q4CA 5GHVA 1AD5A 3R9NA 4DHFA 3CLYA 5HG8A 5IMXA 3P1AA 5J79A 4PL5A 5AP0A 3RI1A 2Z7SA 4QTBA 4AE6A 4CCBA 2JDOA 3P7CA 4D5KA 2X0GA 4MXOA 2UW8A 5GJFA 3MPAA 1YQJA 1B6CB 3EN5A 3UYTA 3HDNA 4DG2E 2BZJA 5KMNA 3GEQA 4E6DA 3PIYA 1ZLTA 2QC6A 3ORMA 4QRCA 4FL1A 4U5JA 1DI9A 2JEDA 4FSQA 4PNIA 2QG7A 4TTHB 3NMUF 3TKHA 4ACGA 4OTGA 5C1QB 3HMNA 4O0RA 5CVFA 4MTAA 5IZFA 2VZ6A 4BIEA 3F9NA 2W1EA 4QMYA 3BU6A 3A61A 3G9LX 4PPAA 5T68A 2BTRA 3VUGA 4A07A 3UNKA 3VBTA 2ZMDA 4YLLA 5FG8A 3DA6A 3RVGA 3LMGA 3OF0A 5HZNA 5CEOA 3F69A 2X7GA 3KRLA 3VJNA 3BHTA 4D5HA 2OIDA 4TW9A 1UWHA 4UYAA 4ZSGA 3S4QA 5AAGA 3EZRA 4YLKA 2YM4A 4DTAA 1YXVA 2XK9A 1SMHA 2YCQA 3DAJA 3F3TA 3NW6A 4BHZA 1BL7A 4KD1A 4F65A 5AUWA 4P2KA 2PVYA 2PL0A 3QLGA 1S9IA 1PY5A 3OT3A 5DT3A 2XKCA 2ZB1A 2WMUA 3HKOA 4I4EA 4L3PA 4MNFA 4JQ8A 2BKZA 4KS7A 4FV2A 3DXPA 4QMLA 2PHKA 4GFMA 3FE3A 4UN0C 2VWBA 3O51A 5HVKA 4JX3A 3I0QA 4D2VA 5E8ZA 5IU2A 3ZSIA 5CSHA 2QR8A 3R9RA 2YDJA 4IAKA 5ACBC 4CEGA 5JN2A 4ZY4A 2W17A 2YLFA 3TNHA 3VS1A 3PXQA 4BCFA 4FKRA 5DR9A 2CNUA 1ZZLA 3QCQA 4XOZA 3QTWA 4YNEA 5EKOA 5CSVA 4FEQA 3U8WA 3WZEA 4HYIA 1W98A 2FA2A 1OIYA 3TEIA 2PMOX 2XNGA 3W2SA 1UWJA 3OWJA 4FSUA 4W9XA 3ZZWA 3OCBA 3SDJA 4AG8A 4HVGA 2VTOA 2XA4A 2PVLA 2E9OA 4FIJA 3BLQA 2GS6A 4FG9A 2R3GA 3ETAA 4ZSLA 2VGOA 5IA1A 2YHVA 3ULIA 4I6FA 4DEEA 4NSTA 4FTAA 3QA0A 4JR3A 2XNMA 5E8XA 5L2WA 3O96A 5CVHA 4GK4A 4W4XA 4EH3A 5EDPA 2BHEA 1YXTA 2O0UA 3F7ZA 3P08A 4OT6A 4S32A 5BVEA 3RK7A 4V05A 2C0IA 3RK5A 3PIXA 4LL5A 5IA2A 5E8VA 3A8WA 3CP9A 4CFNA 4G5PA 4EOPA 3P7BA 3C4EA 4NKSA 4KAOA 5DA3A 3WE4A 4B4LA 2X9FA 1IAJA 3WYXA 3LCDA 5DOSA 1U54B 3U55A 3A60A 3O7LB 3BELA 1ZYSA 2UW5A 4D2WA 3DK3A 4YZCA 4RZVA 2GS7A 2QOKA 4YPSA 4L01A 3ORTA 3OP5A 4YJPA 4K9YA 4RC4A 4X7QA 4ZJJA 4XBUA 2JKOA 5EYDA 4QP7A 3FQHA 1T45A 4DFZE 2Z7LA 5CSPA 3I6UA 4ZTNA 3H10A 1WVXA 2G2IA 1OMWA 3K3IA 5AJQA 4HPUE 3QFVA 3U87A 4AX8A 5C4KA 5L8KA 3FMKA 4OBQA 3MVMA 5CAQA 5C27A 3RPOA 1JAMA 3UTOA 2EXEA 4F0FA 4FKQA 5TT7A 3PVUA 2YISA 4IAYA 2YERA 2W7XA 3L9MA 3RZFA 5HG9A 2JBOA 4FT5A 4EH5A 3DJ6A 3F2NA 1H07A 3LXKA 3ORNA 4HGLA 5CYIA 2W1DA 2PVKA 5HGIA 3RCDA 1A48A 2FUMA 1YDRE 1DM2A 2BVAA 2WZJA 1GNGA 4IHPA 3OW3A 1FGKA 3G2FA 5ANDA 4JXFA 3TXOA 3WIKA 4IWQA 4JIKA 5KBRA 4DN5A 3DFAA 3OMVA 3PJ2A 1A9UA 4BBFA 3E93A 4FOBA 2BDJA 1SZMA 3MWUA 3C5UA 3EN6A 2IZTA 4PTGA 1HOWA 5ETIA 2I7QA 3VULA 4CQGA 3LXLA 4MNEB 4YTFA 4U9AA 2Z60A 4GRBA 4RJ5A 3HNGA 3ZO4A 3FY0A 2W5BA 3M2WA 4E20A 5HORA 3W2QA 5CU4A 4ZEGA 3FBVA 3P5KA 2RG6A 2ITPA 4ENYA 3V5LA 3HP2A 3NUPA 1GIJA 3P9JA 4RA5A 4E6AA 1Y6BA 3EWHA 5K5NA 1Q3WA 4ORKA 2NP8A 3PJ3A 2BZHB 2BDFA 4H3BA 5EM8A 4EHEA 3ANQA 4JX7A 1R0PA 2JIVA 3EIDA 4H3PA 4M7IA 2PK9A 5JRSA 3PVGA 2I6LA 3MJ2A 3G51A 3LKMA 4R1YA 2WQNA 4KIKB 4NUSA 5EFQA 5KCVA 5AV4A 3NNVA 3DJ7A 2WU6A 3OTUA 4QP1A 3MDYA 3OOGA 2VWZA 3M1SA 4HOKA 4MXZA 4Z55A 2XK4A 2OWBA 3HVCA 3TWJA 2R3PA 3MGYA 3QD3A 3S3IA 5LCJA 4O6EA 5HO6A 2PMNX 3FYJX 4QMUA 4F1OA 5I5ZA 3C1XA 1OI9A 2JGZA 3R63A 2F57A 3FI3A 3LFBA 3QZFA 2YITA 4G3DA 4NT4A 4RVMA 2OH0E 1SYKA 4QMZA 3W10A 2C3LA 3QTRA 4OTFA 4F64A 4F9YA 3Q5ZA 1OUKA 3TV7A 3PSDA 4PF4A 1YI3A 5L8JA 4D28A 3ODZX 3JVSA 3TJDA 1SVHA 2WGJA 4IZ5A 3DGKA 2RKUA 1B38A 3FPQA 3OWPA 2OZAA 3FLYA 5HVYA 3CPBA 5E4HA 4DINA 4M69B 4BWXA 4WG5A 4JRVA 1CSNA 5DI1A 3ZLYA 5KMMA 5M4IA 2Y4IC 4L44A 5AP2A 4BL1A 3CXWA 3R30A 2IW8A 4EC9A 3W2CA 5GZ9A 4X2NA 1XH6A 3NCGA 4DT8A 3Q3BA 1M2RA 5J95A 4OTRA 2DYLA 4UEUA 4OBPA 1OB3A 4YZMA 2XKDA 5FDXA 2PE2A 5CU0A 5FQDC 4FIEA 5M4CA 3S1HA 1J1CA 1Q3DA 3AGLA 3HECA 2PVRA 3C50A 5HO8A 3BYOA 3IO7A 5F1ZA 5KHXA 3WBLA 3TZ8A 4I5CA 2V0DA 4EJNA 2ZDTA 4KIPA 4S31A 5ICPA 3BYVA 4RX5A 3MBLA 3AMYA 5CALA 2R3QA 1YW2A 4J96A 2X2LA 4Y5QA 4UX9A 5HI2A 5IQCA 5CI7A 3BKBA 2OGVA 3L8SA 3QAME 4JI9A 2PWLA 3ZEWA 4FV9A 1UA2A 2EU9A 2JDRA 4LUEA 3PUPA 5JFXA 2QOFA 5KMKA 3TV6A 4DEDA 5HLPA 3F2RA 5EW8A 1A06A 3EKNA 4J99A 4NTTA 5FBNC 3ORLA 3FAAA 4GVJA 4ALVA 3KXXA 4CRLA 3UOHA 2B9HA 3H9FA 1G8AA 4D2TA 4O86A 4DH3A 5HOAA 3KRJA 4U42A 3FLSA 3QTUA 3O0GA 4J1RA 1WBSA 2HZ4A 3NUSA 3BBWA 4KIOA 4BHNA 3R04A 3UO5A 3BV3A 2ACXA 2HCKA 1XJDA 4R7HA 2QKRA 5I9YA 3KCFA 3VQUA 4XV9A 5DT4A 3R8VA 3T3UA 3T8OA 4IZYA 4B9DA 2WTKC 4I4FA 3VIDA 3G6HA 5DEWA 1V1KA 3D0EA 4D0WA 4YR8A 4F4PA 2W9FB 5TOZA 2J7TA 1ZMVA 1WMKA 3P86A 4RX9A 2BRMA 3MY5A 3IECA 4C4IA 3RJCA 5DWRA 2GDOA 5JFWA 3UP7A 4ASZA 3P7AA 5FLFA 3Q9ZA 4WT6A 3EL8A 4HJOA 4AXAA 1I09A 4FSNA 3R7VA 3NR9A 3VNTA 2GCDA 3AC8A 3ZFMA 4KNBA 4NM5A 4ZJIA 4FVPA 1IRKA 4IM3A 3AXWA 3C9WA 4M14A 2WMXA 5JQ5A 3NEWA 3LPBA 3FHRA 5CT0A 3MW1A 3R02A 4FT0A 2OFUA 4AGDA 3JYAA 3SXFA 5L6WL 1XHAA 4LUDA 3F2AA 1PRYA 2QOIA 2YIRA 3IW6A 3FV8A 3KN5A 2X2KA 2R3HA 5FWKK 4DFUA 5D7AA 2F2CB 4FTNA 3QYZA 4O21A 3Q60A 5CQWA 1JQHA 1REKA 3SKCA 3R7IA 4LQMA 2BALA 2Z7QA 3V8SA 4EI4A 5CF5A 4IVDA 1IEPA 4A9UA 5M4UA 3ZXTA 4AN2A 1J1BA 1OGUA 1MP8A 3AOXA 3D5VA 2XIZA 1P4FA 3EFJA 3RPYA 2JFLA 3ZOSA 5I4NA 3TI1A 1OITA 4GJ2A 4OTHA 4G16A 1ZOHA 2PE0A 2QU6A 3HZTA 4KKHA 5A3XA 2GQSA 2J0MB 2XNOA 5KHWA 5E1EA 4F6WA 5HTCA 2BCJA 4E4NA 2UZDA 2IVSA 1ZMWA 3LJ0A 4F9CA 5L6OA 4QP2A 2QO9A 2HY81 5C4LA 3POZA 3ORPA 3T9IA 4BTJA 3U6JA 4O7NA 2WXVA 4G3FA 3ZLXA 4BKYA 4K33A 3PVBA 3D7TB 5D11A 4EBWA 5CLPA 3ZRLA 3VO3A 3LXPA 3LVPA 4CVAA 1Y6AA 2QNJA 4KUJA 2CGUA 1WBVA 4ZY5A 2HELA 3CR0A 3ENMA 4RQVA 4IH8A 2XIRA 3PG3A 3KREA 3GB2A 3SGCA 1YXSA 2WTIA 1WCCA 4KBKA 4FZFB 1EH4A 3IS5A 3QKKA 4OW8A 3ACKA 4HVDA 3FSFA 3SRVA 3OC1A 2ZV8A 4YJRA 4LRKA 1GOLA 3TN8A 5CEPA 5EDRA 5BUEA 4KINA 3C4WA 2UW9A 3DBDA 3O8UA 2W1HA 3BIZA 3FKNA 4C4EA 3WYYA 3JXWA 1YHSA 3LFDA 4Q9ZA 2VTIA 3HRFA 1M52A 2XEZA 3NUAA 2XRWA 4WSQA 3DLZA 1YOLA 3FI2A 2YLEA 4HNFA 4IB5A 1O9UA 5BYZA 4ASEA 4EONA 4H1MA 3F3ZA 4YC8A 5HLNA 4DFLA 2R3MA 2YM3A 1IA9A 2BR1A 3I5ZA 2GNGA 3FZRA 4B7TA 1KUTA 4RC2A 1ZRZA 1STCE 1OKYA 4FI1A 4WUAA 3R1SA 2WTDA 3ITZA 4YLJA 2E9NA 4R3PA 4RGJA 3D94A 4YHTA 5EHLA 2W1GA 3W8LA 4FSMA 4U0IA 1H1WA 4TY1A 5L6PA 4Y73A 3ZEPA 4AOIA 1CM8A 3COHA 3KRRA 1MRYA 1OKZA 4MXAA 4KA3A 3EOCA 4LMNA 3CKWA 2C5YA 4WG3A 4AGUA 4W8EA 4FEWA 4HYSA 2XYUA 4O2PA 3WILA 4L52A 2ZM4A 1P5EA 3KRXA 4LRJA 5KMIA 3CC6A 3W55A 4G6OA 4RWLA 4ZTLA 3QUDA 1AQ1A 2PSQA 3MY0A 2JDVA 3OCTA 5LCKA 1K3AA 1H1RA 4ITHA 2C6IA 1FOTA 3B8QA 3CEKA 3VBYA 3KY2A 4KB8A 3ZZEA 3OZ6A 4CV8A 5BVFA 5IEVA 5ANOA 1U5QA 3FZOA 3TTIA 3QX2A 2CGVA 3UZRA 4L7FA 3R9DA 3ZO1A 3FC1X 5E92A 5A4LA 3WARA 5DFPA 4FIIA 3AD5A 4QNYA 5ETCA 3REPA 3FZTA 4GFOA 3ZO3A 3GC0A 2RF9A 4I5MA 4GK3A 3I6WA 1BMKA 3PWYA 5E8SA 2QG5A 3ID6C 5K4JA 4Q2AA 5L4QA 2CN5A 5D41A 3RPVA 5BYYA 3VW6A 3DFCB 4ANLA 4AOJA 3R2YA 5G1XA 3FZPA 4L9IA 1I44A 4CTCA 2OSCA 1Q24A 5H8BA 5EOBA 2BRGA 4R3CA 5HIBA 5AFVA 3HL7A 2QR7A 5HE1A 3RBWA 3IW7A 2V22A 2WAJA 1AGWA 2PULA 3D9VA 4AA5A 5CAUA 4HPTE 3RNIA 3MYGA 3ZMMA 3BGQA 5A4TA 1PMUA 2ZJWA 2C68A 2Y4PA 4USEA 4USFA 5FEQA 5EOLA 3A8XA 3DDQA 4H36A 2YEXA 1ATPE 3D15A 4J95A 4O81A 3MA6A 4AW1A 4XV1A 4E6CA 2VTRA 3UODA 5AR3A 3WZDA 4PMPA 3HUCA 4U79A 5D9HA 3Q32A 1Z9XA 3CQEA 3PZHA 1OM1A 2I0YA 2VTHA 2B9JA 3GCSA 4EK4A 1ZYLA 2R64A 3R8MA 2UW4A 3O71A 5DRBA 1FMOE 4CKIA 4HYHA 3RWPA 3Q9XA 3OY3A 4C4HA 2C6MA 3EQCA 4FKJA 4YHJA 4MD9E 4PTCA 4GIIA 2GHGA 4A9RA 4CZTA 2OJGA 5HLWA 1Y8GA 2IVTA 2PZYA 3HMMA 4YSMA 4OLIA 2H96A 2A19B 4OUCA 3HA8A 4MD8E 4D2SA 1URWA 2XVDA 3RAHA 3BZ3A 2HWOA 5AAEA 5HE2A 3DK7A 4JL9A 4BCGA 4FR4A 2I0VA 4NTSA 3E63A 4FV0A 5DHJA 3KXMA 4FGRA 4PX6A 4CT1A 2X8DA 4DTBA 4F99A 4FC0A 1W82A 4M0ZA 4N70A 5I9VA 2C3IB 4FTUA 3OBGA 4OTDA 4S2ZA 4X2KA 2QD9A 1JKSA 5CX9A 5KZIA 4O83A 2I40A 3ALNA 4M66A 4OTQA 4XV2A 3UZTA 5M44A 3P0MA 3GOKA 2G2FA 4TYJA 5M57A 3N9XA 2XNEA 4BDGA 2IWIA 3RP9A 1KWPA 4K1BA 2QOHA 4FTCA 4U43A 4CLJA 3GU4A 5B0XA 4P7EA 4JG8A 2PYWA 1Q41A 5M08A 2WMSA 5AM6A 3QWJA 5IH5A 1NW1A 3PE1A 4FNXA 5FEDA 4BICA 5HX6A 4IC7A 4O0XA 4MWIA 4EYMA 4RFZA 4WIHA 4ITIA 2GU8A 4KIKA 5LOHA 1H01A 4BTKA 4BWKA 2UW3A 2R4BA 4C57A 3FWQA 5E8UA 4O7YA 2WMBA 2VTTA 3FC2A 2YZLA 4DH8A 3GQIA 3MIYA 4CG8A 2R3OA 5IA5A 5BVKA 2R3KA 5JGBA 3QBNA 3TZ7A 3KL8A 3A7HA 1E1XA 3VVHA 3GC9A 2UZTA 4I6HA 1IAHA 2ZMCA 4LOQA 5E91A 4HW7A 5KO1A 2VTMA 5LVMA 2RSVA 4D4YA 4DC2A 2WU7A 4WRGA 3R22A 3EQHA 4BGHA 5CF4A 1Q5KA 5DLSA 4CKRA 2ERKA 1PMVA 3TNQB 4U44A 3SAYA 3I81A 4DF3A 2WOUA 4KKGA 2CMWA 4O0UA 1CKJA 4M69A 4JAIA 5CSXA 1VEBA 3ZUTA 4EOQA 4Z3VA 3NGAA 2EVAA 3CJGA 4G17A 5KBQA 2CNQA 2ETMA 1XQZA 2YA9A 5IQBA 5K9IA 4K2RA 3E64A 4L8MA 4QMOA 1GJOA 2C5OA 4NK9A 3VBVA 3DZQA 3CBLA 3C4FA 3T9TA 2Z2WA 3PA5A 3D2KA 3R7YA 4ASDA 3FQEA 3S2PA 2VO7A 5AP6A 1K2PA 5IPJA 2ITQA 3QALE 3UNJA 4WRSA 4EBVA 2OF2A 5CWZA 2VWIA 2VGPA 2XNBA 4M12A 3PXRA 4EH9A 4QMQA 3MH0A 1BUHA 2C6DA 2HK5A 5A6NA 5BVOA 4RT7A 4TWOA 2NO3A 2VWYA 1U46A 2XNNA 5DGZA 5H2UA 4C58A 2Y0AA 2BIKB 5HCYA 3OFMA 5GIPE 3MSSA 1V0OA 4IDVA 2AC5A 4HCUA 5FEEA 3C51A 5AX9A 4CLIA 1H1PA 4AUAA 1GY3A 4FL3A 3LFEA 4AW2A 4UZHA 4PL3A 4QMWA 3JS2A 4ZIMA 2IJMA 4QMXA 4AOTA 3DV3A 4E26A 4OTWA 3EH9A 4YJUA 4ZY6A 1RQQA 3E8CA 3AQVA 4XJ0A 3DCVA 1QMZA 3BYMA 3C0HA 2P0CA 3KKVA 1ZYDA 4MQ2A 4UZDA 1ZOGA 4ANSA 4EZ7A 2FSOX 4H3QA 4FE2A 5KKRB 2C69A 4XBRA 2PMLX 4FSWA 4FKUA 3HAVA 3QUPA 3W2RA 2ITZA 2PZPA 4EK6A 4LL0A 3TJCA 3DOGA 4FICA 3IDCA 2WIHA 3LCTA 2YIYA 3B8RA 3NUUA 3UG2A 3EL7A 4ZS4A 4NFMA 4E6QA 4O96A 4IE9A 1KE9A 1ZARA 3ENHA 5EG3A 4O7LA 4IBMA 1YHWA 1O6KA 5EI2A 4TPTA 3NUYA 5EQYA 2A2AA 2BRBA 4FV5A 3ATTA 4UY9A 4DA5A 3C4ZA 3I60A 2XJ2A 3LIJA 1QCFA 4FK6A 3UC4A 5ITAA 2AYPA 4V0GA 4IM0A 3G90X 4J7BA 3U9CA 1W8CA 1G5SA 3COKA 5L2SA 4UMQA 5J1WA 2W05A 1XR1A 2BRNA 3VW8A 3NYOA 4ZTSA 3MJ1A 1HCLA 4QQ5A 3VN9A 2NRYA 1VJYA 3UC3A 4R8QA 4QP9A 4W4VA 4HGEA 4KSPA 3IGOA 4A4OA 3V5PA 5HU9A 3GCVA 3IW5A 4IB1A 3TNIA 4BN1A 3NWWA 1H27A 1Q8UA 2IW9A 4BZDA 3DBCA 4IVCA 2VNYA 4IC8A 2ZAZA 3UGCA 4CG9A 3QRJA 4E4LA 3U51A 2GS2A 4FT3A 4BCIA 2C6TA 5L3AA 4EHVA 3OUNB 4LRMA 5ETFA 5AUUA 5CANA 1M7NA 4Z7GA 4A06A 2O5KA 2X6EA 1VR2A 5EH0A 2ITXA 2VU3A 1PYXA 4DCAA 4ZSEA 3HMPA 5AUXA 5BYLA 4G3EA 3NYXA 4PMTA 4FIGA 4AFJA 1NT2A 5A54A 4Y46A 1JKKA 4M84A 5ANEA 1Z5MA 3RZBA 2X7FA 4G6NA 3GGFA 2R3JA 4Y83A 4WBOA 3SQQA 4TNBA 1TQMA 2C6OA 5AR4A 3D5WA 4TYIA 4YJTA 5FXQA 4CD0A 2YJSA 2GHLA 4RMZA 3RM7A 4HVHA 3QD2B 4DG3E 2R0UA 2XP2A 2WMVA 2P4IA 5LQFA 2PVNA 2XF0A 3BU3A 4W4YA 4WNOA 2JITA 4UMPA 2GTNA 4GL9A 2I1MA 4FA2A 4B8LA 4UWYA 2PPQA 4FNZA 2BAJA 4NJDA 3A99A 5IH6A 2O63A 4HCTA 3ZDUA 2GPHA 4IIRA 1YWRA 3NPCA 1UV5A 5JGDA 3NNUA 3ZFXA 4FEVA 4Z7HA 3FUPA 4P4CA 3BGPA 2UVXA 3FLNC 3LCSA 4FV6A 5I9ZA 3LJ1A 5IKWA 2G9XA 3RKBA 4XS2A 4MBJA 5EW9A 4BIDA 4IAZA 1BI8A 2UZWE 3LHJA 3OVVA 5BPYA 4UWCA 3U6IA 2CHLA 4FTIA 2FB8A 3KB7A 4RFMA 5FP5A 4EYJA 5LARA 4FKPA 5AX3A 1V0BA 3FY2A 5IDNA 2VAGA 4M13A 5I9XA 4RIWB 2NPQA 4I22A 1PXKA 4HCVA 4AFEA 4RA4A 1M17A 1GAGA 1UU3A 3A7JA 4EJ7A 4IXPA 2R7IA 1OZ1A 3EN7A 5BVDA 2ITTA 4IX4A 4LM5A 3UVQA 4O1OA 3K3JA 3Q6WA 1L3RE 3OOMA 2BIYA 3GP0A 4L6QA 3NVKI 5AV0A 5LVOA 5B2MA 2B1PA 2BHHA 2QI8A 4BDEA 3OHTA 1ZWSA 2XK6A 1BYGA 2DUVA 4FSRA 4FV1A 4QMPA 4O82A 1OL1A 4Y8DA 4NIFB 4QYHA 1YKRA 3QTQA 2CLXA 3FXXA 4FTJA 4MWHA 3EN9A 2QO7A 4U3ZA 4X21A 3RINA 5LXMA 3AC3A 2A27A 3C4XA 2X4ZA 2C6EA 3BQRA 3VHEA 3F5GA 3FL5A 5IQFA 2PUNA 2OBJA 4QMNA 4MXXA 1QPDA 3V6SA 3PXZA 3EFKA 4ENXA 4KABA 3G5DA 2BROA 5CXZA 3I7BA 5EQPA 4NM0A 4NH1A 5GJGA 4AZFA 4J52A 2FGIA 3QXOA 3RTPA 1UU9A 4XRJA 1WBPA 3O17A 4I23A 5M06A 4RJ6A 4M15A 4YHFA 4IAFA 4AW0A 4BCPA 3ZUVA 4D0XA 4FTTA 1Y57A 2XKFA 1W7HA 3P4KA 4YJVA 3WE8A 3E92A 2ETKA 4AS0A 4C2VA 2W4KA 2JC6A 4QT1A 2QKWB 2XBJA 4XUFA 4FMQA 3ZC5A 3ANRA 4AP7A 5KMOA 2XYNA 3DLSA 4PTEA 4GUBA 1URCA 4NFNA 3EQIA 3E5AA 4KRCA 1PXMA 4FG7A 3LE6A 2GNJA 3ZO2A 5AA9A 4O7RA 1OL5A 3PPJA 2YAAA 2B55A 2J6MA 2QOCA 2VX0A 3CJFA 3EQDA 3GU5A 4X3FA 4O7ZA 2OJIA 3DDPA 4I21A 4JJRA 4A9TA 1JVPP 3DPKA 2VD5A 3VWAA 4CFUA 4CYJA 5JQ8A 4L68A 4QP4A 3ALOA 3KXGA 2YDKA 3AD6A 2XJ1A 2UZLA 1OPJA 4RJ7A 4OAVB 3R0TA 4BY9E 1KOBA 2VUWA 1OKVA 2OKRA 2C5NA 3BHHA 4IAAA 4DGOA 4BCQA 4YBKA 4YU2A 3HAMA 2GNHA 1H8FA 3CTQA 5LWNA 5K3YA 2J0LA 4AZEA 3V04A 4O91A 4S30A 3V8WA 4YJQA 4AE9A 3IQ7A 4FV3A 5KE0A 5AUTA 2WTVA 3FMDA 5FTGA 3FYKX 2YJRA 3KXHA 2CCHA 4MYGA 4X3FC 3SOAA 3VS5A 4O0WA 2BAQA 2HZNA 3MN3A 3VF8A 4YTIA 5DR6A 4L3LA 4EUTA 3DQXA 3P23A 2Y9QA 1H0VA 2IW6A 4KSQA 1DS5A 3PA4A 3R1QA 5KX8A 2KTYA 4K8AA 4LGDA 3V8TA 3PP0A 4XCUA 1NA7A 4BDIA 2O3PA 5JGAA 3A7FA 4M8TA 4YUQA 3VUIA 5M53A 2XRUA 3AC5A 3ZHPC 3IW4A 2HZ0A 2J50A 1IASA 3W18A 4ANMA 2DWBA 2OICA 3IKAA 3TDWA 3KRWA 4WNPA 2EXCX 3L9NA 4BDCA 2QHMA 3DKCA 3D4QA 4H05A 2A1AB 3S95A 4F7LA 3EZVA 2JAVA 4W8DA 1H0WA 3CE3A 3H9OA 3QUEA 4FTQA 4IADA 2C3KA 5B7VA 4MBLA 3GI3A 3KQ7A 4O0TA 4AW5A 5ANIA 4GH2A 2WQBA 4ZS0A 4LI5A 3GUBA 4L3JA 3DBEA 3R9HA 4L45A 3K2LA 3NDMA 2FVDA 4FKVA 4RIYB 3RNYA 4XP3A 3WF8A 2XNPA 3UP2A 4DLJA 4DEAA 5FXRA 3VC4A 4FYOA 4OT5A 3E8NA 2JDSA 4NJ3A 1UU7A 3NNXA 5J87A 1F0QA 2F7XE 2BPMA 3PSBA 5EW3A 5CEKA 4FYNA 5CNOA 2AC3A 4A4XA 3G9NA 3VJOA 4IEBA 4RRVA 2JDTA 4CZUA 2ZYBA 2W4JA 3VBQA 2A0CX 3FZSA 3OBJA 2BAKA 1MQ4A 3QZIA 2J90A 4NM7A 4GG7A 4BZOA 4D1SA 2QHNA 4HVIA 4N57A 5CZHA 5E8TA 1L8TA 5AP1A 4YC6A 4XLIA 2XCKA 4GSBA 3NSZA 4FZDB 4M3QA 3ZRKA 4FNYA 1DAYA 1RW8A 3P79A 4GS6A 4MF1A 3NUXA 4CGAA 3QQUA 3PLSA 2B4SB 1Q8ZA 1NVRA 2UVYA 4FIHA 5F20A 3OROA 5I9WA 2OO8X 3CTJA 3QGYA 4HZRA 4DH5A 1OKWA 3CTHA 4U8ZA 5BMSA 3R9OA 5IISA 5KNJA 3QKLA 1PXPA 4EQCA 2VWWA 4NCTA 4XNEA 5F4NA 3ODYX 5C8MA 3VBWA 2WEIA 4QMMA 5LJJA 2UW0A 4JBVA 4KWPA 1SM2A 3SG8A 5AUVA 3BEAA 4AF3A 4O0YA 4F70A 4ONAA 4GCJA 4X2FA 4JS8A 3ET7A 4RJ8A 3DBFA 2ERZE 3QC9A 4QMTA 3EFWA 4ZTRA 4OAUC 2CGXA 5I9UA 2R5TA 4Z9LA 3SXSA 3EYGA 3U9NA 5E8WA 4ZP5A 2VTLA 4U40A 3FEGA 2RFDA 4XYFA 3IK3A 3T3VA 5CI6A 3PTGA 5HBJA 5HTIA 3R7GA 2VN9A 4K11A 4M97A 1XWSA 2C30A 4ZTHA 4ZJVA 2CKOA 1YOJA 4X2JA 3MPTA 1T46A 3QYWA 1YDSE 2BUJA 3LCOA 5DBXA 4QO9A 2O64A 4ZZOA 3FKOA 4AA4A 2BDWA 4AWIA 3Q96A 5J9ZA 4PUZA 5C9CA 4ANQA 4D2PA 2PVFA 1QPCA 2YCRA 2XIXA 4GIHA 2F9GA 2WMAA 3ROCA 4IVBA 2RFEA 1PYEA 2W1CA 2CKEA 4XRLA 4MBIA 5CY3A 5I3OA 1Y91A 3L8XA 5FM3A 4AT3A 4C61A 3TIYA 4ANNA 5B2LA 2C5XA 4TL0A 3BV2A 3UOJA 3DTCA 3ZM4A 4BDDA 4WSYA 3ZS5A 2VWUA 4FKWA 1H24A 2XMYA 2XCHA 4HGTA 3SHEA 3UYSA 3ROYA 2B9FA 4AN9A 5JSMA 1RDQE 4GFGA 2B7AA 2LGCA 2VTSA 3LMIA 2JIUA 2W06A 3NNWA 3TT0A 4EKKA 3C13A 2HY0A 3QRUA 3K54A 3VAPA 5EI8A 5IMEA 4CCUA 2JLDA 3ZH8A 2G01A 3MB7A 4C02A 4E1ZA 5BUJA 4PRJA 3S0OA 3OW4A 4RIXB 2PVMA 2OJ9A 2BMCA 5DT0A 1PW2A 2R3FA 2C47A 5ANKA 2EWAA 4GYIA 2VTNA 2VV9A 4IB0A 4C4GA 4YJSA 3VF9A 4XG8A 5HX8A 4FK3A 3B2TA 4FZAB 5IF1A 2Y6MA 1M14A 3H9RA 1P4OA 4ZOGA 4JDIA 4EZ3A 4G3GA 4DBNA 3NIEA 2ZV7A 2R0IA 2UZUE 4F1MA 2IG7A 4XP0A 4WHZA 5CENA 3HV5A 2UZOA 2EB2A 3PXYA 1XKKA 1G3NA 4DEIA 3CSVA 3R21A 4M67A 2UZVA 3N51A 2F2UA 4KKEA 3LLTA 4W4WA 2X8IA 4PP9A 1WBTA 5D12A 1LEZA 1OPLA 3QU0A 3NW7A 4OTPA 5A4EA 4TNDA 4L7SA 1ERKA 3LFCA 3F61A 3SV0A 1WBOA 1UKHA 4JIAA 5HICA 2C0TA 5HQ0A 3FLWA 3JR1A 2UZBA 4EK3A 5JK3A 4K6ZA 4QYFA 4ZLOA 3ZTXA 4IAIA 4EUUA 1FGIA 4XMOA 5AMNA 3WF7A 3MFUA 2CKPA 2X1NA 5CAPA 4GU6A 3HX4A 4IJPA 4C34A 3TTJA 2OLCA 3BCEA 4II5A 4C0TA 3UG1A 4KRDA 5HD4A 5D10A 5CASA 2J9MA 1PF8A 4FT9A 4CYIA 4C38A 4LOPA 4RWJA 5DH3A 3GCUA 1R78A 3GOPA 3IOKA 3QD0A 4YBJA 2OI4X 2IPXA 1QL6A 1MRUA 2GTMA 4IZAA 4IWPA 2GNFA 5DVRA 5K0XA 4ERKA 4EQMA 4QYEA 1OIUA 1W0XC 3L9PA 3VBXA 3QX4A 4EORA 5BQ0A 2QQ7A 4DFXE 5AR2A 4KIQA 4OGRA 4APCA 5A9UA 5HVJA 4ZSAA 1U54A 2ZV2A 4JBPA 5LVNA 3R71A 5AR5A 3HRBA 5BVWA 5TR6A 4BC6A 2GQRA 4U3YA 4IX6A 3IDPA 2G2HA 3O23A 5IQAA 3PDTA 3WF9A 2Y4IB 5CT7A 5GZ8A 3HRCA 3QRTA 4CTBA 2ZB0A 2B9IA 3AMAA 4YO6A 4DITA 5E9EA 3R00A 2X8EA 3FLQA 4BVUA 1NVQA 4BGGA 4TN6A 4BI2A 2VX3A 3GQLA 2WQMA 4DH1A 3UQFA 3F6XA 4TT7A 4DT9A 5AR7A 2J4ZA 4RLLA 5FXSA 4IMYA 3W8QA 4QPSA 3UVRA 4E3CA 4ZMEA 2LAVA 4I6QA 4DTKA 4QQCA 3Q9YA 4DLIA 4Q9SA 4FVRA 4ACDA 4IW0A 4L67A 4UMTA 3H0ZA 4G34A 5AWMA 4WKQA 1CTPE 2WB8A 3PZEA 3MTLA 3SLSA 3AT2A 4GYGA 2XM8A 4B8MA 5CS6A 3LQ3A 3VRZA 4BCJA 3BHUA 3PRFA 1UNGA 3PY0A 4DE4A 3QTIA 4RWIA 5J8IA 2P2HA 3Q4ZA 1SNXA 3E88A 4XG4A 1CKPA 2PTKA 4L46A 4O38A 3UZPA 4BDFA 4CFFA 1H25A 4ANOA 4DYMA 3LFNA 3V6RA 4TWCA 2V7AA 3R6XA 2GQGA 4I3ZA 5EYCA 2RL5A 5M4FA 4BKZA 3PP1A 4PDYA 4FT7A 5HCZA 3QCSA 2OF4A 4MNEA 2PVHA 2VTPA 4GMYA 3SXRA 1R1WA 3NYVA 4O27B 5HE3A 5EDQA 5TE0A 2QOQA 2A4LA 3Q9WA 4G5JA 3RK9A 4A9SA 3CPCA 2VX1A 3WZKA 4FKOA 3TACA 4E93A 1LR4A 3LCKA 5J9YA 4IM2A 2WTKB 3ZONA 4NWMA 1R3CA 3OY1A 4TXCA 3ZFYA 4ASXA 4B6LA 1YWVA 4WG4A 4J71A 4GT5A 4F9AA 4PQNA 1IA8A 3QTZA 2PVJA 2ETRA 2GHMA 1J91A 3VS0A 3LFFA 2CJMA 3F5UA 3LW0A 4FTKA 2P33A 4YC3A 3WZUA 4ARKA 4JR7A 3ZUUA 1JLUE 3IGGA 4BCKA 3R01A 2ITVA 2UVZA 1H28A 3OT8A 2IO6A 3RAKA 5LMKA 3U54A 3PRIA 2PUUA 2J0KA 4GT3A 3KN6A 5L8LA 1UU8A 2HIWA 2QO2A 4U41A 1PXJA 4R78A 5G6VA 4FKLA 3SG9A 4QMVA 4S33A 4RFYA 4UXQA 3DJ5A 3AC1A 4F7JA 2W1FA 4U45A 4BWPA 1WVWA 2OFVA 5A14A 5JRQA 4APPA 1Q8YA 1J7UA 2RG5A 1CDKA 3TG1A 3DKGA 1F5QA 3ULZA 4CV9A 5DE2A
chains in the Genus database with same CATH superfamily
2CLQA 3FMLA 5FD2A 3NIZA 3MH3A 4J8MA 3A2CA 5J7HA 4EHZA 4YP8A 5DYJA 3AT4A 2GFCA 4ZLYA 3QCXA 4EOKA 5M09A 3MPMA 4CMUA 4RIOA 4EHGA 4F7NA 4O6LA 4GK2A 4N4SA 5E90A 3PSCA 4IDTA 2XKEA 4AAYA 5I0BA 1OBGA 1U59A 2BFXA 4IWDA 4D9TA 3MTFA 3BEGA 1O6YA 4DCEA 5CXHA 4A4LA 1YWNA 5EHYA 5HHWA 3VS4A 4H1JA 3ZBFA 2BFYA 5HNBA 2R3RA 3SX9A 3D5UA 2JKQA 5EYKA 2QOBA 1XBBA 4DGNA 3NZ0A 3GXLA 5CF6A 2R9SA 5T6KA 3MA3A 3PFQA 3UOKA 4MX9A 4RWKA 5C8NA 5ANJA 3UVPA 2CPKE 2E9PA 2H9VA 3QGWA 4F7SA 3CD8A 3PE2A 3NFFB 3POOA 2XANA 3OD6X 3PPKA 3ZBXA 3DKOA 4R3RA 5IUGA 5KMLA 2YM8A 1BKXA 1R0EA 4UV0A 5I3RA 3S00A 3GNIB 5EKNA 4BJJA 4K77A 4AAAA 5M07A 4K0YA 1YHVA 4RIYA 4AN3A 3NAYA 4BDKA 5J1VA 4W9WA 4G6LA 4CFMA 4O2ZA 4AU8A 1OECA 3PWDA 3R83A 4L43A 4DFBA 2YDIA 2ZM1A 3H30A 1H00A 1OIQA 3BQCA 4JQ7A 4RJ3A 2VO6A 4IX3A 3W0SA 3VQHA 3PYYA 5CTPA 2WTWA 4R7BA 3O8TA 3L8VA 4TYEA 3OTVA 4D9UA 3ORZA 1KV2A 3BPRA 3EQPA 3E8EA 4NW5A 2C1AA 4AXFA 3OXIA 3DB8A 2QCSA 3ZC6A 4F0GA 4DGMA 1GIHA 2EXMA 1UVRA 4NZWB 4Y85A 1GZNA 3OXZA 3EQBA 4JOAA 1RE8A 2Z02A 4JG7A 4BBEA 4PDOA 1WVYA 4MKCA 2IN6A 3AMBA 4EOSA 3E87A 3QA8A 3LLAA 5M55A 4BI0A 5BX0A 2OIBA 5IH4A 1B39A 3M11A 2E2BA 3DY7A 4R6VA 4TYHB 4CFVA 2FYSA 3PJ1A 4E8AA 4ZXTA 5M51A 3NAXA 5CVGA 1ND4A 1PMEA 2G15A 4BZNA 4BTFA 4MAOA 4BDHA 1H08A 4YPDA 3MH1A 5IUHA 4FTLA 4P90A 5TF9A 3SRVB 4O7SA 3FL4A 4OBOA 3ACJA 3HDMA 2ZFYA 3ORIA 3E62A 2CGWA 4MH7A 3FPMA 1Q8WA 4FKGA 4NEUA 4X6QC 1BLXA 5EK7A 5LVLA 3DKFA 3HV3A 3TL8A 1UNLA 3LOKA 5CQUA 4PPCA 3E7OA 3L9LA 3EQGA 3KK9A 2UV2A 3QRIA 4JDKA 2YCFA 2NYAA 4ACMA 4BI1A 2CNVA 3KA0A 1ZMUA 2JFMA 4FKTA 3AKLA 4GU9A 4LGHA 4IB3A 3RPSA 3I1AA 3DQWA 3R73A 4KBCA 5F95A 5BNJA 3R8LA 4TZRA 4D4SA 4N6YA 4DHIB 3EYHA 3MVJA 4LV8A 3R7EA 4FV4A 3HA6A 4YTHA 3CQUA 4IFGA 1PMNA 5D7VA 1YVJA 2WTJA 1KV1A 1Y8YA 1DAWA 1W83A 2ZOQA 5EM6A 5C03A 3LMHA 3FMNA 1YDTE 1JSTA 3PIZA 5HD7A 1XBAA 3UOLA 2YM6A 2R7BA 4Q5EA 3FQSA 1FVTA 1TQPA 1HCKA 3GC7A 4G9CA 4IANA 5AV2A 2FH9A 4O4FA 3WZJA 2BZIB 4MVFA 3UBDA 4IX5A 3AC4A 3F7WA 4WNKA 3D7TA 3F5XA 5AP4A 1ZYJA 4J98A 4CRSA 3FHIA 4EOMA 3CS9A 2PUPA 5EQEA 3PLAE 4P5QA 4FG8A 1MRVA 3R8ZA 3QXPA 2YCSA 2XS0A 2WMQA 2XBAA 3DZOA 3IG7A 2WPAA 2PE1A 4XG9A 3OCSA 4ACHA 3TUDA 3SC1A 3QC4A 1SVGA 3MFSA 3QLFA 2J0IA 4DHJA 3C0GA 4RZWA 2HAKA 4GEOA 3BBTB 2RFNA 4GG5A 3SD0A 3TNWA 1Q62A 1U4DA 4DH7A 4FEXA 5ACKA 4XG7A 3OXTA 2WNTA 4RIXA 5DN3A 2WO6A 4EEVA 3FMEA 3FXWA 3GC8A 1NVSA 3R8UA 4XEYA 3WF6A 4UWBA 1UKIA 3KMMA 1J3HA 4RLKA 2X81A 3TZMA 3LAUA 3PPZA 4N6ZA 4E7WA 2BKKA 2PUIA 5C01A 4I6LA 5B2KA 4CXAA 5IEYA 3QD4A 1U5RA 3DU8A 2J51A 3UDTA 2YACA 1YRPA 3UNZA 4ZZMA 3ZLSA 4D2RA 4E73A 4EH8A 1JKLA 2XEYA 2VRXA 5FM2A 3VS7A 3EB0A 3KFAA 4FSZA 2CSNA 3FI4A 4MK0A 2NRUA 2Q0NA 3FKLA 5HO7A 3QHWA 3QQGA 2ESMA 2H8HA 4C62A 2VTJA 5CNNA 3QQLA 2B52A 2YN8A 2WOTA 3C7QA 4E5AX 1M2QA 4E4MA 4WO5A 2V62A 3Q5IA 5GZAA 4F9WA 5T3QA 4FJVA 4FKIA 3KU2A 2DQ7X 4RC3A 4BBMA 3DBQA 5AADA 4UBAA 2W5HA 2XK3A 2QLUA 4PWNA 4X6RA 4XLVA 3GCPA 2W5AA 4YO4A 3HEGA 4QTAA 4GKHA 2H34A 3OUKA 4GJ3A 1M2PA 4UYNA 4MD7E 3ZXZA 3UE4A 4AZTA 4D55A 4YTCA 4WOVA 5DG5A 4NW6A 2W96B 5GINE 4YMJA 5FDPA 4JBQA 1BI7A 2BRHA 2WFYA 2X2MA 3D5XA 4C3PA 5FRIA 4L00A 2IZRA 3E8DA 3KF4A 4XOYA 3VS6A 1WAKA 3L8PA 1NY3A 3MS9A 3BWJA 3KULB 4AXCA 4JDJA 2CDZA 3MFTA 3V5WA 4P5ZA 4EH6A 4QP8A 1Q97A 5FP6A 4IVAA 2E9UA 2VNWA 3JY0A 4ZTQA 2OU7A 4C3RA 4YZDA 3CQWA 4C33A 5CEQA 5DRDA 5AUZA 4JBOA 5AR8A 5HIEA 5JFVA 4PY1A 5HESA 4AQKA 3V5TA 3PG1A 2F7EE 2YIXA 5D1JA 1GZ8A 3I4BA 3WIGA 4XHKB 3ML1A 2C1BA 4FTRA 2HZIA 3HMOA 3LZBA 2C5VA 3PJCA 2OXXA 5IQIA 3A62A 4EK5A 3NW5A 4DFNA 3C4CA 1XH9A 2O65A 3RHXA 2BTSA 1YOMA 3F82A 1BL6A 4RPVA 2JD5A 2JKKA 2W4OA 5BMMA 3ZM9A 4BTMA 3RCJA 2HYYA 4LV5A 5E8YA 4I5HA 5AP7A 3CY2A 4BCNA 1JWHA 1K9AA 2VO3A 3MFRA 3GT8A 1M7QA 4CZYB 3II5A 5A4QA 5JZJA 1NXKA 2Q83A 5H3QA 3UMWA 4A7CA 3FJQE 4ZMFA 2ONLA 4TWNA 4IZ7A 3G0EA 2C3JA 2I0HA 2H6DA 2FSLX 3H0YA 4AACA 4FODA 4RVLA 5CU3A 4EH2A 5DNRA 1ZAOA 4O0VA 4U80A 4PV0A 4EC8A 1KE6A 1JBPE 3BI6A 5A4CA 4MXCA 1JOWB 3GU7A 3PJ8A 4HGSA 3MIAA 3QWKA 4QD6A 5A46A 4U6RA 3WI6A 2ITYA 3DK6A 3BX5A 3F3VA 2B53A 4FBXA 3TM0A 5FTQA 5LMBA 3W33A 3W2PA 3CGOA 4JNWA 2OIQA 2CCIA 2F7ZE 2X4FA 4GVAA 3TDVA 3COIA 2W1IA 3GCQA 4O4EA 2XUUA 4EZ5A 4CKJA 2ONLC 4MXYA 2YAKA 2O8YA 4TWPA 3VUHA 1WBWA 4Q5HA 5HKMA 3VS3A 4ZTMA 4EL9A 3MY1A 5TO8A 3I5NA 1V0PA 2X6DA 3Q52A 4CFXA 1MQBA 4ZAUA 5HNGA 4I0RA 3ZDIA 5HBHA 4BB4A 2WHBA 1OBDA 4FZ6A 5K5XA 3V5JA 1YI4A 3EQRA 5GNKA 1FVVA 4Y95A 5DR2A 3D2IA 4AQCA 5HBEA 3RGFA 1LUFA 2HXLA 2F49A 2QONA 4EKLA 3D83A 4O7VA 5CAOA 2BZKB 4Z16A 4PNKA 3DAKA 2R3IA 2YIWA 3PVWA 4G2FA 2OXYA 5AA8A 2YWVA 1GZOA 1CKIA 2REIA 3FMHA 5JT2A 1WZYA 4YJNA 4I5PA 3OEZA 3QL8A 2SRCA 1G8SA 2W1ZA 3MV5A 4C4FA 4O7WA 5GIOE 3W0QA 5HCXA 2YZAA 4Y72A 2PU8A 5E7RA 4F78A 5H9BA 3SA0A 2BILB 3IOPA 2IZUA 4YZBA 3K5VA 2IVVA 2VWVA 3UO6A 4UMUA 4CFWA 4HVSA 2GMXA 3TKIA 1ZYCA 4BDAA 2VTAA 3IW8A 3NX8A 5EYMA 2YM7A 2OH4A 4H58A 4AT4A 2XAMA 3W0MA 4CNHA 3QQJA 1PKDA 4C8BA 5IA3A 1E1VA 3FZ1A 2XK7A 3LXNA 5HU3A 5IA0A 5C26A 4I0TA 4QP6A 2GNIA 4M0YA 4LG4A 4ZZNA 1DI8A 4LOOA 4V0GB 2PMIA 4NKAA 3BYSA 3LJ2A 4R5YA 4B99A 4RX8A 1Q8TA 3F3UA 4QMSA 3R7UA 3N4UA 4BCHA 4EOOA 5HEZA 4K18A 5IA4A 2R2PA 3W2OA 2UZEA 3V01A 3O2MA 4BYIA 3RAWA 2XALA 4FEUA 5BVNA 4F09A 1ZZ2A 2R3NA 4RSSA 4XV3A 3FLZA 4R5SA 4LYNA 3HYHA 4AT5A 5J5SA 2ZVAA 4FUYA 5J7BA 3NLBA 2Z8CA 4XG3A 3FMMA 3OEFX 3OWKA 4IJ9A 4DFYA 3VUKA 3R28A 3DXNA 3A7GA 4QTDA 1LP4A 4O0SA 4RVTA 4LGGA 4NCTC 5J5TA 2WD1A 4XG6A 5H8EA 4RG0A 1PXLA 2OW3A 2ZV9A 3O7LD 5AEPA 4FOCA 4IWOA 3RPRA 4JLCA 1XO2B 3KVWA 3Q4UA 1PHKA 2JIIA 3GU6A 4AGWA 5IG1A 3QTSA 3Q2MA 2XH5A 1CMKE 4ITJA 3HV7A 4IFCA 3QQFA 1PJKA 4RX7A 3KMWA 1X8BA 5AIKA 2ITUA 5FGKA 4O84A 5IQEA 3DTWA 3R1NA 4FIFA 2YFXA 3DAEA 3GFEA 4F08A 5DMZA 1KOAA 4QOXA 1IR3A 5AM7A 3TUCA 1PKGA 3EMGA 1XH7A 2PY3A 2WTCA 2XJ0A 2RIOA 2X7OA 3MI9A 3NS9A 4RQKA 4QYYA 5EM7A 5KMJA 4J97A 4XP2A 3OG7A 5TKDA 2OG8A 3RM6A 3IONA 3MH2A 3QQHA 1P14A 3ZRMA 4DEGA 4AZWA 3UQCA 4J8NA 1GIIA 3QCYA 1H26A 1ZXEA 2VO0A 3O8PA 4C4JA 4B0GA 4TRLA 5HG5A 2DS1A 3W1FA 4C37A 3HV6A 2ZDUA 4E5WA 1Q4LA 3LFSA 1FMKA 2XK8A 4MF0A 5AP5A 4EOJA 3TUBA 5L2IA 2QURA 4FKSA 3HGKA 4JAJA 4JDHA 4CSVA 1MUOA 2OK1A 4I92A 1SVEA 2VTQA 4ZLZA 4FF8A 4TYHA 2XIKA 2QOOA 4FVQA 5EI6A 5JZNA 5KKRC 3I7CA 3LFQA 3PA3A 3QRKA 3Q6UA 4F1TA 3CD3A 2PZIA 3TNPC 3CCNA 2WIPA 4FNWA 4AA0A 4C59A 2QVSE 3BWFA 2GNLA 2J5FA 2Y7JA 2RFSA 1YXUA 4V04A 4AXDA 2ITNA 3DNDA 3UIMA 1OIRA 1ZOEA 4XG2A 3A4OX 3KXZA 4E5BA 2WMWA 2O2UA 1FINA 2QU5A 3H3CA 1VYWA 4O4DA 2YM5A 3HMIA 4C2WA 3TV4A 3DXQA 2RGPA 4UXLA 4D4VA 4G3CA 4GUEA 1P2AA 3OS3A 1GZKA 3EKKA 2AUHA 2FSMX 1H1SA 4GW8A 3FI8A 3RALA 4RVKA 2Q0BA 2WMRA 3ELJA 1WBNA 3IDBA 4ACCA 4C35A 3NVMB 4YGAA 4FSYA 3R1YA 4UMRA 3BHYA 2WQOA 3HP5A 1OPKA 3QHRA 3RHKA 3QQKA 3ERKA 3Q2JA 2WELA 3UIBA 1LEWA 1PXOA 1TVOA 3KK8A 3ZLWA 3KGAA 4J53A 4MQ1A 4S34A 3RWQA 4XX9A 4HZSA 2F4JA 5L2QA 5IEXA 4TYGA 1JPAA 3VUDA 3JY9A 4ANBA 2WKMA 1QPEA 1W84A 2V7OA 3OWLA 4HYUA 1APME 1KE8A 5CZIA 5IUIA 2HXQA 2C0OA 4KS8A 1PXNA 3U4UA 4PPBA 5K0KA 4EOIA 4QP3A 4R77A 4QDVA 3TYKA 1KE7A 3AGMA 4QNAA 4EOLA 3LM5A 4FGBA 1SNUA 3N4TA 2UUEA 4FV7A 2V5QA 3UDBA 4O7TA 3UPXA 2W9ZB 5ANGA 5J9LA 3M42A 3ZSHA 5IQGA 1OVEA 4CMTA 4I20A 4NM3A 5DEYA 4EWQA 1YXXA 2UZNA 3UIXA 4D4RA 4BKJA 1XH4A 3FXZA 2YWPA 4JRNA 3WF5A 4BYJA 5HNIX 4LMUA 1UNHA 3L1SA 3DS6A 3TZ9A 3D14A 4QPAA 3U4WA 3PY1A 5F94A 1Z57A 4CT2A 4JVGA 4BDBA 4PDSA 2OXDA 2UW7A 2J5EA 4BCMA 3KCKA 4X3FB 5IQDA 1FBNA 2XZSA 3FDNA 4RBLA 4DBXA 5L2TA 4XH6A 2P55A 3LFAA 5CU6A 2X9EA 2C4GA 1YI6A 5CF8A 3E3BX 4QTEA 2IZSA 4V01A 4DAWA 2HWPA 5AUYA 3E7VA 4RIWA 2J0JA 4RJ4A 4USDA 3KVXA 3SVVA 3MESA 3BE2A 2J2IB 2GSFA 3I79A 5JKGA 4I6BA 4E4XA 2G1TA 1O6LA 3CY3A 3COMA 3DNEA 3A7IA 2HOGA 4GV1A 4FL2A 2X39A 3O50A 2OJJA 3DT1A 1H1QA 1BX6A 3MVLA 3C5IA 1XBCA 3AT3A 5H8GA 3QF9A 5DPVA 4FX3A 2JBPA 3BLHA 5ETAA 4BF2A 3EN4A 4NIFA 3PXKA 3F3WA 4O1PA 4X2GA 5A6OA 3N4VA 2W99B 5KZ0A 3NCZA 4R7IA 4BR3A 4BCOA 4I94A 4DG0E 2QODA 2PZ5A 3ZYAA 2OZOA 4GKIA 2OZAB 5IQHA 4FSTA 4QYGA 1F3MC 3OCGA 4YJOA 1REJA 1OL2A 4MHAA 4BGQA 2XIYA 2GFSA 3F5PA 4F0IA 5FTOA 3JVRA 3SOCA 3Q04A 4YZNA 1VYZA 4G1WA 4UALA 5CU2A 3W32A 4PL4A 2HW6A 3EJ1A 3IPHA 2P3GX 4WA9A 3BE9A 1FPUA 3BLRA 3H4JA 3WOWA 3ZU7A 4D1XA 5JH6A 3KF7A 3HV4A 4I24A 2C6LA 2UW6A 4LFIA 4AGCA 4DEHA 4F63A 2HW7A 3KEXA 2Y8OA 4N0SA 3SW7A 4IACA 3R7OA 4H39A 2ZM3A 3GVUA 1XH8A 3KULA 4WNMA 2Z7RA 4ZSJA 2ITOA 4EH4A 5AV3A 3G6GA 2CN8A 4AZVA 4CQEA 4NU1A 4QTCA 4DEBA 4PMMA 5JEBA 2KULA 1OL6A 3QKMA 4BFMA 3LM0A 5CEIA 3AD4A 4BRXA 3EHAA 1J7LA 2P2IA 2Y6OA 5IDPA 4G31A 4PMSA 1WFCA 5AP3A 3RMFA 4YSJA 1J7IA 2HENA 3G15A 4X3JA 1FQ1B 5E1SA 3I0OA 4D1ZA 3ATSA 4WD5A 4QPMA 4WUNA 3TCPA 3SW4A 2PZRA 3DB6A 1W2DA 3V5QA 5BUIA 5GJDA 3CIKA 1KE5A 3FSKA 3PXFA 3P5JC 4NL0A 1ZY5A 3CGFA 4GT4A 4EH7A 4DGLC 4U81A 4OR5A 4YZ9A 4Y5HA 3F88A 3THBA 4PP7A 1RJBA 1VZOA 4BIBA 4F9BA 4L42A 3UQGA 3UIUA 2VWXA 1R39A 3P78A 4FUXA 4I0SA 3KMUA 5HE0A 3VUMA 4I93A 5HIDA 5K4IA 3LQ5A 1JKTA 2WMTA 4R1VA 3JUHA 5F9EA 4QQTA 3UJGA 3JPVA 4ALUA 3ORXA 4X0MA 3NUNA 4EQUA 5HTBA 4JG6A 4AZSA 3K5UA 2OJFE 5LMKC 3HLLA 4EK8A 2FO0A 1E9HA 5EM5A 3VRYA 3QTXA 4FZ7A 4IQ6A 5LVPA 3GBZA 5KUPA 4BDJA 3BU5A 1JSUA 2FSTX 2W0JA 2QOLA 4ID7A 3W16A 4A9YA 5CSWA 1IG1A 2JAMA 4I1ZA 3Q4TA 5C8KA 3CKXA 4L53A 4CMOA 2B0QA 5AV1A 4MCVA 1PXIA 3AC2A 1VLRA 4ALWA 3HUBA 3VHKA 4D58A 4YNOA 2V55A 4MEDA 4UB7A 2YABA 3GENA 4F6UA 2WEVA 1TQIA 4JT3A 5FBOA 4U97A 3UMXA 1KSWA 4FRFA 2IVUA 3GFWA 1QPJA 3AG9A 4M68A 3ZSGA 3V3VA 1JSVA 1XH5A 2EB3A 5JFSA 2C6KA 4HNIA 3KXNA 5CAVA 4ZK5A 4F6SA 3R8PA 3ORKA 4QQJA 4U7ZA 4WBBB 5LWMA 4C7TA 5HG7A 2ITWA 4ERWA 3VUTA 1JNKA 3FMJA 3A4PA 3B2WA 1H4LA 2QLQA 3EQFA 3QZGA 3PY3A 4OTIA 3BYUA 5AIRA 3BL9A 4PDPA 5DIAA 5LMAA 2R3LA 2XM9A 4G9RA 3VS2A 5CEMA 1ZY4A 3MVHA 1Q99A 3MB6A 2JKMA 3U6HA 1FVRA 3BGZA 5AAFA 3NRMA 3NYNA 3V51A 3C0IA 1TKIA 2E9VA 1S9JA 3TIZA 2NNWB 4JQEA 3UPZA 1OL7A 3BRBA 4TKSA 3Q53A 3LQ8A 2WQEA 3TKUA 5EHOA 3ZCLA 2CKQA 3GU8A 1Q61A 3G0FA 3KC3A 3F66A 4EWHA 5M56A 4MUQA 5FUTA 4DGGA 4C36A 3E3PA 4NYEA 4C3FA 2EUFB 2B54A 2YIQA 4FTOA 4FV8A 4YURA 3BHVA 3D7ZA 4I41A 1LPUA 4KBAA 3EFLA 3QZHA 3G33A 2XB7A 3R2BA 4FTMA 3UO4A 3RAIA 1OUYA 4O22A 2I0EA 3Q4CA 5GHVA 1AD5A 3R9NA 4DHFA 3CLYA 5HG8A 5IMXA 3P1AA 5J79A 4PL5A 5AP0A 3RI1A 2Z7SA 4QTBA 4AE6A 4CCBA 2JDOA 3P7CA 4D5KA 2X0GA 4MXOA 2UW8A 5GJFA 3MPAA 1YQJA 1B6CB 3EN5A 3UYTA 3HDNA 4DG2E 2BZJA 5KMNA 3GEQA 4E6DA 3PIYA 1ZLTA 2QC6A 3ORMA 4QRCA 4FL1A 4U5JA 1DI9A 2JEDA 4FSQA 4PNIA 2QG7A 4TTHB 3NMUF 3TKHA 4ACGA 4OTGA 5C1QB 3HMNA 4O0RA 5CVFA 4MTAA 5IZFA 2VZ6A 4BIEA 3F9NA 2W1EA 4QMYA 3BU6A 3A61A 3G9LX 4PPAA 5T68A 2BTRA 3VUGA 2IEWA 4A07A 3UNKA 3VBTA 2ZMDA 4YLLA 5FG8A 3DA6A 3RVGA 3LMGA 3OF0A 5HZNA 5CEOA 3F69A 2X7GA 3KRLA 3VJNA 3BHTA 4D5HA 2OIDA 4TW9A 1UWHA 4UYAA 4ZSGA 3S4QA 5AAGA 3EZRA 4YLKA 2YM4A 4DTAA 1YXVA 2XK9A 1SMHA 2YCQA 3DAJA 3F3TA 3NW6A 4BHZA 1BL7A 3KIOC 4KD1A 4F65A 5AUWA 4P2KA 2PVYA 2PL0A 3QLGA 1S9IA 1PY5A 3OT3A 5DT3A 2XKCA 2ZB1A 2WMUA 3HKOA 4I4EA 4L3PA 4MNFA 4JQ8A 2BKZA 4KS7A 4FV2A 3DXPA 4QMLA 2PHKA 4GFMA 3FE3A 4UN0C 2VWBA 3O51A 5HVKA 4JX3A 3I0QA 4D2VA 2AQXA 5E8ZA 5IU2A 3ZSIA 5CSHA 2QR8A 3R9RA 2YDJA 4IAKA 5ACBC 4CEGA 5JN2A 4ZY4A 2W17A 2YLFA 3TNHA 3VS1A 3PXQA 4BCFA 4FKRA 5DR9A 2CNUA 1ZZLA 3QCQA 4XOZA 3QTWA 4YNEA 5EKOA 5CSVA 4FEQA 3U8WA 3WZEA 4HYIA 1W98A 2FA2A 1OIYA 3TEIA 2PMOX 2XNGA 3W2SA 3W0NA 1UWJA 3OWJA 4FSUA 4W9XA 3ZZWA 3OCBA 3SDJA 4AG8A 4HVGA 2VTOA 2XA4A 2PVLA 2E9OA 4FIJA 3BLQA 2GS6A 4FG9A 2R3GA 3ETAA 4ZSLA 2VGOA 5IA1A 2YHVA 3ULIA 4I6FA 4DEEA 4NSTA 4FTAA 3QA0A 4JR3A 2XNMA 5E8XA 5L2WA 3O96A 5CVHA 4GK4A 4W4XA 4EH3A 5EDPA 2BHEA 1YXTA 2O0UA 3F7ZA 3P08A 4OT6A 4S32A 5BVEA 3RK7A 4V05A 2C0IA 3RK5A 3PIXA 4LL5A 5IA2A 5E8VA 3A8WA 3CP9A 4CFNA 4G5PA 4EOPA 3P7BA 3C4EA 4NKSA 4KAOA 5DA3A 3WE4A 4B4LA 2X9FA 1IAJA 2XAOA 3WYXA 3LCDA 5DOSA 1U54B 3U55A 3A60A 3O7LB 3BELA 1ZYSA 2UW5A 4D2WA 3DK3A 4YZCA 4RZVA 2GS7A 2QOKA 4YPSA 4L01A 3ORTA 3OP5A 4YJPA 4K9YA 4RC4A 4X7QA 4ZJJA 4XBUA 2JKOA 5EYDA 4QP7A 3FQHA 1T45A 4DFZE 2Z7LA 5CSPA 3I6UA 4ZTNA 3H10A 1WVXA 2G2IA 1OMWA 3K3IA 5AJQA 4HPUE 3QFVA 3U87A 4AX8A 5C4KA 5L8KA 3FMKA 4OBQA 1ST0A 3MVMA 5CAQA 5C27A 3RPOA 1JAMA 3UTOA 2EXEA 4F0FA 4FKQA 5TT7A 3PVUA 2YISA 4IAYA 2YERA 2W7XA 3L9MA 3RZFA 5HG9A 2JBOA 4FT5A 4EH5A 3DJ6A 3F2NA 1H07A 3LXKA 3ORNA 4HGLA 5CYIA 2W1DA 2PVKA 5HGIA 3RCDA 1A48A 2FUMA 1YDRE 1DM2A 2BVAA 2WZJA 1GNGA 4IHPA 3OW3A 1FGKA 3G2FA 5ANDA 4JXFA 3TXOA 3WIKA 4IWQA 4JIKA 5KBRA 4DN5A 3DFAA 3OMVA 3PJ2A 1A9UA 4O4CA 4BBFA 3E93A 4FOBA 2BDJA 1SZMA 3MWUA 3C5UA 3EN6A 2IZTA 4PTGA 1HOWA 5ETIA 2I7QA 3VULA 4CQGA 3LXLA 4MNEB 4YTFA 4U9AA 2Z60A 4GRBA 4RJ5A 3HNGA 3ZO4A 3FY0A 2W5BA 3M2WA 4E20A 5HORA 3W2QA 5CU4A 4ZEGA 3FBVA 3P5KA 2RG6A 2ITPA 4ENYA 3V5LA 3HP2A 3NUPA 1GIJA 3P9JA 4RA5A 4E6AA 1Y6BA 3EWHA 5K5NA 1Q3WA 4ORKA 2NP8A 3PJ3A 2BZHB 2BDFA 4H3BA 5EM8A 4EHEA 3ANQA 4JX7A 1R0PA 2JIVA 3EIDA 4H3PA 4M7IA 2PK9A 5JRSA 3PVGA 2I6LA 3MJ2A 3G51A 3LKMA 4R1YA 2WQNA 4KIKB 4NUSA 5EFQA 5JMSA 5AV4A 5KCVA 3NNVA 3DJ7A 2WU6A 3OTUA 4QP1A 3MDYA 3OOGA 2VWZA 3M1SA 4HOKA 4MXZA 4Z55A 2XK4A 2OWBA 3HVCA 3TWJA 2R3PA 3MGYA 3QD3A 3S3IA 5LCJA 4O6EA 5HO6A 2PMNX 3FYJX 4QMUA 4F1OA 5I5ZA 3C1XA 1OI9A 2JGZA 3R63A 2F57A 3FI3A 3LFBA 3QZFA 2YITA 4G3DA 4NT4A 4RVMA 1TFFA 2OH0E 1SYKA 4QMZA 3W10A 2C3LA 3QTRA 4OTFA 4F64A 4F9YA 3Q5ZA 1OUKA 3TV7A 3PSDA 4PF4A 1YI3A 5L8JA 4D28A 1XMMA 3ODZX 3JVSA 3TJDA 1SVHA 2WGJA 4IZ5A 3DGKA 2RKUA 1B38A 3FPQA 3OWPA 2OZAA 3FLYA 5HVYA 3CPBA 5E4HA 4DINA 4M69B 4BWXA 4WG5A 4JRVA 1CSNA 5DI1A 3ZLYA 5KMMA 5M4IA 2Y4IC 4L44A 5AP2A 4BL1A 3CXWA 3R30A 2IW8A 4EC9A 3W2CA 5GZ9A 4X2NA 1XH6A 3NCGA 4DT8A 3Q3BA 1M2RA 5J95A 4OTRA 2DYLA 4UEUA 4OBPA 1OB3A 4YZMA 2XKDA 5FDXA 2PE2A 5CU0A 5FQDC 4FIEA 5M4CA 3S1HA 1J1CA 1Q3DA 3AGLA 3HECA 2PVRA 3C50A 5HO8A 3BYOA 3IO7A 5F1ZA 5KHXA 3WBLA 3TZ8A 4I5CA 2V0DA 4EJNA 2ZDTA 4KIPA 4S31A