1MRYA

Crystal structure of an inactive akt2 kinase domain
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
295
structure length
270
Chain Sequence
b'KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-beta serine/threonine kinase
publication title Crystal structure of an inactive akt2 kinase domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 270
sequence length 295
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1mryA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1mryA02
3DKGA 2OLCA 3UP7A 2VUWA 4O0UA 3TG1A 1J7IA 4QQTA 5CSHA 5LVPA 1BKXA 1JQHA 3KK9A 3KRRA 5M57A 1KE7A 3WF6A 5HVYA 3CGOA 2R3PA 5DWRA 4M67A 4CZUA 4HVIA 1CKIA 3A4OX 4DLJA 2Y4IB 2A1AB 2VWYA 4PTEA 4UXLA 2YN8A 3KRJA 4FTCA 3O50A 2GNJA 4GCJA 3FI8A 4H58A 3MW1A 4RIYB 2NNWB 4S2ZA 5IQDA 4L8MA 3R9RA 4NTTA 3FV8A 3LM5A 4YSMA 4LL5A 2JFMA 1XO2B 3MIYA 3U9NA 2IVUA 5L2SA 4O1OA 4I20A 5FXQA 2V55A 3I81A 3R2YA 1ZAOA 2F57A 5M51A 5ANKA 5BYYA 4KSPA 1E1VA 4L9IA 4HNIA 4RGJA 4WRGA 3R7YA 5HG9A 4WNMA 1CDKA 3W16A 5K4JA 4ENXA 3RCJA 5FTQA 5ACKA 5FTGA 4O0XA 3P5KA 3C9WA 4FF8A 3ZLSA 3FJQE 1ZYLA 3O17A 4BDIA 1YKRA 4PX6A 5M4FA 2X9EA 3G90X 3Q5ZA 3TUBA 3GOKA 3NYNA 4R1VA 3F2RA 3FLZA 1NA7A 1REKA 3QQLA 2R3OA 1V0BA 4QMUA 4UZHA 2HXQA 1Q8UA 3DBFA 4ZTNA 4EORA 4O7ZA 4G6NA 4QMVA 3T3UA 4AA0A 4ZZOA 5ANGA 3UIUA 4MHAA 5EH0A 1Y91A 3DBDA 5BUIA 5KMOA 3QYWA 3R83A 1XR1A 4UWBA 4O2ZA 4UX9A 5J95A 5DE2A 4KS8A 2QI8A 4APCA 4TYJA 4LV8A 2R0UA 3EQPA 3PJCA 4DEGA 2BKZA 2UVZA 4H1MA 3UVPA 3V8SA 4FKOA 4N57A 3BHUA 1ZYDA 5EQYA 3GEQA 3HDMA 2UV2A 3HLLA 3A7HA 3WOWA 2PULA 4ANSA 3C4FA 1HCKA 3R8PA 4YJQA 3BKBA 3G33A 4JG6A 4JL9A 3THBA 4DGMA 4D58A 4TWNA 1QPDA 3PTGA 3TKIA 2IJMA 2I0HA 4KBAA 4N6YA 4V0GA 3PA5A 3FUPA 3TXOA 4ORKA 3S2PA 4ACCA 3VJOA 4BF2A 3LCSA 4BYIA 3QCQA 3KRLA 2NRUA 5L2WA 3KN6A 3LHJA 1ZLTA 3IG7A 3IPHA 3DK6A 4QYHA 4YLLA 5CS6A 4C38A 5IMEA 2V5QA 3AD5A 3CSVA 4OTFA 2BIYA 2XNOA 3QUEA 3R7GA 4USDA 4YC3A 4QMTA 4F9AA 5HO7A 3LFFA 1F3MC 3MY5A 3QHRA 3FMKA 2PVRA 3ODYX 4KIKB 1QPJA 3PXRA 5E90A 5HLNA 5IEVA 5IH4A 2UZVA 4KUJA 4PDYA 3TKUA 4L00A 3HGKA 2WIPA 3GCUA 3I0QA 3C51A 3NNWA 4WSYA 3RAKA 5A54A 1UU8A 4DEAA 5HESA 2HENA 3OXTA 4P7EA 3RAIA 3LXLA 5CEMA 3Q9WA 3P7CA 2GNFA 2JC6A 2QOOA 2UW3A 3RBWA 4P4CA 3G15A 2WQEA 4W4YA 2UW4A 4D4SA 3EMGA 5HIDA 4BDBA 2RKUA 3BQCA 4FIJA 4FKSA 3UO5A 3GC9A 5I9WA 3OTVA 3UNZA 5AIKA 2XYNA 2HZIA 2WFYA 5HE3A 2R3KA 1HOWA 3H0ZA 3PY3A 4IXPA 4QNYA 4QP2A 3LFSA 5LMKC 2P2IA 4R3PA 5JZJA 3O8UA 4IADA 4FICA 3QRIA 3NCGA 5AR2A 3DQWA 4TN6A 4UYNA 5CQWA 2VTOA 5CENA 2QR7A 1GZ8A 1PYEA 2W1IA 4GYGA 4OTDA 4WG4A 2RFDA 5DLSA 4UN0C 4CXAA 4X6RA 3QQFA 2EXMA 5D1JA 2FO0A 5HD7A 3JY0A 4RJ4A 1LP4A 3CS9A 2VD5A 3O8PA 3F3ZA 3ORXA 4AFJA 2C6DA 5ETCA 5FP6A 4TWOA 4L42A 3IONA 4ALUA 5HBJA 3GC7A 4MQ1A 4EH6A 4FV1A 2HY81 3HMOA 4L68A 3VS3A 4CZTA 4JVGA 4ANOA 4X2FA 5ETIA 1VZOA 3MB6A 4U43A 4BVUA 3VRZA 1OL6A 4P2KA 4YNEA 5IZFA 3ZBFA 4IW0A 4DC2A 1OIRA 3OZ6A 4KKGA 4QYYA 4M0ZA 2PVNA 4GJ3A 4AA4A 3ZFXA 3AC5A 5J9YA 4K0YA 3ATSA 1XQZA 5M09A 3MPAA 4TY1A 3MGYA 3F2NA 5AM7A 1PYXA 2NRYA 2A19B 2W5HA 2OG8A 3H3CA 3Q53A 2C4GA 3F5UA 4O38A 3OCBA 3R8LA 3ZO2A 4EZ7A 3U51A 3D2KA 3GBZA 3F9NA 3OF0A 5LCKA 5BVEA 2WO6A 1GAGA 4GVAA 4JBQA 5KMKA 4OTHA 3FXXA 3DNDA 3R1SA 3O51A 4NT4A 4C3PA 2R3FA 3GVUA 1WBOA 5HG5A 3ZO1A 4FSNA 3QL8A 4PMMA 2B9FA 2B9JA 3UNKA 2J51A 3NPCA 5G1XA 4O21A 3SHEA 4EH5A 3D5UA 4J8MA 2ESMA 2XM9A 4FZ7A 4O2PA 4AOIA 1GIIA 3VBXA 2KTYA 1XH9A 2FSTX 3EN7A 2OICA 2X9FA 3LFQA 4IZ7A 4RZWA 4ITHA 4YR8A 5I4NA 2Y6OA 4FTNA 4NJDA 3BU3A 1JKTA 2XNMA 2F7ZE 4GG7A 1Z9XA 2VO0A 3LAUA 3R30A 4XBRA 3HV7A 4YTIA 4EOPA 3F69A 3UQGA 3KEXA 3QQUA 4RIXB 5JEBA 4MWHA 4DCAA 3DB6A 4EOQA 4O0TA 4P90A 5CEQA 3RHKA 2HY0A 5HO6A 4PQNA 2WU6A 2HK5A 2Q0NA 4I0SA 4V05A 4LYNA 4BKJA 2C6OA 5L6PA 4YHJA 5CF5A 4DCEA 1WVWA 3NAYA 5ETAA 4I4EA 3RJCA 2YDJA 2JBPA 2X4ZA 4XNEA 4IZYA 2ZAZA 1IA9A 4M69B 3D7TA 3N4TA 4GW8A 1H0WA 4M84A 3UZPA 3ID6C 2WQMA 2YAAA 3MESA 5IQFA 2WMRA 4V01A 5M53A 2PVLA 2PE0A 5E4HA 3CD8A 3FI2A 2A0CX 4FK6A 5IF1A 3H0YA 3RGFA 2C1BA 3IDPA 1H1WA 4EONA 2Y8OA 5DHJA 4EOIA 1A48A 4ZS4A 3OT8A 4A9UA 2C47A 3SRVB 1ZXEA 2HXLA 2W1FA 3P0MA 1XWSA 4U8ZA 3QBNA 5BVOA 5IUGA 1W84A 4D0WA 4E4XA 3FQHA 5JRQA 4F6WA 3OUKA 1R39A 1H4LA 3O71A 1SVHA 4CYJA 2QKWB 3JYAA 4O84A 3ANQA 3TUCA 3LOKA 3O96A 2W1EA 3UQCA 4F99A 2UZEA 2FVDA 5E1EA 5AUWA 1P14A 4YHFA 1JNKA 4FSMA 4QMLA 4XG2A 3W1FA 5A3XA 4C3RA 2OJGA 5M44A 3HV5A 4G3CA 1TVOA 1WBTA 2QNJA 4Z7GA 1QMZA 4HGTA 4JR3A 4OGRA 5GHVA 4EI4A 4F0IA 1TQIA 2X2MA 2NP8A 3JY9A 4A7CA 4UB7A 3A7JA 5HICA 1PXIA 3VS1A 4UV0A 1T45A 5HCYA 4F65A 4AZVA 3MDYA 2JDOA 4B4LA 2ZV2A 2FA2A 3A7FA 3IKAA 3KKVA 4RX8A 3VUIA 5CU6A 5HZNA 1IG1A 2PTKA 4MNFA 2G01A 3SXRA 5C8NA 1SYKA 4XX9A 2J0MB 3QQHA 4MF0A 4QP4A 5JMSA 4ZAUA 1YDTE 5J7BA 4A07A 2BZIB 5BVKA 3Q32A 3UJGA 5E92A 4GIIA 2YLEA 3O0GA 3PSDA 4IJ9A 4H36A 3ERKA 4L67A 5C1QB 5J79A 3ZEPA 1H0VA 3FPQA 1WBVA 4JRVA 2YJSA 4N0SA 2WQNA 1O6LA 1XH7A 4JAJA 5B2LA 2QU5A 4MBIA 1OMWA 5E8VA 4USEA 4M13A 3TN8A 2GMXA 4CT1A 5HTBA 4O7VA 4QP1A 2A2AA 2PVYA 4FODA 2QD9A 3DNEA 4ZTRA 2J0IA 3R1NA 4FNYA 2BKKA 3ZM9A 1U4DA 4I0TA 3CCNA 2X6EA 3DQXA 3FMJA 4FTMA 5AX9A 4GUBA 5EW8A 1PMVA 4NW5A 5A4EA 3HUBA 3AG9A 4FT3A 4V04A 2C6MA 2R0IA 4PDOA 5ACBC 3PJ8A 2C6LA 2QHMA 1SZMA 3NSZA 4RX9A 5AUZA 3NUSA 4NL0A 3FDNA 5IUHA 4PTGA 3NS9A 4FT0A 3IW5A 3ZSGA 2NPQA 4UMQA 4FEQA 4GJ2A 5FD2A 2JDVA 1CTPE 4CQEA 3OEFX 2IVVA 3R0TA 2I0YA 2OH4A 4ZEGA 4ENYA 4FKGA 3IS5A 1B39A 4QYEA 5H9BA 4EYJA 4DN5A 3ZRKA 4FTUA 1YXSA 3PIXA 4AGDA 1GJOA 3EQDA 5D11A 3UZTA 2C0IA 4NTSA 4APPA 3AT3A 3F2AA 4OAVB 4M0YA 3UO4A 2E2BA 5FP5A 2C6EA 3F3WA 4QMQA 1BL7A 3FMNA 2YA9A 4R6VA 1CSNA 2C5VA 5D12A 4O96A 3COIA 2H96A 3QLFA 3WYXA 2WQBA 3SW7A 3OWPA 5LQFA 3IK3A 4Q2AA 3QUPA 4TKSA 3ROYA 5M06A 3Q60A 3HP2A 5JSMA 3I5NA 3TIZA 4QTBA 5DH3A 4RVLA 1Q99A 3VF8A 4IX6A 3KVWA 2ITYA 3HMMA 4CD0A 5IH5A 3M11A 4OTGA 3CKWA 3A2CA 5CT0A 2PU8A 4EOMA 4WKQA 1YOLA 4FKLA 3F5XA 3FWQA 4CKIA 4I4FA 3LKMA 3QA0A 3BYOA 3R21A 2F4JA 4MF1A 2XNBA 3MI9A 2C5YA 2YJRA 1CM8A 2Y6MA 2C30A 4IB1A 3LXNA 3DLZA 4IWDA 3GNIB 3MH1A 5E8XA 3HEGA 3QKLA 2ZM3A 4PMSA 3BEAA 4E7WA 4U5JA 5IKWA 4L7FA 4BDAA 2JFLA 1YXVA 3REPA 2WIHA 4UMTA 2BTRA 4YO6A 4IBMA 4WA9A 4AW2A 4QP8A 4OTPA 5I5ZA 4ZMEA 5HCXA 3RPSA 5C8KA 2J4ZA 1BUHA 4K8AA 5IA0A 5J87A 3QZHA 2V7OA 4WUNA 4K11A 5ANJA 3AMYA 4KIQA 1TQMA 2ZB0A 5L6OA 3KCFA 4I23A 3BHTA 2CLQA 3EQGA 3OUNB 4E5AX 4BBEA 3DBEA 1KUTA 2YCSA 3QTQA 4KIKA 1SNXA 5ITAA 3TNWA 4BCMA 3CQWA 3OHTA 1AQ1A 4AP7A 2WMWA 3LQ3A 3KXNA 1Q3WA 1WBNA 2DYLA 4RFMA 4ZTSA 4TYGA 1YXXA 2VU3A 4HGSA 3GQIA 4JG8A 1KE5A 4ZK5A 4BBFA 4ZY5A 5HU3A 4C2WA 3ORLA 2BTSA 4ZTQA 4I24A 5M08A 5LJJA 3AGLA 4RWLA 3AC4A 2W1HA 4ZLYA 1JSTA 4GT3A 3QTSA 2V7AA 4F1OA 2PYWA 2W4JA 3K3JA 4QTCA 5AAFA 4FTTA 3NLBA 4JDHA 5KHWA 3BX5A 4AX8A 4W8DA 1VJYA 4PNKA 5J1WA 4CTCA 2VTPA 4K1BA 4EL9A 4NM0A 4JQ8A 4G17A 4EZ3A 3G2FA 4LG4A 3I4BA 2ZMDA 2UZDA 2Y0AA 3E8EA 4UY9A 2UVYA 3EKNA 3OY3A 5HNBA 4Z9LA 4F64A 2CGWA 4IZ5A 3PPZA 2YLFA 4AGUA 2PY3A 3D7ZA 4ONAA 2HZ4A 2IVTA 4GT5A 5EDRA 5AR5A 5I3OA 1XBAA 4BIDA 5JT2A 4DA5A 3BGZA 4I94A 3W32A 3UTOA 4WG3A 4BZOA 2X4FA 2OXXA 3QTRA 3P9JA 2VWWA 1JSVA 3QLGA 4EH7A 5DRBA 2YM8A 5C27A 5DA3A 2OU7A 4F9WA 3I5ZA 4GS6A 4IWPA 4A9RA 1B38A 3G9LX 4QOXA 3E88A 2ITVA 3PY0A 5JFVA 3O8TA 1OBGA 3TCPA 4AE6A 5I9YA 5CEKA 2OH0E 4BN1A 1GIJA 4Y83A 2XCKA 1LUFA 2BAQA 3R8VA 4ZS0A 4HVHA 3MN3A 5LOHA 1P4FA 3GQLA 4ACMA 4YP8A 5HORA 4YTHA 4FZFB 3PG3A 3VF9A 3TTJA 2BCJA 4B9DA 3VW8A 4H39A 3VUHA 5A6NA 1ERKA 3RK7A 3R01A 3BWFA 2XJ2A 5CAQA 2RSVA 2VX3A 5A4TA 1Q4LA 3BU5A 3ROCA 3QRJA 5A4CA 5HE2A 3LJ1A 4FI1A 3E3BX 3MA3A 4DFBA 2VO7A 4RBLA 3CD3A 3FLNC 4X2JA 4FK3A 3A61A 4B99A 4EOKA 5BUEA 1YI6A 2BR1A 3IECA 3P7AA 5DFPA 5E8WA 3QTUA 5LMKA 2ZB1A 5HLWA 2Q83A 3ZLXA 2C5OA 4NM3A 1H25A 2VO6A 4IWOA 3POOA 1S9IA 4BDEA 3CJFA 4FL3A 4DINA 2WELA 4Z3VA 2PE1A 4HVGA 3NW5A 3SX9A 2GNIA 2YDIA 4MQ2A 4YZBA 2Y9QA 1U5QA 3FYKX 3IW4A 2R3LA 4MH7A 2VTTA 2VWBA 2RFNA 4A4LA 5M56A 5HVJA 2IW9A 5B2MA 3II5A 1Q8YA 3OFMA 4OTWA 2OJIA 2XKFA 3FZSA 3MVHA 3TZMA 5AP4A 5EK7A 4P5QA 2GDOA 1ZOHA 3GCQA 4K9YA 4UYAA 2BMCA 3CTQA 5AP7A 2RL5A 4U3YA 3UE4A 3C0HA 2ETRA 3GUBA 4TWCA 4QT1A 4FV2A 4GSBA 4YGAA 3UYSA 2WMXA 3E92A 4G5JA 3DOGA 5AUXA 3CP9A 4DGLC 4C4GA 3S0OA 2GFSA 4FV3A 3WIKA 5ANDA 5BVDA 4CEGA 4NWMA 4RJ7A 3RPRA 3IQ7A 4E6AA 4IAKA 5CF6A 5J1VA 1XBCA 3BGQA 2GSFA 3ETAA 3E3PA 3ZO3A 4DBXA 3RMFA 1ZZLA 3EN5A 3KB7A 3L9PA 3PXZA 4RJ5A 4LL0A 4C59A 2WOUA 3E63A 3Q9XA 4C58A 4FSQA 4Y73A 3AOXA 5D10A 3D7TB 4IC7A 1KSWA 4FIEA 3O7LD 3DT1A 4GK4A 5K5XA 1NVQA 3EQFA 2O64A 2R5TA 4RIWB 5D41A 3SRVA 3RPOA 3MFTA 1PRYA 3UP2A 2XIYA 5HVKA 3TM0A 4ZP5A 4MXZA 4ACHA 4MAOA 2A4LA 3MWUA 3P4KA 1H00A 3O7LB 4JBVA 2C1AA 5EFQA 1JKLA 5LMAA 3UPZA 3OXZA 4PRJA 5DNRA 4D0XA 4X2NA 2B52A 1Q61A 5EHOA 4I5CA 4ID7A 1IRKA 4FZDB 3QCYA 5AR8A 3H30A 3S3IA 4QMNA 2W5AA 2XNEA 2W96B 2P0CA 1BLXA 3FC1X 2XUUA 3GGFA 4L53A 3RTPA 1MRVA 2C6KA 3NUPA 5HCZA 3TI1A 4FEWA 4HYUA 3NUNA 3RZBA 4J1RA 4PP9A 4LM5A 4ANLA 1GZOA 3Q2MA 2VTQA 1YXTA 4XV2A 3FI3A 3ZONA 4MXOA 5CU2A 2CDZA 2QOLA 3JVRA 4FV9A 3SVVA 2VAGA 4N4SA 3EYHA 3H9RA 1OL5A 2QODA 3VJNA 3EN6A 1EH4A 1Y6BA 2F2UA 3W33A 4LGHA 2YIYA 4EH8A 1QL6A 4AT5A 1OIUA 2YHVA 5IQCA 4ZTHA 2B0QA 3SKCA 2OIDA 2I0VA 5JZNA 1R0EA 4C3FA 5DPVA 3U4UA 4ASZA 3DS6A 3EZRA 1I09A 3A7IA 3BPRA 4FBXA 4IAFA 3V6SA 5CX9A 4MEDA 4NM5A 3ZUTA 4O7NA 2FB8A 3QD0A 4IB5A 4BGQA 1Q8ZA 4CMUA 2QO7A 3EN4A 2Z7RA 4KIOA 3LM0A 4BWKA 2B54A 2Q0BA 3QWKA 3V5TA 3I6WA 4QP3A 5LVOA 3VUTA 2WTCA 3BV2A 3KQ7A 4MWIA 3NDMA 2OF4A 2XK7A 1PXNA 5KE0A 3HAVA 2REIA 4B8MA 1IEPA 2BPMA 3RI1A 1WFCA 4DF3A 3LQ5A 2YIRA 3HKOA 3D14A 4LRMA 3U4WA 4BIBA 3ZZWA 4CMTA 4O86A 2JITA 1URWA 4GIHA 2VO3A 3WE4A 4MXAA 1YOJA 4CV9A 5BUJA 4AW5A 3ZYAA 3PJ1A 3ZOSA 2X7OA 4BCIA 5EHYA 4O7WA 4F7JA 4WBBB 4BDFA 4BDDA 3L9LA 3MVJA 3RWQA 4LGDA 4ANMA 1ZWSA 4QMOA 5KMIA 3BYMA 4J52A 5TKDA 3LLAA 3E64A 1JAMA 5CZHA 4PWNA 2XEZA 3VAPA 3WZUA 3ZDUA 1H28A 3MPTA 2BRGA 2QOFA 3Q9YA 5EYKA 5TO8A 4CV8A 5CF4A 5IQAA 4TPTA 2JIIA 3L9NA 5M4UA 4C4HA 1NVSA 3R7EA 1G8SA 4DFLA 4YTCA 2C3IB 4WO5A 1WBWA 3LMHA 3AC3A 3ZHPC 3QCSA 3WE8A 4ZMFA 4F6SA 2JIVA 4BR3A 3O2MA 3BHYA 2PK9A 2JAVA 3KC3A 3EIDA 1BMKA 3H4JA 4G34A 2C0OA 4XV3A 4YBKA 1CKPA 5EW3A 4GFOA 5HLPA 4L46A 4Y46A 5DT4A 3FKNA 3C13A 1OKYA 3R9DA 1OKVA 2EWAA 2XJ0A 4F7SA 1ZOGA 3E62A 2VWXA 4D5KA 3R7OA 4DH8A 2XIKA 5IA1A 1OZ1A 3AMBA 3F7ZA 3UC3A 5HX6A 4ZSEA 4DAWA 3ALOA 3LFDA 4IVAA 5F1ZA 4FEVA 2XEYA 5EI8A 3W2CA 1Q24A 3ZXZA 3OVVA 5L2IA 2BDFA 2XA4A 3MH0A 4RWIA 2P55A 3E8NA 3NIZA 4HGLA 4WOVA 5FBNC 3ZXTA 2B53A 4ACGA 2ITUA 1Z5MA 2PZRA 3BE9A 3DZQA 4LOPA 5FEDA 4X2KA 3CPBA 4BGHA 5I0BA 5IEXA 4C4FA 3B8RA 2RIOA 3I7BA 1VYZA 4PDSA 5B7VA 3CGFA 5L2QA 3QHWA 4FT7A 2JKKA 1Y6AA 3LMIA 3GU8A 3FY2A 4H1JA 1CKJA 3DZOA 2XIRA 2VTHA 4RJ6A 4GU9A 2FGIA 5KO1A 4IX4A 3R9HA 5LWNA 1XKKA 4CFWA 2BFYA 2W1ZA 3W8LA 5TE0A 3POZA 5D7VA 3ZU7A 2X7GA 2XM8A 3CY3A 4PPCA 4QQCA 2R7BA 4YZNA 1NW1A 2PMOX 3FZOA 5HE1A 1OIYA 3FMMA 2YDKA 5GJDA 1G3NA 3MV5A 5ANOA 3FQEA 2YITA 4WSQA 2AUHA 4M3QA 3OOGA 4ERKA 2VRXA 3PLSA 4AW1A 3TDVA 4IJPA 2RGPA 4LUEA 3QD4A 3AMAA 4LV5A 2UW5A 3DK7A 1JWHA 3FZ1A 1U5RA 5JGBA 3ULZA 3Q2JA 4BCOA 4E93A 3OW4A 4R7BA 4DGGA 4LRJA 5FRIA 4U3ZA 3HAMA 3DAEA 3QAME 3DFAA 2XZSA 4MBJA 4MK0A 4FT5A 4G3FA 4RC3A 4DFYA 2GNLA 1H07A 4HYHA 5CSPA 4FTQA 2CKQA 3TNIA 3FZTA 4M14A 3C5IA 3LLTA 3A8WA 4FV4A 2P4IA 4PNIA 4C2VA 4R78A 2I40A 1GZNA 4FKIA 4O0SA 4RLKA 4ARKA 3HMPA 4AZWA 5T68A 2ITWA 4RIOA 3NUXA 3K5UA 4HYIA 3AC2A 4L52A 4I6FA 4O22A 4JIAA 4PL3A 5FXSA 4QYFA 3SXSA 1BI8A 5JRSA 4C7TA 5ETFA 5H8EA 3TEIA 4FGBA 2JBOA 3UPXA 5GJGA 3ZDIA 4EOJA 5BNJA 5CALA 3VQHA 4O6EA 3CQUA 4U81A 2P33A 3RVGA 3QA8A 4O7SA 1A06A 3BLHA 3QGWA 4F0FA 2YERA 2IW8A 2W06A 2YZLA 1MP8A 3NAXA 5KX8A 4PV0A 3I6UA 3EQRA 5AP6A 5AV0A 3TNHA 2GNGA 5DN3A 2WMAA 3UZRA 4AE9A 3FL5A 5J9ZA 4X3FC 4OT6A 1OECA 4EHGA 3C4ZA 3VVHA 1DS5A 3TZ9A 3ULIA 3U8WA 5KBRA 1SVEA 5CU4A 2IZTA 2Z02A 5DBXA 2BHEA 4FMQA 3P86A 1PXJA 2XNGA 4FSTA 2F7XE 2UZLA 2YM6A 1ZARA 2CGUA 3MS9A 4DEBA 4J7BA 4XUFA 2ETMA 4DITA 4FV5A 5CSVA 1SMHA 2ZDUA 3A60A 4F7LA 3BWJA 1XH5A 1H24A 5LVNA 2B9HA 3TNQB 3V3VA 4CFUA 4IWQA 3PVUA 4EH2A 4XLIA 3MA6A 3IOKA 4IIRA 1GZKA 3FYJX 3ZSHA 3MFSA 2O8YA 1Y8GA 2JKMA 3MB7A 4Y8DA 3AT4A 1W98A 5AP2A 3EQIA 3W10A 4C4IA 5AA8A 2VTLA 4YJSA 5H8GA 2ITZA 3V51A 2OJFE 2XCHA 3EL8A 1Q62A 4AGWA 2ZV8A 2QLQA 4FG8A 2W1GA 2BAKA 3PXKA 4TNDA 4X2GA 3BGPA 3MTLA 5FDXA 4HCVA 1OPJA 3MIAA 4OR5A 3VQUA 5GZAA 4OTQA 3MH3A 4X3JA 5LCJA 4O82A 2VV9A 2OXDA 3BYVA 3L8SA 4XG3A 3NNUA 1YWVA 4M15A 4QPMA 5HBHA 4KSQA 2R3MA 2WB8A 3ORIA 2IVSA 3KGAA 4X3FB 4RWKA 3F3UA 2GHMA 5DGZA 4G3DA 4CTBA 2XBJA 3TTIA 2DS1A 3GOPA 4BC6A 1SVGA 3D15A 3SOAA 2IW6A 3MBLA 4NSTA 5M07A 4O0VA 2C3LA 4USFA 3FI4A 3MPMA 3NMUF 4FKVA 4FSUA 3NCZA 5CLPA 4IM0A 3C4CA 4D9TA 3OROA 3U55A 1ZYJA 5F20A 4LRKA 4C35A 3DB8A 3OCTA 3SG8A 5J9LA 2O0UA 2WNTA 4NFNA 4MXCA 4FZAB 5DI1A 3SW4A 3ZCLA 5E8SA 4D2RA 5HEZA 5EYMA 4I3ZA 3UIBA 4DH5A 3AC8A 2YCQA 3OT3A 3PG1A 2W1DA 3AT2A 3AD4A 3H9OA 3WF7A 1GY3A 1V0PA 4QMYA 4KB8A 3EYGA 1WBSA 5C9CA 2E9VA 4RX5A 2YWVA 4E6QA 3PP0A 5FDPA 3PIYA 4RIWA 4XRLA 3FC2A 3N51A 3CE3A 4GV1A 3W55A 1KE6A 4KINA 2WXVA 1JPAA 4MTAA 4ZXTA 4AF3A 5CANA 5KMJA 2ZDTA 3BCEA 3PXFA 1O6YA 1ZY5A 2R64A 2VNYA 2G2HA 5CY3A 5CU3A 2R2PA 5IUIA 3AQVA 3PZEA 4FUXA 2EB2A 3A7GA 4AS0A 3ZC6A 4NIFA 4GEOA 4UEUA 1MUOA 2GHLA 4C37A 4L6QA 2WOTA 2XKEA 2PSQA 3JXWA 5EYDA 3ZZEA 2H8HA 3EH9A 3QRUA 4L7SA 2VZ6A 4RSSA 4FT9A 3EWHA 4PL5A 3QTXA 3ZRMA 4P5ZA 4EQUA 3PXQA 4ZZMA 4CKJA 3PVWA 3ORKA 4QP7A 4QPAA 1YWNA 4HJOA 4CZYB 5JGDA 2ETKA 3UOLA 3QXPA 3C4XA 5AMNA 2FSLX 4JNWA 3L8PA 1PXOA 2OZOA 4EK3A 3RINA 3RPYA 1B6CB 3QX4A 2XK6A 4YZDA 3PPJA 3TACA 4DE4A 3VS0A 4F4PA 1J91A 2H34A 3RK9A 3W2OA 5EQEA 4TL0A 2R4BA 3NUAA 4CFFA 2Z2WA 2R3HA 3IGOA 2IZSA 3HMIA 4LUDA 2GQGA 1LEWA 2X8EA 3ENMA 3LFNA 4LMNA 4G6LA 2EXCX 3Q4CA 5AR3A 4RVMA 3NYXA 3AD6A 4TRLA 5IA4A 3PDTA 3SGCA 2VTNA 4JR7A 4EQCA 5EI6A 4BDKA 3RM7A 4I5PA 4E4LA 3EFWA 4O0WA 5IDNA 5AP1A 2JAMA 5H3QA 4B7TA 4OBQA 2UZOA 5K0KA 4PY1A 4NKSA 4GH2A 1UVRA 2BUJA 4WUAA 3VIDA 3SOCA 4DTBA 4MKCA 5GZ9A 2IO6A 4A4XA 3SV0A 3NNXA 4HNFA 1YHWA 4HPUE 3PWDA 4MXYA 3ZTXA 4EKLA 2WZJA 4UZDA 4EWQA 3CKXA 3RAWA 2ZJWA 3C1XA 3PE2A 4IAAA 5J8IA 2B9IA 1MRUA 1UWJA 2VTSA 3QF9A 4JIKA 4NEUA 4RC2A 3SLSA 4BKZA 2EU9A 1OPLA 4C8BA 2Z60A 5DMZA 4U7ZA 4FOCA 5ANEA 4II5A 3BBTB 3QKMA 3Q4ZA 1ND4A 2C6TA 2FYSA 2VWUA 3FKOA 3QZFA 5DRDA 3KXMA 1ZYSA 1YOMA 5AUYA 3VBTA 1M17A 3GFEA 5HTCA 3UG2A 1L3RE 4IC8A 5CAPA 2QQ7A 3LVPA 2LAVA 3Q4TA 3OCGA 3VUGA 2ZM1A 4E5BA 3NYOA 1H08A 1LR4A 2PVKA 1JVPP 4GG5A 5C26A 4O27B 3F7WA 1VYWA 3OWKA 4U40A 3D9VA 5CASA 4XRJA 4AN2A 3EZVA 4AT4A 5FEQA 4DFUA 2JDRA 3LQ8A 5FBOA 4BL1A 2YM5A 4H3QA 2YEXA 3Q9ZA 2I0EA 4L3PA 4KKHA 5F95A 4FX3A 3EQCA 5J5TA 2FUMA 3R1QA 4BCPA 4RPVA 4FIFA 2A27A 4CCUA 4FG9A 1OI9A 2X2LA 4FA2A 5BX0A 4XCUA 5BYZA 3OS3A 5DT0A 3W2SA 3WF5A 5HX8A 3EN9A 5HTIA 2J0KA 1F0QA 2CKPA 2BRHA 5E8UA 5GIPE 3CTJA 2GFCA 3OBGA 4KBCA 3WBLA 5CAUA 3UQFA 2VWZA 4XG7A 2ZV7A 3ZLWA 2EXEA 3RALA 5A46A 4C61A 3VBYA 4IAZA 4BRXA 3T3VA 5HNGA 4G3GA 4YU2A 3FE3A 3NVKI 2YM4A 5DEYA 5DEWA 3DBQA 5KMMA 1XH6A 2XK4A 4XG9A 3V5PA 2X0GA 3V5JA 5L8LA 1O9UA 4WNKA 4O7TA 4FTIA 4NCTC 4U97A 3RAHA 3R22A 4FKTA 3ORZA 1M2PA 5E7RA 3QX2A 5L8JA 4UMPA 2OXYA 2ITTA 1YDSE 2R3NA 4IM3A 2IN6A 3C50A 4QMMA 2CCIA 3GCVA 4U45A 3TWJA 5EI2A 5BVFA 3VUMA 3FXWA 4WBOA 1H1SA 3IGGA 4BCKA 4QRCA 4GFMA 5CWZA 3JVSA 5HIEA 4FKQA 4FE2A 1IR3A 4I6BA 5JFWA 5I9ZA 3UO6A 3PXYA 1URCA 2ERZE 3V5QA 4DFNA 2W0JA 3OTUA 3HMNA 4MX9A 1G5SA 4EK6A 1XHAA 2QLUA 4BTKA 4EUUA 2UZTA 4G3EA 4U79A 3QXOA 3QQKA 5CI6A 5IMXA 2OGVA 5KMNA 1V0OA 3VS6A 3D2IA 4EH9A 2XBAA 4RLLA 2QO2A 2VNWA 5EHLA 3DU8A 1S9JA 2J0JA 3EB0A 3I79A 3V8WA 3TV7A 4AG8A 4CQGA 4XG4A 3R1YA 4D2TA 2RG6A 3QU0A 4FKJA 3NGAA 5A4LA 3MJ2A 2OK1A 3R28A 2W17A 4BDCA 4FVQA 3ELJA 5EM7A 2BIKB 3GU7A 3ZFYA 2PVJA 3C4EA 1RJBA 4CMOA 5FLFA 5CZIA 3R8MA 2O3PA 3IDBA 4ZSLA 5D7AA 5HGIA 2R9SA 3OXIA 4XH6A 3FHRA 3FSFA 3HA6A 4YSJA 4YZCA 3KA0A 2WPAA 3TL8A 4DH7A 3BHHA 3ORTA 3PIZA 3QFVA 5EYCA 5AUUA 4YC8A 4I1ZA 1PKDA 4QO9A 2V0DA 3QTIA 3D83A 2HW6A 3WF9A 2R3QA 3IDCA 3NW6A 4FYOA 3C5UA 4RX7A 3JUHA 1UKIA 3HRFA 2UZNA 2YACA 5KNJA 5CNNA 5AV2A 4D4YA 2PVFA 4G31A 2GQRA 4FNXA 3RCDA 3I0OA 2WEVA 3E5AA 3C0GA 5DR9A 5FUTA 3BYUA 1YQJA 3FZPA 2UZUE 3LE6A 3DKFA 5CXHA 4XP0A 5AFVA 2XVDA 3F61A 1YDRE 5EM6A 2C3KA 2HOGA 4C57A 4EBVA 3VS2A 1QPEA 4BCGA 3QC4A 4C62A 2IPXA 1VEBA 2J90A 5TF9A 1R78A 1M52A 3NX8A 5EOLA 5M4CA 4RA5A 2XK3A 1Q5KA 2QHNA 2VTRA 3SG9A 5C01A 5CU0A 1M2QA 4IVCA 3NNVA 4FKPA 2Z7LA 4IX5A 4R7HA 3H9FA 4EK4A 5K5NA 1J1CA 3MY1A 4C4EA 5I9UA 3PRIA 4G9RA 2HW7A 2XKDA 3R9NA 3SDJA 2Y7JA 3ET7A 4ANBA 4BB4A 1WBPA 3HNGA 3UNJA 4ZTMA 4BDHA 3BBWA 1R0PA 2XKCA 4KBKA 2CHLA 3FAAA 3LCOA 4L3JA 5BVWA 3PLAE 3R7UA 4CFMA 4X3FA 4Z16A 3T9IA 2P3GX 3PVBA 2LGCA 2WD1A 3ZSIA 4M8TA 3UBDA 3R02A 4FR4A 2CGXA 3NR9A 1FVVA 4R3CA 4MD7E 1XH4A 5CEPA 4MD8E 2WGJA 4FSWA 5EM5A 4ZOGA 3QKKA 4JDKA 1OKWA 4TNBA 3RM6A 1KWPA 4I5HA 1FGIA 4ZJIA 1NY3A 4GK3A 4JLCA 3DTWA 1GOLA 2QURA 4DFZE 3JS2A 3W2RA 4TZRA 5LVLA 4ITJA 3Q6UA 4MXXA 5AUVA 4FEUA 5CSXA 3FEGA 4NYEA 1KV2A 2AC3A 3ACJA 4YPSA 2YCFA 4D5HA 4YJRA 3ALNA 4JXFA 3VW6A 4CG9A 3UOJA 4G5PA 5E91A 5BMMA 5CI7A 4HZSA 4FTAA 3Q96A 4FV0A 1IASA 2GU8A 2X8DA 1TKIA 5HG8A 2BHHA 5JQ8A 2HCKA 4BTMA 4FVPA 3UVRA 1K3AA 1YHVA 3KXZA 3UGCA 4D9UA 4O0RA 5E8YA 2WU7A 2BRNA 4PL4A 2XS0A 4MNEA 5HKMA 3KMUA 3DJ6A 3RHXA 3FLYA 4E8AA 4ZJVA 3GI3A 4A9SA 4O7LA 4M66A 5JKGA 4CLJA 2OI4X 3R71A 4EJNA 5J5SA 1OBDA 2J50A 4W4WA 4AWIA 4FKUA 3FXZA 2RFEA 3IW8A 4NIFB 1T46A 4FVRA 2R3RA 2WTIA 4EC9A 4K33A 4F1MA 3EQBA 2WMTA 3N9XA 4WNOA 3OWLA 3QRTA 4H3BA 2F9GA 1AD5A 4RQVA 4C02A 3RKBA 3ZUVA 4ZZNA 2XRWA 3A99A 2CN8A 2X7FA 3SD0A 3IW6A 2HZ0A 1BI7A 1FVTA 3OD6X 4IQ6A 2HWOA 4JOAA 4XS2A 4I92A 3SAYA 3HV4A 4E1ZA 2PWLA 3A4PA 4K77A 2WMSA 5L8KA 2BDJA 1R3CA 2H9VA 3GU5A 3NRMA 1Q3DA 4DFXE 2YIXA 3GCSA 4PTCA 4DTAA 2G1TA 4EK8A 4UALA 4JQEA 4EZ5A 3UMXA 4E6CA 2WHBA 2C69A 4J8NA 3TIYA 3MH2A 3VNTA 2VGPA 4DEDA 4W9XA 2J7TA 2QOIA 3VRYA 4CKRA 4YZMA 3D5XA 4Y85A 4EHVA 4WG5A 2QONA 2X1NA 4W9WA 3T9TA 2GS2A 2XNPA 2OZAB 3FHIA 5HIBA 4O7YA 2QC6A 3CR0A 3QGYA 4YLKA 4NFMA 4YBJA 3I7CA 3OY1A 1OUKA 4DEIA 3FLWA 2ITOA 4AOTA 5E8ZA 2EVAA 3G9NA 3DXNA 3V8TA 2OJ9A 5AUTA 2X39A 3DJ5A 3OW3A 3GXLA 4NU1A 1UWHA 3CPCA 2JKOA 4CFNA 4E5WA 2WTVA 1H8FA 3TV4A 5DT3A 2F49A 3HV6A 1G8AA 3HUCA 3R73A 4OAUC 1CMKE 2E9PA 4MCVA 2CCHA 4YHTA 3HECA 5HQ0A 5LARA 4AAAA 1ZRZA 1ZOEA 2XYUA 1K2PA 4KRCA 3BYSA 3DDQA 4BI2A 2G2FA 2JIUA 2UVXA 4XP3A 1JSUA 3BELA 4BHNA 5DG5A 3F82A 4G1WA 5HBEA 4E4NA 1BL6A 1Q97A 3A62A 1FOTA 3HP5A 3QTWA 5IISA 5LXMA 3CEKA 5AP5A 4HPTE 3KMWA 5H2UA 3R9OA 4BICA 2QVSE 4U80A 4IFCA 4EOLA 1YVJA 3EJ1A 1UKHA 4BCHA 5H8BA 3M1SA 5GIOE 4HOKA 2BFXA 3OCSA 5KHXA 3HL7A 5FM3A 4EYMA 3TDWA 3TZ7A 2PZPA 1KE8A 2E9OA 2X8IA 2G15A 4U0IA 4CRLA 2WEIA 4EC8A 4PMPA 2E9NA 4LI5A 4YJTA 1PMNA 3EKKA 2RG5A 1W82A 3EL7A 2AC5A 5CVFA 4BZDA 4ZY6A 4D2PA 4G6OA 3COMA 3B2WA 5IG1A 3L8VA 4XHKB 2V62A 4S33A 5HOAA 2ITXA 2ITPA 4FSRA 5IQIA 2OWBA 4WT6A 2HZNA 3Q04A 4CSVA 3DGKA 2JD5A 3LJ0A 4IANA 5I9VA 2Z7QA 4OW8A 3RZFA 4D28A 3TKHA 3Q5IA 1KE9A 3FZRA 4J71A 4L45A 3ZC5A 4PPBA 4EKKA 2UZBA 4FTJA 4GMYA 5IDPA 5C4LA 4RVKA 1I44A 3SA0A 4XOYA 5BYLA 4GT4A 4B0GA 1DI8A 2DUVA 4FSZA 4M97A 4O7RA 4BTJA 5TR6A 4ANQA 3E8DA 3HRCA 1PHKA 5CTPA 4F9CA 3OBJA 3PZHA 3FMEA 5ANIA 5EDQA 2OO8X 4JBPA 3U6HA 3B2TA 1M7QA 2YAKA 2O2UA 2PMNX 3G0FA 4QMPA 2WMUA 4FSYA 3OEZA 4QMSA 4CFXA 4R77A 5EOBA 3F5GA 1M2RA 2C68A 4PMTA 4Y5HA 3TJCA 3S4QA 5I3RA 4K6ZA 1DAWA 3CJGA 4R1YA 4L43A 4W4VA 2SRCA 3V5LA 2GS6A 5BQ0A 3RNIA 4FEXA 3DXPA 4BFMA 3KXGA 3D5VA 2EB3A 4EBWA 3K2LA 1O6KA 3ORMA 4TYHB 3DLSA 1U54A 4AW0A 3TV6A 3MTFA 4Z55A 4KAOA 2PMIA 2YM3A 2X81A 3R7IA 2J2IB 4ZJJA 2PZIA 5TOZA 2XK8A 1J3HA 2BILB 2XNNA 3L8XA 3P78A 4QP9A 5DIAA 3GC0A 4A9YA 5AADA 3DXQA 3KMMA 3R8UA 5HI2A 4LMUA 3UOKA 4U6RA 4Q5HA 5HG7A 4S34A 4RQKA 2F7EE 3I1AA 3KL8A 3DY7A 5KCVA 5BMSA 3QQJA 3QALE 3LFCA 2UUEA 4XOZA 4YJOA 4IDTA 4KNBA 4QTDA 1YI3A 5JFXA 2CKOA 4WIHA 4F9YA 3GCPA 4JS8A 4YJVA 1Y57A 2PVMA 2UZWE 4AZEA 3TJDA 5JGAA 5K4IA 4NCTA 1YW2A 4CVAA 4FOBA 5LMBA 4RJ8A 3IW7A 1E1XA 1P5EA 3VHKA 2JDSA 4DHFA 4RWJA 4ZSGA 3ENHA 4BGGA 4FTRA 4WD5A 4O91A 4OTIA 1Q41A 2CMWA 4QQ5A 4RVTA 1JKKA 3B8QA 2PHKA 4K18A 3SXFA 4DT8A 4UWYA 3UIMA 3FSKA 5FTOA 4DG2E 2UW9A 3KF7A 2ACXA 4C36A 3WYYA 2IZRA 2QCSA 3G51A 4L44A 2IG7A 1FMOE 3EFKA 3MVMA 5AP0A 5AWMA 1FGKA 3AC1A 5A9UA 3MY0A 2P2HA 2BZKB 4J95A 4MD9E 4BCJA 1OPKA 2R3GA 3A8XA 4FTKA 2OIQA 4YJUA 5AR4A 4MVFA 5KZIA 4GKIA 4AUAA 2CSNA 2UW8A 1H26A 3U6IA 4TTHB 5C4KA 2G9XA 1U59A 2QOHA 5EQPA 3HYHA 2YABA 4ASDA 1H1RA 2GNHA 3OMVA 1UNLA 1OVEA 5L6WL 1IAJA 5KUPA 4GKHA 3L1SA 3VBWA 4ALVA 4NH1A 3QWJA 1IAHA 2X2KA 4QTEA 3DAKA 4JI9A 5F94A 5LWMA 2PL0A 3PPKA 3FBVA 2QR8A 3ZS5A 3UVQA 1XBBA 4AACA 5G6VA 4CT2A 3V04A 5L3AA 2J0LA 4S31A 4O81A 2RFSA 4PP7A 3NWWA 3WI6A 3GB2A 3UG1A 4AN9A 5IQEA 4BKYA 4D4RA 4YO4A 2DQ7X 2VWVA 1AGWA 1YI4A 3H10A 4FYNA 3ZUUA 3BQRA 2YZAA 5HU9A 2XK9A 2G2IA 2WMQA 4S30A 4XJ0A 4Z7HA 4YPDA 3KF4A 1DM2A 4O1PA 2QKRA 3LZBA 3ZH8A 2B1PA 5EKNA 3ZRLA 4BY9E 4IB0A 1TQPA 2C5NA 3JPVA 5IA2A 3S95A 3IO7A 2VTAA 2WTWA 4J99A 2VTIA 3BLQA 3ORNA 4RG0A 5K3YA 4AGCA 5T3QA 5AJQA 4DBNA 3KULA 1QCFA 2PVHA 3GU6A 3OOMA 5AEPA 4BCFA 4ANNA 1OGUA 1OIQA 4BHZA 1PW2A 5CVHA 3FY0A 1UA2A 3D4QA 3KFAA 2QOKA 4I93A 1DI9A 1OB3A 3BE2A 5HD4A 3M42A 1J1BA 2WTKC 1GNGA 5IQBA 5M4IA 3I60A 1R1WA 4A9TA 5GZ8A 4CFVA 1WAKA 5DVRA 5E9EA 2X6DA 3CTHA 4IH8A 4PUZA 5L2TA 4IFGA 1ZMVA 2R3JA 2YIQA 3R6XA 4FTOA 5DR6A 5A4QA 1REJA 2V22A 2ZOQA 4JDJA 3PJ3A 2ONLC 5HE0A 4X6QC 4AZTA 3BI6A 4EHZA 3LXKA 2QG7A 4RJ3A 5AX3A 1X8BA 2BRMA 2WTDA 2YIWA 4MNEB 3QD2B 1U46A 1PMEA 4RMZA 3P7BA 4NUSA 4U42A 4WHZA 4BWPA 1ZMUA 2VTMA 5IQHA 2I6LA 3MYGA 2XF0A 4JT3A 4BBMA 4D1XA 4U44A 3VO3A 5IEYA 4OLIA 3F5PA 2OFVA 5IA5A 5CEOA 3DCVA 3DK3A 5FQDC 3HZTA 2W9FB 3PJ2A 3VULA 4B6LA 4DYMA 2OBJA 5HO8A 5FWKK 4CRSA 4RRVA 4E73A 4JX7A 1RW8A 3PSCA 4D1SA 2ZYBA 4Y95A 4ZY4A 3PUPA 2IZUA 2XRUA 4FV8A 4RA4A 3DA6A 4U9AA 4ASXA 1SNUA 2WTKB 5A14A 3E87A 4GRBA 2J5FA 5JN2A 5B0XA 3VUDA 4R5SA 1JLUE 3ZEWA 4XG8A 4R8QA 3DFCB 1PMUA 4G16A 3DKCA 4QMXA 4L01A 3EHAA 5E8TA 2C5XA 4XG6A 1PJKA 3G0EA 1RQQA 4X7QA 3UMWA 2JEDA 2OZAA 3HDNA 5LVMA 4E4MA 3GT8A 3ATTA 3UYTA 1MQBA 4N70A 1UU9A 4FKWA 4EEVA 2HWPA 4XBUA 5IU2A 3JR1A 1OKZA 4JRNA 4YUQA 4BI1A 3AGMA 5C03A 2CKEA 4WRSA 4EUTA 4XEYA 4JBOA 3NIEA 4JAIA 2XIZA 5HHWA 2CJMA 5I9XA 2JLDA 3VC4A 3V6RA 1SM2A 3NW7A 3ODZX 2C6IA 3WZDA 4B8LA 1YRPA 3VWAA 4E20A 1UNGA 2DWBA 3R00A 1Q8WA 3WZKA 3FPMA 3U6JA 1LPUA 2ZVAA 2B4SB 2GHGA 3P23A 1M14A 4XV1A 4F6UA 1HCLA 3FQSA 4R3RA 2CNVA 3KXHA 4O83A 2YCRA 4BCQA 4ZLOA 2CNUA 3E93A 1FINA 4JG7A 1BYGA 4F08A 3GC8A 2QO9A 2PUIA 3U54A 4D2SA 2IWIA 3K54A 3Q3BA 4ACDA 3BU6A 4FV7A 4QQJA 5EDPA 4I0RA 4YLJA 2ITNA 2PE2A 3NEWA 4KWPA 3KK8A 4AOJA 1H1QA 5GNKA 1WCCA 2GCDA 2W9ZB 4W8EA 5CT7A 5AAEA 4IHPA 4IZAA 4I21A 3W8QA 2O5KA 2R3IA 5JH6A 1NVRA 5JFSA 2Y4PA 3R04A 3DV3A 4QMWA 4RIYA 4EH3A 4ZSAA 3PWYA 2GQSA 3S1HA 2JDTA 3ZMMA 4BWXA 4FNZA 1Z57A 2XMYA 4L3LA 3LW0A 4FG7A 3LCTA 4IACA 3RK5A 4N6ZA 4I5MA 3NUYA 1WZYA 4H05A 4J98A 3RP9A 5BVNA 3E7VA 2OFUA 1ZMWA 3OC1A 4FIHA 3KN5A 5D9HA 4KRDA 2BRBA 4NKAA 2OW3A 4KS7A 3UC4A 4HVDA 4A4OA 4LOOA 2W7XA 3G5DA 1UU7A 4D2VA 3TNPC 1OL7A 1J7LA 5AP3A 1OUYA 4E6DA 5CF8A 1YWRA 2CPKE 3RPVA 2HIWA 5AV4A 3KCKA 4AFEA 1OM1A 2CNQA 3LCDA 3K3IA 3QRKA 1M7NA 2OJJA 4XYFA 4DGNA 3LFAA 1VR2A 4C4JA 4DG0E 2B7AA 3FMHA 4Q9SA 3UIXA 2BROA 4IVDA 4IAIA 4AQCA 2Z8CA 3D5WA 2VTJA 4GFGA 4UBAA 3W18A 2XB7A 4AZSA 4C0TA 1H01A 3R63A 4FL1A 1A9UA 4FIIA 4PPAA 4YNOA 4HW7A 4FV6A 3TUDA 4ZSJA 3HA8A 2W1CA 2ERKA 3BEGA 4XP2A 3Q6WA 1RDQE 2UW7A 4G2FA 5CEIA 3DJ7A 4X21A 2BVAA 4U41A 2QOCA 1PKGA 2E9UA 5IPJA 3Q4UA 1PXMA 1XJDA 4H3PA 4W4XA 5CVGA 3LMGA 4BDGA 3PA3A 4ZTLA 3VHEA 3MFRA 2OSCA 3WZEA 4LFIA 3LJ2A 3FMDA 4C33A 3FKLA 3M2WA 3DKOA 1P2AA 3CQEA 4TYHA 4EQMA 1ZYCA 3COHA 4KD1A 4TYEA 3QZGA 4DG3E 4GYIA 3VBQA 1APME 4O6LA 3HV3A 4YMJA 1JKSA 1U54B 4QTAA 4HZRA 4EK5A 2RF9A 3PY1A 4NJ3A 2O65A 4QP6A 3HX4A 4YTFA 4R7IA 3OG7A 4S32A 4CLIA 2NO3A 5CSWA 5FXRA 2WMVA 4FC0A 5JK3A 2EUFB 1NXKA 2JGZA 3AXWA 3PYYA 5K9IA 3EOCA 3KXXA 2BDWA 4WNPA 2PUUA 2WMBA 4RFZA 4D2WA 3QUDA 4IAYA 4TW9A 3PRFA 4V0GB 4AA5A 4AZFA 3KREA 4HGEA 2XJ1A 3N4UA 3N4VA 4YJNA 5T6KA 2O63A 2PMLX 2PUNA 4KIPA 4EOOA 2GPHA 3F6XA 2CGVA 3T8OA 3DTCA 2J9MA 4FTLA 4HCUA 5FEEA 4RC4A 1ZZ2A 2BZHB 5B2KA 4AN3A 1F5QA 2I1MA 4XLVA 1PY5A 1Q8TA 1STCE 4Y72A 4QPSA 3V5WA 1OITA 5GINE 1UV5A 3LFEA 5CNOA 1KOAA 2HYYA 3R7VA 3V01A 4MYGA 3U87A 3WARA 4DLIA 2I7QA 1H1PA 2GTMA 3IOPA 4IEBA 4F63A 1WMKA 2BZJA 1LEZA 2C3JA 4YC6A 1IA8A 1FMKA 3F3TA 4GUEA 5AV1A 1L8TA 4IE9A 3VN9A 4IB3A 3C0IA 4D4VA 4F0GA 3FLSA 2QOQA 3FMLA 3WILA 2UW0A 3W2QA 3NZ0A 2GTNA 3ZO4A 2H6DA 3E8CA 2XP2A 3GFWA 3ITZA 4I22A 1YHSA 4ASEA 4M12A 2YWPA 3GENA 1DAYA 1FPUA 3BLRA 4TT7A 4NW6A 3CBLA 4RFYA 3DPKA 1MRYA 1BX6A 3OWJA 3LCKA 3RNYA 4K2RA 1PXPA 3DAJA 4ZLZA 3CLYA 2Z7SA 2VN9A 4EWHA 4QD6A 3ZFMA 4A06A 4M68A 4OBOA 2WAJA 4DH1A 1RE8A 3R8ZA 3ZM4A 4JDIA 2J6MA 2W99B 3MFUA 3TT0A 4E26A 4FIGA 4UMUA 4KA3A 4OUCA 5KBQA 5F4NA 4EHEA 1W0XC 4O0YA 1V1KA 4ALWA 2W05A 2PZYA 4TXCA 4BIEA 5GJFA 4LQMA 3SC1A 4MBLA 2OIBA 3QCXA 1KV1A 4PDPA 4UWCA 3BZ3A 4Q5EA 1FQ1B 3UDBA 4FZ6A 2QOBA 3ANRA 2JKQA 4UMRA 3L9MA 1H27A 4J97A 4NK9A 3UODA 5EG3A 4X0MA 2OF2A 2VWIA 3ORPA 3COKA 1XH8A 4IMYA 3NVMB 3OP5A 4KABA 4F9BA 2XH5A 3UOHA 3KRXA 3SQQA 1UNHA 5EKOA 2BAJA 4HVSA 4C34A 3HVCA 5J7HA 4RZVA 4J96A 4UXQA 3R2BA 4QNAA 2WTJA 4JJRA 5CYIA 4IM2A 3W2PA 3G6HA 4BZNA 1UU3A 5A6OA 1GIHA 4YZ9A 1W7HA 3CY2A 2QU6A 3LXPA 2HELA 5AV3A 3ZLYA 3NYVA 3PP1A 4OTRA 2AYPA 3P79A 5E1SA 5CAVA 3K5VA 3P1AA 5KMLA 4E3CA 4HYSA 3KULB 3PFQA 4PF4A 3KY2A 2BALA 4KKEA 4DGOA 4DEHA 1YXUA 4Q9ZA 5BPYA 5K0XA 1ATPE 3GP0A 5C8MA 3EFJA 2FSMX 2ZMCA 3KU2A 4EJ7A 1W8CA 3VS5A 3VS4A 1JBPE 3LFBA 1PXKA 5AIRA 5FM2A 4DT9A 3LIJA 3TZ8A 4I6HA 2PPQA 5M55A 4XV9A 4YURA 4BYJA 2W4OA 5EW9A 5EM8A 4JX3A 4QMZA 4F70A 2FSOX 3PE1A 3EFLA 1FBNA 3BRBA 2FH9A 4NM7A 3DDPA 4RIXA 5KKRC 1JOWB 3P08A 3PA4A 5IH6A 3VBVA 3QYZA 4ITIA 5AAGA 3GU4A 2ZM4A 3QD3A 3QZIA 4GL9A 4D55A 1OL1A 4I6QA 1ZY4A 1P4OA 4TWPA 1W83A 4ZIMA 1OL2A 4CNHA 4M69A 5F9EA 5CQUA 4D1ZA 2UW6A 4FUYA 5CAOA 3FLQA 3S00A 3F88A 3WIGA 5KZ0A 1PXLA 3LPBA 3C7QA 2PUPA 4BCNA 3DBCA 3QTZA 4FKRA 3ACKA 4JQ7A 3MJ1A 4DH3A 2F2CB 4QYGA 3ZBXA 2PZ5A 5ICPA 3O23A 2XIXA 4F7NA 5DR2A 4EOSA 5AA9A 5HNIX 3D94A 4BI0A 1K9AA 2KULA 5CXZA 1FVRA 1J7UA 1E9HA 3BHVA 3Q52A 4IVBA 4FNWA 4BDJA 2YISA 4HCTA 4M7IA 4AU8A 2C0TA 4LGGA 4LOQA 5IQGA 5AM6A 2OKRA 1MQ4A 3C4WA 3EQHA 3BV3A 3QQGA 2QG5A 4G9CA 3NUUA 3VS7A 3HRBA 3E7OA 3CIKA 5L4QA 2GS7A 2Y4IC 1PF8A 2ZV9A 4CGAA 3F66A 3MVLA 4TYIA 2W4KA 2HAKA 5DOSA 4CYIA 5KKRB 2WKMA 5IA3A 2ONLA 2J5EA 1NT2A 3WF8A 2R7IA 3BIZA 5DYJA 3WZJA 4RT7A 4Y5QA 4OBPA 2B55A 3MSSA 3U9CA 3VUKA 1WVYA 5FGKA 4DTKA 2W5BA 1WVXA 5JQ5A 4GU6A 4CG8A 4IDVA 3QC9A 2YFXA 1QPCA 2YM7A 4GVJA 3KVXA 4NZWB 2CN5A 4DEEA 4ERWA 2WQOA 2VX1A 4YJPA 5FG8A 2CLXA 2VGOA 2VX0A 4IX3A 3D0EA 4F1TA 5AR7A 3CXWA 3F3VA 3PVGA 3RWPA 4FGRA 3PSBA 4BTFA 3KRWA 4OT5A 3CC6A 5TT7A 4I41A 3FL4A 4XMOA 4AT3A 3G6GA 4AXAA 4J53A 4CCBA 4F09A 2ITQA 4EH4A 4GK2A 4FL2A 4R5YA 1KOBA 1Y8YA
chains in the Genus database with same CATH superfamily
3DKGA 2OLCA 3UP7A 2VUWA 4O0UA 3TG1A 1J7IA 4QQTA 5CSHA 5LVPA 1BKXA 1JQHA 3KK9A 3KRRA 5M57A 1KE7A 3WF6A 5HVYA 3CGOA 2R3PA 5DWRA 4M67A 4CZUA 4HVIA 1CKIA 3A4OX 4DLJA 2Y4IB 2A1AB 2VWYA 4PTEA 4UXLA 2YN8A 3KRJA 4FTCA 3O50A 2GNJA 4GCJA 3FI8A 4H58A 3MW1A 4RIYB 2NNWB 4S2ZA 5IQDA 4L8MA 3R9RA 4NTTA 3FV8A 3LM5A 4YSMA 4LL5A 2JFMA 1OGYA 1XO2B 3MIYA 3U9NA 2IVUA 5L2SA 4O1OA 4I20A 5FXQA 2V55A 3I81A 3R2YA 1ZAOA 2F57A 5M51A 5ANKA 5BYYA 4KSPA 1E1VA 4L9IA 4HNIA 4RGJA 4WRGA 3R7YA 5HG9A 4WNMA 1CDKA 3W16A 5K4JA 4ENXA 3RCJA 5FTQA 5ACKA 5FTGA 4O0XA 3P5KA 3C9WA 4FF8A 3ZLSA 3FJQE 1ZYLA 3O17A 4BDIA 1YKRA 4PX6A 5M4FA 2X9EA 3G90X 3Q5ZA 3TUBA 3GOKA 3NYNA 4O4EA 4R1VA 3F2RA 3FLZA 1NA7A 1REKA 3QQLA 2R3OA 1V0BA 4QMUA 4UZHA 2HXQA 1Q8UA 3DBFA 4ZTNA 4EORA 4O7ZA 4G6NA 4QMVA 3T3UA 4AA0A 4ZZOA 4O4CA 5ANGA 2AEGA 3UIUA 4MHAA 5EH0A 1Y91A 3DBDA 5BUIA 5KMOA 3QYWA 3R83A 1XR1A 4UWBA 4O2ZA 4UX9A 5J95A 5DE2A 4KS8A 2QI8A 4APCA 4TYJA 4LV8A 2ZFYA 2R0UA 3EQPA 3PJCA 4DEGA 2BKZA 2UVZA 4H1MA 3UVPA 3V8SA 4FKOA 4N57A 3BHUA 1ZYDA 5EQYA 3GEQA 3HDMA 2UV2A 3HLLA 3A7HA 3WOWA 2PULA 4ANSA 3C4FA 1HCKA 3R8PA 4YJQA 3BKBA 4DHZA 3G33A 4JG6A 4JL9A 3THBA 4DGMA 4D58A 2XANA 4TWNA 1QPDA 3PTGA 3TKIA 2IJMA 2I0HA 4KBAA 4N6YA 4V0GA 3PA5A 3FUPA 3TXOA 4ORKA 3S2PA 4ACCA 3VJOA 4BF2A 3LCSA 4BYIA 3QCQA 3KRLA 2NRUA 5L2WA 3KN6A 3LHJA 1ZLTA 3IG7A 3IPHA 3DK6A 4QYHA 4YLLA 5CS6A 4C38A 5IMEA 2V5QA 3AD5A 3CSVA 4OTFA 2BIYA 2XNOA 3QUEA 3R7GA 4USDA 4YC3A 4QMTA 4F9AA 5HO7A 3LFFA 1F3MC 3MY5A 3QHRA 3FMKA 2PVRA 3ODYX 4KIKB 1QPJA 3PXRA 5E90A 5HLNA 5IEVA 5IH4A 2UZVA 4KUJA 4PDYA 3TKUA 4L00A 3HGKA 2WIPA 3GCUA 3I0QA 3C51A 3NNWA 4WSYA 3RAKA 5A54A 1UU8A 4DEAA 5HESA 2HENA 3OXTA 4P7EA 3TMOA 3RAIA 3LXLA 5CEMA 3Q9WA 3P7CA 2GNFA 2JC6A 2QOOA 2UW3A 3RBWA 4P4CA 2X0PA 3G15A 2WQEA 4W4YA 2UW4A 4D4SA 3EMGA 5HIDA 4BDBA 2RKUA 3BQCA 4FIJA 4FKSA 3UO5A 3GC9A 5I9WA 3OTVA 3UNZA 5AIKA 2XYNA 2HZIA 2WFYA 5HE3A 2R3KA 1HOWA 3H0ZA 3PY3A 4IXPA 4QNYA 4QP2A 4AXDA 3LFSA 5LMKC 2P2IA 4R3PA 5JZJA 3O8UA 4IADA 4FICA 3QRIA 3NCGA 5AR2A 3DQWA 4TN6A 4UYNA 5CQWA 2VTOA 3AKKA 5CENA 2QR7A 1GZ8A 1PYEA 2W1IA 4GYGA 4OTDA 4WG4A 2RFDA 5DLSA 4UN0C 4CXAA 4X6RA 3QQFA 2EXMA 5D1JA 2FO0A 5HD7A 3JY0A 4RJ4A 1LP4A 3CS9A 3W0OA 2VD5A 3O8PA 3F3ZA 3ORXA 4AFJA 2C6DA 5ETCA 5FP6A 4TWOA 4L42A 3IONA 4ALUA 5HBJA 3GC7A 4MQ1A 4EH6A 4FV1A 2HY81 3HMOA 4L68A 3VS3A 4CZTA 4JVGA 4ANOA 4X2FA 5ETIA 1VZOA 3MB6A 4U43A 4BVUA 3VRZA 1OL6A 4P2KA 4YNEA 5IZFA 3ZBFA 4IW0A 4DC2A 1OIRA 3OZ6A 4KKGA 4QYYA 4M0ZA 2PVNA 4GJ3A 4AA4A 3ZFXA 3AC5A 5J9YA 4K0YA 3ATSA 1XQZA 5M09A 3MPAA 4TY1A 3MGYA 3F2NA 5AM7A 1PYXA 2NRYA 2A19B 2W5HA 2OG8A 3H3CA 3Q53A 2C4GA 3F5UA 4O38A 3OCBA 3R8LA 3ZO2A 4EZ7A 3U51A 3D2KA 3GBZA 3F9NA 3OF0A 5LCKA 5BVEA 2WO6A 1GAGA 4GVAA 4JBQA 5KMKA 4OTHA 3FXXA 3DNDA 3R1SA 3O51A 4NT4A 4C3PA 2R3FA 3GVUA 1WBOA 5HG5A 3ZO1A 4FSNA 3QL8A 4PMMA 2B9FA 2B9JA 3UNKA 2J51A 3NPCA 5G1XA 4O21A 3SHEA 4EH5A 3D5UA 4J8MA 2ESMA 2XM9A 4FZ7A 4O2PA 4AOIA 1GIIA 3VBXA 2KTYA 1XH9A 2FSTX 3EN7A 2OICA 2X9FA 3LFQA 4IZ7A 4RZWA 4ITHA 4YR8A 5I4NA 2Y6OA 4FTNA 4NJDA 3BU3A 1JKTA 2XNMA 2F7ZE 4GG7A 1Z9XA 2VO0A 3LAUA 3R30A 4XBRA 3HV7A 4YTIA 4EOPA 3F69A 3UQGA 3KEXA 3QQUA 4RIXB 5JEBA 4MWHA 4DCAA 3DB6A 4EOQA 4O0TA 4P90A 5CEQA 3RHKA 2HY0A 5HO6A 4PQNA 2WU6A 2HK5A 2Q0NA 4I0SA 4V05A 4LYNA 4BKJA 2C6OA 5L6PA 4YHJA 5CF5A 4DCEA 1WVWA 3BLAA 3NAYA 5ETAA 4I4EA 3RJCA 2YDJA 2JBPA 2X4ZA 4XNEA 2NYAA 4IZYA 2ZAZA 1IA9A 4M69B 3D7TA 3N4TA 4GW8A 1H0WA 4M84A 3UZPA 3ID6C 2WQMA 2YAAA 3MESA 3W0QA 5IQFA 2WMRA 4V01A 5M53A 2PVLA 2PE0A 5E4HA 3CD8A 3FI2A 2A0CX 4FK6A 5IF1A 3H0YA 3RGFA 2C1BA 3IDPA 1H1WA 4EONA 2Y8OA 5DHJA 4EOIA 1A48A 3W0PA 3OT8A 4A9UA 4ZS4A 2C47A 3SRVB 1ZXEA 2HXLA 2W1FA 3P0MA 1XWSA 4U8ZA 3QBNA 5BVOA 5IUGA 1W84A 4D0WA 4E4XA 3FQHA 5JRQA 4F6WA 3OUKA 1R39A 1H4LA 3O71A 1SVHA 4CYJA 2QKWB 3JYAA 4O84A 3ANQA 3TUCA 3LOKA 3O96A 2W1EA 3UQCA 4F99A 2UZEA 2FVDA 5E1EA 5AUWA 1P14A 4YHFA 1JNKA 4FSMA 4QMLA 4XG2A 3W1FA 5A3XA 4C3RA 2OJGA 4BJJA 4FRFA 2IF8A 5M44A 3HV5A 4G3CA 1TVOA 1WBTA 2QNJA 4Z7GA 1QMZA 4HGTA 4JR3A 4OGRA 5GHVA 4EI4A 4F0IA 1TQIA 2X2MA 2NP8A 3JY9A 4A7CA 4UB7A 3A7JA 5HICA 1PXIA 3VS1A 4UV0A 1T45A 5HCYA 4F65A 3ML1A 4AZVA 3MDYA 2JDOA 4B4LA 2ZV2A 2FA2A 3A7FA 3IKAA 3KKVA 4DDGA 4RX8A 3VUIA 5CU6A 5HZNA 1IG1A 2PTKA 4MNFA 2G01A 3SXRA 5C8NA 1SYKA 4XX9A 2J0MB 3QQHA 4MF0A 4QP4A 5JMSA 4ZAUA 1YDTE 5J7BA 4A07A 2BZIB 5BVKA 3Q32A 3UJGA 5E92A 4GIIA 2YLEA 3O0GA 3PSDA 4IJ9A 4H36A 3ERKA 4L67A 5C1QB 5J79A 3ZEPA 1H0VA 3FPQA 1WBVA 4JRVA 2YJSA 4N0SA 2WQNA 1O6LA 1XH7A 4JAJA 5B2LA 2QU5A 4MBIA 1OMWA 5E8VA 4USEA 4M13A 3TN8A 2GMXA 4CT1A 5HTBA 4O7VA 4QP1A 2A2AA 2PVYA 4FODA 2QD9A 3DNEA 4ZTRA 2J0IA 3R1NA 4FNYA 2BKKA 3ZM9A 1U4DA 4I0TA 3CCNA 2X6EA 3DQXA 3FMJA 4FTMA 5AX9A 4GUBA 5EW8A 1PMVA 4NW5A 5A4EA 3HUBA 3AG9A 4FT3A 4V04A 2C6MA 2R0IA 4PDOA 5ACBC 3PJ8A 2C6LA 4DDIA 2QHMA 1SZMA 3NSZA 4RX9A 5AUZA 3NUSA 4NL0A 3FDNA 5IUHA 4PTGA 3NS9A 4FT0A 3IW5A 3ZSGA 2NPQA 4UMQA 4FEQA 4GJ2A 5FD2A 2JDVA 1CTPE 4CQEA 3OEFX 2IVVA 3R0TA 2I0YA 2OH4A 4ZEGA 4ENYA 4FKGA 3IS5A 1B39A 4QYEA 5H9BA 4EYJA 4DN5A 3ZRKA 4FTUA 1YXSA 3PIXA 4AGDA 1GJOA 3EQDA 5D11A 3UZTA 2C0IA 4NTSA 4APPA 3AT3A 3F2AA 4OAVB 4M0YA 3UO4A 2E2BA 5FP5A 2C6EA 3F3WA 4QMQA 1BL7A 3FMNA 2YA9A 4R6VA 1CSNA 2C5VA 5D12A 4O96A 3COIA 2H96A 3QLFA 3WYXA 2WQBA 3SW7A 3OWPA 5LQFA 3IK3A 4Q2AA 3QUPA 4TKSA 3ROYA 5M06A 3Q60A 3HP2A 5JSMA 3I5NA 3TIZA 4QTBA 5DH3A 4RVLA 1Q99A 3VF8A 4IX6A 3KVWA 2ITYA 3HMMA 4CD0A 5IH5A 3M11A 4OTGA 3CKWA 3A2CA 5CT0A 2PU8A 4EOMA 4WKQA 1YOLA 4FKLA 3F5XA 3FWQA 4CKIA 4I4FA 3LKMA 3QA0A 3BYOA 3R21A 2F4JA 4MF1A 2XNBA 3MI9A 2C5YA 2YJRA 1CM8A 2Y6MA 2C30A 4IB1A 3LXNA 3DLZA 4IWDA 3GNIB 3MH1A 5E8XA 3HEGA 3QKLA 2ZM3A 4PMSA 3BEAA 4E7WA 4U5JA 5IKWA 4L7FA 4BDAA 2JFLA 1YXVA 3REPA 2WIHA 4UMTA 2BTRA 4YO6A 4IBMA 4WA9A 4AW2A 4QP8A 4OTPA 5I5ZA 4ZMEA 5HCXA 3RPSA 5C8KA 2J4ZA 1BUHA 4K8AA 5IA0A 5J87A 3QZHA 2V7OA 4WUNA 4K11A 5ANJA 3AMYA 4KIQA 1TQMA 2ZB0A 5L6OA 3KCFA 4I23A 3BHTA 2CLQA 3EQGA 3OUNB 4E5AX 4BBEA 3DBEA 1KUTA 2YCSA 3QTQA 4KIKA 1SNXA 5ITAA 3TNWA 4BCMA 3CQWA 3OHTA 1AQ1A 4AP7A 2WMWA 3LQ3A 3KXNA 1Q3WA 1WBNA 2DYLA 4RFMA 4ZTSA 4TYGA 1YXXA 2VU3A 4HGSA 3GQIA 4JG8A 1KE5A 4ZK5A 4BBFA 4ZY5A 5HU3A 4C2WA 3ORLA 2BTSA 4ZTQA 2XAOA 4I24A 5M08A 5LJJA 3AGLA 4RWLA 3AC4A 2W1HA 4ZLYA 1JSTA 4GT3A 3QTSA 2V7AA 4F1OA 2PYWA 2W4JA 3K3JA 4QTCA 5AAFA 4FTTA 3NLBA 4JDHA 5KHWA 3BX5A 4AX8A 4W8DA 1VJYA 4PNKA 5J1WA 4CTCA 2VTPA 4K1BA 4EL9A 4NM0A 4JQ8A 4G17A 4EZ3A 3G2FA 4LG4A 3I4BA 2ZMDA 2UZDA 2Y0AA 3E8EA 4UY9A 2UVYA 3EKNA 3OY3A 5HNBA 4Z9LA 4F64A 2CGWA 4IZ5A 3PPZA 2YLFA 4AGUA 2PY3A 3D7ZA 4ONAA 2HZ4A 2IVTA 4GT5A 5EDRA 5AR5A 5I3OA 1XBAA 4BIDA 5JT2A 4DA5A 3BGZA 4I94A 3W32A 3UTOA 4WG3A 4BZOA 2X4FA 2OXXA 3QTRA 3P9JA 2VWWA 1JSVA 3QLGA 4EH7A 5DRBA 2YM8A 5C27A 5DA3A 2OU7A 4F9WA 3I5ZA 4GS6A 4IWPA 4A9RA 1B38A 3G9LX 4QOXA 3E88A 2ITVA 3PY0A 5JFVA 3O8TA 1OBGA 3TCPA 4AE6A 5I9YA 5CEKA 2OH0E 4BN1A 1GIJA 4Y83A 2XCKA 1LUFA 2BAQA 3R8VA 4ZS0A 4HVHA 3MN3A 5LOHA 1P4FA 3GQLA 4ACMA 4YP8A 5HORA 4YTHA 4FZFB 3PG3A 3VF9A 3TTJA 2BCJA 4B9DA 3VW8A 4H39A 3VUHA 5A6NA 1ERKA 3RK7A 3R01A 3BWFA 2XJ2A 5CAQA 2RSVA 2VX3A 5A4TA 1Q4LA 3BU5A 3ROCA 3QRJA 5A4CA 5HE2A 3LJ1A 4FI1A 3E3BX 3MA3A 4DFBA 2VO7A 4RBLA 3CD3A 3FLNC 4X2JA 4FK3A 3A61A 4B99A 4EOKA 5BUEA 1YI6A 2BR1A 3IECA 3P7AA 5DFPA 5E8WA 3QTUA 5LMKA 2ZB1A 5HLWA 2Q83A 3ZLXA 2C5OA 4NM3A 1H25A 2VO6A 4IWOA 3POOA 1S9IA 4BDEA 3CJFA 4FL3A 4DINA 2WELA 4Z3VA 2PE1A 4HVGA 3NW5A 3SX9A 2GNIA 2YDIA 4MQ2A 4YZBA 2Y9QA 1U5QA 3PFYA 3FYKX 3IW4A 2R3LA 4MH7A 2VTTA 2VWBA 2RFNA 4A4LA 5M56A 5HVJA 2IW9A 5B2MA 3II5A 1Q8YA 3OFMA 4OTWA 2OJIA 2XKFA 3FZSA 3MVHA 3TZMA 5AP4A 5EK7A 4JMQA 4P5QA 2GDOA 1ZOHA 3GCQA 4K9YA 4UYAA 5BV3A 2BMCA 3CTQA 5AP7A 2RL5A 4U3YA 3UE4A 3C0HA 2ETRA 3GUBA 4TWCA 4QT1A 4FV2A 4GSBA 4YGAA 3UYSA 2WMXA 3E92A 4G5JA 3DOGA 5AUXA 3CP9A 4DGLC 4C4GA 3S0OA 2GFSA 4FV3A 3WIKA 5ANDA 5BVDA 4CEGA 4NWMA 4RJ7A 3RPRA 3IQ7A 4E6AA 4IAKA 5CF6A 5J1VA 1XBCA 3BGQA 2GSFA 3ETAA 3E3PA 3ZO3A 4DBXA 3RMFA 1ZZLA 3EN5A 3KB7A 3L9PA 3PXZA 4RJ5A 4LL0A 4C59A 2WOUA 3E63A 3Q9XA 4C58A 4FSQA 4Y73A 3AOXA 5D10A 3D7TB 4IC7A 1KSWA 4FIEA 3O7LD 3DT1A 4GK4A 5K5XA 1NVQA 3EQFA 2O64A 2R5TA 4RIWB 4QDVA 5D41A 3SRVA 3RPOA 3MFTA 1PRYA 3UP2A 2XIYA 5HVKA 3TM0A 4ZP5A 4MXZA 4ACHA 4MAOA 2A4LA 3MWUA 3P4KA 1H00A 3O7LB 4JBVA 2C1AA 5EFQA 1JKLA 5LMAA 3UPZA 3OXZA 4PRJA 5DNRA 4D0XA 4X2NA 2B52A 1Q61A 5EHOA 4I5CA 4ID7A 1IRKA 4FZDB 3QCYA 5AR8A 3H30A 3S3IA 4QMNA 2W5AA 2XNEA 2W96B 2P0CA 1BLXA 3FC1X 2XUUA 3GGFA 4L53A 3RTPA 1MRVA 2C6KA 3NUPA 5HCZA 3TI1A 4FEWA 4HYUA 3NUNA 3RZBA 4J1RA 4PP9A 4LM5A 4ANLA 1GZOA 3Q2MA 2VTQA 1YXTA 4XV2A 3FI3A 3ZONA 4MXOA 5CU2A 2CDZA 2QOLA 3JVRA 4FV9A 3SVVA 2VAGA 4N4SA 3EYHA 3H9RA 1OL5A 2QODA 3VJNA 3EN6A 1EH4A 1Y6BA 2F2UA 3W33A 4LGHA 2YIYA 4EH8A 1QL6A 4AT5A 1OIUA 2YHVA 5IQCA 4ZTHA 2B0QA 3SKCA 2OIDA 2I0VA 5JZNA 1R0EA 4C3FA 5DPVA 3U4UA 4ASZA 3DS6A 3EZRA 1I09A 3A7IA 3BPRA 4FBXA 4IAFA 3V6SA 5CX9A 4MEDA 4NM5A 3ZUTA 4O7NA 2FB8A 3QD0A 4IB5A 4BGQA 1Q8ZA 4CMUA 2QO7A 3EN4A 2Z7RA 4KIOA 3LM0A 4BWKA 2B54A 2Q0BA 3QWKA 3V5TA 3I6WA 4QP3A 5LVOA 3VUTA 2WTCA 3BV2A 3KQ7A 4MWIA 3NDMA 2OF4A 2XK7A 1PXNA 5KE0A 3HAVA 2REIA 4B8MA 1IEPA 2BPMA 3RI1A 1WFCA 4DF3A 3LQ5A 2YIRA 3HKOA 3D14A 4LRMA 3U4WA 4BIBA 3ZZWA 4CMTA 2AQXA 4O86A 2JITA 1URWA 4GIHA 2VO3A 3WE4A 4MXAA 1YOJA 4CV9A 5BUJA 4AW5A 3ZYAA 3PJ1A 3ZOSA 2X7OA 4BCIA 5EHYA 1G8KA 4F7JA 4O7WA 4WBBB 4BDFA 4BDDA 3L9LA 3MVJA 3RWQA 4LGDA 4ANMA 1ZWSA 4QMOA 5KMIA 3BYMA 4J52A 5TKDA 3LLAA 3E64A 1JAMA 5CZHA 4PWNA 2XEZA 3VAPA 3WZUA 3ZDUA 1H28A 3MPTA 2BRGA 2QOFA 3Q9YA 5EYKA 5TO8A 4CV8A 5CF4A 5IQAA 4TPTA 2JIIA 3L9NA 5M4UA 4C4HA 1NVSA 3R7EA 1G8SA 4DFLA 4YTCA 2C3IB 4WO5A 1WBWA 3LMHA 3AC3A 3ZHPC 3QCSA 3WE8A 4ZMFA 4F6SA 2JIVA 4BR3A 3O2MA 3BHYA 2PK9A 2JAVA 3KC3A 3EIDA 1BMKA 3H4JA 4G34A 2C0OA 4XV3A 4YBKA 1CKPA 5EW3A 4GFOA 5HLPA 4L46A 4Y46A 5DT4A 3FKNA 3C13A 1OKYA 3R9DA 1OKVA 2EWAA 2XJ0A 4F7SA 1ZOGA 3E62A 2VWXA 4D5KA 3R7OA 4DH8A 2XIKA 5IA1A 1OZ1A 3AMBA 3F7ZA 3UC3A 5HX6A 4ZSEA 4DAWA 3ALOA 1ST0A 3LFDA 4IVAA 5F1ZA 4FEVA 2XEYA 5EI8A 3W2CA 1Q24A 3ZXZA 3OVVA 5L2IA 2BDFA 2XA4A 3MH0A 4RWIA 2P55A 3E8NA 3NIZA 4HGLA 4WOVA 5FBNC 3ZXTA 2B53A 4ACGA 2ITUA 1Z5MA 2PZRA 3BE9A 3DZQA 4LOPA 5FEDA 4X2KA 3CPBA 4BGHA 5I0BA 5IEXA 4C4FA 3B8RA 3W0MA 2RIOA 3I7BA 1VYZA 4PDSA 5B7VA 3CGFA 5L2QA 3QHWA 4FT7A 2JKKA 1Y6AA 3LMIA 3GU8A 3FY2A 4H1JA 1CKJA 3DZOA 2XIRA 2VTHA 4RJ6A 4GU9A 2FGIA 5KO1A 4IX4A 3R9HA 5LWNA 1XKKA 4CFWA 2BFYA 2W1ZA 3W8LA 5TE0A 3POZA 5D7VA 3ZU7A 2X7GA 2XM8A 3CY3A 4PPCA 4QQCA 2R7BA 4YZNA 1NW1A 2PMOX 3FZOA 5HE1A 1OIYA 3FMMA 2YDKA 5GJDA 1G3NA 3MV5A 5ANOA 3FQEA 2YITA 4WSQA 2AUHA 4M3QA 3OOGA 4ERKA 2VRXA 3PLSA 4AW1A 4LDTA 3TDVA 4IJPA 2RGPA 4LUEA 3QD4A 3AMAA 4LV5A 2UW5A 3DK7A 1JWHA 3FZ1A 1U5RA 5JGBA 3ULZA 3Q2JA 4BCOA 4E93A 3OW4A 4R7BA 4DGGA 4LRJA 5FRIA 4U3ZA 3HAMA 3DAEA 3QAME 3DFAA 2XZSA 4MBJA 4MK0A 4FT5A 4G3FA 4RC3A 4DFYA 2GNLA 1H07A 4HYHA 5CSPA 4FTQA 2CKQA 3TNIA 3FZTA 4M14A 3C5IA 3LLTA 3A8WA 4FV4A 2P4IA 4PNIA 4C2VA 4MUQA 4R78A 2I40A 1GZNA 4FKIA 4O0SA 4RLKA 4ARKA 3HMPA 4AZWA 5T68A 2ITWA 4RIOA 3NUXA 3K5UA 4HYIA 3AC2A 4L52A 4I6FA 4O22A 4JIAA 4PL3A 5FXSA 4QYFA 3SXSA 4QDEA 1BI8A 5JRSA 4C7TA 5ETFA 5H8EA 3TEIA 4FGBA 2JBOA 3UPXA 5GJGA 3ZDIA 4EOJA 5BNJA 5CALA 3VQHA 4F78A 4O6EA 3CQUA 4U81A 2P33A 3RVGA 3QA8A 4O7SA 1A06A 3BLHA 3QGWA 4F0FA 2YERA 2IW8A 2W06A 2YZLA 1MP8A 3NAXA 5KX8A 4PV0A 3I6UA 3EQRA 5AP6A 5AV0A 3TNHA 1G8JA 2GNGA 5DN3A 2WMAA 3UZRA 4AE9A 3FL5A 5J9ZA 4X3FC 4OT6A 1OECA 4EHGA 3C4ZA 3VVHA 1DS5A 3TZ9A 3ULIA 3U8WA 5KBRA 1SVEA 5CU4A 2IZTA 2Z02A 5DBXA 2BHEA 4FMQA 3P86A 1PXJA 2XNGA 4FSTA 2F7XE 2UZLA 2YM6A 1ZARA 2CGUA 3MS9A 4DEBA 4J7BA 4XUFA 2ETMA 4DITA 4FV5A 5CSVA 1SMHA 2ZDUA 3A60A 4F7LA 3BWJA 1XH5A 1H24A 5LVNA 2B9HA 3TNQB 3V3VA 4CFUA 4IWQA 3PVUA 4EH2A 2XALA 4XLIA 3MA6A 3IOKA 4IIRA 1GZKA 3FYJX 3ZSHA 3MFSA 2O8YA 1Y8GA 2JKMA 3MB7A 4Y8DA 3AT4A 1W98A 5AP2A 3EQIA 3W10A 3W0NA 4C4IA 5AA8A 2VTLA 4YJSA 5H8GA 2ITZA 3V51A 2OJFE 2XCHA 3EL8A 1Q62A 4AGWA 2ZV8A 2QLQA 4FG8A 2W1GA 2BAKA 3PXKA 4TNDA 4X2GA 3BGPA 3MTLA 5FDXA 4HCVA 1OPJA 3MIAA 4OR5A 3VQUA 5GZAA 4OTQA 3MH3A 4X3JA 5LCJA 4O82A 2VV9A 2OXDA 3BYVA 3L8SA 4XG3A 3NNUA 1YWVA 4M15A 4QPMA 5HBHA 4KSQA 2R3MA 2WB8A 3ORIA 2IVSA 3KGAA 4X3FB 4RWKA 3F3UA 2GHMA 5DGZA 4G3DA 4CTBA 2XBJA 3TTIA 2DS1A 3GOPA 4BC6A 1SVGA 3D15A 3SOAA 2IW6A 3MBLA 4NSTA 5M07A 4O0VA 2C3LA 4USFA 3FI4A 3MPMA 3NMUF 4FKVA 4FSUA 3NCZA 5CLPA 4IM0A 3C4CA 4D9TA 3OROA 3U55A 1ZYJA 5F20A 4LRKA 4C35A 3DB8A 3OCTA 3SG8A 5J9LA 2O0UA 2WNTA 4NFNA 4MXCA 4FZAB 5DI1A 3SW4A 3ZCLA 5E8SA 4D2RA 5HEZA 5EYMA 4I3ZA 3UIBA 4DH5A 3AC8A 2YCQA 3OT3A 3PG1A 2W1DA 3AT2A 3AD4A 3H9OA 3WF7A 1GY3A 1V0PA 4QMYA 4KB8A 3EYGA 1WBSA 5C9CA 2E9VA 4RX5A 2YWVA 4E6QA 3PP0A 5FDPA 3PIYA 4RIWA 4XRLA 3FC2A 3N51A 3CE3A 4GV1A 3W55A 1KE6A 2X0QA 2WXVA 1JPAA 4KINA 4MTAA 4ZXTA 4AF3A 5CANA 2ZDTA 3BCEA 1ST4A 3PXFA 1O6YA 1ZY5A 2R64A 2VNYA 2G2HA 5CY3A 5CU3A 2R2PA 5IUIA 3AQVA 3PZEA 4FUXA 2EB2A 3A7GA 4AS0A 3ZC6A 4NIFA 4GEOA 4UEUA 1MUOA 2GHLA 4C37A 4L6QA 2WOTA 2XKEA 2PSQA 3JXWA 5EYDA 3ZZEA 2H8HA 3EH9A 3QRUA 4L7SA 2VZ6A 4RSSA 4FT9A 3EWHA 4PL5A 3QTXA 3ZRMA 4P5ZA 4EQUA 1W2FA 3PXQA 4ZZMA 4CKJA 3PVWA 3ORKA 4QP7A 4QPAA 1YWNA 4HJOA 4CZYB 5JGDA 2ETKA 3UOLA 3QXPA 3O5AA 3C4XA 5AMNA 2FSLX 4JNWA 3L8PA 1PXOA 2OZOA 4EK3A 3RINA 3RPYA 1B6CB 3QX4A 2XK6A 4YZDA 3PPJA 3TACA 4DE4A 3VS0A 4F4PA 1J91A 2H34A 3RK9A 3W2OA 5EQEA 4TL0A 2R4BA 3NUAA 4CFFA 2Z2WA 2R3HA 3IGOA 2IZSA 3HMIA 4LUDA 2GQGA 1LEWA 2X8EA 3ENMA 3LFNA 4LMNA 4G6LA 2EXCX 3Q4CA 5AR3A 4RVMA 3NYXA 3AD6A 4TRLA 5IA4A 3PDTA 3SGCA 2VTNA 4JR7A 4EQCA 5EI6A 4BDKA 3RM7A 4I5PA 4E4LA 3EFWA 4O0WA 5IDNA 5AP1A 2JAMA 5H3QA 4B7TA 4OBQA 2UZOA 5K0KA 4PY1A 4NKSA 4GH2A 1UVRA 2BUJA 4WUAA 3VIDA 3SOCA 4DTBA 4MKCA 5GZ9A 2IO6A 4A4XA