4M14A

Crystal structure of itk in complex with compound 9 [4-(carbamoylamino)-1-[7-(propan-2-yloxy)naphthalen-1-yl]-1h-pyrazole-3-carboxamide]
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
263
structure length
263
Chain Sequence
KWVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWRERPEDRPAFSRLLRQLAEIAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Selectively targeting an inactive conformation of interleukin-2-inducible T-cell kinase by allosteric inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 263
sequence length 263
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4m14A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4m14A01
4A06A 4ENXA 5LWMA 1PXNA 4FEWA 5BYYA 5TKDA 5LARA 3QQFA 5KMKA 2J0JA 3F82A 5AP6A 4A9SA 2XNEA 4IB5A 2DS1A 3R22A 3ROCA 4AZSA 3HL7A 3ITZA 4XG4A 3KRLA 5J7HA 1PHKA 4O22A 3TNIA 2ZV9A 3B8QA 4I0RA 4MKCA 2PULA 2QOBA 3QA8A 4WD5A 1J3HA 4PMPA 3AC3A 2BUJA 2JDRA 5KBRA 2IVUA 1LP4A 3EFLA 3FC1X 3R9OA 2ITUA 4G6LA 2ZMCA 2X7OA 3OOGA 4EKKA 3C4XA 3KMWA 3FI2A 4N57A 1RDQE 2PE0A 3QWJA 2VRXA 4WG4A 5AP0A 5AUTA 3V51A 2IJMA 5J9LA 5EI2A 3Q2JA 2RFNA 4DFBA 1XQZA 2G01A 3TN8A 3GFEA 5ETCA 4WT6A 3C0IA 1UKHA 2WTVA 3I1AA 3GQLA 4MVFA 3DK6A 3NNXA 3PIYA 4TYHA 1CDKA 1T46A 4JBVA 4R7IA 5ANOA 4MQ2A 3NUUA 5D9HA 4F9BA 4CD0A 5AX9A 3GU4A 1YDSE 3S3IA 4BGGA 4MNEB 2PMOX 2VTOA 3BI6A 3GQIA 2HAKA 4ZTSA 3UTOA 4KKEA 2NO3A 5IQEA 2BALA 3C7QA 3FMDA 4TWNA 4AGWA 3ACJA 4TRLA 3RZFA 4KBCA 1JNKA 1FQ1B 1O9UA 3Q04A 3QXOA 4RWLA 3KCFA 3KRXA 3PJ8A 3R30A 4QYEA 4R3RA 1TQIA 4U3YA 3UP2A 4HYUA 1PF8A 3KY2A 2GPHA 4WG3A 4U80A 4YR8A 4RVLA 2BPMA 4OR5A 3UVRA 5A3XA 3KRWA 1Y57A 3WZEA 5IPJA 1ATPE 1WBWA 3D7TA 4GJ2A 3MVLA 4N4SA 2HZIA 3BBTB 4JIKA 1Z9XA 2E9NA 2Z7RA 3B2WA 3FZOA 1F3MC 2WQNA 2GCDA 3UG2A 3VNTA 4QQCA 4HPTE 1YRPA 4HCUA 1ZWSA 4LRJA 3VHEA 3T8OA 3ZRLA 4CRSA 5DRBA 4IB1A 5DGZA 1YKRA 1IAJA 2QCSA 3NDMA 5LVLA 4TWCA 3MPAA 3TUDA 2XK9A 3PLAE 4FIEA 4QPMA 5BYZA 3WZKA 4IAZA 4UMTA 5FTQA 5L2SA 4BCNA 5A6NA 3JUHA 4F70A 3HGKA 5HVJA 1NY3A 4KIKB 5FM3A 5E4HA 3KXHA 4M12A 4JDKA 4U42A 5HO6A 4C57A 3NUNA 4ZTNA 1DI9A 4MF1A 5HBJA 4YZBA 2R0UA 3QD4A 3RAIA 5AMNA 2C6OA 4JT3A 3DZQA 1YDTE 4KB8A 2QU6A 4P5QA 2NRUA 2X4FA 1JAMA 3FYJX 4FV5A 3ANRA 5TO8A 1EH4A 3PY3A 2QOCA 1U46A 3V01A 3U6JA 3SW7A 3ZSIA 3MY1A 3ORLA 2XS0A 4IC7A 5AAGA 3HRCA 2HW7A 1BYGA 3RPVA 4GYGA 5HIBA 2YWPA 4MCVA 4HCVA 4ONAA 3P5KA 4O6LA 4ZMFA 3GU6A 3OWJA 4QMVA 4YU2A 3G5DA 4HGEA 3UBDA 4MD8E 4AOTA 2C3JA 4IBMA 4ANSA 4BDHA 3U54A 1NT2A 3GU7A 4JQ7A 4BBFA 5J5TA 3MW1A 3GB2A 4O0RA 3FPQA 4AN3A 2YFXA 3DAKA 5EM7A 2PK9A 3OMVA 5D41A 4EHZA 4FTNA 4G5JA 4RX7A 1JKKA 2V5QA 4EH4A 2R5TA 2XK4A 4RJ7A 3MIAA 3V5LA 2YDJA 2Y0AA 3NNVA 4EBVA 4Z7HA 2JAVA 3GCUA 2QVSE 5BQ0A 4FL2A 5J1VA 2YABA 4M67A 2ITYA 2OO8X 5HIEA 3H9RA 4L43A 3R8MA 5CXZA 5HLNA 2OBJA 5DR2A 3G9LX 2PVFA 4J97A 5M07A 2PZPA 3C5UA 1IA9A 3NUSA 1FMKA 3CXWA 4IM2A 1URWA 2Z7QA 3P7AA 4RGJA 4BRXA 2CGVA 5FXRA 2EVAA 1H26A 2RG6A 2PHKA 1Q8WA 2BRHA 4HGSA 2R7BA 3QTSA 3W10A 1KOAA 5BNJA 4BICA 2W1FA 2EWAA 2R3OA 3CJFA 3Q4CA 4E4NA 4PDPA 1H1RA 4E7WA 4LUDA 1WMKA 1ZAOA 3IK3A 2VO0A 3IW8A 4TWOA 4GKHA 1HOWA 3ENMA 3D7ZA 4HZSA 2JKMA 4IB3A 3OBGA 5J95A 4O1PA 2X9EA 4ORKA 3W8LA 3VS5A 3A7JA 3L9LA 3BHYA 5CEQA 4PDOA 1JLUE 3HX4A 5IMXA 2J50A 3UQFA 5AV0A 4FIHA 4D2TA 5AM7A 3UODA 4KAOA 3TTIA 3VS3A 1F5QA 3H10A 3UYSA 2EXCX 4I5HA 4RIOA 2BROA 4YZMA 3KF7A 2EB2A 3GC8A 3ORKA 4GG5A 2OXXA 4CZUA 2ZM1A 3GC0A 4NCTC 1URCA 2WU6A 5D12A 3EL7A 5IEXA 1WVWA 2E9UA 2R7IA 3PVBA 4FIGA 4N6ZA 3P08A 4MXYA 4D2SA 5BVFA 2W06A 4C3FA 3LCDA 5L3AA 4YHTA 2OIQA 2ZVAA 2AC3A 4AP7A 4IAYA 4GH2A 4H1MA 4HZRA 1XBBA 2ZDTA 1P4OA 3WF7A 4QO9A 2B9HA 2UZVA 2V7AA 5AIKA 5CZIA 1R39A 1WBTA 1SVEA 4I92A 2JIUA 3C9WA 4R8QA 1Q24A 3U9NA 4FZ6A 4YZNA 5EI8A 4D4RA 2G2IA 1PY5A 5LCJA 1GIHA 3LFAA 3GBZA 3GGFA 2E9PA 4BGHA 2QR8A 2JDOA 4E5BA 2ZM4A 4CYJA 4I20A 4RT7A 3Q53A 2C68A 2YHVA 3HRFA 3DY7A 3ET7A 4G16A 2ZB1A 3UYTA 4QP4A 4I41A 4JRNA 5FBNC 1CMKE 4KRDA 4MTAA 3COIA 4MF0A 3WE8A 4IAIA 1OKYA 4RIXA 4OBQA 3EMGA 4HYIA 2O2UA 2O63A 1I44A 2JIIA 4FKOA 1YQJA 3BWJA 1M2RA 1PXLA 5GZ8A 1NXKA 1S9JA 1BL6A 4IFCA 4BTKA 4BDCA 2BKZA 4D4SA 5CVHA 5E8YA 4RA5A 3W32A 3RAHA 5HORA 1CKJA 4XP3A 4JOAA 3P7BA 4GK4A 2VWUA 3G51A 3HKOA 3VQUA 5CI7A 4YJSA 2GDOA 2C0OA 5EW8A 5L6PA 3DV3A 4PPCA 5EFQA 2XBAA 4IZYA 2OJ9A 1ZOEA 1HCLA 5IUGA 5LVOA 4JAIA 4J8MA 3UOJA 4IAFA 3QRIA 4GW8A 4UY9A 3U55A 5DR9A 5HE0A 2C47A 3NYVA 2LAVA 4DC2A 3MH3A 4YLJA 5DFPA 1BI7A 2X8IA 5CT7A 4L42A 4JQEA 5CZHA 4XP0A 2GHGA 5FEEA 4PP7A 3SDJA 4BCPA 1CM8A 5HZNA 3DB6A 2PYWA 1PMUA 5G6VA 3ORMA 4EI4A 3BCEA 4W9WA 2R64A 3GNIB 3IKAA 3UOHA 4YO4A 3RTPA 5JKGA 4QMXA 4Q5HA 5ANKA 4ANQA 2FSTX 4FX3A 3UIXA 3OHTA 1OIRA 2C0TA 2X81A 3OWLA 4FTMA 4TYJA 5GJGA 2YDKA 4DCAA 4XG9A 3I6WA 4YJTA 4O86A 4CFNA 4R1YA 4ZSGA 5ANJA 3MFUA 2XNMA 4IWDA 4B6LA 4OTDA 2DQ7X 1XJDA 3ORXA 2XZSA 5JFVA 1MQ4A 2W1HA 5CU6A 2J0KA 3OEZA 1OPKA 3CKWA 3OY3A 3R28A 4UBAA 1MRUA 3HA6A 3N4VA 2W1DA 5EM5A 4GU6A 3KMUA 4I5MA 4LL0A 3NAYA 4K33A 4NM3A 4YP8A 3W2OA 1OIYA 2GS6A 4MQ1A 5B0XA 2IZSA 4L6QA 4XOZA 4CTCA 3MVMA 2WPAA 3HV3A 1FVTA 3CTJA 4RIWA 5AV2A 1ZY4A 4NIFB 1H4LA 2W17A 3E63A 3GENA 3PWYA 2BDWA 3R0TA 4FTQA 2UZBA 1U5QA 2PMIA 1ERKA 1Y8YA 4K9YA 4Y8DA 5E8VA 2HXLA 1YDRE 4QNYA 2P4IA 4J1RA 2I1MA 2VO3A 4AWIA 1SYKA 2ESMA 4CLJA 2OXDA 5CASA 4XBUA 3OROA 3VBXA 5AUWA 4IX3A 4FSUA 3S0OA 1R1WA 1WVYA 3RWQA 2FSLX 3PA5A 3P86A 5D1JA 4D1ZA 2W1EA 4GRBA 4CKIA 2CCIA 4QMLA 3FMJA 1STCE 3R73A 1K2PA 2XIRA 3FMHA 4O0UA 4J96A 4AU8A 4CV9A 4FIFA 4F9CA 1PJKA 4BDIA 2HY0A 4BGQA 4D58A 3F88A 4A7CA 2BCJA 4WNKA 5DH3A 4PPAA 2W96B 3WI6A 3OG7A 3SRVB 5AR7A 2X6DA 5CENA 3DCVA 4FTAA 2HXQA 4RJ4A 4YZ9A 5H8EA 5BVKA 2OSCA 4KWPA 5TT7A 4E6DA 4MXCA 1XO2B 5HQ0A 1FOTA 5H9BA 1PMNA 5L8JA 2DUVA 5EK7A 4UMUA 4J52A 4MH7A 4LGHA 5L6OA 4DYMA 2R3NA 4IVCA 3C4WA 4EYJA 3DDPA 4FEQA 3QTZA 4USEA 4JDJA 3SHEA 3QCXA 2HWPA 5JGBA 2CMWA 4FSNA 3FY0A 2RFEA 4QMWA 4X2FA 2I0EA 4HYSA 5ETAA 3PY1A 3HUBA 2PVMA 3HV7A 5EH0A 4MEDA 1A06A 2JAMA 1RE8A 1OKZA 4DN5A 4G5PA 2PWLA 4J71A 2HOGA 4M0YA 3Q3BA 3BV3A 4N70A 5JFWA 3LE6A 3NPCA 4FK6A 3DTWA 4RC3A 3CY2A 4BWXA 4FKTA 4LYNA 5DNRA 3IW6A 4ACCA 3DK3A 2XIYA 3BE9A 4GFGA 3A4PA 2X2MA 3A99A 4L67A 5EG3A 4EH6A 4NFMA 3OZ6A 1XH6A 2XK6A 3R7EA 1Q61A 4S34A 5EQEA 4KIPA 1OIQA 5HBEA 1J1BA 3VUTA 2ONLA 3ZUVA 2JLDA 5K5NA 1AD5A 1Y6BA 1XH7A 3VBQA 3DKCA 4NW6A 5HGIA 2CJMA 5IUHA 4MNFA 3EQBA 3PA4A 5AAFA 3OF0A 3E8DA 4AFEA 4ANLA 5CAQA 4FIJA 4R5SA 3CC6A 3R02A 5CEKA 2BIKB 2UZLA 4NT4A 5DE2A 3UIMA 2Y4PA 4KIOA 4UYAA 3I81A 4E4MA 2W4KA 3SA0A 4K1BA 3C4ZA 4CG9A 1ZYSA 3HP2A 5E90A 4CRLA 4DGNA 1U5RA 3WYYA 3QTXA 5KMMA 4FGRA 2J7TA 3UNZA 4UXQA 5CALA 2EXMA 4XJ0A 4C2VA 4ASXA 1OUKA 3U4WA 1V0OA 2OIDA 5E9EA 2C30A 2PVKA 5CI6A 4E6AA 4QTEA 4ALWA 4BR3A 2ITXA 5M4CA 4FV9A 4BHNA 3RK5A 4EBWA 4HNFA 3DAJA 3GCVA 5KZIA 3UE4A 4EK3A 3A7GA 4GS6A 4IACA 1P5EA 3RHXA 4BF2A 4F6SA 2GNJA 5FEQA 4CVAA 4JG8A 5CXHA 2HELA 2A1AB 2Q0NA 4YTFA 1JVPP 4ZP5A 2GS2A 4L53A 4ZEGA 5GIOE 3EQFA 4KKHA 3VHKA 4F09A 1E9HA 1JKSA 2ITNA 4J7BA 3RK7A 1W7HA 2R3KA 4FTIA 5AA8A 3VUKA 2CNVA 5A4QA 2EUFB 5DG5A 2BFYA 3BYOA 4E5AX 3AMBA 2YCQA 3EFJA 4WBOA 3C0HA 4C37A 2OWBA 2XIKA 3FSFA 3MIYA 3O50A 3A61A 4FZFB 4MBIA 4YSJA 4ZTLA 4FTUA 2BAQA 3ULZA 3RPRA 3F5PA 3JXWA 3U4UA 5AR2A 3BQRA 4QRCA 5CYIA 2VX3A 4D9TA 2W7XA 5I0BA 5J1WA 2WNTA 3QUDA 5LXMA 3BYUA 2VTIA 4F99A 2YAAA 4MHAA 5E8WA 2O8YA 3RAWA 3R83A 3BEAA 2QOFA 2VZ6A 2FO0A 3I60A 3MH0A 2YM5A 3R6XA 3KXGA 4L68A 4Y73A 4Y72A 4QP1A 5IEVA 2UZEA 3S4QA 1IG1A 2UVZA 4F7LA 3UP7A 3H3CA 4YZCA 3OWPA 4S31A 3ZO3A 3C4CA 3OTVA 4DH8A 4DFLA 2ETKA 3QXPA 4BY9E 4NJDA 4TTHB 2WAJA 2WU7A 3UNJA 4FV4A 3NWWA 5DYJA 2DWBA 3LLAA 3W16A 3PLSA 4RG0A 4HW7A 4AZFA 2VWVA 2FYSA 4TPTA 1ZY5A 4EORA 5J7BA 1ZMUA 3LXLA 5C8MA 4HJOA 2JFMA 4CMOA 3OUKA 2F7ZE 4I21A 4XLVA 3E5AA 3AG9A 3NW6A 4WRGA 4NYEA 5JH6A 4BDBA 4FNXA 5CSXA 5GNKA 3MFTA 3M42A 3OXZA 4I5CA 4WRSA 5AV4A 1TVOA 4ZLOA 4XP2A 5HTBA 2PUNA 2XJ2A 2ITTA 5KX8A 4DA5A 3HZTA 1PXPA 3HMNA 3NIEA 3RP9A 5JRSA 4CZTA 4MD9E 2OFVA 3F2AA 5A46A 1ZMVA 5HLPA 5KNJA 1W8CA 1J1CA 4F1TA 4X6QC 5M09A 3BGPA 1W98A 3ZS5A 4DG2E 5IQDA 4C59A 2C5OA 2B54A 2OF2A 4M69A 3KXZA 3RCDA 3IW4A 1RQQA 2X2LA 4I6BA 2VV9A 3WF5A 4FUXA 4QPAA 2C4GA 4GU9A 4XX9A 2XF0A 3W2RA 3NYOA 2A2AA 3VBTA 4C34A 4YUQA 3GVUA 3VS7A 3MJ1A 1X8BA 3E8CA 4IZ7A 3E8NA 5G1XA 2FH9A 4ZJJA 4I1ZA 1PXKA 3LFBA 4UWBA 4IM0A 1WVXA 5IQCA 5IQIA 3BU3A 3MYGA 3QL8A 2XM8A 5M06A 2PUUA 4RC2A 5HHWA 3O8PA 4HGLA 5L4QA 3IONA 4O7LA 4LOQA 4XYFA 3PY0A 2Y4IB 3EQHA 3NUYA 1UWHA 3UC4A 4EZ7A 5FD2A 5BUIA 2WZJA 4BCMA 4AA0A 1SNUA 2HWOA 3IW7A 4DFUA 2Y8OA 3EFWA 4RQVA 2GTMA 4B0GA 5KCVA 3RZBA 4P7EA 1UU8A 3CPCA 3VVHA 2BRNA 5HEZA 2AC5A 4ZY5A 2PVNA 2JGZA 3FI3A 3LXNA 4FV0A 5E8UA 4EOJA 5LMBA 4EK5A 3C1XA 4DBNA 1H1SA 3LVPA 3OXTA 2F9GA 2HW6A 4ANMA 4JR3A 2I40A 5F9EA 1UA2A 4JDHA 3LIJA 5EHLA 4F1OA 4HYHA 3R7UA 4BDFA 2WXVA 2YIXA 4RA4A 1W83A 2FB8A 4G1WA 3ZRKA 4F6WA 1M14A 2UVXA 4X2NA 3FEGA 3BYVA 3G6HA 4PY1A 4RWKA 2QG7A 1PXIA 2WGJA 3BELA 4AQCA 1M2PA 3SLSA 4EHVA 5ETFA 1VEBA 2IWIA 3KXMA 4EOMA 4YLLA 4E3CA 1MRVA 3R21A 3ZRMA 5C9CA 5AP4A 4FK3A 4MXAA 4O7TA 2J9MA 1PMEA 2YERA 1VR2A 2YJRA 4LRMA 5DLSA 3IW5A 2C5NA 3CJGA 4UXLA 1WBNA 2UZWE 4FTRA 3FSKA 3F9NA 4OTGA 4P2KA 5JFSA 4Y5HA 3P1AA 4BCQA 2HYYA 4G6OA 4BWPA 5A4TA 2VO6A 1ZYDA 1KV1A 3D94A 4K11A 5H8BA 5JQ5A 4UV0A 5HCZA 4YURA 2RIOA 2X1NA 2IG7A 2HY81 2JDSA 3FY2A 4C3PA 3HP5A 4CNHA 3A2CA 1KV2A 3KK8A 3KREA 5BPYA 1PKGA 2PMNX 5CSVA 4A07A 2RL5A 4LI5A 4EWHA 4FV2A 2XNPA 3QQHA 1WBOA 4JLCA 4RJ3A 3KB7A 3NX8A 5J5SA 1PW2A 4D4YA 2WQEA 4EH2A 1NW1A 1VYWA 4IVDA 5HG8A 3ZSHA 5EW9A 3GC7A 3PUPA 5CSPA 4JBOA 5CU4A 4TL0A 3PZHA 3ODYX 4FSTA 4ZZOA 3LMIA 3BLHA 4GT4A 4NTSA 4C61A 4KS8A 1H1PA 1GZ8A 4F7JA 4LOPA 1ZLTA 4APPA 2QHNA 4QTDA 5FP6A 4EK4A 4ZS4A 3R8ZA 3EN7A 4A9TA 4AF3A 3RKBA 1W84A 3TUCA 4F0GA 3DXNA 3QTIA 4HCTA 5ETIA 4C4EA 1PXJA 4IXPA 5AP3A 5M08A 3NVMB 4IC8A 5DT4A 2ACXA 1JBPE 5I5ZA 4BCGA 3TCPA 3PJ1A 3TZ8A 4M69B 5FTGA 3LQ3A 5M4FA 2VWWA 4NKAA 2Z2WA 4TY1A 4DITA 3OWKA 3MPMA 1U54A 3TTJA 4ITJA 3C4EA 4QD6A 2UW7A 2Q0BA 2VTRA 4JG6A 5JFXA 1BI8A 4IMYA 4M8TA 2F49A 3JYAA 5IG1A 4ID7A 3TNPC 3QFVA 1M17A 3QX4A 4G34A 5TR6A 3QF9A 4EONA 2WMXA 5AUXA 3T3UA 3DT1A 4F65A 3L8VA 2GHLA 2XVDA 1MRYA 5J9YA 3OS3A 2PZYA 5T3QA 2XNNA 4YO6A 2IZTA 2OU7A 2R3IA 1IRKA 4CLIA 4K6ZA 4CG8A 3PPJA 4KRCA 2ZB0A 3C4FA 2C1AA 2OJIA 1H24A 1REKA 1YXVA 4JQ8A 1ZOGA 2IVTA 4GJ3A 4XS2A 1OL5A 4DG0E 3K3IA 4V0GA 4JBQA 3VUHA 3BZ3A 1RW8A 1Q8TA 4OUCA 3RI1A 3L8PA 5BYLA 3VIDA 3RCJA 3MN3A 3IOKA 5EI6A 4CMUA 1G5SA 2UZDA 5AR3A 3LZBA 4GSBA 1ZARA 2O5KA 4FOCA 4AACA 2YCFA 4EC8A 3W2CA 3K5VA 3D9VA 5GHVA 2H96A 2WOUA 3Q5IA 4XLIA 4P4CA 2QC6A 1T45A 3DFCB 1OL7A 3O7LD 2E2BA 3BHHA 3ERKA 5DI1A 3FKNA 2PZ5A 2CN5A 4RWJA 4HVIA 1PYEA 2VX1A 5AIRA 5B2KA 3C5IA 2EU9A 3F2NA 3FMKA 1FGIA 4FTTA 2WELA 1L3RE 4CTBA 1B38A 3UZRA 3GEQA 3PJCA 3PXFA 4NH1A 4EC9A 2ZV7A 4OTHA 3GUBA 4U0IA 3QTWA 5HBHA 1O6LA 4O0TA 5IH5A 1G8AA 4OTFA 3KKVA 4BHZA 5IA4A 4KSQA 4TN6A 2PE2A 3DXQA 2BZKB 2OF4A 2XIXA 3F3UA 3LJ2A 3QZFA 4R1VA 5E8TA 3OCBA 5AUUA 4C2WA 3SVVA 3DLSA 2WTJA 3E62A 4RFMA 4Y5QA 4A4OA 3UDBA 5GIPE 3TJDA 3MH1A 2RGPA 4O2ZA 4M14A 5AEPA 3FLYA 3CS9A 4CFWA 4X3FA 3K54A 4EQCA 1KE9A 4BKJA 4EH8A 4MX9A 5AA9A 4QYGA 1M7NA 2GQSA 2OICA 4CYIA 2ZV8A 5FRIA 3PXYA 2IW9A 2XUUA 3DDQA 3H9FA 2W4OA 4FNYA 4C62A 5HTCA 3QAME 3Q2MA 3UOLA 3UMXA 2XNOA 3Q60A 3BEGA 3IDCA 1YHVA 2CDZA 3DGKA 3MY0A 4MBJA 5CSWA 4PRJA 4FKRA 3W55A 4RLKA 3GC9A 4EKLA 1K9AA 4O96A 3P9JA 1OL1A 4RVTA 4C4JA 3R9HA 5DIAA 3WF9A 2W5BA 4IFGA 3OT3A 1OECA 3LXKA 3UO6A 3G90X 2J5EA 5FBOA 2XK8A 3HRBA 3O51A 3OTUA 2OZAA 3Q96A 3JY9A 4PL3A 3AQVA 1GY3A 3PIZA 3HUCA 4OTWA 4P90A 5HE1A 3ZFXA 1M2QA 2WTDA 2UZOA 4A9YA 3PZEA 3QLGA 3C51A 4YTIA 4OTQA 4BC6A 2VTQA 3AMYA 3CD8A 2Z7SA 2GFSA 2R0IA 5HG7A 5E91A 3R1NA 3SXRA 1M52A 2OIBA 4QMNA 3TACA 3C50A 4TYHB 3BWFA 1G3NA 3UPXA 4WG5A 4U7ZA 4I6FA 4E5WA 4KUJA 4ZTHA 5H8GA 2B1PA 2GHMA 4QP2A 4U9AA 3FZTA 4KSPA 1U54B 5E1SA 4FKUA 3VS0A 2C3IB 1VZOA 1H27A 2C6EA 2UV2A 3G9NA 3NGAA 3P78A 2QKWB 3PIXA 2XRWA 3Q4TA 5HVKA 3NUPA 5HG5A 3TKHA 2WMQA 3DQXA 4ACMA 2WTWA 4OAVB 2WEIA 5FXSA 3I5NA 4S30A 3N4TA 3R8UA 4DLJA 2RFDA 4X2JA 4WNMA 3TKUA 4JJRA 3GCQA 2O64A 4S33A 5IA1A 2UVYA 5AJQA 3ZU7A 3QYZA 3BHTA 3MWUA 3QTRA 4OTIA 4AT5A 3BBWA 5CWZA 4X0MA 3O17A 3ZFYA 1U59A 1QPDA 2XJ1A 3QYWA 4ENYA 1OKWA 4L52A 4QTCA 3VS2A 3QZHA 4J53A 4NW5A 4U40A 3H0YA 4BZNA 3D7TB 3HAVA 2BFXA 2GS7A 2WTCA 3EYGA 3KC3A 3VUIA 4AZEA 4JR7A 4ERWA 4XUFA 3SAYA 3H0ZA 3AT3A 3UGCA 4CV8A 4J8NA 1Y8GA 2XMYA 2YITA 1FBNA 1QCFA 3GI3A 3WYXA 3KVWA 1XKKA 2WMVA 3NUAA 4EWQA 2BILB 3Q52A 4L46A 2QONA 2X7GA 5AR8A 3V5WA 3VW8A 4I4EA 4R7BA 1XH5A 1LUFA 4R5YA 5CNOA 5E1EA 4IDTA 3TZ9A 4EOIA 2Z02A 2Y9QA 4D1XA 4DCEA 3LAUA 2Y6OA 2CNUA 4A4LA 1Y6AA 2F7XE 3WZJA 3EH9A 3EIDA 1ZOHA 4JNWA 4MWHA 2VTMA 1H8FA 4FEXA 2CNQA 2RKUA 3F5GA 2PVYA 3TKIA 3IS5A 2QOLA 5JMSA 3TV6A 4C3RA 4QTAA 1E1XA 2E9VA 3DS6A 1ZXEA 2W4JA 2G15A 4RBLA 3R8PA 5CEMA 3ETAA 4WNOA 4NTTA 4UB7A 3UNKA 3BE2A 4I23A 4F63A 3DKGA 4BCHA 1H28A 4FE2A 4ZMEA 3IOPA 2FUMA 4JL9A 4L7FA 1FVRA 2B9JA 3FYKX 4H3PA 4QPSA 3THBA 1XH4A 2B9IA 3ORZA 1Q62A 3NYXA 1S9IA 3HDNA 4GVJA 4BTMA 4FV6A 2C6DA 4JI9A 4DEDA 3UO5A 1KE8A 3FQEA 4AS0A 1SMHA 3UIBA 1NVRA 4UMRA 1GNGA 4LRKA 3OUNB 3KU2A 4JRVA 3CQEA 1P14A 3R1SA 4CSVA 1JKLA 3AGLA 1BKXA 3BPRA 2YCSA 2A4LA 4CFXA 3FZ1A 2REIA 4NU1A 4XG3A 4DINA 1OITA 4YMJA 3WE4A 4AT3A 3QQJA 4QT1A 5IEYA 4H3BA 4WA9A 1WBVA 2BRBA 3LPBA 3D5UA 4LL5A 3DLZA 3Q9ZA 4FG7A 3DXPA 5EYKA 1ZYCA 3ORNA 3VWAA 5L2QA 3ZYAA 1YOLA 4FSQA 4BCJA 1MUOA 2R3QA 2PL0A 2OZAB 5DEWA 5TE0A 3RBWA 3W18A 3PXZA 1BUHA 2UW3A 1SVGA 1GAGA 3FLWA 4GFOA 3EN5A 5GINE 3IGOA 3O0GA 4FEVA 5CLPA 4CGAA 2VU3A 1VYZA 4TYEA 5J79A 1H00A 3K3JA 5TF9A 4JAJA 3SW4A 2CGWA 4B9DA 3EJ1A 5DA3A 3PE2A 5J8IA 2C6IA 3VW6A 4D28A 5BVOA 4XG6A 3UMWA 4AE9A 3SD0A 4D2VA 4CZYB 3QA0A 3UQGA 1Z57A 3DAEA 1YHSA 4BB4A 4D2RA 4D5HA 4FICA 5JZJA 4DF3A 5K3YA 4E6QA 3D2KA 3NCGA 2VGOA 3KN6A 3A60A 1OM1A 4TWPA 3OEFX 1UU3A 4RVKA 4AZWA 5BX0A 3CGFA 3T9TA 2R2PA 2R9SA 3TT0A 4EQUA 3QALE 5IQGA 2OH0E 4DFXE 2UZUE 3W33A 4Q9SA 4EHGA 1WFCA 4J98A 3D15A 4DGGA 2W0JA 3NIZA 2XKDA 2O65A 3FLQA 2QO9A 3VRYA 3BX5A 5DN3A 5EHOA 4QMMA 4ZZNA 1UNHA 3BV2A 5DRDA 3PWDA 4OBPA 2JIVA 2HIWA 4U44A 4BDKA 3TNHA 3SKCA 5DVRA 1Q5KA 3NMUF 3PVGA 3HMIA 3DFAA 3VQHA 3U6IA 4OTPA 2OXYA 2IW6A 4FC0A 5CT0A 4RJ8A 4R3PA 3I0OA 4BDAA 2XEZA 3LHJA 4J99A 1XWSA 5E7RA 4TKSA 3R7IA 3RVGA 3P0MA 4O2PA 4DEBA 4EQMA 4F08A 5IA3A 3POZA 4FKJA 5LMKA 3JVRA 5BVDA 3VF8A 5ANDA 3TNWA 3COMA 3D5WA 3EHAA 4CQGA 1B39A 2XEYA 5J87A 4XRLA 2JKKA 5K4IA 4D9UA 2WHBA 2BR1A 2WMBA 3I7CA 4RRVA 5T68A 4E20A 4JS8A 1APME 3DA6A 3QQLA 4W8EA 3BYSA 2VTAA 4G9RA 1OIUA 4D55A 4ZJVA 5IF1A 2HZ0A 2B55A 3QRJA 5F1ZA 4NUSA 4UWCA 4AZTA 3LFSA 3WILA 4O1OA 3P79A 4GFMA 3QQGA 3ZBXA 3SQQA 5A14A 3KULA 4UYNA 3V5TA 3AC5A 5DMZA 4RIXB 1JSUA 4BDEA 4R3CA 5IMEA 4TXCA 4ITIA 2IPXA 4PNKA 5I9XA 3TDVA 3QZGA 4O7ZA 4IX4A 4RZVA 2NPQA 4EOSA 3HA8A 4N6YA 4QP3A 4M68A 3CSVA 4TZRA 4XOYA 4Z3VA 3VS6A 2OJJA 1L8TA 4MYGA 2V7OA 4FYOA 4QTBA 4TW9A 3OY1A 4QMSA 3I0QA 5IISA 4FKVA 1OL6A 2UW0A 2XCHA 5HESA 1I09A 4DGLC 5IH4A 5A9UA 4K2RA 5I9VA 1SVHA 1Q8UA 4LGDA 4LMNA 3TV7A 5JRQA 2XA4A 3WF6A 2BTRA 4FTCA 5DPVA 5HO8A 4JVGA 3PPZA 1JSVA 1H1QA 3QLFA 4KA3A 2QD9A 2J0MB 5JN2A 2YEXA 2ONLC 4ANBA 5M44A 3EWHA 3SGCA 2I0YA 3GOKA 1P4FA 1J7LA 3DBDA 2QR7A 3PVWA 3WOWA 5KZ0A 3UVQA 1OGUA 3LFCA 5CAVA 4YJQA 3D83A 4WO5A 3K2LA 5FEDA 3HEGA 1KE6A 4GV1A 4KNBA 4WSYA 3FKLA 3OW4A 4O82A 4TT7A 4ASEA 5HX8A 1ZYJA 1XH9A 3HV4A 2BRGA 2WQOA 5ACBC 3SXFA 1OUYA 4O21A 5CF4A 4E4LA 4A9RA 3ZM9A 3TNQB 4FT0A 4RIYA 3VJOA 4IB0A 4FKPA 5GZ9A 3TM0A 2R3LA 2J90A 4KBAA 4EZ5A 2BTSA 1AQ1A 2WKMA 3KL8A 3Q6WA 4D1SA 4R77A 1YI6A 5I3OA 3CCNA 4DGMA 3MFSA 4ZXTA 1H08A 4B7TA 3ATSA 3E7VA 5CEIA 3MPTA 4WHZA 3I6UA 3TZ7A 3UZTA 4O7SA 2J2IB 1M7QA 3MY5A 4GK3A 3UQCA 3IG7A 4C02A 3ZTXA 2OFUA 3WBLA 3PXQA 2WMUA 4RIWB 3V6RA 1PXMA 5BMSA 4UMPA 3F66A 5C8NA 2HZ4A 4C58A 3CEKA 3EKKA 2YM8A 2C6KA 4I5PA 4LGGA 3LJ1A 3FZPA 4XH6A 4AW5A 2F57A 5BVEA 1JQHA 2GFCA 3KA0A 3NRMA 3TL8A 3MFRA 2PU8A 2GTNA 2XP2A 3NW7A 4C7TA 2ITZA 2R3MA 2X2KA 4IE9A 4PUZA 3FDNA 2Q83A 1UVRA 3EZVA 1Z5MA 3FXXA 1CKIA 5JGDA 2YIWA 3QX2A 2W1CA 2XM9A 4NSTA 5A4CA 4MXXA 4EHEA 3A4OX 4FR4A 2A0CX 2F7EE 4O0SA 2G2FA 3QRKA 3FMMA 4G6NA 3F69A 3PDTA 4L8MA 5AV3A 4IQ6A 4D2PA 3MB6A 4GUBA 1BMKA 1OVEA 1IASA 1MP8A 1NA7A 3ORPA 1XHAA 3FQSA 4FKWA 2XBJA 2JBPA 4JX7A 5JZNA 5CQWA 3GU8A 3IGGA 3IQ7A 5FTOA 3RPOA 1O6KA 3R63A 4CT2A 4RX8A 1OBDA 1GIIA 3TZMA 4WKQA 5AR4A 2CHLA 4U6RA 3LOKA 4GMYA 3MDYA 3R1YA 4YBJA 4B8MA 4PV0A 2PE1A 4ANNA 1YOMA 4RLLA 4G3DA 3UC3A 2X39A 2JC6A 5I9WA 4BI2A 3LLTA 4MWIA 4Q5EA 4BCKA 3MSSA 2VUWA 3RM6A 4BTJA 5CEOA 5CVGA 3DTCA 5KMOA 1H1WA 3CTHA 3OC1A 3V6SA 3IPHA 1XR1A 3IDPA 4C4FA 5ICPA 4GT3A 4E1ZA 3VJNA 4AXAA 4BFMA 3V8SA 5AADA 4PNIA 3A7FA 2PTKA 2OI4X 2GSFA 2JDTA 2Z7LA 5CEPA 1Q8YA 4ZTRA 5JEBA 5KUPA 3CKXA 5FM2A 4PL5A 2IZRA 2Y7JA 5BUJA 4U97A 3TUBA 5LMAA 4ALUA 4BWKA 3FAAA 3KRJA 3LJ0A 1WBPA 3H30A 5EOBA 4RWIA 4GG7A 5HG9A 5HLWA 2ETRA 3A8XA 5HU9A 2X9FA 1OZ1A 5L2TA 4ARKA 4GL9A 2RFSA 3R9DA 4CMTA 5DEYA 2BHHA 3CR0A 3QQUA 5JGAA 4OAUC 2VTHA 4HGTA 1KUTA 2WFYA 1J7UA 1GZNA 4DEEA 1LEWA 2VX0A 3V3VA 4NFNA 4I22A 4E73A 3L1SA 4DH1A 4CFFA 2ZYBA 1Q97A 2BZHB 3RK9A 5K5XA 1ZZ2A 4P5ZA 4AA5A 2CLXA 4O0VA 3GP0A 4XG7A 4KIQA 3KMMA 4QQTA 3QZIA 1UU7A 3EYHA 4PF4A 4ZZMA 4RZWA 2PMLX 3AT2A 3FHRA 4YC8A 4RSSA 4KBKA 3MVJA 2B53A 2BHEA 2OLCA 4ZY4A 4HVSA 3LQ8A 3VBWA 4MNEA 1FINA 3B2TA 4E26A 2XKCA 3GXLA 5F95A 4TYGA 3CBLA 4D0WA 3GCPA 2WQBA 4O7RA 3EKNA 2VNWA 2RSVA 3DU8A 1Q4LA 5IUIA 4IM3A 5HOAA 5ITAA 5M55A 4YTCA 1SZMA 2XNGA 3UVPA 4C35A 5HD4A 2ITPA 5BUEA 1OBGA 3QD3A 3COKA 2YIRA 2R3RA 2QU5A 4FMQA 4LUEA 2XK7A 2ZM3A 4YJUA 3A8WA 4BCOA 3PG3A 5DT0A 5LOHA 3EQIA 5GJDA 3VAPA 5AUZA 3MJ2A 1KWPA 3MTLA 3R8LA 4JG7A 1E1VA 1H0VA 4DEIA 5IZFA 1JSTA 4BBMA 1KOBA 5HX6A 3K5UA 2WMTA 4Y46A 5AAEA 4G9CA 1WZYA 2CKEA 3FI8A 3BLQA 3G33A 3PG1A 3PSBA 4V04A 4YJPA 1XBAA 2JKOA 5FGKA 4OGRA 4ZS0A 4CFVA 4KS7A 1LR4A 5EKOA 5DWRA 2PSQA 3PXRA 3V8WA 1YVJA 4CFMA 3I4BA 3DBCA 4QMYA 4QQJA 3SOAA 3RWPA 3D5VA 5EQPA 1A48A 3QKMA 4YHJA 4BIEA 1SNXA 3II5A 1FGKA 2CCHA 2YM4A 5KMNA 2UW9A 3BQCA 4U8ZA 4BCIA 4E6CA 4RJ6A 3Q9YA 4CKRA 2VN9A 2YCRA 4OW8A 2JBOA 3VUMA 4DTKA 5IDNA 4A9UA 4KIKA 5HICA 5KE0A 3V8TA 2VWIA 4G17A 4G3EA 5CX9A 4ERKA 2VTJA 2WOTA 4W4VA 1H07A 2VAGA 4DEAA 5C03A 3QU0A 4USFA 3MV5A 4X21A 2P2IA 2YZLA 1R0EA 1ZZLA 3PP1A 3VBVA 2ZV2A 5D7VA 4C36A 2XK3A 3QKKA 3T3VA 4EOOA 2C5XA 3RINA 4F1MA 4LFIA 2Y6MA 2JITA 2UW4A 4O0YA 4LOOA 5FDXA 4FOBA 4BKYA 5IU2A 3HYHA 4YGAA 1UU9A 2J4ZA 3FXWA 3DKOA 4QQ5A 4YJVA 3S1HA 3R9RA 5CTPA 5ANGA 2P2HA 1IEPA 4F0FA 3T9IA 1UV5A 5CU3A 4FSWA 4EUTA 3RAKA 1MQBA 3PRIA 5C1QB 3NEWA 3H9OA 2XNBA 5KKRC 3NAXA 5EOLA 2RF9A 4PMMA 4AW2A 1ZRZA 4MAOA 3PYYA 2AYPA 5AUVA 3ZSGA 4RPVA 3NS9A 3R7OA 3I5ZA 5IA5A 2C6LA 4H3QA 5M56A 4OT6A 3O7LB 3G0EA 4NL0A 3FJQE 2GQRA 3EQCA 5D11A 4AOIA 3W2PA 4ZTQA 2C6TA 1CSNA 1GJOA 1OB3A 1Q99A 1YHWA 4I94A 3WIGA 1LEZA 3EOCA 2UZTA 3WIKA 3U8WA 1P2AA 2ITVA 2R3PA 2CGXA 3MS9A 4BL1A 4BDGA 3QHRA 2EXEA 3SOCA 4EH7A 3QD2B 4C4IA 3KEXA 2AUHA 4YTHA 3PE1A 3ZUTA 4XG8A 5CAUA 3NYNA 3ZH8A 2R3FA 3BGZA 5AM6A 3C13A 4NWMA 5M51A 2VWXA 2X4ZA 3IO7A 3CTQA 3KGAA 3Q9WA 2W9FB 5DR6A 4RX5A 3PJ2A 3AC8A 5C26A 5AWMA 4J95A 2FA2A 4YNEA 3ZDIA 2VTNA 5FDPA 4ACDA 2QKRA 3DBQA 1PMVA 3QWKA 2GNIA 3CY3A 1UKIA 4H1JA 3D2IA 3DJ5A 3E8EA 3HDMA 5IQHA 4IHPA 1V0PA 3L9MA 4BTFA 4ZIMA 4GUEA 4O83A 4FTOA 4PPBA 4B99A 3DNDA 4FV8A 2W5AA 1CKPA 2QO2A 4ACGA 2YN8A 4HVHA 3CD3A 2A19B 2BAKA 2WMRA 5CF8A 2F4JA 4ZSAA 5JQ8A 3G0FA 5IQFA 3IECA 3U9CA 5DT3A 4CQEA 3F2RA 3D0EA 4HPUE 3EN6A 1JOWB 3KN5A 3S95A 1PRYA 5EKNA 4DT8A 1TQPA 4QMTA 5FLFA 3RNIA 3VULA 3ZUUA 4FA2A 2CKOA 2QLUA 3RM7A 4Z55A 3MH2A 3BLRA 3N9XA 5A6OA 3TDWA 3O8TA 5IA2A 3HLLA 2V55A 4HOKA 4JX3A 3TV4A 3ZEWA 3CIKA 1XH8A 2J0IA 4QP8A 3TEIA 2H8HA 5EHYA 2BDFA 5KHWA 3OCGA 4AUAA 3S2PA 2C3KA 2QO7A 3ACKA 2O0UA 3BHUA 4FSYA 3DBEA 3OW3A 3NUXA 4F7NA 4Y85A 1YXXA 5JSMA 5EDQA 4Q2AA 3RALA 4NK9A 2WMAA 1A9UA 1WBSA 2PZRA 2R4BA 2NRYA 3LFQA 3KF4A 2ERKA 4M3QA 5EYMA 4W4YA 4M84A 2R3JA 3HAMA 3OOMA 3G15A 4PP9A 4UZDA 1O6YA 2P3GX 4ZY6A 3MTFA 3FHIA 4BDJA 4OLIA 1BL7A 3LCOA 3P4KA 3VUGA 2OZOA 2QOKA 4F64A 5B2MA 2HENA 5AFVA 3AC1A 3WARA 2ZDUA 2OW3A 4UN0C 2SRCA 4U5JA 4D4VA 4FGBA 5C8KA 2ZMDA 3DPKA 2VWBA 3RHKA 2YISA 4X3FC 5DBXA 4DG3E 5J9ZA 3F6XA 3PJ3A 4DHFA 2JD5A 5KMJA 3VS1A 5CY3A 4W8DA 4O7WA 2B4SB 1YW2A 2VTPA 1JKTA 2ITQA 4M0ZA 5ANEA 4BBEA 2DYLA 3ZC5A 4R7HA 3HECA 4DLIA 2P0CA 3HV5A 5I4NA 5KKRB 2B52A 4U81A 5I9ZA 1OL2A 3ZO4A 1UNGA 3D14A 4QP7A 3UIUA 5FUTA 4MXZA 3L8SA 4RC4A 4ANOA 3KFAA 4O0WA 5A4EA 1V0BA 5EDRA 2CGUA 3EN9A 3OFMA 4IJ9A 4NKSA 2ERZE 2W9ZB 3F3ZA 4RMZA 5D10A 3V04A 3AC4A 1W82A 4DEHA 2XJ0A 4XRJA 3KCKA 1PXOA 4QMOA 1KE7A 1R0PA 1V1KA 2UW5A 4CEGA 4IW0A 4I3ZA 4XHKB 1J91A 4TNBA 4IVBA 4GYIA 4GVAA 4OTRA 4FV1A 4FVQA 1YXSA 4E4XA 4L45A 4W4WA 2CSNA 4LQMA 3PSCA 2BIYA 4ZLYA 5KO1A 3EB0A 3VBYA 3HVCA 2GMXA 3OCTA 4X2KA 5CANA 4Z7GA 2FSMX 2C1BA 2KTYA 4XV2A 4HVDA 3HV6A 3PTGA 3QTUA 4EJNA 5F94A 3FL4A 4MK0A 5L2WA 2OJGA 4NIFA 2IO6A 3GT8A 2V62A 5AP2A 4FKLA 4O84A 4M15A 4EZ3A 4BIDA 1OPJA 1CTPE 3ZLYA 1OMWA 3NR9A 4JIAA 3ZZEA 5IA0A 2C6MA 3TI1A 2PZIA 2C5VA 4FL1A 4V0GB 4BIBA 5GZAA 1YOJA 4QMUA 5IQBA 2VO7A 1DM2A 2CKPA 4O27B 4DTAA 3R7GA 4NCTA 4FG8A 4QYHA 4EH3A 3O96A 3Q32A 2BKKA 4NM0A 4C4GA 2YLFA 4FT9A 4DH7A 2VNYA 3CLYA 2CKQA 2P55A 2QQ7A 4I0TA 5AR5A 2JKQA 3QD0A 3E3BX 3L9PA 4K8AA 3FE3A 4XMOA 4YLKA 2YLEA 4GIIA 3LCSA 4BKZA 4E93A 1OI9A 4GT5A 3P23A 2ITWA 4FNWA 2W1IA 4XBRA 5K0KA 3SRVA 4FKIA 5CS6A 3SG9A 4YBKA 5L6WL 5IKWA 4IEBA 4FI1A 3GFWA 4DBXA 3PFQA 4C4HA 1R3CA 3PVUA 4L3PA 3FL5A 3UJGA 4FODA 1H25A 5JK3A 5CF6A 2BAJA 2XH5A 3Q6UA 4FL3A 3AD4A 4K0YA 4QMPA 2C0IA 4FVPA 3RPSA 3ZMMA 4WIHA 5EW3A 5EM8A 4BYIA 1QPCA 1YWRA 4FYNA 4WNPA 3U6HA 4U43A 4IDVA 2G9XA 4FBXA 4F9YA 2GNFA 2GQGA 2IZUA 3FQHA 4YPDA 5HCXA 5HE3A 3LM5A 3RJCA 5K4JA 3SV0A 3FI4A 4YSMA 5LVNA 4UX9A 3OT8A 3F7ZA 4YJNA 5JT2A 3R1QA 3EQRA 3MGYA 3LMHA 2WQMA 3FUPA 2XIZA 4L9IA 5FP5A 5HD7A 2XYUA 5EYDA 4X3FB 3MBLA 4EJ7A 4O7NA 4ITHA 3R9NA 1WCCA 2X7FA 2GNHA 1KE5A 2GNLA 2QNJA 4KKGA 1RJBA 5F20A 4DE4A 2VTSA 5A54A 4EOKA 3WZDA 4QNAA 4AA4A 1ND4A 2FVDA 3Q4ZA 3Q9XA 2A27A 3ALNA 4F7SA 5M53A 4NM5A 3VUDA 4F9AA 3D5XA 4Q9ZA 4IZ5A 3FBVA 2J5FA 4LG4A 3ZZWA 4UALA 5TOZA 3FPMA 3KXNA 5CVFA 4XV3A 5CAOA 2B9FA 2QOQA 4L44A 3W8QA 4RFYA 3R2YA 4K18A 4PX6A 3E3PA 2NNWB 3DZOA 3ORTA 4QYYA 4DTBA 1Y91A 2ETMA 3R71A 4PL4A 4APCA 4C33A 4FG9A 5DOSA 5E8XA 5KMIA 1TQMA 3CE3A 3F61A 1Q41A 4DT9A 4X3JA 3EZRA 3GCSA 3ORIA 4D5KA 4X6RA 3DJ7A 4RVMA 3RGFA 3LCTA 3KK9A 3VN9A 5CU0A 2VWZA 4AT4A 4AAAA 3JVSA 1DAWA 5H2UA 4Y83A 4ZLZA 4OT5A 4BI0A 3OD6X 4H36A 3B8RA 4I0SA 2OK1A 3I7BA 2BDJA 4GCJA 4FT7A 4XV9A 4FZ7A 3NSZA 4IJPA 2UW8A 4PTCA 2PUIA 3EQGA 4RJ5A 3NNUA 3NZ0A 4O6EA 3ENHA 5HU3A 2WMWA 4U45A 2QHMA 3FMLA 4W4XA 3TJCA 5EDPA 2CN8A 4BDDA 4G3CA 3ID6C 3E87A 4DEGA 4YHFA 2BZIB 2XYNA 3PA3A 3NLBA 4W9XA 1PKDA 3C0GA 4CCBA 2I7QA 4M66A 2W99B 4YJOA 3CQWA 3FLZA 2B0QA 1R78A 4FKSA 1HCKA 2O3PA 4IANA 3AOXA 3D4QA 4CT1A 5EQYA 5F4NA 1W0XC 1WAKA 4FTLA 3R00A 5FXQA 4NM7A 4MXOA 4FT5A 2WB8A 4L01A 4O7VA 4DAWA 3OBJA 4F9WA 4IX5A 3SG8A 3O8UA 3QCQA 3ROYA 4YC3A 4AW1A 2F2CB 3RNYA 4QMQA 2OG8A 3EN4A 3OP5A 2WEVA 4IAKA 2RG5A 4FF8A 2WMSA 3FXZA 4JXFA 2BVAA 4NZWB 1TKIA 4DFNA 5AP7A 4EOQA 5IH6A 1B6CB 1OPLA 5LMKC 4TNDA 5HTIA 4IWPA 3Q5ZA 3U51A 4GKIA 2XB7A 4IADA 4KABA 2YIQA 3EL8A 3ZM4A 4ASZA 3F3VA 2QURA 2YM3A 4O7YA 5LVMA 1GZOA 5E92A 4BZOA 3WZUA 2G2HA 4IH8A 5BVNA 2JFLA 4CXAA 3ZOSA 3AT4A 4ASDA 4EL9A 3FMEA 3DBFA 2F2UA 2E9OA 4XCUA 3RMFA 4LV5A 3ZO2A 4EUUA 3S00A 3N4UA 4ZJIA 2IN6A 2C5YA 3HMPA 3ZLSA 2NP8A 3BHVA 4I24A 4WUNA 3UG1A 4EOLA 4N0SA 3ZBFA 4C8BA 1YXTA 3POOA 4PTGA 3ZHPC 5B7VA 2PVRA 2QOOA 2VTLA 4ALVA 4BN1A 3BGQA 2C3LA 5C4LA 5CAPA 3BRBA 3FLSA 2V0DA 4O38A 5L2IA 1Q3DA 3A62A 2BRMA 1FVVA 3ZLXA 4UEUA 4FTJA 4U41A 3AD5A 5IDPA 3ALOA 4EK6A 4QP6A 1J7IA 1U4DA 3G6GA 1IR3A 2P33A 3MA6A 3QRTA 4XV1A 3F3WA 4F0IA 2JDVA 3OVVA 3QGWA 1YWVA 4B8LA 5L8LA 2FGIA 2JEDA 3A7HA 4M7IA 5I9YA 5KMLA 3MVHA 5DHJA 3H4JA 2H34A 2UUEA 2QI8A 3F5XA 4AE6A 2YAKA 4FZDB 4B4LA 4CKJA 4Y95A 4FV7A 4G31A 2VD5A 4A4XA 3AGMA 1YWNA 3QC9A 3QUEA 4RQKA 5CSHA 3ZXZA 2WTIA 2VGPA 1ZYLA 2PVHA 1G8SA 3ANQA 1H01A 4PMSA 4ZOGA 4TYIA 4ZAUA 2WD1A 4EH5A 1SM2A 3OCSA 4FSZA 3ZLWA 4FT3A 4AW0A 3DQWA 4ZTMA 3QUPA 4ZK5A 4IWOA 1AGWA 2WIHA 4DH5A 4X2GA 3R2BA 4LMUA 4IIRA 5FG8A 1KSWA 4F4PA 1QMZA 2I6LA 5EYCA 5K9IA 2XCKA 3F5UA 3QKLA 4BZDA 4EEVA 3BU6A 5LWNA 3NVKI 4NJ3A 4S2ZA 3SX9A 4E8AA 4Z16A 4ZSEA 4QP9A 2W1ZA 5AUYA 2Y4IC 3PP0A 2QLQA 2G1TA 3U87A 2HK5A 3M11A 2VWYA 3BU5A 4AGCA 3LFDA 3ZEPA 5FQDC 2PUPA 4PDYA 1GOLA 3M1SA 4I4FA 2OKRA 5C4KA 1DI8A 4G3GA 2WTKC 4L3JA 3W2SA 2WIPA 5C27A 4AGUA 4G2FA 4UZHA 3WF8A 3AMAA 3TWJA 2GU8A 2OGVA 4RX9A 5K0XA 4L00A 4EOPA 1UNLA 3JS2A 4D0XA 4FSRA 3OXIA 3BYMA 4NEUA 5AP1A 5M4IA 4AFJA 1XBCA 3P7CA 3ZONA 3LXPA 4L7SA 4LM5A 2X8EA 4U79A 3VO3A 4DFZE 4FNZA 4PTEA 2PPQA 1BX6A 4AX8A 2Z8CA 3HMMA 3FC2A 4C0TA 1VJYA 4CFUA 4XNEA 3PRFA 4Z9LA 4ACHA 1DAYA 3UOKA 5HI2A 4ZSLA 3DKFA 3FZSA 4QMZA 3HNGA 3VF9A 2LGCA 3NNWA 5HIDA 3DK7A 3E88A 2W5HA 2J0LA 3DOGA 3MA3A 4UWYA 4C38A 3MESA 4JBPA 5HKMA 4USDA 4OBOA 3UO4A 2I0VA 2WO6A 5M57A 4U3ZA 3W2QA 1Q3WA 3EQDA 3BKBA 4UMQA 4EK8A 3KQ7A 4BI1A 4FKGA 3GU5A 2X6EA 3CQUA 3KULB 5ANIA 4PQNA 3FMNA 5HNGA 4AN9A 5B2LA 2IVSA 4FTKA 4IAAA 4AGDA 2X0GA 4YNOA 4CCUA 1IAHA 3TIYA 2GNGA 4X7QA 2X8DA 3LM0A 4II5A 5LVPA 3E64A 4M97A 5FWKK 1QPEA 4AG8A 4H05A 3PXKA 2IW8A 2FSOX 1PYXA 4GIHA 3V5JA 3DJ6A 4V05A 2UZNA 5CF5A 5I3RA 1NVQA 3VRZA 3M2WA 3CP9A 3A7IA 4FEUA 2YIYA 3UZPA 3DNEA 1K3AA 3NCZA 3ZXTA 3FV8A 2ZAZA 5D7AA 4RFZA 4K77A 5HNBA 5HVYA 2YM6A 5HO7A 5BMMA 3I79A 4FIIA 1JWHA 4FV3A 3REPA 4FUYA 4I6HA 3QGYA 4GEOA 3ZO1A 2CLQA 5KHXA 5L8KA 3ZCLA 5A4LA 1FPUA 3COHA 3O23A 1UWJA 1BLXA 2IVVA 2YA9A 2YDIA 3LMGA 3VS4A 2W1GA 1Q8ZA 4IX6A 3LKMA 4V01A 3MB7A 2W05A 3QC4A 5H3QA 3R7YA 4EH9A 5KBQA 3JPVA 3TG1A 2KULA 4FZAB 3ATTA 4MBLA 4O0XA 4AOJA 2QOHA 2PY3A 3G2FA 5E8SA 5I9UA 4WOVA 2V22A 2CPKE 3NW5A 3F3TA 1QL6A 4XG2A 5GJFA 5LCKA 4YC6A 3QCYA 3QQKA 3O71A 3QRUA 4WSQA 5E8ZA 4WUAA 4HNIA 4RIYB 2EB3A 4R78A 3RPYA 2R3GA 4BYJA 2PVLA 3EQPA 1OKVA 2J51A 3FKOA 3LFEA 4QYFA 4IWQA 3AD6A 5T6KA 1ZMWA 4GK2A 4S32A 4IZAA 3KVXA 3L9NA 4HVGA 2ZJWA 5CU2A 4O91A 3KXXA 3ODZX 4XEYA 3V5QA 4O81A 2ZOQA 4KINA 2BMCA 3UPZA 2B7AA 4MD7E 5AP5A 3FZRA 4H39A 4D2WA 4PDSA 3ELJA 1F0QA 2HCKA 1YI4A 2PVJA 3LFNA 5CNNA 4EYMA 3MI9A 2WTKB 2XRUA 3SXSA 3AC2A 1GIJA 2UW6A 2I0HA 3O2MA 3TIZA 1FMOE 1YI3A 4YZDA 3ULIA 1IA8A 3FWQA 4BVUA 4F6UA 3SC1A 3IDBA 3R01A 4M13A 4I6QA 2XKFA 3CGOA 5LQFA 4YJRA 3TXOA 2QG5A 3DB8A 4BCFA 4JDIA 4H58A 3GOPA 1NVSA 3R04A 3CPBA 4L3LA 5CQUA 3E93A 4PMTA 2C69A 2OH4A 1LPUA 5HNIX 2ITOA 2BZJA 2H9VA 1QPJA 3LCKA 2H6DA 1H0WA 2Z60A 5LJJA 4AN2A 3PSDA 3FLNC 3EFKA 4DGOA 4KD1A 4ZSJA 4AZVA 4DH3A 2QOIA 2YM7A 3QHWA 3QCSA 4YPSA 2R3HA 3LQ5A 4DFYA 1REJA 4I93A 3HMOA 5IQAA 3JY0A 5EM6A 4FVRA 5C01A 3JR1A 3LW0A 5HCYA 2YACA 3KRRA 5AX3A 2YZAA 3VC4A 3F7WA 5HE2A 3ZC6A 5M4UA 3ZFMA 3QBNA 5AV1A 3L8XA 4FKQA 5BVWA 3ZDUA 2XKEA 3LFFA 3E7OA 2OJFE 3E92A 4WBBB 2QODA 3R8VA 4LV8A 1DS5A 3N51A 3R7VA 4IVAA 2YJSA 3QTQA 3Q4UA 5ACKA 2J6MA 3W1FA 1GZKA 3BIZA 4PWNA 1YXUA 2VTTA 1JPAA 3AXWA 4FSMA 3PPKA 2HZNA 4G3FA 3V5PA 2YWVA 4R6VA 4QOXA
chains in the Genus database with same CATH superfamily
4A06A 4ENXA 5LWMA 1PXNA 4FEWA 5BYYA 5TKDA 5LARA 3QQFA 5KMKA 2J0JA 4QDEA 3F82A 5AP6A 4A9SA 2XNEA 4IB5A 2DS1A 3R22A 3ROCA 4AZSA 3HL7A 3ITZA 1TZDA 4XG4A 3KRLA 5J7HA 1PHKA 1W2DA 4O22A 2ZV9A 3B8QA 4I0RA 4MKCA 3TNIA 2PULA 2QOBA 3QA8A 4WD5A 1J3HA 4PMPA 3AC3A 2BUJA 2JDRA 5KBRA 2IVUA 1LP4A 3EFLA 3FC1X 3R9OA 2ITUA 4G6LA 2ZMCA 2X7OA 3OOGA 4EKKA 3C4XA 3KMWA 3FI2A 4N57A 1RDQE 2PE0A 3QWJA 2VRXA 4WG4A 5AP0A 5AUTA 3V51A 2IJMA 5J9LA 5EI2A 3Q2JA 2RFNA 4DFBA 1XQZA 2G01A 3TN8A 3GFEA 5ETCA 4WT6A 3C0IA 1UKHA 2WTVA 3I1AA 3GQLA 4MVFA 3DK6A 3NNXA 3PIYA 4TYHA 1CDKA 1T46A 4JBVA 4R7IA 5ANOA 4MQ2A 3NUUA 5D9HA 4F9BA 4CD0A 5AX9A 3W0RA 3GU4A 1YDSE 3S3IA 4BGGA 4MNEB 2PMOX 2VTOA 3BI6A 3GQIA 2HAKA 4ZTSA 3UTOA 4KKEA 2NO3A 5IQEA 2BALA 3C7QA 3FMDA 4TWNA 4AGWA 3ACJA 4TRLA 3RZFA 4KBCA 1JNKA 1FQ1B 1O9UA 3Q04A 3QXOA 4RWLA 3KCFA 3KRXA 3PJ8A 3R30A 4QYEA 4R3RA 1TQIA 4U3YA 3UP2A 4HYUA 1PF8A 3KY2A 2GPHA 4WG3A 1VLRA 4U80A 4YR8A 4RVLA 2BPMA 4OR5A 3UVRA 5A3XA 3KRWA 1Y57A 3WZEA 5IPJA 1ATPE 1WBWA 3D7TA 4GJ2A 3MVLA 4N4SA 2HZIA 3BBTB 4JIKA 1Z9XA 2E9NA 1OGYA 2Z7RA 3B2WA 3FZOA 1F3MC 2WQNA 2GCDA 3UG2A 3VNTA 4QQCA 4HPTE 1YRPA 4HCUA 1ZWSA 4LRJA 3VHEA 3T8OA 3ZRLA 4CRSA 5DRBA 4IB1A 5DGZA 1YKRA 1IAJA 2QCSA 3NDMA 5LVLA 4TWCA 3MPAA 3TUDA 2XK9A 3PLAE 4FIEA 4QPMA 5BYZA 3WZKA 4IAZA 4UMTA 5FTQA 5L2SA 4BCNA 5A6NA 3JUHA 4F70A 3HGKA 5HVJA 1NY3A 4KIKB 5FM3A 5E4HA 3KXHA 4M12A 4JDKA 4U42A 5HO6A 4C57A 3NUNA 4ZTNA 1DI9A 4MF1A 5HBJA 4YZBA 2R0UA 3QD4A 3RAIA 5AMNA 2C6OA 4JT3A 3DZQA 1YDTE 4KB8A 2QU6A 4P5QA 2NRUA 2X4FA 1JAMA 3FYJX 4FV5A 3ANRA 5TO8A 1EH4A 3PY3A 2QOCA 1U46A 3V01A 3U6JA 3SW7A 3ZSIA 3MY1A 3ORLA 2XS0A 4IC7A 5AAGA 3HRCA 2HW7A 1BYGA 3RPVA 4GYGA 5HIBA 2YWPA 4MCVA 4HCVA 4ONAA 3P5KA 4O6LA 4ZMFA 3GU6A 3OWJA 4QMVA 4YU2A 3G5DA 4HGEA 3UBDA 4MD8E 4AOTA 2C3JA 4IBMA 4ANSA 4BDHA 3U54A 1NT2A 3GU7A 4JQ7A 4BBFA 5J5TA 3MW1A 2XALA 3GB2A 4O0RA 3FPQA 4AN3A 3NFFB 2YFXA 3DAKA 5EM7A 2PK9A 3OMVA 5D41A 4EHZA 4FTNA 4G5JA 4RX7A 1JKKA 2V5QA 4EH4A 2R5TA 2XK4A 4RJ7A 3MIAA 3V5LA 2YDJA 2Y0AA 3NNVA 4EBVA 4Z7HA 2JAVA 3GCUA 2QVSE 5BQ0A 1G8JA 4FL2A 5J1VA 2YABA 4M67A 2ITYA 2OO8X 5HIEA 3H9RA 4L43A 3R8MA 5CXZA 5HLNA 2OBJA 5DR2A 3G9LX 2PVFA 4J97A 5M07A 2PZPA 3C5UA 1IA9A 3NUSA 1FMKA 3CXWA 4IM2A 1URWA 2Z7QA 3P7AA 4RGJA 4BRXA 2CGVA 5FXRA 2EVAA 1H26A 2RG6A 2PHKA 1Q8WA 2BRHA 4HGSA 2R7BA 3QTSA 3W10A 3W0OA 1KOAA 5BNJA 4BICA 2W1FA 3W0PA 2EWAA 2R3OA 3CJFA 3Q4CA 4E4NA 4PDPA 1H1RA 4E7WA 4LUDA 1WMKA 1ZAOA 3IK3A 2VO0A 3IW8A 4TWOA 4GKHA 3VONA 1HOWA 3ENMA 3D7ZA 4HZSA 2JKMA 4IB3A 3OBGA 5J95A 4O1PA 2X9EA 4ORKA 3W8LA 3VS5A 3A7JA 3L9LA 3BHYA 5CEQA 4PDOA 1JLUE 3HX4A 5IMXA 2J50A 3UQFA 1W2CA 5AV0A 4FIHA 4D2TA 5AM7A 3UODA 4KAOA 3TTIA 3VS3A 1F5QA 3H10A 3UYSA 2EXCX 4I5HA 4RIOA 4DHZA 2BROA 4YZMA 3KF7A 2EB2A 3GC8A 3ORKA 4GG5A 2OXXA 4CZUA 2ZM1A 3GC0A 4NCTC 1URCA 2WU6A 5D12A 3EL7A 5IEXA 1WVWA 2E9UA 2R7IA 3PVBA 4FIGA 4N6ZA 3P08A 4MXYA 4D2SA 5BVFA 2W06A 4C3FA 3LCDA 5L3AA 4YHTA 2OIQA 2ZVAA 2AC3A 4AP7A 4IAYA 4GH2A 4H1MA 4HZRA 1XBBA 2ZDTA 1P4OA 3WF7A 4QO9A 2B9HA 2UZVA 2V7AA 5AIKA 5CZIA 1R39A 1WBTA 1SVEA 4I92A 2JIUA 3C9WA 4R8QA 1Q24A 3U9NA 4FZ6A 4YZNA 5EI8A 4D4RA 2G2IA 1PY5A 5LCJA 1GIHA 2XARA 3LFAA 3GBZA 3GGFA 2E9PA 4BGHA 2QR8A 2JDOA 4E5BA 2ZM4A 4CYJA 4I20A 4RT7A 3Q53A 2C68A 2YHVA 3HRFA 3DY7A 3ET7A 4G16A 3PFYA 2ZB1A 3UYTA 4QP4A 4I41A 4JRNA 5FBNC 1CMKE 4KRDA 4MTAA 3COIA 4MF0A 3WE8A 4IAIA 1OKYA 4RIXA 4OBQA 3EMGA 4HYIA 2O2UA 2O63A 1I44A 2JIIA 4FKOA 1YQJA 3BWJA 1M2RA 1PXLA 5GZ8A 1NXKA 1S9JA 4AXEA 1BL6A 4IFCA 4BTKA 4BDCA 2BKZA 4D4SA 5CVHA 5E8YA 4RA5A 3W32A 3RAHA 5HORA 1CKJA 4XP3A 4JOAA 3P7BA 4GK4A 2VWUA 3G51A 3HKOA 3VQUA 5CI7A 4YJSA 2GDOA 2C0OA 5EW8A 5L6PA 3DV3A 4PPCA 5EFQA 2XBAA 4IZYA 2OJ9A 1ZOEA 1HCLA 5IUGA 5LVOA 4JAIA 4J8MA 3UOJA 4IAFA 3QRIA 4GW8A 4UY9A 3BL7A 3U55A 5DR9A 5HE0A 2C47A 3NYVA 2LAVA 4DC2A 3MH3A 4YLJA 5DFPA 1BI7A 2X8IA 5CT7A 4L42A 4JQEA 5CZHA 4XP0A 2GHGA 5FEEA 4PP7A 3SDJA 4BCPA 1CM8A 5HZNA 3DB6A 2PYWA 1PMUA 5G6VA 3ORMA 4EI4A 3BCEA 4W9WA 2R64A 3GNIB 3IKAA 3UOHA 4YO4A 3RTPA 5JKGA 4QMXA 4Q5HA 5ANKA 4ANQA 2FSTX 4FX3A 3UIXA 3OHTA 1OIRA 2C0TA 2X81A 3OWLA 4FTMA 4TYJA 5GJGA 2YDKA 4DCAA 4XG9A 3I6WA 4YJTA 4O86A 4CFNA 4R1YA 4ZSGA 5ANJA 3MFUA 2XNMA 4IWDA 4B6LA 4OTDA 2DQ7X 1XJDA 3ORXA 2XZSA 5JFVA 1MQ4A 2W1HA 5CU6A 2J0KA 3OEZA 1OPKA 3CKWA 3OY3A 3R28A 4UBAA 1MRUA 3HA6A 3N4VA 2W1DA 5EM5A 4GU6A 3KMUA 4I5MA 4LL0A 3NAYA 4K33A 4NM3A 4YP8A 3W2OA 1OIYA 2GS6A 4MQ1A 5B0XA 2IZSA 4L6QA 4XOZA 4CTCA 3BL9A 3MVMA 2WPAA 3HV3A 1FVTA 3CTJA 4RIWA 5AV2A 1ZY4A 4NIFB 1H4LA 2W17A 3E63A 3GENA 3PWYA 2BDWA 3R0TA 4FTQA 2UZBA 1U5QA 2PMIA 1ERKA 1Y8YA 4K9YA 4Y8DA 5E8VA 2HXLA 1YDRE 4QNYA 2P4IA 4J1RA 2I1MA 2VO3A 4AWIA 1SYKA 2ESMA 4CLJA 2OXDA 4LDTA 5CASA 4XBUA 3OROA 3VBXA 5AUWA 4IX3A 4FSUA 3S0OA 1R1WA 1WVYA 3RWQA 2FSLX 3PA5A 3P86A 5D1JA 4D1ZA 2W1EA 4GRBA 4CKIA 2CCIA 4QMLA 3FMJA 1STCE 3R73A 1K2PA 2XIRA 3FMHA 4O0UA 4J96A 4AU8A 4CV9A 4FIFA 4F9CA 1PJKA 4BDIA 2HY0A 4BGQA 4D58A 3F88A 4A7CA 2BCJA 4WNKA 5DH3A 4PPAA 2W96B 3BLAA 3WI6A 3OG7A 3SRVB 5AR7A 2X6DA 5CENA 3DCVA 4FTAA 2HXQA 4RJ4A 4YZ9A 5H8EA 5BVKA 2OSCA 4KWPA 5TT7A 4E6DA 4MXCA 1XO2B 5HQ0A 1FOTA 5H9BA 1PMNA 5L8JA 2DUVA 5EK7A 4UMUA 4J52A 4MH7A 4LGHA 5L6OA 4DYMA 2R3NA 4IVCA 3C4WA 4EYJA 3DDPA 4FEQA 3QTZA 4USEA 4JDJA 3SHEA 3QCXA 2HWPA 5JGBA 2CMWA 4FSNA 3FY0A 2RFEA 4QMWA 4X2FA 2I0EA 4HYSA 5ETAA 3PY1A 3HUBA 2PVMA 3HV7A 5EH0A 4MEDA 1A06A 2JAMA 1RE8A 1OKZA 4DN5A 4G5PA 2PWLA 4J71A 2HOGA 4M0YA 3Q3BA 3BV3A 4N70A 5JFWA 3LE6A 3NPCA 4FK6A 3DTWA 4RC3A 3CY2A 4BWXA 4FKTA 4LYNA 5DNRA 3IW6A 4ACCA 3DK3A 2XIYA 3BE9A 4GFGA 3A4PA 2X2MA 3A99A 4L67A 5EG3A 4QDVA 4EH6A 4NFMA 3OZ6A 1XH6A 2XK6A 3R7EA 1Q61A 4S34A 5EQEA 4KIPA 1OIQA 5HBEA 1J1BA 3VUTA 2ONLA 3ZUVA 2JLDA 5K5NA 1AD5A 1Y6BA 1XH7A 3VBQA 3DKCA 4NW6A 5HGIA 2CJMA 5IUHA 4MNFA 3EQBA 3PA4A 5AAFA 3OF0A 3E8DA 4AFEA 4ANLA 5CAQA 2XAMA 4FIJA 4R5SA 3CC6A 3R02A 5CEKA 2BIKB 2UZLA 4NT4A 5DE2A 3UIMA 2Y4PA 4KIOA 4UYAA 3I81A 4E4MA 2W4KA 3SA0A 4K1BA 3C4ZA 4CG9A 1ZYSA 3HP2A 5E90A 4CRLA 4DGNA 1U5RA 3WYYA 3QTXA 5KMMA 4FGRA 2J7TA 3UNZA 4UXQA 5CALA 2EXMA 4XJ0A 4C2VA 4ASXA 1OUKA 3U4WA 1V0OA 2OIDA 2XAOA 5E9EA 2C30A 2PVKA 5CI6A 4E6AA 4QTEA 4ALWA 4BR3A 2ITXA 5M4CA 4FV9A 4BHNA 3RK5A 4EBWA 4HNFA 3DAJA 3GCVA 5KZIA 3UE4A 4EK3A 3A7GA 4GS6A 4IACA 1P5EA 3RHXA 4BF2A 4F6SA 2GNJA 5FEQA 4CVAA 4JG8A 3AKJA 5CXHA 2HELA 2A1AB 2Q0NA 4YTFA 1JVPP 4ZP5A 2GS2A 4L53A 4ZEGA 5GIOE 3EQFA 4KKHA 3VHKA 4F09A 1E9HA 1JKSA 2ITNA 4J7BA 3RK7A 1W7HA 2R3KA 4FTIA 5AA8A 3VUKA 1XMLA 2CNVA 5A4QA 2EUFB 5DG5A 2BFYA 3BYOA 4E5AX 3AMBA 2YCQA 3EFJA 4WBOA 3C0HA 4C37A 2OWBA 2XIKA 3FSFA 3MIYA 3O50A 3A61A 4FZFB 4MBIA 4YSJA 4ZTLA 4FTUA 2BAQA 3ULZA 3TMOA 3RPRA 3F5PA 3JXWA 3U4UA 5AR2A 3BQRA 4QRCA 5CYIA 2VX3A 4D9TA 2W7XA 5I0BA 5J1WA 2WNTA 3QUDA 5LXMA 3BYUA 2VTIA 4F99A 2YAAA 4MHAA 5E8WA 2O8YA 3RAWA 3R83A 3BEAA 2QOFA 2VZ6A 2FO0A 3I60A 3MH0A 2YM5A 3R6XA 3KXGA 4L68A 4Y73A 4Y72A 4QP1A 5IEVA 2UZEA 3S4QA 1IG1A 2UVZA 4F7LA 3UP7A 3H3CA 4YZCA 3OWPA 4S31A 3ZO3A 3C4CA 3OTVA 4DH8A 4DFLA 2ETKA 3QXPA 4BY9E 4NJDA 4TTHB 2WAJA 2WU7A 3UNJA 4AQKA 4FV4A 3NWWA 5DYJA 3AKKA 2DWBA 3LLAA 3W16A 3PLSA 4RG0A 4HW7A 4AZFA 2VWVA 2FYSA 4TPTA 1ZY5A 4EORA 5J7BA 1ZMUA 3LXLA 5C8MA 4HJOA 2JFMA 4CMOA 3OUKA 2F7ZE 4I21A 4XLVA 3E5AA 3AG9A 3NW6A 4WRGA 4NYEA 5JH6A 4BDBA 4I6LA 4FNXA 5CSXA 5GNKA 3MFTA 3M42A 3OXZA 4I5CA 4WRSA 5AV4A 1TVOA 4ZLOA 4XP2A 5HTBA 2PUNA 2XJ2A 2ITTA 5KX8A 4DA5A 3HZTA 1PXPA 3HMNA 3NIEA 3RP9A 5JRSA 4CZTA 4MD9E 2OFVA 3F2AA 5A46A 1ZMVA 5HLPA 5KNJA 1W8CA 1J1CA 4F1TA 4X6QC 5M09A 3BGPA 1W98A 3ZS5A 4DG2E 5IQDA 4C59A 2C5OA 2B54A 2OF2A 4M69A 3KXZA 3RCDA 3IW4A 1RQQA 2X2LA 4I6BA 2VV9A 3WF5A 4FUXA 4QPAA 2C4GA 4GU9A 4XX9A 2XF0A 3W2RA 3NYOA 2A2AA 3VBTA 4C34A 4YUQA 3GVUA 3VS7A 3MJ1A 1X8BA 2IF8A 3E8CA 4IZ7A 3E8NA 5G1XA 2FH9A 4ZJJA 4I1ZA 1PXKA 3LFBA 4UWBA 4IM0A 1WVXA 5IQCA 5IQIA 3BU3A 3MYGA 3QL8A 2XM8A 5M06A 2PUUA 4O4CA 4RC2A 5HHWA 3O8PA 4HGLA 5L4QA 3IONA 4O7LA 4LOQA 4XYFA 3PY0A 2Y4IB 3EQHA 3NUYA 1UWHA 3UC4A 4EZ7A 5FD2A 5BUIA 2WZJA 4BCMA 4AA0A 1SNUA 2HWOA 3IW7A 4DFUA 2Y8OA 3EFWA 4RQVA 2GTMA 4B0GA 5KCVA 3RZBA 4P7EA 1UU8A 3CPCA 3VVHA 2BRNA 5HEZA 2AC5A 4ZY5A 2PVNA 2JGZA 3FI3A 3LXNA 4FV0A 5E8UA 4EOJA 5LMBA 4EK5A 3C1XA 4DBNA 1H1SA 3LVPA 3OXTA 2F9GA 2HW6A 4ANMA 4DHIB 4JR3A 2I40A 5F9EA 1UA2A 4JDHA 3LIJA 5EHLA 1G8KA 4F1OA 4HYHA 3R7UA 4BDFA 2WXVA 2YIXA 4RA4A 1W83A 2FB8A 4G1WA 3ZRKA 3KIOC 4F6WA 1M14A 2UVXA 4X2NA 3FEGA 3BYVA 3G6HA 4PY1A 4RWKA 2QG7A 1PXIA 2WGJA 3BELA 4AQCA 1M2PA 3SLSA 4EHVA 4F78A 5ETFA 1VEBA 2IWIA 3KXMA 4EOMA 4YLLA 4E3CA 1MRVA 3R21A 3ZRMA 5C9CA 5AP4A 4FK3A 4MXAA 4O7TA 2J9MA 1PMEA 2YERA 1VR2A 2YJRA 4LRMA 5DLSA 3IW5A 2C5NA 3CJGA 4UXLA 1WBNA 2UZWE 4FTRA 3FSKA 3F9NA 4OTGA 4P2KA 5JFSA 4Y5HA 3P1AA 4BCQA 2HYYA 4G6OA 4BWPA 5A4TA 2VO6A 1ZYDA 1KV1A 3D94A 4K11A 5H8BA 5JQ5A 4UV0A 5HCZA 4YURA 2RIOA 2X1NA 2IG7A 2HY81 2JDSA 3FY2A 4C3PA 3HP5A 4CNHA 3A2CA 1KV2A 3KK8A 3KREA 5BPYA 1PKGA 2PMNX 2A98A 5CSVA 4A07A 2RL5A 4LI5A 3ML1A 4EWHA 4FV2A 2XNPA 3QQHA 1WBOA 4JLCA 4RJ3A 3KB7A 3NX8A 5J5SA 1PW2A 4D4YA 2WQEA 4EH2A 1NW1A 1VYWA 4IVDA 5HG8A 3ZSHA 5EW9A 3GC7A 3PUPA 5CSPA 4JBOA 5CU4A 4TL0A 3PZHA 3ODYX 4FSTA 4ZZOA 3LMIA 3BLHA 4GT4A 4NTSA 4C61A 4KS8A 1H1PA 1GZ8A 4F7JA 4LOPA 1ZLTA 4APPA 2QHNA 4QTDA 5FP6A 4EK4A 4ZS4A 3R8ZA 3EN7A 4FJVA 4A9TA 4AF3A 3RKBA 1W84A 3TUCA 4F0GA 3DXNA 4JMQA 3QTIA 4HCTA 5ETIA 4C4EA 1PXJA 4IXPA 5AP3A 5M08A 3NVMB 4IC8A 5DT4A 2ACXA 1JBPE 5I5ZA 4BCGA 3TCPA 3PJ1A 3TZ8A 4M69B 5FTGA 3LQ3A 5M4FA 2VWWA 4NKAA 2AQXA 2Z2WA 4TY1A 4DITA 3OWKA 3MPMA 1U54A 3TTJA 4ITJA 3C4EA 4QD6A 2UW7A 2Q0BA 2VTRA 4JG6A 5JFXA 1BI8A 4IMYA 4M8TA 2F49A 3JYAA 5IG1A 4ID7A 3TNPC 3QFVA 1M17A 3QX4A 4G34A 5TR6A 3QF9A 4EONA 2WMXA 5AUXA 3T3UA 3DT1A 4F65A 3L8VA 2GHLA 2XVDA 1MRYA 5J9YA 3OS3A 2PZYA 5T3QA 2XNNA 4YO6A 2IZTA 2OU7A 2R3IA 1IRKA 4CLIA 4K6ZA 4CG8A 3PPJA 4KRCA 2ZB0A 3C4FA 2C1AA 2OJIA 1H24A 1REKA 1YXVA 4JQ8A 1ZOGA 2IVTA 4GJ3A 4XS2A 1OL5A 4DG0E 3K3IA 4V0GA 4JBQA 3VUHA 3BZ3A 1RW8A 1Q8TA 4OUCA 3RI1A 3L8PA 5BYLA 3VIDA 3RCJA 3MN3A 3IOKA 5EI6A 4CMUA 1G5SA 2UZDA 5AR3A 3LZBA 4GSBA 1ZARA 2O5KA 4FOCA 4AACA 2YCFA 4EC8A 3W2CA 3K5VA 4BJJA 3D9VA 5GHVA 2H96A 2WOUA 3Q5IA 4XLIA 4P4CA 2QC6A 1T45A 3DFCB 1OL7A 3O7LD 2E2BA 3BHHA 3ERKA 5DI1A 3FKNA 2PZ5A 2CN5A 4RWJA 4HVIA 1PYEA 2VX1A 5AIRA 5B2KA 3W0NA 3C5IA 4O4FA 2EU9A 3F2NA 3FMKA 1FGIA 4FTTA 2WELA 1L3RE 4CTBA 1B38A 3UZRA 3GEQA 3PJCA 3PXFA 4NH1A 4EC9A 2ZV7A 4OTHA 3GUBA 4U0IA 3QTWA 5HBHA 1O6LA 4O0TA 5IH5A 1G8AA 4OTFA 3KKVA 4BHZA 5IA4A 4KSQA 4TN6A 2PE2A 3DXQA 2BZKB 2OF4A 2XIXA 3F3UA 3LJ2A 3QZFA 4R1VA 5E8TA 3OCBA 5AUUA 4C2WA 3SVVA 3DLSA 2WTJA 3E62A 4RFMA 4Y5QA 4A4OA 3UDBA 5GIPE 3TJDA 3MH1A 2RGPA 4O2ZA 4M14A 5AEPA 3FLYA 3CS9A 4CFWA 4X3FA 3K54A 4EQCA 1KE9A 4BKJA 4EH8A 4MX9A 5AA9A 4QYGA 1M7NA 2GQSA 2OICA 4CYIA 2ZV8A 5FRIA 3PXYA 2IW9A 2XUUA 3DDQA 3H9FA 2W4OA 4FNYA 4C62A 5HTCA 3QAME 3Q2MA 3UOLA 3UMXA 2XNOA 3Q60A 3BEGA 3IDCA 1YHVA 2CDZA 3DGKA 3MY0A 4MBJA 5CSWA 4PRJA 4FKRA 3W55A 4RLKA 3GC9A 4EKLA 1K9AA 4O96A 3P9JA 1OL1A 4RVTA 4C4JA 3R9HA 5DIAA 3WF9A 2W5BA 4IFGA 3OT3A 1OECA 3LXKA 3UO6A 3G90X 2J5EA 5FBOA 2XK8A 3HRBA 3O51A 3OTUA 2OZAA 3Q96A 3JY9A 4PL3A 3AQVA 1GY3A 3PIZA 3HUCA 4OTWA 4P90A 5HE1A 3ZFXA 1M2QA 2WTDA 2UZOA 4A9YA 3PZEA 3QLGA 3C51A 4YTIA 3UDSA 4OTQA 4BC6A 2VTQA 3AMYA 3CD8A 2Z7SA 2GFSA 2R0IA 5HG7A 5E91A 2AEGA 3R1NA 3SXRA 1M52A 2OIBA 4QMNA 3TYKA 3TACA 3C50A 4TYHB 3BWFA 1G3NA 3UPXA 4WG5A 4U7ZA 4I6FA 4E5WA 4KUJA 4ZTHA 5H8GA 2B1PA 2GHMA 4QP2A 4U9AA 3FZTA 4KSPA 1U54B 5E1SA 4FKUA 3VS0A 2C3IB 1VZOA 1H27A 2C6EA 2UV2A 3G9NA 3NGAA 3P78A 2QKWB 3PIXA 2XRWA 3Q4TA 5HVKA 3NUPA 5HG5A 3TKHA 1TFFA 2WMQA 3DQXA 4ACMA 2WTWA 4OAVB 2WEIA 5FXSA 3I5NA 4S30A 3N4TA 3R8UA 4DLJA 2RFDA 4X2JA 4WNMA 3TKUA 4JJRA 3GCQA 2O64A 4S33A 5IA1A 2UVYA 5AJQA 3ZU7A 3QYZA 3BHTA 3MWUA 3QTRA 4OTIA 4AT5A 3BBWA 5CWZA 4X0MA 3O17A 3ZFYA 1U59A 1QPDA 2XJ1A 3QYWA 4ENYA 1OKWA 4L52A 4QTCA 3VS2A 3QZHA 4J53A 4NW5A 4U40A 3H0YA 4BZNA 3D7TB 3HAVA 2BFXA 2GS7A 2WTCA 3EYGA 3KC3A 3VUIA 4AZEA 4JR7A 4ERWA 4XUFA 3SAYA 3H0ZA 3AT3A 3UGCA 4CV8A 4J8NA 1Y8GA 2XMYA 2YITA 1FBNA 1QCFA 3GI3A 3WYXA 4BJJB 3KVWA 1XKKA 2WMVA 3NUAA 4EWQA 2BILB 3Q52A 4L46A 2QONA 2X7GA 5AR8A 3V5WA 3VW8A 4I4EA 3O5AA 4R7BA 1XH5A 1LUFA 4R5YA 5CNOA 5E1EA 4IDTA 3TZ9A 4EOIA 2Z02A 2Y9QA 4D1XA 4DCEA 3LAUA 2Y6OA 2CNUA 4A4LA 1Y6AA 2F7XE 3WZJA 3EH9A 3EIDA 1ZOHA 4JNWA 4MWHA 2VTMA 1H8FA 4FEXA 2CNQA 2RKUA 3F5GA 2PVYA 2X0PA 3TKIA 3IS5A 2QOLA 5JMSA 3TV6A 4C3RA 4QTAA 1E1XA 2E9VA 3DS6A 1ZXEA 2W4JA 2G15A 4RBLA 3R8PA 5CEMA 3ETAA 4WNOA 4NTTA 4UB7A 3UNKA 3BE2A 4I23A 4F63A 3DKGA 4BCHA 1H28A 4FE2A 4ZMEA 3IOPA 2FUMA 4JL9A 4L7FA 1FVRA 2B9JA 3FYKX 4H3PA 4QPSA 3THBA 1XH4A 2B9IA 3ORZA 1Q62A 3NYXA 1S9IA 3HDNA 4GVJA 4BTMA 4FV6A 2C6DA 4JI9A 4DEDA 3UO5A 2IEWA 1KE8A 3FQEA 4AS0A 1SMHA 3UIBA 1NVRA 4UMRA 1GNGA 4LRKA 3OUNB 3KU2A 4JRVA 3CQEA 1P14A 3R1SA 4CSVA 1JKLA 3AGLA 1BKXA 3BPRA 2YCSA 2A4LA 4CFXA 3FZ1A 2REIA 4NU1A 4XG3A 4DINA 1OITA 4YMJA 3WE4A 4AT3A 3QQJA 4QT1A 5IEYA 4H3BA 4WA9A 1WBVA 2BRBA 3LPBA 3D5UA 4LL5A 3DLZA 3Q9ZA 4FG7A 3DXPA 5EYKA 1ZYCA 3ORNA 3VWAA 5L2QA 3ZYAA 1YOLA 4FSQA 4BCJA 1MUOA 2R3QA 2PL0A 2OZAB 5DEWA 5TE0A 3RBWA 3W18A 3PXZA 1BUHA 2UW3A 1SVGA 1GAGA 3FLWA 4GFOA 3EN5A 5GINE 3IGOA 3O0GA 4FEVA 5CLPA 4CGAA 2VU3A 1VYZA 4TYEA 5J79A 1H00A 3K3JA 5TF9A 4JAJA 3SW4A 2CGWA 4B9DA 3EJ1A 5DA3A 3PE2A 5J8IA 2C6IA 3VW6A 4D28A 5BVOA 4XG6A 3UMWA 4AE9A 3SD0A 4D2VA 4CZYB 3QA0A 3UQGA 1Z57A 3DAEA 1YHSA 4BB4A 4D2RA 4D5HA 4FICA 5JZJA 4DF3A 5K3YA 4E6QA 3D2KA 3NCGA 2VGOA 3KN6A 3A60A 1OM1A 4TWPA 3OEFX 1UU3A 4RVKA 4AZWA 5BX0A 3CGFA 3T9TA 2R2PA 2R9SA 3TT0A 4EQUA 3QALE 5IQGA 2OH0E 4DFXE 2UZUE 3W33A 4Q9SA 4EHGA 1WFCA 3AKLA 4J98A 3D15A 4DGGA 2W0JA 3NIZA 2XKDA 2O65A 3FLQA 2QO9A 3VRYA 3BX5A 5DN3A 5EHOA 4QMMA 4ZZNA 1UNHA 3BV2A 5DRDA 3PWDA 4OBPA 2JIVA 2HIWA 4U44A 4BDKA 3TNHA 3SKCA </