4M14A

Crystal structure of itk in complex with compound 9 [4-(carbamoylamino)-1-[7-(propan-2-yloxy)naphthalen-1-yl]-1h-pyrazole-3-carboxamide]
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
263
structure length
263
Chain Sequence
KWVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWRERPEDRPAFSRLLRQLAEIAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Selectively targeting an inactive conformation of interleukin-2-inducible T-cell kinase by allosteric inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 263
sequence length 263
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4m14A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4m14A01
2PY3A 3HYHA 2FSOX 1IAHA 4WBOA 4XP3A 3EN5A 4R7IA 2I0VA 3DTCA 2CGWA 3EQPA 3G9NA 5CSWA 4ZZNA 5BVFA 4O7NA 2W96B 4C37A 3BBTB 3EL7A 3F3UA 3LKMA 2OSCA 2YCSA 1KSWA 4WKQA 3HLLA 3PVBA 4MX9A 4BTFA 2VX1A 3R8PA 5DLSA 4CMOA 2O63A 5DGZA 5CYIA 4I20A 1WVXA 2PVFA 3P5KA 5KMOA 4G6OA 4FF8A 2WMXA 2QONA 3RGFA 4EHGA 4IXPA 4E8AA 3AC4A 3R83A 4GUBA 5JRSA 2W1GA 5ANOA 1H0VA 5ETAA 3UMXA 3WE4A 3HRCA 3ZO4A 1ZLTA 3P79A 5KZIA 5D41A 4EH7A 4QPAA 4C4EA 4GG5A 1ZYSA 5CVHA 4DEAA 2XJ0A 4U80A 4C34A 4AWIA 2RKUA 3EN7A 4EZ3A 5DN3A 3UG1A 4MKCA 1Q99A 4USDA 4C38A 5IUIA 4D2PA 1WCCA 1GIHA 4NT4A 3W18A 3DJ7A 4I92A 1FVRA 1NXKA 3AMYA 3LM0A 4P2KA 5I3OA 1IA9A 2CNUA 5E8XA 3RINA 3ZTXA 4JLCA 1SVHA 4F4PA 1LPUA 2UZOA 3W2RA 3C1XA 2UZLA 4RQVA 4HVSA 5KUPA 2OF2A 3LLTA 4PY1A 5KE0A 4FSTA 4O0TA 4ANBA 4O7LA 4CFUA 4H1JA 4UWYA 3E93A 4AGDA 3ZCLA 4EL9A 3KK9A 2QOQA 3I81A 3VUMA 3IK3A 1A9UA 3KQ7A 3ACKA 4I6FA 4PDSA 1AGWA 5DHJA 4YTFA 3UOKA 2GHLA 1ZYJA 4AZSA 4OTDA 1K9AA 4BN1A 4IE9A 2XH5A 4WNKA 3NEWA 4RVKA 3QZIA 5HESA 4O81A 3BYMA 4UZDA 5ETIA 3HMNA 3Q4UA 4QQTA 2BMCA 3E3PA 4A9TA 1H25A 3EB0A 2PMLX 4FC0A 5CTPA 4Z3VA 5HTIA 4UXLA 1JNKA 4JDIA 4L7SA 2PE0A 2HIWA 3E5AA 2QR8A 3VS1A 4BHNA 3S1HA 3LQ3A 2XEZA 4JQ8A 5LCJA 3ZOSA 4B9DA 2UVZA 4FV2A 4NWMA 4GSBA 4I22A 5HO8A 2A0CX 5I5ZA 2WMRA 3P86A 3MVMA 5HVKA 2ZOQA 2UW3A 4WA9A 1OL6A 3QQFA 1ERKA 1UKIA 4U8ZA 2C0TA 2IZTA 1Y8GA 3I7BA 4A9YA 1OKZA 2I0HA 3HRFA 5CZHA 4ASXA 1XH6A 1OI9A 2DYLA 4XUFA 3ZRLA 4UALA 3SKCA 2J51A 1ATPE 3FMLA 2V22A 3IGOA 1BL7A 4RGJA 5M4FA 1Q8ZA 3PVUA 4C3RA 4AW0A 2RIOA 2P33A 2EU9A 2DUVA 3F3WA 4BTJA 4D4VA 4RVLA 1S9IA 3KRLA 4EOSA 5LVMA 5D7VA 5ICPA 3F69A 3GXLA 5J87A 1P4FA 2XMYA 3IDPA 4FT5A 4RMZA 4BBMA 4OTPA 4QMSA 4W4WA 3ZSGA 2JIUA 2W99B 4IB5A 5AMNA 1ZOGA 3SW4A 5I9XA 4F9CA 3N51A 3FI2A 3OT3A 2C0IA 2YM4A 3NS9A 4EH4A 3UPXA 1SM2A 4K18A 2A27A 2OK1A 2PMNX 4M8TA 5CVGA 5BYZA 5J7HA 4BBFA 3ZLWA 4O0SA 2W05A 2LGCA 3O71A 4C3FA 4GYGA 2OZAB 2XNMA 2UVYA 4QMPA 3I6UA 2PVJA 4L46A 4U97A 5J8IA 4TXCA 4AA0A 4AFEA 4CT1A 5K4IA 3FKNA 4RC3A 3FZOA 3N4VA 5M06A 5ANKA 2B55A 5LMKC 4D1SA 4C33A 2BFYA 4J7BA 2OLCA 3E88A 4EI4A 4NUSA 4FKQA 2BFXA 3AD5A 3C0HA 3Q4TA 2GFCA 4M67A 3VF9A 3Q9ZA 3TJDA 4YZDA 4BDBA 5CVFA 2VRXA 3OTUA 4CNHA 2BHHA 3QQUA 3GOKA 3KRRA 4BCNA 4YMJA 3C4ZA 4FODA 2XKCA 3V01A 3OW3A 2BVAA 3ULZA 2WTDA 4MXCA 2XK9A 5BVNA 1UV5A 5HX8A 3JY9A 4F0GA 3OWJA 3OBGA 1MRYA 5IMXA 1GZOA 3SA0A 2ZYBA 5C9CA 3VUGA 3BCEA 4UY9A 4QPMA 2XRWA 3ORIA 1UU9A 1YI6A 4C4IA 4IB1A 4C2VA 3D5XA 4LUDA 3W2PA 4RX5A 4EH8A 2RFSA 4R8QA 2QOIA 3GU8A 4G3DA 4BKJA 4EJNA 1JBPE 3QKLA 4I41A 5J7BA 2O65A 1VJYA 5M08A 3GFEA 3DZQA 3G9LX 4O7RA 4FIEA 5EKNA 3A2CA 2WTVA 4FTKA 5JFXA 2ITUA 4DEGA 3VQUA 2PVLA 2GNFA 3MFSA 3QTQA 4JR7A 4I3ZA 4RIYB 4EOQA 3PWDA 2YJSA 3KY2A 2XIYA 2OO8X 2CN5A 4MBLA 2XZSA 3D2IA 4KAOA 2HXLA 3K3JA 3QRTA 4L00A 3FLSA 3ORXA 5ANEA 3EFKA 4F1MA 4TRLA 5CU4A 4AE6A 4I0TA 3ERKA 3COIA 1JLUE 4FV4A 3ENHA 2QG7A 3ZUVA 4OW8A 3LOKA 4X2JA 4WIHA 3UJGA 3M11A 3A7IA 4TZRA 1JWHA 3NW5A 1CDKA 1STCE 4FZFB 2ESMA 4D9UA 3GC7A 2EB2A 3TG1A 4BGGA 4D4RA 4DCAA 4RFYA 2IW9A 3KVXA 2EWAA 1QPJA 4JDKA 5KMNA 3FPMA 3RAWA 1KE6A 5AJQA 5IQIA 5EM8A 4CFMA 4P5QA 3IKAA 3D94A 4X6RA 2I7QA 4HGSA 4F9YA 4GFMA 3V5JA 3SXFA 2CMWA 4LI5A 3AMAA 1YDTE 4JR3A 3ZFXA 2F7EE 3BGPA 2J90A 2YEXA 1YOJA 3BHHA 2R3JA 2BTRA 2BZKB 2ZDTA 2REIA 5GINE 1PYXA 1OIUA 1KV1A 3KMMA 4KS8A 5IQBA 2QLQA 3R01A 4FKJA 5LMAA 4CMTA 4GEOA 4ALWA 3ORPA 2E9PA 3UYSA 1XBAA 3VUKA 3S0OA 3K3IA 4BCJA 4J52A 3FPQA 4X2KA 3UVRA 1W82A 4FKPA 4YUQA 4BIDA 2I0EA 2IZUA 1QPCA 5HU9A 1LUFA 2AUHA 2X0GA 3PA3A 4X21A 3OCTA 2WMWA 2EXEA 2XRUA 4O6LA 4AT5A 5GHVA 3F66A 4IVAA 4PUZA 2WTIA 3FLQA 5D11A 4QTEA 2ITYA 3ZEPA 1PKGA 3O8PA 5M53A 3UP2A 3FYJX 3GC8A 2QNJA 3UO5A 3KRWA 2WTCA 4KA3A 4HCVA 3I7CA 3UP7A 4KKHA 3LJ2A 4I5CA 2PK9A 2GU8A 3I6WA 4BCKA 3QXOA 1Y8YA 5CT0A 3VULA 1FGIA 3TTJA 4E6QA 5AR2A 3Q04A 4RZWA 1PXOA 1Y91A 4XV9A 4AS0A 4F7LA 2QOFA 3LIJA 3ZC6A 4M69B 3A7JA 2BRHA 2PYWA 3OTVA 5ACBC 4DC2A 4FSZA 3I0OA 3PXKA 4I6HA 5CZIA 4KRDA 4GK4A 5E1EA 4G17A 4ITIA 3VF8A 4L44A 4HVDA 1GZNA 3FC1X 5IA2A 5FQDC 4ANMA 2XA4A 4KD1A 4NFMA 5C03A 5BYYA 1W0XC 5HCZA 3UC3A 4RJ3A 5EHOA 4AW5A 4YU2A 5I9WA 3CCNA 1GOLA 1Q8YA 4OGRA 5CI6A 2JBOA 3ZZEA 4QYGA 5JMSA 4AX8A 4GFGA 3QD0A 2B9IA 5IQHA 4GYIA 2J0IA 2ITPA 3TT0A 1TQIA 5FBOA 2IVSA 5LXMA 3LHJA 4Z55A 3R7GA 5DMZA 5IF1A 2DQ7X 4I5HA 3E8CA 5HBHA 3VO3A 4UWCA 4UMRA 4Q5HA 1OM1A 3MVHA 4FZAB 4ALVA 5IMEA 2GMXA 3HMPA 3Q6UA 3MBLA 4HYSA 5HNGA 4ZMFA 4JG8A 3OOGA 3FAAA 4IZYA 5K3YA 4N0SA 4K9YA 3RPOA 1XH5A 3F61A 3T8OA 4DT8A 2ZAZA 2QOLA 1GIJA 3EHAA 3ORZA 3EL8A 2YIQA 4LMUA 4XG9A 4CKJA 4U7ZA 4FV8A 4II5A 2BDFA 5HLWA 5JK3A 1OPKA 1OKYA 4QP9A 5CENA 3F82A 4X2GA 4FSYA 2XNBA 4BCIA 4Y8DA 3D0EA 3VRZA 4I4FA 3V5WA 5CT7A 3HMMA 1FINA 4PNIA 4F63A 3GU4A 5HI2A 2R3NA 3FE3A 3MB7A 2CCHA 5CQWA 5CX9A 3VS5A 3LE6A 3DY7A 3V5LA 3Q9XA 3R9DA 3D9VA 4PTEA 4EONA 3VBXA 2P2IA 2R3RA 2HELA 4CRLA 4F1TA 4XV3A 1XKKA 4H58A 4CFVA 3ZFYA 3SG8A 5IA3A 3NUUA 3MY0A 4IX5A 2X39A 3NUXA 3A7FA 4IX3A 3OW4A 5K9IA 2W5AA 2VTMA 2WMAA 2OICA 3ODZX 3SG9A 1LR4A 4IC7A 4U42A 2R2PA 1Q5KA 1ZOEA 2HWPA 4C35A 2A19B 4AGCA 1ZWSA 2OZAA 3O0GA 4L7FA 4YJRA 3EFJA 2G01A 1U46A 4G16A 4EK8A 3CPCA 5DR9A 4D2TA 2UW8A 4FK3A 2X2KA 4FMQA 4Q5EA 5IQAA 3E8DA 2OU7A 3JY0A 4FUXA 3VHKA 3F5GA 2HZ0A 3ORNA 4FTLA 3TZ7A 4J99A 2W17A 3GU7A 4FBXA 3ZLSA 3EN6A 2BR1A 2E2BA 4JXFA 4RFZA 4DH3A 3R1QA 2JDRA 3TUDA 3T3VA 2VUWA 4LV8A 1OB3A 3COMA 3UDBA 3E7OA 3BIZA 4XCUA 3AD6A 3DAKA 5I9VA 1PXLA 1PXPA 3DKOA 3DLZA 2XIRA 3MTFA 3B8RA 4GMYA 4J98A 4NM5A 3NIZA 4O2ZA 1YOLA 1OZ1A 4EZ5A 1OL5A 3QWKA 1PXNA 3GC0A 4J1RA 2XM8A 4A9UA 5AA9A 4WD5A 2PVYA 4FK6A 3PSBA 2C0OA 3QKKA 4ZTSA 3UMWA 3WZEA 3DAEA 3WZDA 3FI8A 4EQUA 4EOOA 2C6LA 3FDNA 2ITNA 3PFQA 3ZONA 3TKHA 5I3RA 3QALE 3BE9A 1YXUA 4JRNA 4TYJA 4AW1A 4BI0A 3R7IA 4EBWA 1KWPA 3NUYA 4FKLA 3RHXA 4XG4A 5IDNA 4XBUA 1H1QA 4R3PA 3KGAA 1HCLA 2ZB1A 4QQJA 4YJVA 4EK6A 4F1OA 3HV3A 4GCJA 4EJ7A 1XJDA 3QCXA 4RIYA 2VTAA 2GDOA 1ZY5A 4C58A 5K5NA 4QNAA 1RJBA 5AUTA 1KV2A 2QHMA 3HP2A 4FIJA 1KE7A 4PMTA 2BAKA 4S34A 5L2QA 1GZ8A 4D9TA 2VTNA 5FEQA 2UW6A 2GFSA 2WU6A 4LM5A 5JEBA 3RK5A 3WF8A 3C51A 5FTGA 3E8EA 3KXMA 5EI8A 3SRVB 4ZIMA 2GTNA 1H24A 1PMEA 4XS2A 5LVLA 4MYGA 2PHKA 5H9BA 4X2FA 2QURA 4DFLA 1JKTA 4BL1A 3QGWA 4PRJA 1YDRE 1WBVA 3BHTA 4OAVB 5DRBA 2ZMDA 2H9VA 3QD4A 2RF9A 2JDSA 4MTAA 3HMIA 4RA5A 4YC6A 3R7OA 4C62A 5G1XA 2OZOA 1ZZ2A 3CEKA 4UN0C 4NW6A 5A6NA 2BKKA 4AGUA 2R3QA 5IA1A 1R0EA 3MTLA 4FIFA 4LGDA 3P78A 4U45A 5CWZA 4P90A 4UZHA 3P0MA 2JAMA 1VEBA 3F3VA 1H1SA 5ITAA 1WZYA 5I9UA 3LFFA 4BDCA 4W8EA 3HA8A 4QMTA 4NJ3A 3WZUA 3U4WA 4TPTA 3T9IA 2IVUA 4NM3A 3ID6C 3UIMA 4EOMA 3H4JA 2C5NA 5F9EA 4FNZA 4J96A 2PUIA 2HENA 2YDIA 2Y8OA 2YHVA 4DYMA 5LCKA 1WBNA 3L8PA 4QMZA 3ZM4A 5M56A 4RJ6A 3KCFA 4EHEA 3EZRA 2RG5A 1QL6A 4BCHA 4UXQA 3MS9A 5AP5A 2OIDA 4YPDA 3NUPA 3PXQA 2KULA 5A4EA 1MUOA 5CLPA 4O38A 3GQIA 4BKYA 5D12A 3UOHA 4FT7A 3VUDA 2CSNA 4M15A 1WBPA 2UZDA 3SW7A 4UB7A 4CCBA 4I0SA 4B0GA 3BWFA 3QX2A 3K5UA 5IH5A 5C27A 3RBWA 2ZM4A 3OUNB 2YM3A 4X2NA 2C6MA 5GIPE 3PZEA 4AN9A 2JITA 1T46A 3R8MA 4MF0A 3WZJA 2V55A 2VX0A 1CSNA 5IISA 1H08A 1XR1A 4E4NA 4O7ZA 2XK7A 4ENYA 3HDNA 3NAXA 4BTMA 1BI7A 3ZO2A 5LVOA 5GZ8A 2CCIA 2RFEA 3FC2A 4C0TA 3QTIA 4ZK5A 4BZDA 4CRSA 1UU7A 3NYVA 4E20A 5L3AA 3UQCA 4FE2A 3DK6A 2IW6A 1NT2A 4PP7A 2XK6A 2XS0A 3M2WA 3AXWA 4BY9E 4PV0A 2YWPA 4FICA 2JEDA 4LGHA 1MQBA 4O7YA 1F3MC 3C13A 2NNWB 5CQUA 1PY5A 3ANRA 3W10A 4IVCA 2J2IB 4B4LA 5A4CA 4FSQA 3ZDIA 4BC6A 2VZ6A 3SD0A 5HNBA 2NP8A 4S30A 3VBYA 3ZMMA 4CFXA 5BYLA 4AA5A 4F6UA 4JBVA 4FIHA 5FD2A 3OP5A 1JAMA 1A06A 2PVHA 3HNGA 2WZJA 5JT2A 2JDVA 4X6QC 3V51A 4MWIA 3V5QA 4MAOA 3ETAA 2XUUA 4C3PA 2V5QA 3NMUF 3TNPC 4JBOA 3Q2JA 1OL1A 4I0RA 4DE4A 1JKLA 4DTBA 5FWKK 4CSVA 3W32A 4BYJA 3E92A 4FG8A 4FKTA 4KSQA 2VV9A 5C8NA 5M4CA 3ELJA 1YRPA 3SXSA 2YAAA 4FOBA 4FSUA 3ZXTA 3OY1A 3P7BA 3JXWA 2VNYA 4WNMA 4BDJA 2O8YA 3DQXA 3BV2A 4EH2A 4IWPA 3KN6A 1IEPA 3F3TA 3QYWA 4O96A 1YXSA 5BMMA 3R28A 1DI9A 3MJ1A 3OXIA 3JPVA 1CM8A 4ZLYA 5EYKA 5JSMA 3FEGA 5J79A 3KREA 3U6JA 3H0ZA 1P4OA 1OPLA 1PW2A 1ZAOA 2Z7RA 4FZ7A 5I4NA 3A8WA 3OMVA 3QTZA 5EFQA 1PF8A 4RT7A 5LQFA 4TYEA 1SMHA 4OR5A 3BLQA 1URWA 2VGOA 4PL5A 4M68A 3MV5A 5ANGA 2XB7A 2PZ5A 3R9OA 4OTHA 4E6DA 4NSTA 4HGLA 4FTOA 2YDKA 3KB7A 3KF7A 4AXAA 3AGLA 5DT4A 4DH5A 3OD6X 4LGGA 3O17A 3NNUA 4FV1A 4MD9E 2GSFA 1R39A 3LFCA 1SNUA 3DBQA 4EOKA 4RJ8A 2WGJA 1PMVA 3ET7A 3EZVA 3RNYA 2FSLX 1W8CA 1F5QA 3R63A 3OBJA 1I44A 3HV7A 5CSXA 1U59A 4K0YA 4QQ5A 2R4BA 3S95A 3U51A 4RBLA 1DI8A 2GS6A 3VBVA 2OH0E 3PXFA 3M1SA 4BI1A 3KXNA 5F94A 4WUAA 4NKAA 3FZ1A 3FL4A 3ROCA 2PZIA 4A4LA 2YA9A 2JDOA 5AIKA 2J0JA 5LOHA 3DBFA 4JL9A 4DN5A 3BYVA 3I5ZA 3DU8A 4XMOA 2BRGA 4DFYA 2FUMA 2XP2A 4KNBA 4BI2A 2W5HA 4EC9A 4JBPA 1Q61A 4PL4A 4YR8A 4EYMA 1J1BA 3KRJA 5CEOA 4J53A 4QMVA 5JFVA 3BELA 4AF3A 3HGKA 3CD3A 3NLBA 5K5XA 1V0OA 4QP2A 3BHYA 4YLJA 4OT5A 3NUNA 1QMZA 3BYUA 4HPUE 2HK5A 1XQZA 3B2TA 3RCDA 1JQHA 4A07A 3Q52A 1Y6AA 2B0QA 1UNGA 4TKSA 1K3AA 3ZBXA 4IM0A 4U81A 1H01A 4FKRA 3O8TA 4FV6A 3COHA 2OWBA 4G5JA 1ZMVA 4KBCA 4NU1A 1DS5A 3JVSA 3PZHA 3QU0A 4M0ZA 3A61A 4ZOGA 3TEIA 4AN2A 3LLAA 4AGWA 2C6OA 2F57A 3DBEA 3NNWA 3ORMA 4QMNA 4K1BA 2F4JA 2B53A 4YNEA 2F9GA 2BALA 3SDJA 2I0YA 5M4UA 4GK2A 4DEEA 2XCHA 2HCKA 4F6SA 3TUBA 2NRUA 2X8DA 2W7XA 3W16A 3PLAE 2XKDA 3GCSA 2ZVAA 3RKBA 5A4QA 2UZUE 2X2MA 4KKEA 4ID7A 1FGKA 4D55A 4EYJA 5IKWA 3DDQA 4BB4A 3QD2B 4JDJA 5AP3A 4D0WA 4F08A 1ZY4A 2ZM3A 2R3OA 3G0EA 3IONA 4M84A 2W1FA 5AUUA 5C4KA 4RWKA 3TZ9A 5IEVA 4CTCA 4U5JA 4G3FA 1EH4A 3H30A 3P08A 2RGPA 5HE2A 3VJNA 2WKMA 4IWDA 2VTIA 4WUNA 3SC1A 4OTRA 3JUHA 4L43A 3ALOA 5EH0A 1ZYCA 1Q62A 2IO6A 5FDPA 3TDWA 5EW8A 4ZZOA 4GT5A 4BCOA 1R3CA 3CKWA 1Q3WA 3LFSA 3OY3A 4BRXA 5A4LA 3WYYA 1JKKA 1O6LA 2BDJA 3M42A 1O6YA 3UE4A 2Z02A 3CKXA 4M14A 5E8TA 3ZO1A 2W1CA 2PE2A 3BBWA 1XBBA 3D5WA 3E8NA 3PJCA 4RJ7A 4XBRA 3TXOA 4PMMA 5C26A 3C5IA 2G1TA 2GNGA 2VN9A 4RIOA 4FKUA 3C0IA 3CC6A 4DAWA 3FQSA 4FYOA 2XK8A 3WF6A 3RVGA 3RALA 4DH1A 3D5UA 1L3RE 2WFYA 3PXZA 4QP7A 4MH7A 4ITHA 1NVQA 3IW5A 3EQGA 4IWOA 4CKRA 2F2CB 3EQCA 3PUPA 4WO5A 5DVRA 3ODYX 2RSVA 4H39A 4JDHA 4OTFA 4NW5A 2EXMA 5E8ZA 3B2WA 4BZNA 2QLUA 5AV4A 3L8SA 1L8TA 1M14A 2A1AB 4NCTC 3LMGA 1Z57A 4ENXA 3VS3A 1HCKA 2YIXA 5IQFA 3OROA 4FUYA 4XV1A 1NVSA 3NAYA 1H1WA 4R6VA 4M13A 2GHGA 4IADA 3C5UA 4FGBA 5HOAA 3UZRA 3TNIA 4DEIA 5KNJA 2I40A 1ZRZA 4QPSA 3Q9WA 4RIXB 2X8IA 2OFVA 5A14A 4PTGA 4RVTA 3EH9A 4FEQA 3P1AA 2F2UA 4V01A 4W8DA 3FKLA 5DT3A 4GVJA 5E92A 2C3IB 5L8JA 4HW7A 2QKRA 2VWZA 3R8UA 4E4MA 3C50A 1IR3A 2J0LA 4FTAA 3HUCA 3OXTA 4LFIA 4ZJJA 3TIZA 2XNNA 4H3PA 4KB8A 4TWCA 3EKKA 4KBKA 5JZNA 3CSVA 4HNIA 3LXKA 1WFCA 3DNDA 4XG7A 1NA7A 3BV3A 3DQWA 5DI1A 2QC6A 4AT4A 3OOMA 4IAAA 4MNFA 5EK7A 3KXXA 3WI6A 5J95A 5D10A 2CHLA 2ITVA 2QOCA 4QP6A 4WNPA 3RPVA 3W1FA 4OTGA 4FNYA 3UGCA 5IQEA 4IC8A 1X8BA 4EK3A 2QI8A 3PRIA 4EHZA 4W4XA 2VTLA 4B99A 3FQEA 3QRJA 3FMDA 3EJ1A 4NTSA 4G3GA 4GT4A 4TN6A 3ZH8A 4D28A 3I0QA 1KE5A 2OJFE 3RWQA 3WIKA 4O0VA 4FTJA 4X3FA 3VS0A 4ZZMA 3VS2A 1APME 3A4OX 3KCKA 3IO7A 5EI2A 3W8QA 3LCTA 4L45A 4MVFA 5FTQA 3FJQE 3ULIA 5GJDA 2XM9A 3GFWA 4PL3A 5EHLA 3VS6A 3C4FA 3NRMA 3WE8A 4EUUA 5M09A 4EBVA 3GEQA 2QQ7A 4J97A 3EWHA 2HZNA 2ITWA 2QD9A 4TTHB 3RJCA 3ZSIA 4EOIA 2VWXA 3EKNA 1Q8TA 3HEGA 3O50A 2EUFB 3EOCA 4DFBA 2HWOA 5EI6A 3U6IA 1SNXA 4IEBA 5F4NA 4ASEA 3G51A 4ZY5A 5M07A 2Y6MA 3MY5A 4G2FA 3RM6A 3KULB 2AYPA 3U8WA 3PTGA 4RLLA 2GNHA 3Q6WA 3ITZA 3PWYA 2PSQA 4F70A 5AADA 4I5MA 3GP0A 3O7LB 4BTKA 4DF3A 2QOBA 1QPEA 4XG6A 2OFUA 4H3QA 5M57A 3BGQA 2UZBA 4CKIA 4C4FA 4RRVA 4D2RA 4V0GB 4E7WA 5K0KA 3HKOA 4NH1A 1XBCA 2UUEA 4J71A 3DKGA 2WIPA 5DG5A 1RDQE 3TJCA 2P4IA 5CAOA 4JVGA 4IWQA 1V0BA 3HVCA 5M51A 4LMNA 5CXHA 4G1WA 5HE0A 1H1PA 1BL6A 3UYTA 3EQDA 3Q5ZA 3NNVA 3E64A 1BKXA 4JG7A 3GU6A 5DWRA 3PJ2A 2ACXA 4R1YA 3V6SA 3KXGA 4BWPA 2V7AA 4RC4A 1S9JA 4K77A 2W9ZB 1GIIA 3PJ8A 5CF8A 2YLEA 3BPRA 3S4QA 4O7VA 3CPBA 4P4CA 5CNNA 3UOLA 4ANSA 1PKDA 4KBAA 4R3CA 3UIBA 3FUPA 3GBZA 3DFCB 2ZDUA 3NNXA 5KO1A 4DEDA 2JD5A 2JC6A 1G3NA 2Y4IC 3RP9A 3WILA 5AAEA 4IAKA 5IDPA 2CLQA 4ZJIA 4DGOA 3R73A 2W4OA 3FSKA 4PX6A 1XO2B 5H3QA 1OITA 4C2WA 2Z7QA 4O91A 3IW8A 3UIXA 3H0YA 4YZ9A 3NX8A 2B52A 1IAJA 1OBGA 3LCKA 5JFSA 4DCEA 3W2SA 4PPCA 2YITA 4L3JA 5AP0A 4FVRA 1G5SA 4A4XA 5CANA 1Q24A 2XIXA 4FKVA 4XHKB 2PUPA 3JR1A 4FTUA 4K11A 4CD0A 4XV2A 4DGMA 2CPKE 3FLWA 5AUXA 3MVJA 2P0CA 3ZFMA 4MQ2A 3G33A 2QOKA 4O83A 1PRYA 3ACJA 3UO6A 2JIVA 4LRKA 3IW7A 3OS3A 3IPHA 3VAPA 3PSDA 1UVRA 1JSUA 4OUCA 5FDXA 3WF9A 4RA4A 4YJPA 4I23A 4WG4A 4EUTA 4LL0A 5CY3A 3BE2A 4CFWA 2PUNA 1SZMA 4YHJA 3CTQA 4E3CA 2C5OA 3UQGA 3V6RA 5CU2A 4GJ3A 4JRVA 4K2RA 5CSPA 2CNQA 1OVEA 1Q4LA 2FSMX 4S32A 3UTOA 2WU7A 5AAGA 5AX9A 5IG1A 2QODA 2YIRA 3D14A 2X4ZA 4BCMA 4TWOA 4FEUA 3JYAA 3ZM9A 2B54A 2UZWE 2RL5A 4S33A 3F7WA 3RWPA 5DFPA 5AV0A 4FVPA 4J8MA 2VD5A 2WMQA 3TL8A 3VS7A 4XP0A 4D2VA 3UO4A 1YHWA 2Y4PA 4EOLA 4UMUA 1H27A 3RZFA 4BZOA 3MYGA 3OWPA 2YAKA 4E5WA 4W4VA 2FH9A 2C68A 3FMKA 4U41A 3RHKA 4BDFA 4XEYA 4E1ZA 4R5YA 4EHVA 4F64A 3H9OA 4L8MA 5LVPA 2E9OA 5I9ZA 5GJFA 1HOWA 2W4JA 5IEYA 4G5PA 3DXPA 4GH2A 4A06A 3E63A 2C1BA 3QAME 3P9JA 5C4LA 2GS7A 3FLZA 4AN3A 2QU6A 3P7AA 4D4YA 5HX6A 2J0KA 4FV3A 5DPVA 4F9AA 2CLXA 4ONAA 3MH2A 4QQCA 4FTIA 4MXAA 4R77A 1O6KA 1UWHA 2J0MB 4L52A 4RLKA 5FEEA 5JN2A 4X3JA 3EYGA 4C7TA 3TKIA 4ACHA 3FHRA 3DDPA 3R71A 4UYAA 4WRSA 4IACA 3D7TB 5H2UA 4IHPA 4YLLA 2VWBA 4F6WA 2XK4A 3MVLA 3PP1A 4WRGA 4B7TA 3G6GA 5KMIA 3ANQA 3SGCA 3D15A 3QWJA 4RJ4A 5HVYA 2WTJA 3TV4A 5KHWA 3G5DA 5BUIA 4KRCA 4QP1A 3VBWA 3DXQA 4FX3A 3WOWA 4XJ0A 4BBEA 5LWMA 3QLGA 5KBQA 3VC4A 2JDTA 4L42A 3SX9A 2YM7A 3CQUA 3W33A 3GCQA 4KSPA 4CEGA 2X81A 2QU5A 1CKPA 3IDCA 3LM5A 2XYUA 3U6HA 4FTTA 4XG2A 4Y73A 4CQEA 1OIYA 2G2IA 2GPHA 1UA2A 3QUPA 2QKWB 4ZSLA 3A62A 3FI4A 4L01A 1GY3A 2AC5A 3K2LA 5TE0A 4PDYA 2ITXA 4WSYA 4UEUA 4FV0A 3IOKA 4U6RA 3C7QA 5HLPA 3WYXA 4EWQA 1H28A 3OCSA 2ONLA 3N4TA 2PZPA 4YZBA 4J95A 3VBQA 2WMBA 4U3YA 4EQMA 2XJ1A 4G3CA 5IUHA 3BLRA 1XHAA 3SQQA 3O2MA 5L8LA 1RW8A 3TDVA 4C57A 2WNTA 5JZJA 4AE9A 3CGOA 3QX4A 4K33A 4DBNA 4ANQA 2FYSA 3QLFA 1GZKA 2IG7A 4CYJA 5L8KA 5FG8A 3MFTA 1E9HA 5CI7A 2VTJA 5E8SA 2H8HA 3K54A 3PYYA 2R9SA 4AW2A 1H07A 2WPAA 3NUSA 4LOQA 4IX6A 3ZDUA 3TACA 2GCDA 5A46A 5HE1A 4B8MA 2WB8A 3W2OA 5L6OA 3TTIA 4BCFA 5AM7A 4TL0A 3OWLA 5AWMA 1YXXA 2G15A 2W0JA 4E5BA 3G90X 2UZNA 3L9NA 2C47A 4LG4A 4EOPA 1WAKA 3GT8A 2P55A 3D7ZA 3A8XA 4ZEGA 3RK9A 3I79A 5DR2A 3FZTA 3L8VA 2J5FA 4PP9A 2J9MA 2BRMA 1J7IA 4GUEA 2VAGA 1OBDA 3PP0A 4ALUA 4QNYA 2BDWA 3EIDA 3VBTA 2PMIA 2HZ4A 4CTBA 5B7VA 1BX6A 3BRBA 3Q4CA 2R3LA 3RAHA 5EDQA 5CAVA 3BHVA 2Y4IB 4IDVA 3Q96A 4O7TA 1P5EA 2C6DA 3QRKA 1IRKA 3QF9A 4APPA 3KULA 4V04A 3R7YA 3KA0A 5JH6A 2WMSA 1A48A 3MY1A 4DT9A 1PJKA 4JOAA 3NVKI 2VWIA 4L53A 3S00A 3V8TA 4FVQA 5A4TA 5A54A 5IQGA 4YZMA 4LOOA 4Z16A 4BDAA 1H8FA 3IW6A 4JIAA 4V0GA 4L3PA 3DOGA 1WBOA 2BPMA 2CGVA 4FIGA 2VTRA 2X6DA 3QTUA 4TNDA 4JBQA 1GNGA 2C30A 2UW5A 3C9WA 4HYHA 4BDKA 5FXRA 2PMOX 2X1NA 4OTIA 5AP2A 2CN8A 3QCQA 3PRFA 2WMVA 4QMLA 3GNIB 4ZLZA 3BYOA 3QQLA 5H8EA 2ZJWA 4QYEA 4U43A 5EYDA 3AC1A 2PVKA 1KUTA 3ZS5A 3UVPA 4HJOA 1UWJA 4X0MA 4N57A 4Q9SA 2JKMA 5CEMA 4JX7A 4IAIA 2BROA 4MNEB 4N4SA 5BVWA 1T45A 3MESA 3P4KA 4Y5QA 5TKDA 5EW9A 5HEZA 5HTBA 5IH6A 1O9UA 5KCVA 2V0DA 4LL5A 3Q5IA 2WQOA 2J5EA 4RX8A 3MH3A 4YTCA 1YXTA 1QCFA 4JS8A 1IASA 1YHSA 3R04A 2R3IA 4OBPA 4Z7HA 2VWUA 2X9FA 2IJMA 1KE8A 4CV8A 4HVIA 3PPJA 4GK3A 4RG0A 1MP8A 3HAVA 4Y95A 4ANOA 4DTAA 1TKIA 4MF1A 4DH8A 5AR8A 1V0PA 5F95A 3Q60A 5C8MA 3GUBA 3QA8A 3LFNA 3TWJA 2YDJA 1Z9XA 3Q4ZA 3ZSHA 3R21A 3UZPA 4QYFA 3REPA 1LP4A 4ZP5A 2UZVA 1OIQA 1Y6BA 4L68A 3KMWA 2C4GA 2IZSA 2R0UA 3QBNA 5DIAA 5JQ8A 4FGRA 4XX9A 1I09A 2GNIA 3CLYA 3WARA 2VO6A 3R00A 2KTYA 3IOPA 3LQ8A 3V5PA 5JQ5A 1P2AA 4MWHA 2CGUA 2Z2WA 5EKOA 4BDHA 3TIYA 1P14A 2QO9A 3BZ3A 4FL1A 3G15A 4ZMEA 4EH9A 4ZLOA 5BVEA 4O22A 3MB6A 3ZRKA 5KMMA 4BKZA 3CJGA 1SVGA 5TT7A 3MFUA 3FHIA 4UWBA 3R8ZA 4FZ6A 2ETKA 5AV3A 3RPYA 4JQ7A 4OBOA 3R0TA 3U9CA 3PA5A 3G6HA 3FMJA 4AACA 3ATTA 5GNKA 4O21A 5DH3A 2R3GA 5HG5A 1Q8UA 2WXVA 3F88A 4TNBA 5HIEA 2W4KA 2ZV7A 3CQWA 2UV2A 2VTQA 4M69A 1M52A 3IG7A 5CAUA 5LMBA 4DINA 5DBXA 5CAQA 3HA6A 5CSHA 2BRNA 3NZ0A 5AM6A 3CQEA 4V05A 5ACKA 4QRCA 3ENMA 3VJOA 4I5PA 4GKIA 1CKJA 1REJA 1CKIA 2HOGA 1XWSA 2ITZA 1FMKA 1OKVA 3FI3A 3NCGA 4FG9A 4GKHA 1WVYA 5HU3A 4H1MA 2YM8A 5EM6A 3SHEA 5DEWA 5F1ZA 3ZLXA 3DKCA 4X7QA 4XG8A 3OEZA 4Y5HA 4I21A 4IAYA 5DYJA 1ND4A 4L9IA 2X9EA 4PPBA 4A9SA 3GVUA 4ZTRA 4YGAA 3E3BX 4PDPA 4QMQA 5E8UA 4YJOA 4AT3A 3RPSA 4FG7A 2A4LA 4FL2A 4YHTA 1H1RA 3R02A 4LRMA 5C01A 4CLIA 3LFEA 3KF4A 4WT6A 3PXYA 3HECA 3EFWA 2VWWA 2ITOA 5HVJA 3FMHA 2Z7LA 3AT4A 3TV7A 4BDIA 5AEPA 5ETFA 4HCTA 5TR6A 5G6VA 3DB8A 5HG8A 4FKGA 1WBTA 4IZAA 4YNOA 3D7TA 5HO7A 5KX8A 4ZSGA 5HLNA 1TQMA 5C8KA 3QTRA 2GQGA 4G3EA 5EDRA 5AV2A 5L2WA 4TYHB 2W1EA 2OW3A 5LMKA 3QQJA 4IJPA 2XIZA 2ZV8A 3UOJA 2OJ9A 4FEVA 3QHWA 4LQMA 5FBNC 5FGKA 4C8BA 5CEIA 4DEHA 4ZS0A 4CFFA 4DLIA 4EH5A 3ATSA 4CG9A 5IU2A 3FY2A 3KMUA 3MA3A 3O51A 4CV9A 3BQCA 3KFAA 2B9JA 4I93A 4BHZA 3R7EA 3UQFA 2YCFA 3F5PA 2PE1A 4QMOA 3TZ8A 5BX0A 4W9XA 5AUVA 4ACMA 1DM2A 4XRLA 3POOA 4AG8A 3DJ5A 4PPAA 1PMNA 2W5BA 3DNEA 3GCPA 5IA4A 2VTPA 4F7JA 3A7GA 4FNXA 5IQCA 4YSMA 4HNFA 4WBBB 4IDTA 2ERKA 3MH1A 3VN9A 4HZSA 4CCUA 1ZXEA 2OBJA 3IGGA 4DGLC 3IS5A 3LMHA 5HD7A 4TY1A 5CASA 3CR0A 4C4GA 4E26A 4XG3A 3ZYAA 2PU8A 4F9WA 4K6ZA 4FYNA 5FRIA 3QTSA 3QZFA 4HZRA 3BEGA 4B8LA 5AP7A 2V7OA 2Y7JA 3A99A 3MA6A 1YWNA 3Q53A 4Y46A 5LJJA 5HNIX 1W7HA 3L9LA 1W84A 4M12A 4MHAA 3QTXA 4CMUA 3KXZA 3VIDA 1BI8A 3LW0A 3ZUTA 5A9UA 3WIGA 3IW4A 1DAYA 2CGXA 2SRCA 2WTWA 1U4DA 3C0GA 4PTCA 5J1WA 4YPSA 5D9HA 5BVOA 2F7XE 4FSNA 5CEQA 3GI3A 2VWYA 4WSQA 5DOSA 4C4JA 5EOLA 4ZTLA 1WBSA 2VTHA 1BUHA 4U79A 3W2QA 3K5VA 3QRIA 4H3BA 3WBLA 4IFCA 4PMPA 4FZDB 3DBCA 4GV1A 3P23A 4O0RA 2PZYA 4GIIA 3MWUA 2BZJA 2OXYA 4D2WA 3DCVA 1U54B 3VVHA 2WELA 4WHZA 1G8SA 5DT0A 2DWBA 4FTCA 4PQNA 4R78A 2HZIA 5AR3A 4E4LA 2F7ZE 5A3XA 4IIRA 2YZLA 2PVMA 1OL7A 2BTSA 3UG2A 2J6MA 3UNZA 3AC3A 3O23A 3POZA 3DTWA 4GFOA 3ZU7A 4FSWA 5GJGA 3VW8A 2P2HA 3ZO3A 4EH3A 4H05A 1Q41A 2IZRA 3TI1A 4ZSEA 3PIZA 3QQGA 2OG8A 4IM2A 4DFUA 3P7CA 5CSVA 3SLSA 1TQPA 2DS1A 4QP4A 5AX3A 4IAZA 4YJUA 3Q2MA 3Q32A 4M7IA 2ETMA 2O3PA 4DGNA 3CBLA 2OF4A 3RMFA 4G34A 5TO8A 4QYHA 3VQHA 3EMGA 4IB0A 3VUIA 1B38A 4TW9A 1FVTA 3SRVA 4FTRA 4D0XA 4NJDA 3BU5A 1ZZLA 3EQBA 4MBIA 4O86A 3H9FA 3UZTA 4ZS4A 1K2PA 5AA8A 5L2TA 3ORLA 2ZM1A 2Z7SA 4IMYA 3FMNA 4DBXA 1W83A 1XH4A 4MXOA 1JKSA 2UW9A 3EQIA 4MNEA 5TOZA 3R8VA 2C6EA 1KE9A 2G2HA 4ANNA 2JAVA 3OC1A 5AP1A 4XLVA 3NSZA 4CYIA 4QMUA 1OUKA 4ARKA 3BU3A 3TM0A 3LVPA 2ZV9A 3FL5A 4CZTA 3AT2A 3V8WA 2QHNA 3QFVA 3HRBA 3LMIA 3QTWA 1XH7A 1VYZA 3DS6A 5L2IA 4BCQA 3FYKX 4FKWA 3VW6A 4R7HA 3LFDA 5EM7A 5IQDA 3PY3A 1E1VA 4O6EA 2YFXA 4GVAA 2I1MA 3BKBA 3UBDA 2C5YA 2PUUA 3U55A 3LAUA 4DHFA 1WMKA 2EVAA 1M2PA 5FLFA 2NPQA 3MPMA 3U54A 3GOPA 3UPZA 2HY81 4O27B 2GS2A 3QYZA 1PXMA 3MFRA 4CT2A 3TUCA 3TKUA 5KMLA 5FP5A 5BVDA 5AP4A 1NVRA 3PJ1A 3BI6A 5EM5A 1SYKA 2GNLA 3RCJA 5C1QB 4XOZA 3UIUA 2C6KA 4I6BA 3PLSA 3NIEA 3H10A 4BF2A 2WQBA 5CS6A 5FUTA 3I60A 3FLNC 3W2CA 2B7AA 2QOOA 4TYIA 3CE3A 4YHFA 5L6PA 4QMMA 2G9XA 5CEPA 4YSJA 2B9HA 3WZKA 2R64A 1KOAA 3F3ZA 1AD5A 1REKA 2YCQA 4MCVA 3UNKA 4AA4A 2R3MA 2OH4A 4YBKA 3OZ6A 4ANLA 2WOTA 2R5TA 4IBMA 4F9BA 3T3UA 5BQ0A 3DK7A 4RX9A 4C02A 2G2FA 4PDOA 5KKRC 1FBNA 5HE3A 2WHBA 2XEYA 4DA5A 3ALNA 4TWPA 5E90A 3TNQB 2OJJA 3GB2A 2ERZE 2GNJA 5ANIA 4FEXA 3LPBA 4S2ZA 4XLIA 5EQYA 1R78A 2VO7A 3AC2A 4A4OA 4NK9A 5EOBA 4TT7A 1LEWA 4GS6A 5HICA 4JAIA 2W06A 3EQFA 5EQPA 2CDZA 3ZEWA 3QXPA 3NUAA 1FOTA 3V5TA 4KIKB 3LXPA 3CD8A 4TYGA 2HAKA 3ZLYA 4RWLA 4FIIA 2E9UA 3FZRA 4E4XA 1GJOA 2X4FA 3VNTA 4AP7A 5BPYA 3D83A 5IH4A 4XH6A 2J4ZA 4QMWA 4F0FA 3GGFA 4Z7GA 3NWWA 4EORA 1NW1A 2CNVA 2PZRA 4GRBA 3H3CA 1Y57A 3MH0A 5KHXA 5L2SA 3MGYA 3DA6A 4USFA 3Q9YA 4TYHA 2YABA 3BWJA 3VUTA 5J9ZA 1YI4A 1ZYLA 3PVGA 4EOJA 4HCUA 2W9FB 4AOIA 4DITA 3QC9A 3H9RA 2Q0NA 3ORKA 5GZAA 4FEWA 1B6CB 2OJGA 2IVTA 3PDTA 4AOJA 1WVWA 3DT1A 4RIWB 4AZFA 4CG8A 1J1CA 3MDYA 2O64A 4KIPA 4CVAA 1MQ4A 4OT6A 3NYXA 2PTKA 5JKGA 4KS7A 2VO3A 4GT3A 2UVXA 3QUEA 5FM2A 5HD4A 3EFLA 3DBDA 3FKOA 3HL7A 4CQGA 4G31A 4EK4A 4L3LA 2OI4X 3WF5A 1PXKA 4EWHA 2C6IA 4UX9A 3FZPA 3F2RA 3CJFA 3F5XA 4N70A 4RX7A 5HG9A 3FV8A 3BLHA 2P3GX 4FTQA 4YO4A 5J1VA 3NYNA 5M55A 4EC8A 4FKSA 3VUHA 4BYIA 4L67A 2CKQA 2Q83A 4XRJA 4I6QA 3R22A 3F6XA 5IA5A 1YWRA 3CXWA 3FSFA 4YLKA 2ITTA 4QTBA 5AP6A 3BQRA 3SAYA 2BRBA 4AAAA 4C59A 4QYYA 3RPRA 3KKVA 1PMUA 2CKEA 4R7BA 4AOTA 2XBJA 4BIBA 2IPXA 1IG1A 4O0YA 3G2FA 3MJ2A 2BAJA 3QCSA 5FXSA 4HVHA 4QD6A 3KRXA 1VYWA 4IH8A 5JFWA 2C5XA 3SXRA 1R1WA 3L1SA 3R1YA 2OKRA 3GENA 2C3JA 4IB3A 3DFAA 1YI3A 1UU3A 2JLDA 1M2RA 3THBA 4ERKA 4IZ7A 5M44A 2UW4A 4FT9A 3FXWA 2IW8A 2W1DA 4BICA 4ZY4A 4PMSA 4RFMA 3AG9A 3EN9A 1YXVA 1F0QA 4GW8A 1LEZA 1U54A 3GU5A 3KK8A 2R3FA 2YN8A 4IM3A 4AFJA 5HTCA 2C6TA 3DPKA 4MD7E 3FXXA 4BDDA 5D7AA 4YJTA 3L8XA 5CALA 4WG3A 5EHYA 3LCOA 4Q2AA 2WOUA 2CJMA 1J7UA 2GTMA 3FBVA 4J8NA 2QR7A 4DFXE 2E9NA 3BHUA 4AZVA 1CTPE 3O8UA 5FEDA 3HAMA 4JX3A 2FSTX 3TV6A 2RFDA 4O2PA 1RE8A 3VWAA 4M66A 4Q9ZA 5IA0A 5IPJA 4ACCA 2PULA 4C36A 4KWPA 4RVMA 2XNEA 4ACGA 3OT8A 3RNIA 4ZTNA 4PNKA 3EYHA 4XP2A 1R0PA 2XKEA 1JPAA 2BKZA 4QTCA 5ANDA 1DAWA 4O7SA 4R3RA 5E91A 1FQ1B 5AUZA 2XF0A 4EKKA 5FP6A 4IAFA 5FXQA 1U5QA 4YBJA 4D2SA 5GZ9A 3U4UA 3HV5A 4ITJA 5HIBA 5AFVA 2X6EA 3D4QA 3EN4A 1PHKA 4P5ZA 4NEUA 2GHMA 4QP8A 4HGTA 3COKA 2CKOA 1ZOHA 3A60A 3GQLA 4MQ1A 4YO6A 2QOHA 4CZUA 5HCYA 5E8VA 2B9FA 3AD4A 4JNWA 4YURA 2BUJA 2OIQA 4UMTA 4NIFB 5CF5A 4EH6A 2XCKA 4C61A 4CZYB 3L9PA 4C4HA 4JIKA 3AC8A 4OLIA 3L9MA 4WG5A 5LARA 1MRUA 2OGVA 2Z60A 4N6YA 4PWNA 4MEDA 5FM3A 2WTKC 1H26A 3EQHA 3R7VA 1J91A 3R8LA 5KKRB 3LJ0A 4FV9A 3MPTA 3PXRA 4QP3A 2XJ2A 1JOWB 4DEBA 5TF9A 4APCA 3HMOA 2X7GA 3RAIA 4B6LA 2XBAA 4O84A 5J5TA 5EW3A 2H96A 3KN5A 5JGDA 4GU9A 2X7OA 3OG7A 4O82A 4TWNA 4F0IA 2Z8CA 2WQEA 3NW7A 2Y6OA 1M7NA 4EQCA 4UV0A 2IVVA 4FSRA 5EYMA 5CNOA 5I9YA 5ANJA 2VU3A 2ZMCA 4G6NA 4BWXA 4DLJA 4NKSA 4GL9A 2C69A 2YIWA 4MD8E 4W4YA 3D5VA 3OHTA 3QA0A 4RPVA 4BIEA 5H8BA 5J9YA 5CU3A 3LXNA 1SVEA 4O0WA 3TN8A 1YW2A 4FOCA 4RQKA 2GQSA 5BMSA 5KMJA 2R3KA 4ZY6A 2PWLA 3PJ3A 3QC4A 4ASDA 5BVKA 4AQCA 5LVNA 4QTDA 4IQ6A 1Q97A 1VR2A 3U87A 3CY3A 3DLSA 4Y72A 3ZBFA 4YC3A 2FA2A 2O2UA 5CF6A 1OL2A 5GIOE 2QCSA 4RIXA 4I24A 3DXNA 3V8SA 3HDMA 3PSCA 2QVSE 4AZTA 3OCBA 2CKPA 3R9NA 5J9LA 1YKRA 5L6WL 3VRYA 5B2MA 3D2KA 1JSVA 3F2NA 3R7UA 3RTPA 5E4HA 4I1ZA 3F7ZA 1XH9A 4KUJA 2XNGA 5E1SA 4F7NA 4IFGA 2XKFA 2C5VA 4WOVA 3PE1A 5AIRA 3RZBA 4K8AA 4O0XA 3TNWA 4AZEA 4E5AX 3HV4A 4ZJVA 4NYEA 4MXYA 3LJ1A 2VGPA 2W1ZA 2FGIA 3DK3A 4FT0A 4IVDA 3SOAA 3ZC5A 2R7IA 3QCYA 4DTKA 2YERA 4PF4A 4DG0E 4E6CA 5CAPA 2JKQA 3QD3A 3IQ7A 4IANA 3UC4A 2FO0A 5CF4A 3BGZA 4EEVA 4UYNA 2W1IA 4JAJA 4U44A 5DEYA 1AQ1A 3CTHA 3PA4A 5AR4A 3CTJA 4X3FC 2X2LA 3KXHA 4M97A 2BCJA 4KIKA 4RSSA 4R1VA 4JI9A 1B39A 4RZVA 3MSSA 2JBPA 4O7WA 4U40A 3NR9A 4D1ZA 3BEAA 3QQKA 4JT3A 1YQJA 3O7LD 3OWKA 3F9NA 5AV1A 4IZ5A 4JG6A 4QO9A 2QO7A 5T3QA 4ACDA 2ETRA 4QTAA 4I4EA 4KINA 5AAFA 2BIKB 5CU0A 4CLJA 4EKLA 2Y9QA 4FL3A 2X7FA 5B0XA 2VTSA 2YIYA 3ZXZA 2F49A 3SOCA 4ZSJA 4BWKA 4AZWA 3R2BA 3VS4A 4P7EA 2YCRA 2HXQA 2YJRA 3DV3A 5HKMA 3GCVA 1M17A 4F09A 1JVPP 1TVOA 2O5KA 2WO6A 2WAJA 4ZAUA 1FVVA 1UNLA 4RIWA 1H0WA 5DRDA 2C3LA 4UMPA 4U9AA 3C4XA 4LYNA 1YWVA 2BILB 3FZSA 3OVVA 4D1XA 4F65A 2PL0A 2JIIA 2RFNA 3ROYA 2XIKA 4MK0A 4FT3A 5ETCA 2WMUA 4FTMA 3I4BA 3R9RA 1OECA 2BHEA 2EXCX 3LFAA 5HG7A 1Q8WA 2WQMA 3MN3A 5EQEA 2VO0A 4YZNA 3CGFA 3PG1A 3JVRA 4GU6A 4ZTQA 4ZTHA 3TCPA 2FVDA 1ZMUA 2NO3A 3HX4A 5HORA 3PG3A 2OXXA 3KL8A 5HCXA 4JQEA 2OJIA 3OF0A 4HVGA 3SVVA 1YVJA 2VNWA 4LRJA 1J7LA 3HV6A 4A7CA 5HGIA 3QRUA 4YP8A 2R0IA 5EG3A 1NY3A 1IA8A 4UMQA 4IJ9A 5E8YA 3R1SA 5M4IA 4YZCA 1FMOE 3CIKA 5DE2A 4CGAA 3HZTA 4ORKA 2YACA 3FXZA 3ZHPC 5EYCA 4AU8A 5AUWA 4JJRA 5K0XA 4MBJA 4D58A 4ZTMA 5CEKA 5HBJA 1WBWA 1ZARA 1BLXA 5HBEA 4DFZE 4OTWA 1QPDA 4L6QA 2YISA 3PPZA 2NRYA 1JSTA 2E9VA 2XVDA 4O1PA 5KZ0A 3Q3BA 3C4CA 4EK5A 2ITQA 4FV5A 1ZMWA 1MRVA 3BX5A 2VTTA 2VTOA 4NM0A 3R6XA 3F5UA 4G9CA 1OPJA 4BFMA 4BGQA 3HP5A 3TZMA 1PYEA 3FY0A 1VZOA 4U0IA 5B2LA 4XNEA 3NYOA 5K4JA 3DKFA 5CXZA 3VHEA 2VX3A 3NW6A 2HW7A 4XYFA 2YM5A 4M0YA 1PXIA 3R9HA 1UNHA 3QGYA 3BYSA 3RM7A 4D4SA 4HGEA 1YOMA 4OAUC 4W9WA 4UBAA 3DJ6A 1OIRA 4LUEA 1W98A 5E7RA 4GG7A 4G6LA 4YJQA 2WTKB 4XOYA 3QL8A 3OXZA 2WD1A 1BMKA 2Y0AA 3MIYA 3QZGA 4HYIA 3PE2A 3N9XA 4KIOA 4A9RA 4D5HA 1RQQA 3IECA 1H00A 2C3KA 2UZTA 4M3QA 4QMXA 5IZFA 1J3HA 4EZ7A 3E7VA 3GCUA 2BZIB 4CFNA 3UODA 4ERWA 5BUJA 2XNPA 2R3PA 2VWVA 3DGKA 4OBQA 4RWJA 4WNOA 3ORTA 4NFNA 4DG3E 4GIHA 3LZBA 1URCA 5AUYA 1G8AA 2R3HA 3E87A 4U3ZA 3PY0A 2I6LA 3FMMA 1FPUA 5AR7A 3NDMA 2B4SB 2HY0A 3BU6A 1XH8A 2UW7A 2JGZA 2OXDA 4FKOA 3II5A 2R7BA 4Y83A 4KKGA 3R30A 5B2KA 4FKIA 4YC8A 4NCTA 5J5SA 5L4QA 3I5NA 5DR6A 3NCZA 1H4LA 4FA2A 1ZYDA 2A2AA 3A4PA 2WIHA 4O0UA 5EDPA 1OKWA 4YTHA 2HYYA 4FNWA 4YJNA 2X8EA 4IW0A 3OEFX 4BR3A 5D1JA 3OFMA 3AOXA 4NIFA 4MXXA 4N6ZA 2H6DA 3PVWA 4ZXTA 3DZOA 4NTTA 4USEA 5DA3A 2ZV2A 3U9NA 4RJ5A 3TNHA 3ZZWA 4I94A 2C1AA 4IVBA 2PPQA 3PIXA 2WEIA 2XYNA 3LCSA 3PY1A 5BNJA 2UZEA 3KC3A 2PVRA 4BCGA 4AUAA 2WEVA 3RK7A 4S31A 4KABA 2J7TA 4GJ2A 3HUBA 4NM7A 3NGAA 3UVQA 3NVMB 4H36A 3LCDA 3R2YA 2GQRA 4QOXA 3LFBA 3FMEA 1GAGA 3QUDA 2B1PA 2BIYA 1BYGA 3LFQA 4FI1A 3QZHA 2BAQA 2J50A 4LOPA 5JGBA 3ZRMA 4BDGA 4E6AA 3NPCA 3QHRA 3RAKA 2YLFA 2O0UA 5BUEA 3JS2A 4QMYA 3AC5A 3MIAA 4X3FB 4FTNA 3S2PA 3AT3A 4YJSA 3CP9A 4R5SA 1Q3DA 1V1KA 5HZNA 1YDSE 5E8WA 4F99A 1E1XA 3LQ5A 3QQHA 5FTOA 4BGHA 2Q0BA 5E9EA 3MPAA 2BZHB 3I1AA 2JFMA 5H8GA 3F2AA 4HOKA 3A7HA 2JFLA 5HHWA 3S3IA 3CY2A 2YM6A 1UU8A 3R1NA 4E93A 4ZSAA 2ONLC 5IEXA 4NL0A 3AGMA 2WQNA 3EQRA 4FV7A 3SV0A 5F20A 3GC9A 3MI9A 3OUKA 4HPTE 4FR4A 3W55A 2XK3A 4F7SA 4NZWB 4KIQA 5IUGA 5HQ0A 2OIBA 2WMTA 3RI1A 3ZUUA 4RWIA 3QKMA 3DB6A 3G0FA 3W8LA 5LWNA 4DFNA 1Z5MA 2AC3A 4QT1A 1M7QA 4DGGA 5CU6A 4BVUA 5KBRA 4OTQA 2FB8A 2IN6A 3V04A 3N4UA 3FQHA 4E73A 5T6KA 4MXZA 2YWVA 3O96A 3UNJA 4G9RA 2V62A 1OGUA 2EB3A 3PIYA 3LXLA 1YHVA 4O1OA 3KEXA 3IDBA 4RC2A 2QG5A 5A6OA 4YTIA 5HIDA 2XNOA 5DNRA 2JKKA 2PVNA 3C4WA 3AMBA 3FLYA 4DG2E 4IX4A 3B8QA 3WF7A 1M2QA 1CMKE 3PPKA 2LAVA 2IWIA 3E62A 5AR5A 5JRQA 4HYUA 2RG6A 1PXJA 2H34A 5KMKA 1OUYA 3C4EA 5I0BA 3OCGA 4FSMA 4D5KA 5JGAA 2UW0A 2HW6A 4Z9LA 2W1HA 2YZAA 3V3VA 2ZB0A 4CXAA 3KVWA 3AQVA 3CS9A 3FWQA 4ASZA 4Y85A 3T9TA 3MW1A 4LV5A 5T68A 4BDEA 2JKOA 1U5RA 5HO6A 4DH7A 3DAJA 3KU2A 1KOBA 2QO2A 4BCPA 1UKHA 1OMWA
chains in the Genus database with same CATH superfamily
2PY3A 3HYHA 2FSOX 1IAHA 4WBOA 4XP3A 3EN5A 4R7IA 2I0VA 3DTCA 2CGWA 3EQPA 3G9NA 5CSWA 4ZZNA 5BVFA 4O7NA 2W96B 4C37A 3BBTB 3EL7A 3F3UA 3LKMA 2OSCA 2YCSA 1KSWA 4WKQA 3HLLA 3PVBA 4MX9A 4BTFA 2VX1A 3R8PA 5DLSA 4CMOA 2O63A 5DGZA 5CYIA 4I20A 1WVXA 2PVFA 3P5KA 5KMOA 4G6OA 4FF8A 3UDTA 2WMXA 2QONA 3RGFA 4EHGA 4IXPA 4E8AA 3AC4A 3R83A 4GUBA 5JRSA 2W1GA 5ANOA 1H0VA 5ETAA 3UMXA 3WE4A 3HRCA 3ZO4A 1ZLTA 3P79A 5KZIA 5D41A 4EH7A 4QPAA 4C4EA 4GG5A 1ZYSA 5CVHA 4DEAA 2XJ0A 4U80A 4C34A 4AWIA 2RKUA 3EN7A 4EZ3A 5DN3A 3UG1A 4MKCA 1Q99A 4USDA 4C38A 5IUIA 4D2PA 1WCCA 1GIHA 4NT4A 3W18A 3DJ7A 4I92A 1FVRA 1NXKA 3AMYA 3LM0A 4P2KA 5I3OA 1IA9A 2CNUA 5E8XA 3RINA 3ZTXA 4JLCA 1SVHA 4F4PA 1LPUA 2UZOA 3W2RA 3C1XA 2UZLA 4RQVA 4HVSA 5KUPA 3W0MA 3P5JC 2OF2A 3LLTA 4PY1A 5KE0A 4FSTA 4O0TA 4ANBA 4O7LA 4CFUA 4H1JA 4UWYA 3E93A 4AGDA 3ZCLA 4EL9A 3KK9A 2QOQA 3I81A 3VUMA 3IK3A 1A9UA 3KQ7A 3ACKA 4I6FA 4PDSA 1AGWA 5DHJA 4YTFA 3UOKA 2GHLA 1ZYJA 4AZSA 4OTDA 1K9AA 1W2CA 4IE9A 4BN1A 2XH5A 4WNKA 3NEWA 4RVKA 3QZIA 5HESA 4O81A 3BYMA 4UZDA 5ETIA 3HMNA 3Q4UA 4QQTA 2BMCA 3E3PA 2XAMA 4A9TA 1H25A 3EB0A 2PMLX 4FC0A 5CTPA 4Z3VA 5HTIA 4UXLA 1JNKA 4JDIA 4L7SA 2PE0A 2HIWA 3E5AA 2QR8A 3VS1A 4BHNA 3S1HA 1XMLA 3LQ3A 2XEZA 4JQ8A 5LCJA 3ZOSA 4B9DA 2UVZA 4FV2A 4NWMA 4GSBA 4I22A 5HO8A 2A0CX 5I5ZA 2WMRA 3P86A 3MVMA 5HVKA 2ZOQA 2UW3A 4WA9A 1OL6A 3QQFA 1ERKA 1UKIA 4U8ZA 2C0TA 2IZTA 1Y8GA 3I7BA 4A9YA 1OKZA 2I0HA 3HRFA 5CZHA 4ASXA 1XH6A 1OI9A 2DYLA 4XUFA 3ZRLA 4UALA 3SKCA 2J51A 1ATPE 3FMLA 2V22A 3IGOA 1BL7A 4RGJA 5M4FA 1Q8ZA 3PVUA 4C3RA 4AW0A 2RIOA 2P33A 2EU9A 2DUVA 3F3WA 4BTJA 4D4VA 4RVLA 1S9IA 3KRLA 4EOSA 5LVMA 5D7VA 5ICPA 3F69A 3GXLA 5J87A 1P4FA 2XMYA 3IDPA 4FT5A 4RMZA 4BBMA 4OTPA 4QMSA 4W4WA 3ZSGA 2JIUA 2W99B 4IB5A 5AMNA 1ZOGA 3SW4A 5I9XA 4F9CA 3N51A 3FI2A 3OT3A 2C0IA 2YM4A 3NS9A 4EH4A 3UPXA 1SM2A 4K18A 2A27A 2OK1A 2PMNX 4M8TA 5CVGA 5BYZA 5J7HA 4O4CA 4BBFA 3ZLWA 4O0SA 2W05A 2LGCA 3O71A 4C3FA 4GYGA 2OZAB 2XNMA 2UVYA 4QMPA 3I6UA 2PVJA 4L46A 4U97A 5J8IA 4TXCA 4AA0A 4AFEA 4CT1A 5K4IA 3FKNA 4RC3A 3FZOA 3N4VA 5M06A 5ANKA 2B55A 2IEWA 5LMKC 4D1SA 4C33A 2BFYA 4J7BA 2OLCA 3E88A 4EI4A 4NUSA 4FKQA 2BFXA 3AD5A 3C0HA 3Q4TA 2GFCA 4M67A 3VF9A 3Q9ZA 3TJDA 4YZDA 4BDBA 5CVFA 2VRXA 3OTUA 4CNHA 2BHHA 3QQUA 4MUQA 3GOKA 3KRRA 4BCNA 4YMJA 3C4ZA 4FODA 2XKCA 3V01A 3OW3A 2BVAA 3ULZA 2WTDA 4MXCA 2XK9A 5BVNA 1UV5A 5HX8A 3JY9A 4F0GA 3OWJA 3OBGA 1MRYA 5IMXA 4QDEA 1GZOA 3SA0A 2ZYBA 5C9CA 3VUGA 4FJVA 3BCEA 4UY9A 4QPMA 2XRWA 3ORIA 1UU9A 1YI6A 4C4IA 4IB1A 4C2VA 3D5XA 4LUDA 3W2PA 4RX5A 4EH8A 2RFSA 4R8QA 2QOIA 3GU8A 4G3DA 4BKJA 4EJNA 1JBPE 3QKLA 4I41A 5J7BA 2O65A 1VJYA 5M08A 3GFEA 3DZQA 3G9LX 4O7RA 4FIEA 5EKNA 3A2CA 2WTVA 4FTKA 5JFXA 2ITUA 4DEGA 3VQUA 2PVLA 2GNFA 3MFSA 3QTQA 4JR7A 4I3ZA 4RIYB 4EOQA 3PWDA 2YJSA 3KY2A 2XIYA 2OO8X 2CN5A 4MBLA 2XZSA 3D2IA 4KAOA 2HXLA 3K3JA 3QRTA 4L00A 3FLSA 3ORXA 5ANEA 3EFKA 4F1MA 4TRLA 5CU4A 4AE6A 4I0TA 3ERKA 3COIA 1JLUE 4FV4A 3ENHA 2QG7A 3ZUVA 4OW8A 3LOKA 4X2JA 4WIHA 3UJGA 3M11A 3A7IA 4TZRA 1JWHA 3NW5A 1CDKA 1STCE 4FZFB 2ESMA 4D9UA 3GC7A 2EB2A 3TG1A 4BGGA 4D4RA 4DCAA 4RFYA 2IW9A 3KVXA 2EWAA 1QPJA 4JDKA 5KMNA 3FPMA 3RAWA 1KE6A 5AJQA 5IQIA 5EM8A 4CFMA 4P5QA 3IKAA 3D94A 4X6RA 2I7QA 4HGSA 4F9YA 4GFMA 3V5JA 3SXFA 2CMWA 4LI5A 3AMAA 1YDTE 4JR3A 3ZFXA 2F7EE 3BGPA 2YEXA 2J90A 1W2DA 3BHHA 1YOJA 2R3JA 2BTRA 2BZKB 2REIA 2ZDTA 5GINE 1PYXA 1OIUA 1KV1A 3KMMA 4KS8A 5IQBA 2QLQA 3NFGB 3R01A 4FKJA 5LMAA 4CMTA 4GEOA 4ALWA 3ORPA 2E9PA 3UYSA 1XBAA 3VUKA 3S0OA 3K3IA 4BCJA 4J52A 3FPQA 4X2KA 4FRFA 3UVRA 1W82A 4FKPA 4YUQA 4BIDA 2I0EA 2IZUA 1QPCA 5HU9A 1LUFA 2AUHA 2X0GA 3PA3A 4X21A 3OCTA 2WMWA 2EXEA 2XRUA 4O6LA 4AT5A 5GHVA 3F66A 4IVAA 4PUZA 2WTIA 3FLQA 5D11A 4QTEA 2ITYA 3ZEPA 1PKGA 3O8PA 5M53A 3UP2A 3FYJX 3GC8A 2QNJA 1W2FA 3KRWA 3UO5A 2WTCA 4KA3A 4HCVA 3I7CA 3UP7A 4KKHA 3LJ2A 4I5CA 2PK9A 2GU8A 3I6WA 4BCKA 3QXOA 1Y8YA 4AQKA 5CT0A 3VULA 1FGIA 3TTJA 4E6QA 5AR2A 3Q04A 4RZWA 1PXOA 1Y91A 4XV9A 4AS0A 4F7LA 2QOFA 3LIJA 3ZC6A 4M69B 3A7JA 2BRHA 2PYWA 3OTVA 5ACBC 4DC2A 4FSZA 3I0OA 3PXKA 4I6HA 5CZIA 4KRDA 4GK4A 5E1EA 4G17A 4ITIA 3VF8A 4L44A 4HVDA 1GZNA 3FC1X 5IA2A 5FQDC 4ANMA 2XA4A 4KD1A 4NFMA 5C03A 5BYYA 1W0XC 5HCZA 3UC3A 4RJ3A 5EHOA 4AW5A 4YU2A 5I9WA 3CCNA 1GOLA 1Q8YA 4OGRA 5CI6A 2JBOA 3ZZEA 4QYGA 5JMSA 4AX8A 4GFGA 3QD0A 2B9IA 1G8KA 5IQHA 4GYIA 2J0IA 2ITPA 3TT0A 1TQIA 5FBOA 2IVSA 5LXMA 3LHJA 4Z55A 3R7GA 5DMZA 5IF1A 2DQ7X 4I5HA 3E8CA 5HBHA 3VO3A 4UWCA 4UMRA 4Q5HA 1OM1A 3MVHA 4FZAB 4ALVA 5IMEA 2GMXA 3HMPA 3Q6UA 3MBLA 4HYSA 5HNGA 4ZMFA 4JG8A 3OOGA 3FAAA 4IZYA 5K3YA 4N0SA 4K9YA 3RPOA 1XH5A 3F61A 3T8OA 4DT8A 2ZAZA 2QOLA 1GIJA 3EHAA 3ORZA 3EL8A 2YIQA 4LMUA 4XG9A 4CKJA 4U7ZA 4FV8A 4II5A 2BDFA 5HLWA 5JK3A 1OPKA 1OKYA 4QP9A 5CENA 3F82A 4X2GA 4FSYA 2XNBA 4BCIA 4Y8DA 3D0EA 3VRZA 4I4FA 3V5WA 5CT7A 3HMMA 1FINA 4PNIA 4F63A 3GU4A 5HI2A 2R3NA 3FE3A 3MB7A 2CCHA 5CQWA 5CX9A 3VS5A 3LE6A 3DY7A 3V5LA 3Q9XA 3R9DA 3D9VA 4PTEA 4EONA 3VBXA 2P2IA 2R3RA 2HELA 4CRLA 4F1TA 4XV3A 1XKKA 4H58A 4CFVA 3ZFYA 3SG8A 5IA3A 3NUUA 3MY0A 4IX5A 2X39A 3NUXA 3A7FA 4IX3A 3OW4A 5K9IA 2W5AA 2VTMA 2WMAA 2OICA 3ODZX 3SG9A 1LR4A 4IC7A 4U42A 2R2PA 1Q5KA 1ZOEA 2HWPA 4C35A 2A19B 4AGCA 1ZWSA 2AEGA 2OZAA 3O0GA 4L7FA 4YJRA 3EFJA 2G01A 1U46A 4G16A 4EK8A 3CPCA 5DR9A 4D2TA 2UW8A 4FK3A 2X2KA 4FMQA 4Q5EA 5IQAA 3E8DA 2OU7A 3JY0A 4FUXA 3VHKA 3F5GA 2HZ0A 3ORNA 4FTLA 3TZ7A 4J99A 2W17A 3GU7A 4FBXA 3ZLSA 3EN6A 2BR1A 2E2BA 4JXFA 4RFZA 4DH3A 3R1QA 2JDRA 3TUDA 3T3VA 2VUWA 4LV8A 1VLRA 1OB3A 3COMA 3UDBA 3E7OA 3BIZA 4XCUA 3AD6A 3DAKA 5I9VA 1PXLA 1PXPA 3DKOA 3DLZA 2XIRA 3MTFA 3B8RA 4GMYA 4J98A 4NM5A 3NIZA 4O2ZA 1YOLA 1OZ1A 4EZ5A 1OL5A 3QWKA 1PXNA 3GC0A 4J1RA 2XM8A 4A9UA 5AA9A 4WD5A 2PVYA 4FK6A 3PSBA 2C0OA 3QKKA 4ZTSA 3UMWA 3WZEA 3DAEA 3WZDA 3FI8A 4EQUA 4EOOA 2C6LA 3FDNA 2ITNA 3PFQA 3ZONA 3TKHA 5I3RA 3QALE 3BE9A 1YXUA 4JRNA 4TYJA 4AW1A 4BI0A 3R7IA 4EBWA 1KWPA 3NUYA 4FKLA 3RHXA 4XG4A 5IDNA 4XBUA 1H1QA 4R3PA 3KGAA 1HCLA 2ZB1A 4QQJA 4YJVA 4EK6A 4F1OA 3HV3A 4GCJA 4EJ7A 1XJDA 3QCXA 4RIYA 2VTAA 2GDOA 1ZY5A 4C58A 5K5NA 4QNAA 1RJBA 5AUTA 1KV2A 2QHMA 3HP2A 4FIJA 1KE7A 4PMTA 2BAKA 4S34A 5L2QA 1GZ8A 4D9TA 2VTNA 5FEQA 2UW6A 2GFSA 2WU6A 4LM5A 5JEBA 3RK5A 3WF8A 3C51A 5FTGA 3E8EA 3KXMA 5EI8A 3SRVB 4ZIMA 2GTNA 1H24A 1PMEA 4XS2A 5LVLA 4MYGA 2PHKA 5H9BA 4X2FA 2QURA 4DFLA 1JKTA 4BL1A 3QGWA 4PRJA 1YDRE 1WBVA 3BHTA 4OAVB 5DRBA 2ZMDA 2H9VA 3QD4A 2RF9A 2JDSA 4MTAA 3HMIA 4RA5A 4YC6A 3R7OA 4C62A 5G1XA 2OZOA 1ZZ2A 3CEKA 4UN0C 4NW6A 5A6NA 2BKKA 4AGUA 2R3QA 3W0PA 5IA1A 1R0EA 3MTLA 4FIFA 4LGDA 3P78A 4O4DA 4U45A 5CWZA 4P90A 4UZHA 3P0MA 2JAMA 1VEBA 3F3VA 1H1SA 5ITAA 1WZYA 5I9UA 3LFFA 4BDCA 4W8EA 3HA8A 4QMTA 4NJ3A 3WZUA 3U4WA 4TPTA 3T9IA 2IVUA 4NM3A 3ID6C 3UIMA 4EOMA 3H4JA 2C5NA 5F9EA 4FNZA 4J96A 2PUIA 4AAYA 2HENA 2YDIA 2Y8OA 2YHVA 4DYMA 5LCKA 1WBNA 3L8PA 4QMZA 3ZM4A 5M56A 4RJ6A 3KCFA 4EHEA 3EZRA 2RG5A 1QL6A 4BCHA 4UXQA 3MS9A 5AP5A 2OIDA 4YPDA 3NUPA 3PXQA 2KULA 5A4EA 1MUOA 5CLPA 4O38A 3GQIA 4BKYA 5D12A 3UOHA 4FT7A 3VUDA 2CSNA 4M15A 1WBPA 2UZDA 3SW7A 4UB7A 4CCBA 4I0SA 4B0GA 3BWFA 3QX2A 3K5UA 5IH5A 4BJJB 5C27A 3RBWA 2ZM4A 3OUNB 2YM3A 4X2NA 2C6MA 5GIPE 3PZEA 4AN9A 2JITA 1T46A 3R8MA 4MF0A 3WZJA 2V55A 2VX0A 1CSNA 5IISA 1H08A 1XR1A 4E4NA 4O7ZA 2XK7A 4ENYA 3HDNA 3NAXA 4BTMA 1BI7A 3ZO2A 5LVOA 5GZ8A 2CCIA 2RFEA 3FC2A 4C0TA 3QTIA 4ZK5A 4BZDA 4CRSA 1UU7A 3NYVA 4E20A 5L3AA 3UQCA 4FE2A 3DK6A 2IW6A 1NT2A 4PP7A 2XK6A 2XS0A 3M2WA 3AXWA 4BY9E 4PV0A 2YWPA 4FICA 2JEDA 4LGHA 1MQBA 4O7YA 1F3MC 3C13A 2NNWB 5CQUA 1PY5A 3ANRA 3W10A 4IVCA 2J2IB 4B4LA 5A4CA 4FSQA 1ST0A 3ZDIA 4BC6A 2VZ6A 3SD0A 5HNBA 2NP8A 4S30A 3VBYA 3ZMMA 4CFXA 5BYLA 4AA5A 4F6UA 4JBVA 4FIHA 5FD2A 3OP5A 1JAMA 1A06A 2PVHA 3HNGA 2WZJA 5JT2A 2JDVA 4X6QC 3V51A 4MWIA 3V5QA 4MAOA 3ETAA 2XUUA 4C3PA 2V5QA 3NMUF 3TNPC 4JBOA 3Q2JA 1OL1A 4I0RA 4DE4A 1JKLA 4DTBA 5FWKK 4CSVA 3W32A 4BYJA 3E92A 4FG8A 4FKTA 2IF8A 4KSQA 2VV9A 5C8NA 5M4CA 3ELJA 1YRPA 3SXSA 2YAAA 4FOBA 4FSUA 3ZXTA 3OY1A 3P7BA 3JXWA 2VNYA 4WNMA 4BDJA 2O8YA 3DQXA 3BV2A 4EH2A 4IWPA 3KN6A 1IEPA 3F3TA 3QYWA 4O96A 1YXSA 5BMMA 3R28A 1DI9A 1XMMA 3MJ1A 3OXIA 3JPVA 1CM8A 4ZLYA 5EYKA 5JSMA 3FEGA 5J79A 3KREA 3U6JA 3H0ZA 1P4OA 1OPLA 1PW2A 1ZAOA 2Z7RA 4FZ7A 5I4NA 3A8WA 3OMVA 3QTZA 5EFQA 1PF8A 4RT7A 5LQFA 4TYEA 1SMHA 4OR5A 3BLQA 1URWA 2VGOA 4PL5A 4M68A 3MV5A 5ANGA 2XB7A 2PZ5A 3R9OA 4OTHA 4E6DA 4NSTA 4HGLA 4FTOA 2YDKA 3KB7A 3KF7A 1ST4A 4AXAA 3AGLA 5DT4A 4DH5A 3OD6X 4LGGA 3O17A 3NNUA 4FV1A 4MD9E 2GSFA 1R39A 3LFCA 1SNUA 3DBQA 4EOKA 4RJ8A 2WGJA 1PMVA 3ET7A 3EZVA 3RNYA 2FSLX 1W8CA 1F5QA 3R63A 3OBJA 1I44A 3HV7A 5CSXA 1U59A 4K0YA 4QQ5A 2R4BA 3S95A 3U51A 4RBLA 1DI8A 2GS6A 3VBVA 2OH0E 3PXFA 3M1SA 4BI1A 3KXNA 5F94A 4WUAA 4NKAA 3FZ1A 3FL4A 3ROCA 2PZIA 4A4LA 2YA9A 2JDOA 5AIKA 2J0JA 5LOHA 4O4BB 3DBFA 4JL9A 4DN5A 3BYVA 3I5ZA 3DU8A 4XMOA 2BRGA 4DFYA 2FUMA 2XP2A 4KNBA 4BI2A 2W5HA 4EC9A 4JBPA 1Q61A 4PL4A 4YR8A 4EYMA 1J1BA 3KRJA 5CEOA 4J53A 4QMVA 5JFVA 3BELA 4AF3A 3HGKA 3CD3A 3NLBA 5K5XA 1V0OA 4QP2A 3BHYA 4YLJA 4OT5A 3NUNA 1QMZA 3BYUA 4HPUE 2HK5A 1XQZA 3B2TA 3RCDA 1JQHA 4A07A 3Q52A 1Y6AA 2B0QA 1UNGA 4TKSA 1K3AA 3ZBXA 4IM0A 4U81A 1H01A 4FKRA 3O8TA 4FV6A 3COHA 2OWBA 4G5JA 1ZMVA 4KBCA 4NU1A 1DS5A 3JVSA 3PZHA 3QU0A 4M0ZA 3A61A 4ZOGA 3TEIA 4AN2A 3LLAA 4AGWA 2C6OA 2F57A 3DBEA 3NNWA 3ORMA 4QMNA 4K1BA 2F4JA 2B53A 4YNEA 2F9GA 2BALA 3SDJA 2I0YA 5M4UA 4GK2A 4DEEA 2XCHA 2HCKA 2X0QA 4F6SA 2NRUA 2X8DA 2W7XA 3W16A 3TUBA 3PLAE 2XKDA 3GCSA 2ZVAA 3RKBA 5A4QA 2UZUE 3W0RA 2X2MA 4KKEA 4ID7A 1FGKA 4D55A 4EYJA 5IKWA 3DDQA 4BB4A 3QD2B 4JDJA 5AP3A 4D0WA 4F08A 1ZY4A 2ZM3A 2R3OA 3G0EA 3IONA 4M84A 2W1FA 5AUUA 5C4KA 4RWKA 3TZ9A 5IEVA 4CTCA 4U5JA 4G3FA 1EH4A 3H30A 3P08A 2RGPA 5HE2A 3VJNA 2WKMA 4IWDA 2VTIA 4WUNA 3SC1A 4OTRA 3JUHA 4L43A 3ALOA 5EH0A 1ZYCA 1Q62A 2IO6A 5FDPA 3TDWA 5EW8A 4ZZOA 4GT5A 4BCOA 1R3CA 3CKWA 1Q3WA 3LFSA 3OY3A 4BRXA 5A4LA 3WYYA 1JKKA 1O6LA 2BDJA 3M42A 1O6YA 3UE4A 2Z02A 3CKXA 4M14A 5E8TA 3ZO1A 2W1CA 2PE2A 3BBWA 1XBBA 3D5WA 3E8NA 3PJCA 4RJ7A 4XBRA 3TXOA 4PMMA 5C26A 3C5IA 2G1TA 2GNGA 2VN9A 4RIOA 4FKUA 3C0IA 3CC6A 4DAWA 3FQSA 4FYOA 2XK8A 3WF6A 3RVGA 3RALA 4AXEA 4DH1A 3D5UA 1L3RE 2WFYA 3PXZA 4QP7A 4MH7A 4ITHA 1NVQA 3IW5A 3EQGA 4IWOA 4CKRA 2F2CB 3EQCA 3PUPA 4WO5A 5DVRA 3ODYX 2RSVA 4H39A 4JDHA 4OTFA 4NW5A 2EXMA 5E8ZA 3B2WA 4BZNA 2QLUA 5AV4A 3L8SA 1L8TA 1M14A 2A1AB 4NCTC 3LMGA 1Z57A 4ENXA 3VS3A 1HCKA 2YIXA 5IQFA 3OROA 4FUYA 4XV1A 1NVSA 3NAYA 1H1WA 4R6VA 4M13A 2GHGA 4IADA 3C5UA 4FGBA 5HOAA 3UZRA 3TNIA 4DEIA 5KNJA 2I40A 1ZRZA 4QPSA 3Q9WA 4RIXB 2X8IA 2OFVA 5A14A 4PTGA 4RVTA 3EH9A 4FEQA 3P1AA 2F2UA 4V01A 4W8DA 3FKLA 5DT3A 4GVJA 5E92A 2C3IB 5L8JA 4HW7A 2QKRA 2VWZA 3R8UA 4E4MA 3C50A 4AXDA 1IR3A 2J0LA 4FTAA 3HUCA 3OXTA 4LFIA 4ZJJA 3TIZA 2XNNA 4H3PA 4KB8A 4TWCA 3EKKA 4KBKA 5JZNA 3CSVA 4HNIA 3LXKA 1WFCA 3DNDA 4XG7A 4AXFA 1NA7A 3BV3A 3DQWA 5DI1A 2QC6A 4AT4A 3OOMA 4IAAA 4MNFA 5EK7A 3KXXA 3WI6A 5J95A 5D10A 2CHLA 2ITVA 2QOCA 4QP6A 4WNPA 3RPVA 3W1FA 4OTGA 4FNYA 3UGCA 5IQEA 4IC8A 1X8BA 4EK3A 2QI8A 3PRIA 4EHZA 4W4XA 2VTLA 4B99A 3FQEA 3QRJA 3FMDA 3EJ1A 4NTSA 4G3GA 4GT4A 4TN6A 3ZH8A 4D28A 3I0QA 1KE5A 2OJFE 3RWQA 3WIKA 4O0VA 4FTJA 4X3FA 3VS0A 4ZZMA 3VS2A 1APME 4DHJA 3A4OX 3KCKA 3IO7A 5EI2A 3W8QA 3LCTA 4L45A 4MVFA 5FTQA 3FJQE 3ULIA 5GJDA 2XM9A 3GFWA 4PL3A 5EHLA 3VS6A 3C4FA 3NRMA 3WE8A 4EUUA 5M09A 4EBVA 3GEQA 2QQ7A 4J97A 3EWHA 2HZNA 2ITWA 2QD9A 4TTHB 3RJCA 3ZSIA 4EOIA 2VWXA 3EKNA 1Q8TA 3HEGA 3O50A 2EUFB 3EOCA 4DFBA 2HWOA 5EI6A 3U6IA 1SNXA 4IEBA 5F4NA 4ASEA 3G51A 4ZY5A 5M07A 2Y6MA 3MY5A 4G2FA 3RM6A 3KULB 2AYPA 3U8WA 3PTGA 4RLLA 2GNHA 3Q6WA 3ITZA 3PWYA 2PSQA 4F70A 5AADA 4I5MA 3GP0A 3O7LB 4BTKA 4DF3A 2QOBA 1QPEA 4XG6A 2OFUA 4H3QA 5M57A 3BGQA 2UZBA 4CKIA 4C4FA 4RRVA 4D2RA 4V0GB 4E7WA 5K0KA 3HKOA 4NH1A 1XBCA 2UUEA 4J71A 3DKGA 2WIPA 5DG5A 1RDQE 3TJCA 2P4IA 5CAOA 4JVGA 4IWQA 1V0BA 3HVCA 5M51A 4LMNA 5CXHA 4G1WA 5HE0A 1H1PA 1BL6A 3UYTA 3EQDA 3Q5ZA 3NNVA 3E64A 1BKXA 4JG7A 3GU6A 5DWRA 3PJ2A 2ACXA 4R1YA 3V6SA 3KXGA 4BWPA 2V7AA 4RC4A 1S9JA 4K77A 2W9ZB 1GIIA 3PJ8A 5CF8A 2YLEA 3BPRA 3S4QA 4O7VA 3CPBA 1G8JA 4P4CA 5CNNA 3UOLA 4ANSA 1PKDA 4KBAA 4R3CA 3UIBA 3FUPA 3GBZA 3DFCB 2ZDUA 3NNXA 5KO1A 4DEDA 2JD5A 2JC6A 1G3NA 2Y4IC 3RP9A 3WILA 5AAEA 4IAKA 5IDPA 2CLQA 4ZJIA 4DGOA 3R73A 2W4OA 3FSKA 4PX6A 1XO2B 5H3QA 1OITA 4C2WA 2Z7QA 4O91A 3IW8A 3UIXA 3H0YA 4YZ9A 3NX8A 2B52A 1IAJA 1OBGA 3LCKA 5JFSA 4DCEA 3W2SA 4PPCA 2YITA 4L3JA 5AP0A 4FVRA 1G5SA 4A4XA 5CANA 1Q24A 2XIXA 4FKVA 4XHKB 2PUPA 3JR1A 4FTUA 4K11A 4CD0A 4XV2A 4DGMA 2CPKE 3FLWA 5AUXA 3MVJA 2P0CA 3ZFMA 4MQ2A 3G33A 2QOKA 4O83A 1PRYA 3ACJA 3UO6A 2JIVA 4LRKA 3IW7A 3OS3A 3IPHA 3VAPA 3PSDA 1UVRA 1JSUA 4OUCA 5FDXA 3WF9A 4RA4A 4YJPA 4I23A 4WG4A 4EUTA 4LL0A 5CY3A 3BE2A 4CFWA 2PUNA 1SZMA 1OGYA 4YHJA 3CTQA 4E3CA 2C5OA 3UQGA 3V6RA 5CU2A 4GJ3A 4JRVA 4K2RA 5CSPA 2CNQA 1OVEA 1Q4LA 2FSMX 4S32A 3UTOA 2WU7A 5AAGA 5AX9A 5IG1A 2QODA 2YIRA 3D14A 2X4ZA 4BCMA 4TWOA 4FEUA 3JYAA 3ZM9A 2B54A 2UZWE 2RL5A 4S33A 3F7WA 3RWPA 5DFPA 5AV0A 4FVPA 4J8MA 2VD5A 2WMQA 3TL8A 3VS7A 4XP0A 4D2VA 3UO4A 1YHWA 2Y4PA 4EOLA 4UMUA 1H27A 3RZFA 4BZOA 3MYGA 3OWPA 2YAKA 4E5WA 4W4VA 2FH9A 2C68A 3FMKA 4U41A 3RHKA 4BDFA 4XEYA 4E1ZA 4R5YA 4EHVA 4F64A 3H9OA 4L8MA 5LVPA 2E9OA 5I9ZA 5GJFA 1HOWA 2W4JA 5IEYA 4G5PA 3DXPA 4GH2A 4A06A 3E63A 2C1BA 3QAME 3P9JA 5C4LA 2GS7A 3FLZA 4AN3A 2QU6A 3P7AA 4D4YA 5HX6A 2J0KA 4FV3A 5DPVA 4F9AA 2CLXA 4ONAA 3MH2A 4QQCA 4FTIA 4MXAA 4R77A 1O6KA 1UWHA 2J0MB 4L52A 4RLKA 5FEEA 5JN2A 4X3JA 3EYGA 4C7TA 3TKIA 4ACHA 3FHRA 3DDPA 3R71A 4UYAA 4WRSA 4IACA 3D7TB 5H2UA 4IHPA 4YLLA 2VWBA 4F6WA 2XK4A 3MVLA 3PP1A 4WRGA 4B7TA 3G6GA 5KMIA 3ANQA 3SGCA 3D15A 3QWJA 4LV7A 4RJ4A 5HVYA 2WTJA 3TV4A 5KHWA 3G5DA 5BUIA 4KRCA 4QP1A 3VBWA 3DXQA 4FX3A 3WOWA 4XJ0A 4BBEA 5LWMA 3QLGA 5KBQA 3VC4A 2JDTA 4L42A 3SX9A 2YM7A 3CQUA 3W33A</