1MRYA

Crystal structure of an inactive akt2 kinase domain
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
295
structure length
270
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an inactive akt2 kinase domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords RAC-beta serine/threonine kinase
total genus 74
structure length 270
sequence length 295
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1mryA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1mryA02
5CF6A 3R8LA 4DLJA 2WU6A 4YNOA 3EQCA 3KGAA 3NGAA 3QYWA 4PTGA 4EORA 2FYSA 3NIEA 4DFLA 2ZDTA 4JIAA 4UBAA 1FINA 2V7OA 2BR1A 2G1TA 4UB7A 4EJNA 4DE4A 4EHGA 5KKRB 2OIDA 5AUUA 5LOHA 2ITWA 2R3FA 4C62A 1RQQA 3QC9A 2HY0A 4CRLA 5AAEA 2GNJA 3PXZA 4APCA 5GNKA 3UIXA 3PLSA 5JGDA 4IAIA 5IUIA 3ZO1A 3ZRLA 4BKZA 4DGNA 4FEVA 3ACJA 2FUMA 2I6LA 4FTUA 1KUTA 2FVDA 2CN5A 4FG7A 5IQGA 4QYEA 5L2WA 3BGQA 3KRLA 1VEBA 4FTIA 3V6RA 1OVEA 4W4WA 1KSWA 3OWPA 5E8VA 4RC4A 4TWPA 3SC1A 3OXZA 3UIBA 4GFGA 5A4CA 2FGIA 1UNLA 3CPCA 2BAJA 3Q32A 5EDPA 3OOMA 5J9LA 2OXDA 4L46A 4I0RA 4LV8A 4HZSA 4AX8A 3PPZA 4WBOA 5BVOA 2B9JA 2F57A 2PVKA 3AMYA 3A7HA 4YNEA 4USFA 3BEGA 1J91A 4RJ5A 3VUHA 4PNKA 3RNYA 2OO8X 4ZS0A 1OL2A 4AQCA 4RFZA 3Q9WA 4UEUA 4RX9A 2PL0A 3QZGA 4H1MA 4RRVA 3WF8A 2I7QA 5A4TA 3Q5IA 3UPXA 3LMIA 3DJ6A 5LCJA 2CPKE 4DG0E 3UGCA 5BQ0A 2WGJA 1SVHA 4GSBA 2W17A 3MFUA 4Y85A 1XQZA 4QYHA 2EB2A 1WBPA 3AD4A 2QOLA 2XF0A 3FUPA 4JQEA 4FOBA 2UZOA 4QNAA 5ANIA 2QOCA 4J8MA 3REPA 2Z2WA 2XM8A 5E8XA 4CZYB 4Z55A 1CKJA 4JXFA 4D5KA 1UNGA 2IZUA 2CNVA 2XK8A 3LXLA 4KRDA 4GFMA 3UO6A 5L6OA 3P9JA 4CQGA 3QZHA 3DZQA 4G3DA 3R8VA 2JIIA 4HVDA 3ZHPC 5HNIX 1V0OA 4FR4A 2HWOA 3MH1A 2YWPA 2ITUA 3PRIA 4P4CA 1M2RA 1BKXA 4FTNA 2WU7A 4E6QA 3DLSA 5J1WA 3EQBA 3FLYA 4L43A 3W33A 5HVKA 4HVIA 3QLFA 3KXGA 2NRUA 4WBBB 3PJ1A 4FZDB 4MKCA 4OTIA 4F09A 2WTVA 4RIYA 4YLJA 4ITHA 4YSMA 4DLIA 3TZ8A 3HV5A 1K2PA 2PMIA 2WZJA 4OTRA 2C0IA 3V5TA 1Q8TA 4UMUA 2YABA 4G2FA 3B8QA 3FMLA 3MA6A 4C4JA 2H8HA 1B39A 2IW8A 3EN4A 3ODZX 2W0JA 3KN6A 4FTKA 5CVFA 3MY0A 3R9RA 4EBWA 1P2AA 3QA8A 4G3GA 4F9WA 2X81A 3AOXA 4RG0A 3UIUA 5C8NA 3MB7A 3FZRA 2W1GA 2YITA 4PWNA 4RZVA 2ITXA 5HHWA 4ASXA 3QC4A 1J1BA 4NW5A 5GJDA 3BZ3A 4PRJA 1M2QA 4DEHA 4CCBA 3DBDA 2BALA 3UOKA 3MIAA 3HECA 4EJ7A 4C57A 3N4VA 4O7VA 4QRCA 4USDA 3M42A 4IAZA 2J0IA 3CEKA 1M7QA 4S33A 2XEYA 2QU6A 5AV1A 3FMMA 3FMNA 4IFCA 5F20A 4QMLA 3DOGA 3DAEA 3IKAA 4CFWA 4BN1A 2OICA 4FV4A 4G9CA 3TJDA 4HYUA 4FKTA 3UTOA 3O50A 4W4VA 4IB1A 5HX6A 5CX9A 3O2MA 4NWMA 4RZWA 5DH3A 4D55A 2GNGA 5E1SA 3SVVA 4KIKB 5BYLA 2NP8A 2W4JA 3PE2A 4AA5A 3DGKA 5CEOA 3KK8A 3OCGA 4F0IA 4P2KA 5HORA 4YZDA 3HDMA 1SM2A 1Y91A 2ZMDA 2IO6A 1PXNA 4JDIA 4FZAB 5IUHA 3KXHA 5CZHA 4YC6A 1PXKA 2BZJA 4TYIA 2YEXA 5J95A 2IG7A 3LM5A 4O22A 4DH8A 3Q9YA 1FQ1B 4ACMA 4CFNA 4IWOA 2PU8A 1YDSE 2UW5A 5FM3A 3DT1A 3EQHA 2Y7JA 3ZXTA 4RWKA 5J5SA 2WQMA 4NKAA 5DOSA 3R22A 4A9SA 1O6YA 2BVAA 4KABA 3CLYA 3LXKA 3OXTA 3VBXA 4BZNA 4E73A 1ZWSA 1RW8A 4PDYA 2R3MA 2RG6A 3KXXA 4RQKA 5HNGA 4JDJA 2I0YA 2HENA 4DT8A 2Q0NA 5E90A 3KXNA 3QRUA 4MNFA 4W4XA 3MIYA 2J9MA 1OL5A 1UU8A 3EYHA 3QALE 4OT6A 4C33A 2X4FA 4HOKA 5A4EA 4QMPA 3PXFA 3MBLA 1LEWA 3F3TA 5EQYA 1OUKA 3R04A 4Y8DA 4BHZA 4F9CA 2BZKB 1FOTA 4H1JA 4NM0A 5T68A 4CLIA 4CV8A 5K4JA 4XG7A 4O2ZA 1YVJA 3RCJA 4CZTA 3SG9A 2E9PA 5JT2A 4I20A 2YWVA 3BYOA 4CGAA 2X39A 4LL0A 1M17A 1ZAOA 4JX7A 3BI6A 2OFVA 5C9CA 3WZDA 4U80A 1OKWA 5AR5A 3UDBA 3KKVA 3RALA 1A48A 4IXPA 5LCKA 3LOKA 4HVGA 3KK9A 3Q96A 4FT5A 4D2TA 2J7TA 4F7JA 5M4UA 4O7LA 4JG6A 3HRBA 4WNKA 1H1PA 2YJSA 5HE0A 3NRMA 1ATPE 3OXIA 2QOQA 4XG3A 3TXOA 4XNEA 5D41A 4D28A 5HX8A 3K2LA 2WB8A 4PY1A 4TWCA 2F9GA 3P7CA 3FWQA 4PP7A 3VQHA 4LYNA 3RVGA 4F70A 2OIQA 3CC6A 3BHUA 3LFQA 4QP1A 5KMMA 3B8RA 3JVSA 4BCNA 5LMKC 3F2NA 3BRBA 5DG5A 5F4NA 2YDIA 1GZNA 3FLSA 4D2RA 2UUEA 5CENA 5JMSA 2C5NA 2YJRA 4YHJA 4DH1A 3WF5A 4YTFA 1UV5A 2GHMA 1R3CA 4LI5A 4XG8A 4F9AA 5AM7A 2VGPA 2XVDA 2V62A 4QO9A 5IQHA 4PX6A 4N6YA 1XH9A 5AX3A 4FV7A 4V0GA 2OJGA 5CF4A 2HWPA 3DFAA 1R0PA 3OMVA 3HKOA 4NIFB 2ZV7A 1P14A 2JIUA 3PJ3A 4GG5A 4GUBA 4IX5A 4QMYA 4RJ6A 4X0MA 4JAIA 4FVQA 1LPUA 4R1YA 1VZOA 1WBOA 2PVYA 3HMPA 4RX7A 5EOLA 2C6OA 4JDKA 3OCSA 4HYHA 5DE2A 3L9PA 4FKSA 2BDWA 3OC1A 3SGCA 3WARA 1DI8A 1PXJA 4OTGA 5HI2A 3DY7A 5BNJA 4K8AA 3C7QA 2WO6A 3QL8A 4GRBA 3C4EA 2HELA 4IFGA 5ANKA 5EI6A 3ZLYA 4UY9A 4FEXA 5IDPA 3HGKA 3TV7A 3R7GA 4BDBA 2XIXA 4PL4A 3ZDUA 4ZTMA 4R78A 4ONAA 4CFXA 4XP0A 3GU8A 4DGLC 2ZM3A 3EN5A 2XYNA 4L7SA 3UG1A 4EH4A 2WMSA 4DH5A 3QTWA 2HY81 1G8AA 3F3UA 4AA0A 5B0XA 2J51A 4IVAA 4PTCA 2ITZA 4YGAA 5E9EA 3MESA 3RM7A 4PTEA 4WSQA 5CAUA 3NUPA 3NAXA 4K33A 5CXZA 1I44A 3ZRKA 2CDZA 3IK3A 2R2PA 3C4ZA 3IOPA 1ZRZA 2BRBA 5L2SA 1E1XA 4EWQA 2GNHA 4G31A 2XK3A 3B2TA 4DT9A 3S4QA 3PWYA 4BHNA 3LFFA 1SNXA 2VNWA 3QWKA 3C51A 4GU6A 2BIKB 4IAAA 3ZMMA 3MH3A 2GS7A 5EI2A 1DAWA 4YC8A 4GEOA 2FSOX 2JKOA 1QMZA 3F3ZA 4K18A 3OW3A 4DBNA 4IX6A 1GOLA 3NYOA 5HD4A 2WIPA 4K11A 1ZLTA 4USEA 2PMOX 1WCCA 3QYZA 4IZAA 3VHEA 2WMRA 4F08A 4R7HA 4U97A 4IW0A 3ZEPA 1ZYJA 2OFUA 5AX9A 4IE9A 1DM2A 2CKPA 4U81A 2XJ2A 2O63A 2VTMA 3TTIA 3WIKA 4QQTA 3WE8A 3TG1A 3I6UA 3FE3A 4I41A 4FIFA 4EKLA 4NJ3A 3ZO2A 3GFEA 5FQDC 2JIVA 3O0GA 1H07A 3NPCA 4NU1A 4MHAA 3VNTA 3C9WA 4R5YA 3WI6A 3FV8A 3BQRA 5BVNA 2FSTX 2O65A 5DVRA 4ZTQA 1YI6A 3HX4A 4C7TA 2YAKA 5HIDA 5M4CA 4RFMA 2WMXA 3K5VA 3VS5A 3OVVA 4QYYA 3OFMA 4D5HA 4FV9A 5GJFA 2V5QA 4L6QA 2YACA 2X7GA 3ZBXA 1REJA 2XNOA 3NNUA 4CD0A 4IVBA 4BDAA 2BDFA 3LQ5A 1Z9XA 3LPBA 4G1WA 1R1WA 2Z7LA 1HCLA 4BWXA 2PPQA 3QQKA 4FTJA 3SOAA 1WZYA 5M09A 4L01A 4ZJJA 4LV5A 4BCPA 3CBLA 4F0GA 2QURA 4M7IA 3PA5A 5LWNA 5L4QA 3OG7A 4UWYA 3PZEA 4JRNA 2YM8A 2Z60A 4JQ7A 2XK7A 2YERA 1CSNA 5LJJA 2XK4A 4FKJA 1APME 4FKWA 3MV5A 3PDTA 1OI9A 2I0HA 4IBMA 2RFNA 3RHXA 1PXPA 1B6CB 3CY2A 4U44A 3W18A 2G2HA 3PPJA 3GOPA 4L53A 2XIYA 3PXKA 5AEPA 5JFSA 4EHZA 1W0XC 4A06A 4FSUA 4ZZOA 4PMTA 4DF3A 3ZS5A 2C5XA 2VTQA 2G01A 4NFMA 4FKUA 2R3OA 2FA2A 2B9HA 2PK9A 3NNXA 4CFFA 4TN6A 1WVYA 4Y95A 3UZTA 3IO7A 1LR4A 4KSPA 3RPSA 3ETAA 4D4RA 1Q8ZA 4FK6A 4KB8A 3BWJA 4MEDA 3LJ1A 4WRSA 4EUUA 2YFXA 5JQ8A 3UZRA 1KE8A 2PVMA 3CS9A 4FSZA 3Q3BA 3PE1A 4QD6A 3PXQA 2ITPA 4GU9A 4JR7A 5CYIA 4ASEA 4EOOA 1BI7A 3BELA 3P86A 4R7IA 4AG8A 4TWOA 2C6MA 3R7IA 3EYGA 2O5KA 4FZ6A 5AAGA 1BX6A 4BIBA 4PDSA 5BYYA 3JY9A 5D10A 5AR8A 1OMWA 3ODYX 4CCUA 3F66A 2NO3A 4RIWB 4QYGA 3D7TB 5CQUA 4ZK5A 4APPA 4HW7A 5LQFA 2OG8A 4TTHB 4IX4A 4WO5A 1MUOA 1J7LA 3LVPA 4XOYA 3VUMA 2UZBA 4PL3A 3SW4A 4KBAA 5J9YA 3R73A 2WQEA 4FTOA 4LFIA 1W83A 4IZ5A 3RAKA 3DKGA 3TL8A 4ZXTA 4AUAA 4LMNA 4CMUA 2A19B 1IEPA 2J0KA 4UMTA 3ULZA 1Q61A 2X9FA 3TZ7A 3Q4CA 3T9IA 2FH9A 3A2CA 2BRMA 4DAWA 4QP4A 4DGMA 5L2TA 3DDPA 5AP5A 3HV4A 4QP2A 4FSMA 3SOCA 4EYJA 3NWWA 3DXPA 2QONA 2WEVA 2WEIA 2PVRA 1VR2A 4JG7A 5IG1A 3OHTA 5A9UA 3VBWA 5DIAA 2BPMA 4BGGA 3HEGA 2UZVA 2YAAA 3GC7A 4I0TA 2XNPA 4AOJA 3NUXA 3P0MA 5IH5A 4ANLA 2J90A 4RWJA 2JFMA 4MCVA 3H30A 4C34A 5ITAA 4O83A 3TM0A 1O9UA 2PYWA 5AV0A 5IMXA 1J7UA 4H05A 3QQJA 5HG5A 4F9YA 5HQ0A 4ZZNA 4I4FA 4IVCA 3RJCA 4BCQA 3ZO4A 5EM6A 4ZEGA 4AS0A 3BX5A 4EOJA 1IAHA 2YM3A 1J7IA 2W4KA 5CVGA 4L44A 2W1EA 4BZOA 3FKOA 3DZOA 3G9NA 4BBEA 4RIXA 3CKXA 1Q41A 3NCGA 4FT9A 4GK3A 4LRJA 5EYDA 5A46A 4WSYA 3ENHA 4OTHA 4A9RA 4MK0A 4FTTA 5DHJA 2W05A 5ACBC 5EHOA 3ZZWA 4NL0A 3LXNA 4TYHA 3MFTA 3MFRA 4EHVA 4O2PA 3U6HA 3ZDIA 4FIGA 5B2MA 2HCKA 1ZARA 4AW1A 4BYJA 5CT0A 2VX1A 1JVPP 3V51A 3T3UA 2CGWA 5AUVA 1ZY4A 3E5AA 3MPMA 4O6LA 3F2AA 3MVMA 3UC3A 3NLBA 3RMFA 4Z3VA 4BGQA 4D1ZA 5HBEA 2B9FA 3EKKA 4P5QA 2OXXA 4BRXA 4BKYA 2ESMA 1LP4A 3TKIA 1GNGA 3LFSA 4DCEA 1JSUA 3NR9A 3DJ5A 3DA6A 2J0MB 3BU6A 5JEBA 5HE2A 1E9HA 4IM0A 3QFVA 4F4PA 5IZFA 4YJRA 4AACA 2XKDA 3LJ0A 2B54A 2R7BA 2CKQA 3CQEA 3L8XA 5FTQA 2XKCA 4M84A 2EXMA 4YZMA 5CWZA 4FEQA 4BCOA 4CKJA 3U87A 4A9YA 5J1VA 5EDQA 1E1VA 3OT8A 3VRZA 5BX0A 2ZM1A 2VTJA 3CJFA 1B38A 4JT3A 4MX9A 3VS3A 4AZEA 4D2PA 1YWVA 4NM3A 5KBQA 3WZUA 4I6QA 2GNLA 2XZSA 2ZM4A 3I5ZA 3R7OA 4ERKA 1Q99A 4K2RA 2UV2A 2HXLA 3UQFA 1OBGA 2VGOA 2R3HA 1L8TA 4IM3A 4N6ZA 3ZSIA 3NAYA 2W06A 4I92A 3TV6A 4ASZA 3GB2A 3SG8A 3ORPA 3ITZA 3AG9A 3ZSGA 4ZJVA 5BVFA 4MWIA 4PL5A 3L1SA 5DR6A 4OAVB 3EWHA 2R7IA 5EW3A 4EQCA 3E8DA 4YR8A 2OJ9A 2VO7A 3VUGA 4U41A 4QP7A 2QO7A 5CNNA 2QLUA 4A4XA 5ANEA 2C4GA 3LHJA 3TACA 2ETMA 4PUZA 3BV3A 2DYLA 3F88A 4F1OA 2CN8A 1H1SA 1PJKA 3DNDA 5LVPA 3A8WA 2RL5A 5KMNA 4CZUA 4FKOA 2Z7SA 3ZLWA 3FJQE 4IEBA 5G6VA 2OKRA 4O0YA 5DPVA 2A1AB 3F3VA 3OEFX 5M56A 4U3YA 3C4FA 5LARA 2WQOA 3BKBA 1MRVA 2O3PA 2HAKA 4JBQA 4YP8A 2WNTA 3R8UA 4QOXA 5AWMA 3HUCA 4M97A 3I1AA 2IVUA 3CTQA 3HUBA 1XR1A 4FL1A 3DJ7A 3HP5A 2X8DA 2ZB1A 3WF9A 4L3PA 2J0JA 4C2WA 3Q9XA 4Q2AA 4Y5HA 2BAKA 2ITQA 5A4QA 4U42A 2XJ1A 4GFOA 5HG8A 5EYCA 2R3QA 5C27A 4C8BA 3U6JA 5ETIA 4UXLA 3IS5A 4BR3A 2GQRA 4BTKA 2BTRA 2YCRA 3FKLA 1GIIA 1P4FA 5BVWA 4BZDA 1OL6A 5I9UA 3FSKA 2VZ6A 3I81A 3QTSA 5BVKA 4BC6A 3VS4A 1YKRA 1Y8YA 2AYPA 5F9EA 2EXEA 2VV9A 3I6WA 4YSJA 3PG3A 5E7RA 3WZJA 3PY3A 2PE0A 4FKRA 4X2FA 2R3LA 4G9RA 5AP6A 1R78A 4WNPA 4EC9A 2Y4IC 2OBJA 2YZAA 3O71A 3VS6A 5JKGA 3SDJA 5HE1A 1WMKA 3IPHA 3QD0A 1ZYLA 5ANDA 4I1ZA 2XNMA 3GVUA 3EQRA 3G2FA 4GJ2A 5D9HA 4UX9A 2QODA 5LVMA 3DQXA 5GIPE 3BE2A 4AT4A 3KY2A 3MJ2A 4NH1A 3G15A 5CNOA 1H4LA 1Y57A 2C68A 3HYHA 4XBUA 5GZ8A 5T3QA 4S31A 4XHKB 1QPEA 5CAOA 2O64A 4QMXA 4WIHA 2I0VA 5CXHA 3R2BA 4I4EA 3GNIB 4FT7A 4FV8A 4QP3A 3UOHA 2BCJA 4ZP5A 4B6LA 5TKDA 4FG9A 2PMLX 4NIFA 5E8SA 2X1NA 5DRBA 2R3PA 1FPUA 4EUTA 4FIHA 3CD3A 2BRNA 3PP0A 4CT1A 2JBPA 1V1KA 1XBCA 2RKUA 2F2UA 4NW6A 4WG4A 3SQQA 4D9TA 1WVWA 1H25A 3MVHA 5K5NA 2CCHA 2QG5A 3AT4A 2PE1A 4X2NA 4TY1A 4YJPA 4C2VA 2UZDA 3N4UA 3H9FA 4QMQA 4BCHA 5EDRA 5L6WL 4JL9A 3DK3A 3A62A 3TNWA 4X3FB 3ZEWA 4M12A 4BWKA 3RCDA 4RJ8A 5DRDA 3EJ1A 2KULA 3FYJX 5IEXA 1XWSA 4S32A 2GQGA 2EUFB 1PHKA 4UWBA 3IONA 3QTZA 4F7LA 1OIUA 1OPJA 1H28A 1ZY5A 2OF2A 2W1FA 4X2KA 2ZDUA 2CCIA 3PUPA 4H39A 4JVGA 2EWAA 3NZ0A 4R5SA 3VW6A 1F3MC 3G51A 4ZJIA 1NVSA 3PSBA 4U6RA 1PW2A 4F65A 5CSXA 4KIOA 4F1TA 4FC0A 3D9VA 3R9NA 3A8XA 3W2RA 1YW2A 2OZOA 4RVKA 5BPYA 4R3CA 4X6RA 3FHRA 3KA0A 4PF4A 3RPRA 3RGFA 2XH5A 4BDIA 4IJ9A 4MNEB 3RZBA 4AGDA 1URCA 3BIZA 3HMIA 2UW8A 2VWIA 3MH2A 4BDFA 1YHWA 4C3FA 2I40A 4FV5A 4G17A 5ANJA 3PVGA 4DG3E 2W1ZA 3I7CA 4O84A 4QTDA 3TUDA 3CTJA 2B9IA 3AC5A 5E91A 2HW7A 1YOLA 3BYVA 5HE3A 4TYGA 3R83A 3LKMA 1R39A 2IN6A 3QLGA 4L7FA 3F7ZA 4RA5A 5KNJA 1Y8GA 1J1CA 3MA3A 4O91A 5EHYA 4DGOA 4XV1A 2VTNA 4IWDA 1PXMA 1OIQA 3AQVA 1OGUA 3OWJA 3W32A 5J5TA 4DFBA 2YM7A 3MFSA 2WFYA 4WNOA 3W2PA 5K5XA 4XG4A 4GVAA 4EI4A 4IZ7A 4MXCA 4MBLA 2IW9A 5CF5A 5IA0A 3FZTA 5FXRA 4DITA 2GQSA 5LMBA 3UBDA 1J3HA 3EB0A 3GI3A 3SX9A 4AZVA 4F0FA 4EZ3A 2YISA 1YXSA 2VWBA 1K9AA 3JUHA 5J7BA 5CAVA 4NEUA 4WHZA 4IWPA 5KHXA 5I4NA 4AGUA 3R8PA 3EN6A 4EH6A 2Y6OA 2PTKA 3QQGA 1WBNA 2QLQA 3G6GA 4UWCA 2PZPA 2GS6A 5AR4A 4U0IA 5DT0A 5AUWA 4GJ3A 2R3GA 4KBCA 4C4EA 2J4ZA 3F61A 3Q6WA 3GU4A 3NNWA 4GIHA 3P7AA 4O21A 4EOSA 4A9TA 3W2OA 5H8EA 2CNQA 4UYNA 1M2PA 3CR0A 4AP7A 3R8MA 4FX3A 4KKEA 4L8MA 4OAUC 5AUTA 4BKJA 5AR2A 2BZIB 1NT2A 4GT4A 2G9XA 3PSDA 2OH0E 3GCPA 1WAKA 3HV7A 1ND4A 5AP0A 4BDGA 3M11A 4DEAA 4HVSA 2JDSA 4O7NA 1WVXA 4I6HA 1VYZA 4I6FA 4G3CA 3NYVA 4RPVA 4D4SA 3KMWA 2RGPA 2WELA 2QHNA 3GUBA 4FZFB 4M14A 3S2PA 3QZIA 4D4YA 5T6KA 2R64A 4DG2E 3TUCA 5HIBA 3Q9ZA 3BLRA 4KRCA 1OIRA 4FV6A 4O81A 1KWPA 3L9LA 1YXTA 1REKA 1KE9A 5KE0A 4AE6A 3BGPA 4V04A 3KCKA 4W9XA 1OITA 5CVHA 4HZRA 2VU3A 2W5BA 4HGLA 4O1OA 3UO4A 4XV2A 3TN8A 2QKWB 3LFCA 3VS2A 4ENXA 1G8SA 1T46A 5DNRA 5DLSA 3RAIA 4D2VA 3H9OA 5M06A 4W8DA 1YQJA 2V7AA 1TQPA 3LJ2A 2C3KA 1LEZA 3FMJA 4K1BA 4NSTA 3ZUUA 3LZBA 5KMOA 3S1HA 2YCSA 4U3ZA 3LQ8A 3UODA 3DFCB 4G3FA 3SHEA 3R01A 5KHWA 3EFJA 3FDNA 4TPTA 4WG5A 2R5TA 2Y4PA 4MQ1A 2B55A 5HICA 4RIYB 5IISA 3O8UA 5AA8A 4CV9A 2ITTA 4MXZA 1OBDA 5CU3A 4I5CA 2OXYA 3UOJA 4EZ7A 4ALWA 4FTMA 2IVSA 4GL9A 4HGSA 3HAVA 1GY3A 4CKRA 3QUEA 3TKUA 2PULA 3MW1A 5EH0A 1W8CA 3N4TA 2GMXA 3IW7A 4J1RA 2AC3A 4JDHA 2YA9A 2W9FB 4R3RA 4YJUA 4GH2A 3H3CA 5D7VA 5FP5A 1MP8A 4BDEA 3CTHA 3NS9A 3D2KA 3C1XA 4I94A 5AJQA 4E5BA 3DLZA 4EOKA 2PVHA 3I0QA 2E9OA 4W4YA 3VVHA 5C26A 5I0BA 4O7RA 1H24A 4CMTA 3II5A 2RG5A 4Q9SA 3RI1A 2WQNA 3ACKA 3MGYA 4U79A 2QO9A 3FBVA 3CY3A 3R2YA 3PIZA 1P4OA 1TKIA 3NCZA 2XRWA 3FL5A 4ANBA 4CKIA 1URWA 4YZNA 4M0ZA 5A54A 3UP7A 4ZMEA 5E8TA 1JWHA 5JN2A 2QHMA 4HGTA 4O86A 1Z5MA 2C5VA 3VJOA 3S0OA 5DT4A 5I9XA 2R4BA 2XCHA 5CU2A 2YDJA 4JI9A 4O6EA 4WOVA 2R3RA 3Q5ZA 4PDOA 3DK7A 3BU5A 1H0WA 1YDTE 5HO6A 2BRGA 1OUYA 3QF9A 5CEKA 4IADA 4RX5A 3Q52A 4F9BA 4F99A 3JYAA 3D5VA 3P79A 4ZAUA 3UVQA 4QPMA 4IZYA 4FTCA 3NVMB 3GFWA 4BCJA 3A4OX 4NYEA 2QI8A 4E6DA 4HVHA 1CMKE 1XH8A 4RJ7A 4RLLA 4DFUA 4NJDA 5HBJA 5CAQA 5JFXA 4AT3A 5F94A 2IZTA 4OBOA 5HO8A 5AP7A 5IA5A 2WOUA 3WOWA 4BCMA 2VWWA 4KA3A 3D7TA 4R7BA 4ITJA 2UW7A 5EFQA 2PVFA 3MY5A 3A7FA 5AUYA 5FP6A 2HZIA 2IW6A 2WTDA 4CQEA 5HEZA 3D5WA 5CI7A 1F0QA 5M57A 3PA4A 4XLVA 1WBVA 5CF8A 4QYFA 3U6IA 3R1QA 5KO1A 1U54B 1OL1A 1UKHA 1UWHA 1QPJA 2GDOA 4XBRA 5JZNA 3R7YA 3UJGA 1Q8WA 4O0XA 4XV9A 3VC4A 3QHWA 3G0FA 5E92A 4H3QA 4C38A 4FSRA 3RAHA 5IQAA 4FNXA 4EWHA 2ETRA 2XP2A 3KL8A 2C3JA 4EC8A 4IB0A 5EW8A 3E8EA 4EH2A 4O1PA 3L9NA 4R8QA 2W1DA 5JZJA 4I3ZA 1W7HA 3RWQA 1U5QA 5TOZA 4NK9A 3KULA 3JY0A 3P78A 3SRVA 3DBQA 1YI4A 3RPYA 4CSVA 2BDJA 2BHHA 1MQ4A 2BROA 4CVAA 4RC2A 2GHGA 3Q04A 3UNZA 2P2IA 3PJCA 2F2CB 4F6SA 4YBKA 4BDJA 4L3JA 4Q5HA 4N0SA 4FSQA 4I6BA 4MD8E 4AN2A 5BVEA 5M08A 2C69A 4CTCA 1CKPA 1RE8A 4FKGA 3UPZA 4U5JA 3ATSA 2R9SA 4RJ3A 2EB3A 5ANOA 4QMWA 4EHEA 4OTPA 3GU5A 3RAWA 1UNHA 4G34A 4O7ZA 2PUPA 4ZLZA 1SZMA 4R1VA 2JLDA 3D0EA 3NYNA 4KKHA 4M15A 3VN9A 3DBEA 5J79A 2CLXA 4EK3A 3ENMA 3ORZA 4WUNA 3ALNA 4ALUA 4MF0A 3LM0A 1YI3A 5JGAA 2JITA 3SLSA 2CLQA 3IG7A 1V0BA 4IB5A 4LRMA 2OF4A 1IG1A 3DTCA 4FKLA 4W8EA 1GIHA 1A06A 3ZH8A 5EQPA 4EH3A 5I5ZA 4D4VA 3EN9A 4HJOA 5FWKK 1QPDA 1YRPA 3LXPA 5H3QA 2BRHA 4LRKA 3RPVA 3OWKA 3VBQA 4LM5A 1GZ8A 2XYUA 3QQLA 5IQFA 3H10A 2BFXA 4Y46A 4BL1A 4EK6A 2GU8A 2QQ7A 1XO2B 3C13A 3EHAA 2EVAA 4PDPA 4PP9A 1YWNA 4MD9E 3D7ZA 3BGZA 3V01A 1IA8A 1UU7A 4AZFA 3W10A 3ANRA 3OS3A 4O0UA 4O0WA 4CLJA 4FVPA 4QP8A 3IDCA 5AM6A 4GT5A 4DN5A 3QKMA 1JOWB 2R3JA 4FV3A 3W8LA 3UYSA 3M1SA 4I5PA 3U4UA 5HNBA 4YUQA 2P4IA 1IASA 5B2LA 4QQ5A 4E5AX 4Y72A 3V5WA 1BLXA 4MF1A 2HOGA 2WOTA 2VTAA 4YZBA 4B99A 2VWVA 3ELJA 4J71A 3F6XA 4F6WA 4J95A 4IWQA 4ACDA 3ATTA 3H4JA 4FKVA 4NTSA 4X21A 4HPTE 4YJNA 5EM7A 4ZTHA 3VIDA 3UNKA 5B7VA 3ORTA 4I23A 1YOMA 3DKFA 3TI1A 4AW5A 2VTLA 4FTQA 4OW8A 4FF8A 4IQ6A 4TYHB 2WMTA 4IANA 3TNPC 4XYFA 3V5LA 4ZY5A 4OT5A 3JR1A 2YN8A 3WYYA 4AWIA 2GSFA 3C0HA 4DHFA 4ZLYA 3I60A 2XKFA 4QTAA 4HCUA 1YHVA 5DFPA 5IA2A 4FEWA 4JLCA 2W5AA 1P5EA 4DINA 3E63A 3V8WA 5CEMA 1OPLA 4HGEA 3V3VA 4JAJA 1W98A 1A9UA 2E9VA 3GU7A 3O8TA 5CU0A 3THBA 3A60A 5IKWA 1KV2A 5AP2A 2C30A 4ACGA 5H2UA 3EZRA 4YBJA 4ZTSA 5JK3A 3HMNA 3QQUA 3FI3A 4HYSA 1OPKA 5F95A 3ORIA 1U5RA 1H27A 2BHEA 2JAMA 3DV3A 2VD5A 2WMBA 1AGWA 3F3WA 2OJIA 3Q6UA 4TNBA 3EL7A 4DYMA 2E9NA 2X2KA 4EEVA 3AXWA 4F1MA 5K0XA 3FZ1A 3ZM9A 2VWZA 2XIZA 1ZXEA 4DTAA 4RT7A 1Q24A 3EQGA 3NUAA 4IC8A 1OECA 5C03A 4YLLA 3W8QA 3JXWA 3FZSA 3OBGA 3LLAA 4TNDA 1X8BA 4DH7A 3NUSA 4KUJA 4QMMA 3FMKA 3BYUA 1ZOGA 1MQBA 3PTGA 5TE0A 4C3RA 4F6UA 3NUUA 2JEDA 2C6KA 5BMSA 1FBNA 4DTBA 1TVOA 3KN5A 4RC3A 3VS0A 4A7CA 5L8KA 2XNBA 3W2SA 3QXPA 3SXRA 4UALA 3CGFA 4J99A 4V0GB 4X2JA 4ZS4A 5LMAA 3BLHA 4C37A 5A14A 3QX2A 1IR3A 3BYMA 3TTJA 4ANSA 2C3LA 4DFZE 2YIRA 4CNHA 5D11A 4RX8A 5ETFA 5FEDA 2C1BA 2UVZA 4WA9A 3R7EA 3VULA 2WTCA 4IHPA 2B0QA 3VBYA 5M55A 5AV2A 3PVWA 4D1SA 5E8ZA 4LMUA 3HAMA 5GHVA 1XBBA 2QR8A 3SXSA 3R1SA 4LOOA 3HZTA 2QNJA 3PP1A 5L2QA 5L8LA 4UMQA 3CIKA 3QUDA 1WBSA 3KXZA 4DFYA 3ROYA 3KREA 4A4OA 1JKTA 3MVLA 5DMZA 4QPSA 3H9RA 3ALOA 2UW4A 5HU9A 5IDNA 3Q4TA 4CYJA 3MJ1A 3DB6A 3ORLA 3RBWA 3ZO3A 3D15A 2AC5A 1PXOA 1XBAA 1SMHA 2DQ7X 4G6OA 5CI6A 1H8FA 4C35A 5CLPA 2OSCA 1BUHA 2P3GX 3I5NA 1LUFA 2G2FA 1ZYDA 3AD6A 2IPXA 2R0IA 3B2WA 3KF4A 3LFEA 5GJGA 3TV4A 4Z16A 3IGOA 3KRJA 4OTDA 4YTHA 3ZCLA 4FSWA 3KMUA 2BZHB 3NEWA 3EH9A 3FPMA 2I0EA 5FDXA 4Y83A 3E3BX 3QU0A 5C4LA 2RIOA 3PYYA 3UYTA 5EM5A 3IW6A 3E3PA 3DAKA 4NKSA 4EH8A 2B7AA 2QOKA 3H0ZA 3UNJA 1JBPE 3RK9A 4AW2A 2CGVA 4L42A 3FMEA 1UKIA 3W55A 4GT3A 4E4MA 3F2RA 2XEZA 3ZU7A 5CASA 4FUYA 1S9JA 3OCTA 4AOIA 4KBKA 3SKCA 2PMNX 2ZB0A 2WAJA 3LIJA 2Y9QA 4M66A 5G1XA 4LUDA 2JFLA 1UA2A 2AUHA 3FC1X 2XK9A 5EKOA 4EONA 5EKNA 4FTAA 3QAME 4FKPA 4Q9ZA 4XG6A 3R9DA 4ZTRA 4EL9A 5TO8A 2OLCA 3N51A 1BI8A 5ANGA 2J50A 4YJVA 3D4QA 1SVGA 3DQWA 3I7BA 3UG2A 3QTRA 1BMKA 4FODA 4XP3A 2WTWA 5EYKA 5HCYA 4JBOA 4I5MA 4CRSA 3QQFA 3AMAA 3T8OA 2WTKC 4WD5A 4GKHA 3W16A 5H9BA 3PSCA 5L8JA 4IDTA 2Y4IB 5IEVA 3LCOA 4GK4A 4BIDA 4DEBA 3ORKA 3BU3A 3BHHA 4MH7A 3OTUA 4FE2A 3WZEA 2B4SB 2XJ0A 1Y6BA 2J5EA 3GQIA 3MYGA 2C6EA 2JBOA 1BL7A 3COHA 2WMQA 3HMOA 3MI9A 3OUNB 2ZYBA 5IQCA 4MXYA 4GG7A 5K0KA 4DC2A 4I0SA 2Y0AA 4HCTA 4TYEA 3ZONA 2YZLA 3OT3A 3BLQA 2RFEA 2RSVA 5IQDA 4FG8A 5ETAA 5HESA 3ORMA 3PY0A 1Q62A 3CQUA 4X3FA 2HZ0A 3E87A 5CSVA 4BI1A 4CXAA 4D1XA 4IM2A 3U8WA 2C6LA 3RWPA 4YHTA 3FHIA 2FSLX 4JBVA 4ZMFA 3COKA 4S30A 3EQIA 4I24A 4D0XA 1UVRA 3ZRMA 2P55A 2VWUA 4NCTA 2PWLA 2XIKA 1PYEA 3WIGA 3V04A 4JNWA 2P2HA 2W96B 5H8GA 4BDCA 3FPQA 5I9VA 5J9ZA 5EK7A 3FQEA 4XX9A 1TQIA 4IDVA 5CTPA 3GC9A 3QTXA 1YDRE 5E1EA 2W1HA 1PRYA 2JKQA 4Z9LA 4CFVA 4YJOA 4QPAA 2XBAA 3AMBA 3MVJA 5CSHA 3GBZA 1ZOHA 2YM6A 5KMKA 4X2GA 3WF7A 3R7VA 3RZFA 4G5PA 3IGGA 2ONLC 3POZA 2ITYA 3GGFA 3GCVA 3G5DA 4IVDA 4M68A 2FSMX 4MBJA 4ZOGA 3QGWA 2DUVA 4IH8A 5HBHA 3SV0A 4J53A 4BF2A 2Q83A 4L67A 3FXZA 3RK7A 3HA8A 4MYGA 4E20A 2ITVA 2YIYA 1YXUA 3OWLA 4KS8A 5BYZA 4FT0A 5K4IA 4RVLA 3HRFA 3GU6A 4LGDA 4AGCA 4K9YA 5JH6A 3S3IA 1JNKA 2UVXA 4R3PA 3ZTXA 3TEIA 3NYXA 2LGCA 3RM6A 4EOIA 2OZAA 1NY3A 3F82A 3QTQA 5EI8A 1M52A 3EOCA 4MVFA 1AQ1A 3BBWA 3DPKA 4E4XA 4E6CA 4CEGA 3NUYA 4DH3A 4U8ZA 4F7SA 5JFVA 5CQWA 3M2WA 3IECA 4V01A 4BB4A 4E5WA 4QMOA 5M4IA 2JC6A 2QKRA 4PPAA 2X2MA 3A4PA 2Y6MA 2V55A 4CG9A 3R28A 2PE2A 1PMVA 5D1JA 3E7OA 4ANQA 4B8LA 4LGHA 4E7WA 5L3AA 3PLAE 1FVTA 2C0OA 3PXRA 3HP2A 2QOHA 3TIZA 5HLNA 3Q60A 3BV2A 1JQHA 4I5HA 4MD7E 2CMWA 5E8WA 3A99A 4ASDA 4ITIA 1PMUA 2WIHA 1BYGA 3O7LB 2XS0A 3EKNA 5AADA 4FNYA 5FG8A 2KTYA 1WBWA 3C5UA 3FLWA 2ACXA 3AT2A 4L68A 4RQVA 4XOZA 5HG9A 4U7ZA 2PZ5A 3QCYA 3UO5A 2OGVA 2YHVA 4IC7A 3UIMA 5I3RA 3SW7A 4JOAA 4GKIA 5M51A 3DU8A 1XKKA 3L8PA 3UVRA 4DTKA 4FA2A 2QCSA 5HGIA 1NXKA 1UWJA 3AC3A 3KF7A 4FIIA 3AD5A 3R7UA 3LFNA 3HLLA 5AR3A 2NNWB 3I4BA 1H08A 1QL6A 4QQCA 1ZYCA 2DWBA 3ORXA 2CGUA 4FKQA 2C6IA 5EQEA 1ZMUA 5K3YA 4LL5A 3WILA 2PHKA 2IJMA 4J8NA 4TZRA 5BUIA 4EKKA 1GAGA 4P7EA 4ZSEA 3EN7A 3O23A 4BCIA 5DBXA 5C8KA 1FMKA 4FKIA 3S00A 3GP0A 4YHFA 2DS1A 3DXNA 3QKLA 4P90A 4S34A 4AZTA 2OJJA 1U54A 3KMMA 5JRSA 3TT0A 4BYIA 4YTCA 2J5FA 3CCNA 3L8SA 3S95A 1XH4A 4BFMA 2ZMCA 4JX3A 3TDWA 4NM7A 1SNUA 3UP2A 2IVVA 5CEPA 1JSVA 4XEYA 3GT8A 3ZOSA 4FBXA 3SAYA 3LFBA 2JAVA 3PIYA 4XS2A 3VS1A 2Z7QA 2G15A 2RF9A 4BIEA 4DFNA 4EH7A 3NSZA 4ZSLA 2NPQA 2YIWA 3BHVA 2XIRA 3FSFA 3POOA 5LMKA 2HW6A 3EMGA 3I79A 3FC2A 2QVSE 3P5KA 3QXOA 3PRFA 4XJ0A 4ZSGA 3UZPA 4Y73A 1XH5A 2YIXA 3R02A 4RFYA 5LWMA 3FXWA 1F5QA 3ERKA 4ENYA 4E26A 2YLFA 4G6LA 2X6DA 3RP9A 2UZNA 2WQBA 4HNFA 2VTHA 3EFWA 3FI4A 4TXCA 4G16A 3K3JA 5HTBA 4IACA 5GIOE 4FICA 4FVRA 4J7BA 1OIYA 4PPBA 4GS6A 4DEIA 2H96A 3JPVA 1HCKA 2XUUA 4AOTA 5M4FA 4R77A 2P33A 4FGRA 1Q5KA 4EOQA 4UMPA 3DNEA 5FM2A 2OZAB 4MWHA 4J52A 2V22A 4FSNA 2NRYA 2YIQA 4KNBA 3PZHA 4GMYA 4YZCA 4EQMA 3CSVA 3COIA 3OD6X 2VRXA 4G6NA 1SVEA 1S9IA 3R0TA 3G90X 4RBLA 3A7GA 4BTFA 2JDVA 4LOPA 2F7EE 4QMVA 3V5PA 4EK8A 4EOLA 3TUBA 4TWNA 4ORKA 4FL2A 3KU2A 5HIEA 5M07A 4GVJA 3E93A 4V05A 2R0UA 2W5HA 3EFLA 5AV3A 5CZIA 2PVJA 3ZUTA 4ANNA 3OEZA 5AR7A 1YOJA 5J87A 4KIQA 4R6VA 2JKKA 4TKSA 2X6EA 3BBTB 5FRIA 5J8IA 2O0UA 3TKHA 4AN3A 4TYJA 2G2IA 2WTKB 4K0YA 5KMJA 1VYWA 5JGBA 2H34A 4QP9A 4YURA 2UW9A 4UYAA 3ROCA 1GJOA 4G3EA 4OGRA 4PMMA 1JLUE 2VTOA 1KE5A 2FO0A 4A9UA 2UZLA 5IA4A 4X3FC 4BBMA 4F7NA 4A07A 3BHTA 1W84A 3QCQA 3QZFA 5CSPA 2VUWA 2WXVA 2XRUA 4IMYA 3Q53A 1BL6A 3IQ7A 1EH4A 3P4KA 3V8SA 5ETCA 4ARKA 4CTBA 4WKQA 3HDNA 5IMEA 1OKZA 3NVKI 1GIJA 2VTIA 3RKBA 2WMAA 4LQMA 4AZWA 5HG7A 2PUUA 4TW9A 4YJSA 3UMXA 3VUTA 2JDTA 4AT5A 4EQUA 2BAQA 4GYGA 2UW0A 3PVBA 3K54A 5D7AA 4F63A 4KKGA 1JKSA 1ZZ2A 4E6AA 3PVUA 4RJ4A 5CU4A 4YJTA 5IU2A 5IPJA 3ZLXA 2YM4A 3CJGA 3MDYA 3QTIA 5IF1A 4ANMA 3K5UA 4MBIA 4KSQA 4QQJA 1Y6AA 2ZV2A 1XHAA 5FBOA 4AE9A 4H58A 2X7OA 5FXQA 3FYKX 4LG4A 5CSWA 3V5JA 5FEEA 3I0OA 2BKZA 2VX3A 3FQHA 5AFVA 4B4LA 3V8TA 3HMMA 5CEQA 3EQPA 4EBVA 4C59A 1R0EA 3U54A 4FV0A 4JS8A 4IB3A 3SXFA 2JGZA 4RIWA 4YZ9A 4UZHA 1RJBA 3FZOA 4JR3A 1KE7A 3OZ6A 1YWRA 2C47A 5HO7A 1M7NA 2GTMA 5GZ9A 4PV0A 3U4WA 3PFQA 3LCSA 4WNMA 2A27A 3QRJA 3ZC6A 5IQEA 5AUZA 3OY3A 3GCUA 3EL8A 4E8AA 4XUFA 4YC3A 3HRCA 4ZY6A 4BBFA 1IAJA 1WFCA 4ACHA 2QU5A 3PXYA 5AP4A 1H01A 4I21A 1GZOA 3BYSA 2VO3A 4FTRA 5A6NA 3TZ9A 2LAVA 3E62A 3ZFMA 3MSSA 2IVTA 3LCKA 1FVRA 4QT1A 1V0PA 4KAOA 4NM5A 2SRCA 4CYIA 2PVNA 3A61A 4DEGA 1PXIA 3UQCA 3ZXZA 2XKEA 3NUNA 2QOOA 4FEUA 4IAFA 2X0GA 4PPCA 5K9IA 1H0VA 4OTQA 3CPBA 4L3LA 1UU3A 1OKVA 3GC8A 5KUPA 3BPRA 1IRKA 5AP1A 4L00A 3VBVA 4J96A 4BDHA 4QTCA 3E64A 2HYYA 4BCGA 2C0TA 2JDRA 3OBJA 3R63A 3C0IA 3O7LD 4PQNA 4X3JA 4FL3A 4NT4A 3D83A 4AN9A 4EH9A 2WTJA 3BHYA 5JFWA 5HVJA 3F7WA 3LFDA 3QWJA 2H6DA 2XBJA 4RVTA 2BUJA 5DEYA 5FD2A 2CKEA 3WF6A 2C3IB 4PMSA 3KRWA 3EQDA 2QOIA 3FMHA 4D2SA 4AXAA 4EYMA 1PF8A 3BE9A 3D5XA 4XCUA 5FUTA 3QRIA 2VTRA 5KKRC 1CM8A 3R21A 2YCFA 1AD5A 3VHKA 4C4GA 5J7HA 3WZKA 3FY2A 3BWFA 5HLPA 2GFCA 3MB6A 1Q3DA 2VX0A 4YPDA 4ALVA 1M14A 5EM8A 2V0DA 1NA7A 3A7IA 3AT3A 2CJMA 2W1IA 5HZNA 3KQ7A 1KV1A 5HCZA 4XP2A 3FLQA 4FV1A 4KIPA 1W82A 1H00A 2ZV9A 3V5QA 3ORNA 2QOFA 2OJFE 2J6MA 1ZMVA 5M53A 3DDQA 2VTTA 2ITNA 2R3IA 5AV4A 4BVUA 4NFNA 1NVRA 1L3RE 5AAFA 5A6OA 5HCXA 1MRYA 4NZWB 2A2AA 4HYIA 2F49A 3LCTA 3O96A 2XNNA 3EZVA 3RHKA 4FNZA 1PMNA 2VTPA 3VUKA 3QRKA 2XNGA 4AW0A 3LMGA 5FDPA 1QCFA 2C6DA 4J98A 1FVVA 1PY5A 3BQCA 3O51A 3QHRA 4FUXA 4RSSA 4U9AA 4Z7GA 3DS6A 4FMQA 4DEDA 3QCSA 3O17A 4XV3A 3WYXA 4RA4A 3TDVA 5DYJA 2E2BA 3OW4A 4FYOA 4CFMA 2OH4A 3QKKA 4O7TA 4PMPA 3D5UA 5TR6A 4J97A 5DN3A 1JPAA 4XMOA 3IDBA 5CS6A 2IZRA 1ZMWA 2OK1A 4OTWA 2ERZE 4O7WA 3FLNC 4GW8A 3HL7A 3JVRA 5IA1A 4DBXA 3KEXA 3UC4A 4BCFA 5IEYA 4UMRA 3FKNA 4JIKA 3QCXA 3VF9A 1Q4LA 3IOKA 1JKLA 4MTAA 4O27B 2HZ4A 3H0YA 3COMA 3E8CA 2Z8CA 3DBFA 1CDKA 2W4OA 3FXXA 3OROA 2PUNA 4I22A 4CFUA 1U4DA 2C6TA 5I9YA 4O82A 3FY0A 3T9TA 2ZOQA 5FEQA 5HLWA 5C1QB 5BUJA 3ZFYA 3FQSA 3TNQB 2C1AA 2HIWA 4DCAA 2GNFA 5DEWA 4IX3A 3HV6A 5CANA 5I9WA 4MQ2A 4WT6A 2YLEA 1ZOEA 3C0GA 3F5XA 2O8YA 1PYXA 3CGOA 4MXXA 1XJDA 4N4SA 4RLKA 4YJQA 4D58A 3EQFA 4UV0A 4WG3A 3ZZEA 2CKOA 4H3BA 5IQIA 5JQ5A 2XNEA 4LOQA 3P7BA 3ZSHA 4BCKA 3PPKA 2R3NA 3MN3A 4KS7A 4M0YA 2J0LA 3ID6C 4GUEA 1XH7A 4AFEA 5BVDA 3LE6A 4GK2A 4XG9A 2Z02A 4CG8A 4O38A 3KC3A 3UQGA 4YLKA 1G3NA 3R8ZA 4AA4A 4K6ZA 4B0GA 4JQ8A 3QD3A 3TCPA 3GCSA 2W99B 4O0TA 3KVXA 3VO3A 3PG1A 5KMLA 1G5SA 5CALA 2OW3A 2WHBA 5FXSA 2PUIA 2YCQA 4U45A 5C01A 4EH5A 3QRTA 5KBRA 1OKYA 2VO6A 2QG7A 2HZNA 1H1RA 2QR7A 2VWXA 4E1ZA 4ZSAA 4FZ7A 3SA0A 5AUXA 5DR2A 5CEIA 2F4JA 3WE4A 1PKDA 4QTBA 2EU9A 5LVLA 4NCTC 3OCBA 2UZTA 3F5UA 2VNYA 3NW7A 4AF3A 3MPAA 5HU3A 2XCKA 4O7SA 2HK5A 2BKKA 4F64A 2CSNA 3G9LX 3IW5A 4QMNA 2OI4X 1KE6A 4U43A 3TWJA 1PMEA 3E88A 5DT3A 5ACKA 1Q8YA 3OTVA 5D12A 3LFAA 4ERWA 2X8IA 4NTTA 2Q0BA 5L2IA 4C3PA 2XB7A 3QGYA 2YDKA 3VF8A 1ZYSA 1GZKA 4FYNA 3NW6A 4M13A 4MNEA 5HOAA 3TJCA 3TNHA 5BUEA 3LQ3A 5IUGA 2ZAZA 1H26A 1H1QA 4KINA 2GS2A 2QC6A 2PZRA 3VAPA 3F5GA 4AZSA 4IIRA 3BCEA 1CKIA 4RWIA 4H36A 4KIKA 5EHLA 1DI9A 2F7ZE 2UZEA 4HNIA 3ZYAA 4FOCA 3PA3A 2X9EA 4MXAA 2OIBA 1JKKA 2UZWE 1RDQE 2R3KA 4ZTNA 2GPHA 2B53A 5CT7A 3HNGA 3U9NA 4C0TA 2GFSA 1PXLA 3R71A 4DEEA 4JBPA 3QX4A 2GHLA 4O0SA 4X7QA 5AMNA 3V6SA 4OBPA 4M67A 5KZIA 4G5JA 2UW3A 4QP6A 4XG2A 4TL0A 3MTLA 4AFJA 1Q8UA 4YMJA 3ZUVA 2B1PA 5FTGA 2W9ZB 3E7VA 4ID7A 3SD0A 2WMUA 3MY1A 3QBNA 3DTWA 5AA9A 2UW6A 2F7XE 4UZDA 1CTPE 2PZIA 2VN9A 5A4LA 4QMUA 2W1CA 4ZTLA 4QMSA 3KCFA 4WUAA 4X6QC 4C4FA 3IW4A 3U9CA 3PJ8A 3KRRA 3R9OA 3UOLA 3W1FA 1O6KA 3O8PA 4WRGA 3PJ2A 1Z57A 3GOKA 1FGKA 2A0CX 4ACCA 4UXQA 4H3PA 4M3QA 3D94A 3D2IA 4Z7HA 1OZ1A 2JDOA 1YHSA 5BMMA 3EIDA 3KULB 3SRVB 4S2ZA 3U51A 4ZY4A 5I9ZA 3AGMA 1UU9A 4YPSA 4AGWA 4E3CA 3P23A 2OWBA 4E4LA 4LUEA 5KCVA 5DI1A 3P08A 5JRQA 3PIXA 1STCE 4ZIMA 2CNUA 4YO6A 3FZPA 3HVCA 4A4LA 3CQWA 4D9UA 5TT7A 3GXLA 3KXMA 3F9NA 4M69A 3DB8A 4W9WA 5AP3A 2XK6A 3ULIA 4JG8A 5DR9A 2EXCX 4AAAA 4EOPA 3LW0A 2ZJWA 3R00A 3R6XA 4FGBA 3E8NA 4OR5A 3ET7A 3RTPA 1FMOE 1QPCA 4B9DA 2CHLA 2X8EA 3KVWA 2JKMA 3U55A 2ITOA 3AC1A 3C50A 5CY3A 3DKCA 4FT3A 3VBTA 5KX8A 4RWLA 3DKOA 1KOAA 4FK3A 5F1ZA 3VUIA 4AU8A 1IA9A 1OL7A 4FSYA 3G6HA 1Q97A 3Q2JA 5E8UA 2X7FA 3C4WA 1ZZLA 3FLZA 3PY1A 3QUPA 3VJNA 3QD4A 3DCVA 3NMUF 4IJPA 3FL4A 4PNIA 5DA3A 4DGGA 4OLIA 2Y8OA 4RIXB 3CXWA 4II5A 4BI0A 3R1YA 2UVYA 3TIYA 2WPAA 1I09A 3G0EA 3MH0A 3C4XA 4JRVA 3VW8A 2CGXA 3OP5A 3RINA 4CT2A 4L9IA 2BMCA 5EG3A 3PWDA 4GIIA 3W2QA 5CAPA 4U40A 4FI1A 1U46A 4FIEA 5HVYA 5C8MA 2J2IB 1XH6A 4O0VA 3R9HA 4FTLA 1YXXA 4IAYA 5A3XA 4UN0C 4DA5A 3QTUA 4BDKA 3AC8A 4N57A 2FB8A 2C5OA 3R30A 5HD7A 2HXQA 3AGLA 3IDPA 4QNYA 4C58A 5IQBA 4C36A 5I3OA 4QMZA 4O0RA 1K3AA 3KFAA 3QD2B 5B2KA 4JJRA 3UVPA 2BTSA 3HV3A 4K77A 5ICPA 2XA4A 2GTNA 4RIOA 5GINE 2YM5A 4BY9E 1YXVA 4EK4A 5IH6A 3DAJA 4RVMA 3K3IA 2BILB 3AC4A 2VO0A 4B8MA 3C4CA 3VUDA 3ZBFA 4EK5A 4EZ5A 1OM1A 5LVNA 5GZAA 4FIJA 5KZ0A 1DS5A 2VTSA 5KMIA 3D14A 5LXMA 2P0CA 2OU7A 3F5PA 4E4NA 3VRYA 3FAAA 5E4HA 3AC2A 5FGKA 2RFDA 3LCDA 4ZSJA 3CP9A 3QQHA 2ONLA 5AIKA 3FI2A 1T45A 4YU2A 2GCDA 3Q4ZA 2E9UA 4XH6A 1OB3A 4N70A 4TT7A 3Q4UA 3GC0A 2QOBA 2PVLA 3IW8A 4O96A 4OBQA 4LGGA 4EOMA 2PSQA 4DFXE 3VWAA 5IA3A 2PY3A 3CKWA 4L45A 3TNIA 4KD1A 3UE4A 3F69A 3OY1A 5EYMA 2WTIA 3NX8A 3VQUA 4L52A 3E92A 4XLIA 2O2UA 4KWPA 2ZV8A 4RMZA 2UZUE 2X4ZA 3NNVA 2BIYA 3W2CA 3KB7A 3MS9A 3OF0A 2WMWA 4IAKA 4Y5QA 4BI2A 4BDDA 3CE3A 2ZVAA 3A7JA 3N9XA 4E93A 1KOBA 2WMVA 4OUCA 4HPUE 5EOBA 3RK5A 4RGJA 3LLTA 3RNIA 3ZC5A 3FI8A 4YTIA 3DBCA 3GCQA 2ETKA 4D2WA 3EFKA 3GQLA 2Z7RA 3QA0A 3DK6A 1TQMA 4BTMA 2WD1A 3LAUA 3NDMA 5HTCA 4M8TA 5M44A 3RPOA 5DWRA 1PKGA 1Q3WA 3TZMA 3R1NA 3MTFA 3LMHA 5LVOA 3MWUA 4FNWA 4XRLA 1ERKA 2GNIA 4MAOA 2B52A 3C5IA 1H1WA 1VJYA 2BFYA 5L6PA 3BEAA 1JSTA 2W7XA 2WKMA 3NW5A 2VWYA 2PZYA 2ERKA 1U59A 1WBTA 3FEGA 3L8VA 2RFSA 3NIZA 4YO4A 5TF9A 4NUSA 4C61A 3ANQA 5FLFA 3WBLA 3ZLSA 4O7YA 4I93A 4GV1A 5H8BA 1HOWA 3ZFXA 5CU6A 3JS2A 1JAMA 4GCJA 3ZM4A 3OUKA 3L9MA 4BICA 2VAGA 4Q5EA 1O6LA 3GEQA 3P1AA 5DGZA 5FTOA 1NW1A 4OTFA 4FV2A 4HCVA 1NVQA 4C4IA 4GYIA 3UMWA 3VS7A 3DXQA 3Q2MA 2A4LA 5FBNC 2QD9A 5C4KA 4QTEA 4M69B 3HA6A 2IWIA 4CMOA 4B7TA 4TRLA 4ANOA 4C02A 4P5ZA 3CD8A 3KRXA 3G33A 4ZZMA 4C4HA 5HTIA 2XMYA 5EW9A 1SYKA 2JD5A 1MRUA 2X2LA 4XRJA 2QO2A 5HKMA 2XM9A 1FGIA 5AIRA 1DAYA 2I1MA 4BGHA 5IH4A 4MXOA 3FMDA 4FSTA 2C5YA 5E8YA 4BTJA 4ZLOA 5JSMA 3OOGA 4QMTA 3T3VA 3GENA 2REIA 2H9VA 2IZSA 4BWPA 3MPTA 4D0WA
chains in the Genus database with same CATH superfamily
5CF6A 3R8LA 4DLJA 2WU6A 4YNOA 3EQCA 3KGAA 3NGAA 3QYWA 4PTGA 4EORA 2FYSA 3NIEA 4DFLA 2ZDTA 4JIAA 4UBAA 1FINA 2V7OA 2BR1A 2G1TA 4UB7A 4EJNA 4DE4A 4EHGA 5KKRB 2OIDA 3UDSA 5AUUA 5LOHA 2ITWA 2R3FA 4C62A 1RQQA 3QC9A 2HY0A 4CRLA 5AAEA 2GNJA 3PXZA 4APCA 5GNKA 3UIXA 3PLSA 5JGDA 4IAIA 5IUIA 3ZO1A 3ZRLA 4BKZA 4DGNA 4FEVA 3ACJA 2FUMA 2I6LA 4FTUA 1KUTA 5BV3A 2FVDA 2CN5A 4FG7A 5IQGA 4QYEA 5L2WA 3BGQA 1W2FA 1VEBA 3KRLA 4FTIA 3V6RA 1OVEA 4W4WA 1KSWA 3OWPA 5E8VA 4RC4A 4TWPA 3SC1A 3OXZA 3UIBA 4GFGA 5A4CA 2FGIA 1UNLA 3CPCA 2BAJA 3Q32A 5EDPA 3OOMA 5J9LA 2OXDA 4L46A 4I0RA 4LV8A 4HZSA 4AX8A 3PPZA 4WBOA 5BVOA 2B9JA 2F57A 2PVKA 3AMYA 3A7HA 4YNEA 4USFA 3BEGA 1J91A 4RJ5A 3VUHA 4PNKA 3RNYA 2OO8X 4ZS0A 1OL2A 4AQCA 4RFZA 1G8KA 3Q9WA 4UEUA 4RX9A 2PL0A 3QZGA 4H1MA 4RRVA 3WF8A 2I7QA 5A4TA 3Q5IA 3UPXA 4LV7A 3LMIA 3DJ6A 5LCJA 2CPKE 4DG0E 3UGCA 5BQ0A 2WGJA 1SVHA 4GSBA 2W17A 3MFUA 4Y85A 1XQZA 4QYHA 2EB2A 1WBPA 3AD4A 2QOLA 2XF0A 3FUPA 4JQEA 4FOBA 2UZOA 4QNAA 5ANIA 2QOCA 4J8MA 3REPA 2Z2WA 2XM8A 5E8XA 4CZYB 4Z55A 1CKJA 4JXFA 4D5KA 1UNGA 2IZUA 2CNVA 2XK8A 3LXLA 4KRDA 4GFMA 3UO6A 5L6OA 3P9JA 4CQGA 3QZHA 3DZQA 4G3DA 3R8VA 2JIIA 4HVDA 3ZHPC 5HNIX 1V0OA 4FR4A 2HWOA 3MH1A 2YWPA 2ITUA 3PRIA 4P4CA 1M2RA 1BKXA 4FTNA 2WU7A 4E6QA 3DLSA 5J1WA 3EQBA 3FLYA 4L43A 3W33A 5HVKA 4HVIA 3QLFA 3KXGA 2NRUA 4WBBB 3PJ1A 4FZDB 4MKCA 4OTIA 4F09A 2WTVA 4RIYA 4YLJA 4ITHA 4YSMA 4DLIA 3TZ8A 3HV5A 1K2PA 2PMIA 2WZJA 4OTRA 3KIOC 2C0IA 3V5TA 1Q8TA 4UMUA 2YABA 4G2FA 3B8QA 3FMLA 3MA6A 4C4JA 2H8HA 1B39A 2IW8A 3EN4A 3ODZX 4DDIA 2W0JA 3KN6A 4FTKA 5CVFA 3MY0A 3R9RA 4EBWA 1P2AA 3QA8A 4G3GA 4F9WA 2X81A 3AOXA 4RG0A 3UIUA 5C8NA 3MB7A 3FZRA 2W1GA 2YITA 4PWNA 4RZVA 2ITXA 5HHWA 4ASXA 3QC4A 1J1BA 4NW5A 5GJDA 3BZ3A 4PRJA 1M2QA 4DEHA 4CCBA 3DBDA 2BALA 3UOKA 4FRFA 3MIAA 3HECA 4EJ7A 4C57A 3N4VA 4O7VA 4QRCA 4USDA 3M42A 4IAZA 2J0IA 3CEKA 1M7QA 4S33A 2XEYA 2QU6A 5AV1A 1TZDA 3FMMA 3FMNA 4IFCA 5F20A 4QMLA 3DOGA 3DAEA 3IKAA 4CFWA 4BN1A 2OICA 4FV4A 4G9CA 3TJDA 4HYUA 4FKTA 3UTOA 3O50A 4W4VA 4IB1A 5HX6A 5CX9A 3O2MA 4NWMA 4RZWA 5DH3A 4D55A 2GNGA 5E1SA 3SVVA 4KIKB 5BYLA 2NP8A 2W4JA 3PE2A 4AA5A 3DGKA 5CEOA 3KK8A 3OCGA 4F0IA 4P2KA 5HORA 4YZDA 3HDMA 1SM2A 1Y91A 2ZMDA 2IO6A 1PXNA 4JDIA 4FZAB 5IUHA 3KXHA 5CZHA 4YC6A 1PXKA 2BZJA 4TYIA 2YEXA 5J95A 2IG7A 3LM5A 4O22A 4DH8A 3Q9YA 1FQ1B 4ACMA 4CFNA 4IWOA 2PU8A 1YDSE 2UW5A 5FM3A 3DT1A 3EQHA 2Y7JA 3ZXTA 4RWKA 5J5SA 2WQMA 4O4CA 4NKAA 5DOSA 3R22A 4A9SA 1O6YA 2BVAA 4KABA 3CLYA 3LXKA 3OXTA 3VBXA 4BZNA 4E73A 1ZWSA 1RW8A 4PDYA 2R3MA 2RG6A 3KXXA 4RQKA 5HNGA 4JDJA 2I0YA 2HENA 4DT8A 2Q0NA 5E90A 3KXNA 3QRUA 4MNFA 4W4XA 3MIYA 2J9MA 1OL5A 1UU8A 3EYHA 3QALE 4OT6A 4C33A 2X4FA 4HOKA 5A4EA 4QMPA 3PXFA 3MBLA 1LEWA 3F3TA 5EQYA 1OUKA 3R04A 4Y8DA 4BHZA 4F9CA 2BZKB 1FOTA 4H1JA 4NM0A 5T68A 4CLIA 4CV8A 5K4JA 4XG7A 4O2ZA 1YVJA 3RCJA 4CZTA 3SG9A 2E9PA 5JT2A 4I20A 2YWVA 3BYOA 4CGAA 2X39A 4LL0A 1M17A 1ZAOA 4JX7A 3BI6A 2OFVA 5C9CA 3WZDA 4U80A 3W0OA 1OKWA 5AR5A 1OGYA 3UDBA 3KKVA 3RALA 1A48A 4IXPA 5LCKA 3LOKA 4HVGA 3KK9A 3Q96A 4FT5A 4D2TA 2J7TA 4F7JA 5M4UA 4O7LA 4JG6A 3HRBA 4WNKA 1H1PA 2YJSA 5HE0A 3NRMA 1ATPE 3OXIA 2QOQA 4XG3A 3TXOA 4XNEA 5D41A 4D28A 5HX8A 3VONA 3K2LA 2WB8A 4PY1A 4TWCA 2F9GA 3P7CA 3FWQA 4PP7A 3VQHA 4LYNA 3RVGA 4F70A 2OIQA 3CC6A 3BHUA 3LFQA 4QP1A 5KMMA 3B8RA 3JVSA 4BCNA 5LMKC 3F2NA 3BRBA 5DG5A 5F4NA 2YDIA 1GZNA 3FLSA 4D2RA 2UUEA 5CENA 5JMSA 2C5NA 2YJRA 4YHJA 4DH1A 3WF5A 4OAVB 4YTFA 1UV5A 2GHMA 1R3CA 4LI5A 4XG8A 4F9AA 5AM7A 2VGPA 2XVDA 2V62A 4QO9A 5IQHA 4PX6A 4N6YA 1XH9A 5AX3A 4FV7A 4V0GA 2OJGA 5CF4A 2HWPA 3DFAA 1R0PA 3TMOA 3OMVA 3HKOA 4NIFB 2ZV7A 1P14A 2JIUA 3PJ3A 4GG5A 4GUBA 4IX5A 4QMYA 4RJ6A 4X0MA 4JAIA 4FVQA 1LPUA 4R1YA 1VZOA 1WBOA 2PVYA 3HMPA 4RX7A 5EOLA 2C6OA 4JDKA 3OCSA 4HYHA 5DE2A 3L9PA 4FKSA 2BDWA 3OC1A 3SGCA 3WARA 1DI8A 1PXJA 4OTGA 5HI2A 3DY7A 5BNJA 4K8AA 3C7QA 2WO6A 3QL8A 4GRBA 3C4EA 4AXEA 2HELA 4IFGA 5ANKA 5EI6A 3ZLYA 4UY9A 4FEXA 5IDPA 3HGKA 3TV7A 3R7GA 4BDBA 3W0QA 2XIXA 4PL4A 3ZDUA 4ZTMA 4R78A 4ONAA 4CFXA 4XP0A 3GU8A 4DGLC 2ZM3A 3EN5A 2XYNA 4L7SA 3UG1A 4EH4A 2WMSA 4DH5A 3QTWA 2HY81 1G8AA 3F3UA 4AA0A 1ST4A 5B0XA 2J51A 4IVAA 4PTCA 2ITZA 4YGAA 5E9EA 3MESA 3RM7A 4PTEA 4WSQA 5CAUA 3AKLA 3NUPA 3NAXA 4K33A 5CXZA 1I44A 3ZRKA 2CDZA 3IK3A 2R2PA 3C4ZA 3IOPA 1ZRZA 2BRBA 5L2SA 1E1XA 4EWQA 2GNHA 4G31A 2XK3A 3B2TA 4DT9A 3S4QA 3PWYA 4BHNA 3LFFA 1SNXA 2VNWA 3QWKA 3C51A 4GU6A 2BIKB 4IAAA 3ZMMA 3MH3A 2GS7A 5EI2A 1DAWA 4YC8A 4GEOA 2FSOX 2JKOA 1QMZA 3F3ZA 4K18A 3OW3A 4DBNA 4IX6A 1GOLA 3NYOA 5HD4A 2WIPA 4K11A 1ZLTA 4USEA 2PMOX 1WCCA 3QYZA 4IZAA 3VHEA 2WMRA 4F08A 4R7HA 4U97A 4IW0A 3ZEPA 1ZYJA 2OFUA 5AX9A 4IE9A 1DM2A 2CKPA 4U81A 2XJ2A 2O63A 2VTMA 3TTIA 3WIKA 4QQTA 3WE8A 3TG1A 3I6UA 3FE3A 4I41A 4FIFA 4EKLA 4NJ3A 3ZO2A 3GFEA 5FQDC 2JIVA 3O0GA 1H07A 3NPCA 4NU1A 4MHAA 3VNTA 3C9WA 4R5YA 3WI6A 3FV8A 3BQRA 5BVNA 2FSTX 2O65A 5DVRA 4ZTQA 1YI6A 3AKJA 3HX4A 4C7TA 2YAKA 5HIDA 5M4CA 4RFMA 2WMXA 3K5VA 3VS5A 3OVVA 4QYYA 3OFMA 4D5HA 4FV9A 5GJFA 2V5QA 4L6QA 2YACA 2X7GA 3ZBXA 1REJA 2XNOA 3NNUA 4CD0A 4IVBA 4BDAA 2BDFA 3LQ5A 1Z9XA 3LPBA 4G1WA 4MUQA 1R1WA 2Z7LA 1HCLA 4BWXA 2PPQA 3QQKA 4FTJA 3SOAA 1WZYA 5M09A 4L01A 4ZJJA 4LV5A 4BCPA 3CBLA 4F0GA 2QURA 4M7IA 3PA5A 5LWNA 5L4QA 3OG7A 4UWYA 3PZEA 4JRNA 2YM8A 2Z60A 4JQ7A 2XK7A 2YERA 1CSNA 5LJJA 2XK4A 4FKJA 1APME 4FKWA 3MV5A 3PDTA 1OI9A 2I0HA 4IBMA 2RFNA 3RHXA 1PXPA 1B6CB 3CY2A 4U44A 3W18A 2G2HA 4FJVA 3PPJA 3GOPA 4L53A 2XIYA 3PXKA 5AEPA 5JFSA 4EHZA 1W0XC 4A06A 4FSUA 4ZZOA 4PMTA 4DF3A 3ZS5A 2C5XA 2VTQA 2G01A 4NFMA 4FKUA 2R3OA 2FA2A 2B9HA 2PK9A 3NNXA 4CFFA 4TN6A 1WVYA 4Y95A 3UZTA 3IO7A 1LR4A 4KSPA 3RPSA 3ETAA 4D4RA 1Q8ZA 4FK6A 4KB8A 3BWJA 4MEDA 3LJ1A 4WRSA 4EUUA 2YFXA 5JQ8A 3UZRA 1KE8A 2PVMA 3CS9A 4FSZA 3Q3BA 3PE1A 2IEWA 4QD6A 3PXQA 2ITPA 4GU9A 4JR7A 5CYIA 4ASEA 4EOOA 1BI7A 3BELA 3P86A 4R7IA 4AG8A 4TWOA 2C6MA 3R7IA 3EYGA 2O5KA 4FZ6A 5AAGA 1BX6A 4BIBA 4PDSA 5BYYA 3JY9A 5D10A 5AR8A 1OMWA 3ODYX 4CCUA 3F66A 2NO3A 4RIWB 4QYGA 3D7TB 5CQUA 4ZK5A 4APPA 4HW7A 5LQFA 2OG8A 4TTHB 4IX4A 4WO5A 1MUOA 1J7LA 3LVPA 4XOYA 3VUMA 2UZBA 4PL3A 2XALA 3SW4A 4KBAA 5J9YA 3R73A 2WQEA 4FTOA 4LFIA 1W83A 4IZ5A 3RAKA 3DKGA 3TL8A 4ZXTA 4AUAA 4LMNA 4CMUA 2A19B 1IEPA 2J0KA 4UMTA 3ULZA 1Q61A 2X9FA 3TZ7A 3Q4CA 3T9IA 2FH9A 3A2CA 2BRMA 4DAWA 4QP4A 4DGMA 5L2TA 3DDPA 5AP5A 4LDTA 3HV4A 4QP2A 4FSMA 3SOCA 4EYJA 3NWWA 3DXPA 3AKKA 2QONA 2WEVA 2WEIA 2PVRA 1VR2A 4JG7A 2XARA 5IG1A 3OHTA 5A9UA 3VBWA 5DIAA 2BPMA 4BGGA 3HEGA 2UZVA 2YAAA 3GC7A 4I0TA 2XNPA 4AOJA 3NUXA 3P0MA 5IH5A 4ANLA 2J90A 4RWJA 2JFMA 4MCVA 3H30A 4C34A 5ITAA 4O83A 3TM0A 1O9UA 2PYWA 5AV0A 5IMXA 1J7UA 4H05A 3QQJA 5HG5A 4AXFA 4F9YA 5HQ0A 4ZZNA 4I4FA 4IVCA 3RJCA 4BCQA 3ZO4A 5EM6A 4ZEGA 4AS0A 3BX5A 4EOJA 1IAHA 2YM3A 1J7IA 2W4KA 5CVGA 4L44A 2W1EA 4BZOA 3FKOA 3DZOA 3G9NA 4BBEA 4RIXA 3CKXA 1Q41A 3NCGA 4FT9A 4GK3A 4LRJA 5EYDA 5A46A 4WSYA 3ENHA 4OTHA 4A9RA 4MK0A 1ST0A 4FTTA 5DHJA 2W05A 5ACBC 5EHOA 3ZZWA 4NL0A 3LXNA 4TYHA 3MFTA 3MFRA 4EHVA 4O2PA 1G8JA 3U6HA 3ZDIA 4FIGA 5B2MA 2HCKA 1ZARA 4AW1A 4BYJA 5CT0A 2VX1A 1JVPP 3V51A 3T3UA 2CGWA 5AUVA 1ZY4A 3E5AA 3MPMA 4O6LA 3F2AA 3MVMA 3UC3A 3NLBA 3RMFA 4Z3VA 4BGQA 4D1ZA 5HBEA 2B9FA 3EKKA 4P5QA 2OXXA 4BRXA 4BKYA 2ESMA 4O4DA 1LP4A 3TKIA 1GNGA 3LFSA 4DCEA 1JSUA 3NR9A 3DJ5A 3DA6A 2J0MB 3BU6A 5JEBA 5HE2A 1E9HA 4IM0A 3QFVA 4F4PA 5IZFA 4YJRA 4AACA 2XKDA 3LJ0A 2B54A 2R7BA 2CKQA 3CQEA 3L8XA 5FTQA 2XKCA 4M84A 2EXMA 4YZMA 5CWZA 4FEQA 4BCOA 4CKJA 3U87A 4A9YA 5J1VA 5EDQA 1E1VA 3OT8A 3VRZA 5BX0A 2ZM1A 2VTJA 3CJFA 1B38A 4JT3A 4MX9A 3VS3A 4AZEA 4D2PA 1YWVA 4NM3A 5KBQA 3WZUA 4I6QA 2GNLA 2XZSA 2ZM4A 3I5ZA 3R7OA 4ERKA 1Q99A 4K2RA 2UV2A 2HXLA 3UQFA 1OBGA 2VGOA 2R3HA 1L8TA 4IM3A 4N6ZA 3ZSIA 3NAYA 2W06A 4I92A 3TV6A 4ASZA 3GB2A 2NYAA 3ORPA 3ITZA 3AG9A 3ZSGA 3SG8A 4ZJVA 5BVFA 4MWIA 4PL5A 2AQXA 3L1SA 5DR6A 3EWHA 2R7IA 5EW3A 4EQCA 3E8DA 4YR8A 2OJ9A 2VO7A 3VUGA 4U41A 4QP7A 2QO7A 5CNNA 2QLUA 4A4XA 5ANEA 2C4GA 3LHJA 3TACA 2ETMA 4PUZA 3BV3A 2DYLA 3F88A 4F1OA 2CN8A 1H1SA 1PJKA 3DNDA 5LVPA 3A8WA 2RL5A 5KMNA 4CZUA 4FKOA 2Z7SA 3ZLWA 3FJQE 4IEBA 5G6VA 2OKRA 4O0YA 5DPVA 2A1AB 3F3VA 3OEFX 5M56A 4U3YA 3C4FA 5LARA 2WQOA 3BKBA 3BLAA 1MRVA 2O3PA 2HAKA 4JBQA 4YP8A 2WNTA 3R8UA 4QOXA 5AWMA 3HUCA 4M97A 3I1AA 2IVUA 3CTQA 3HUBA 1XR1A 4FL1A 3DJ7A 3HP5A 2X8DA 2ZB1A 3WF9A 4L3PA 2J0JA 4C2WA 3Q9XA 4Q2AA 4Y5HA 2BAKA 2ITQA 5A4QA 4U42A 2XJ1A 4GFOA 5HG8A 5EYCA 2R3QA 5C27A 4C8BA 3U6JA 5ETIA 4UXLA 3IS5A 4BR3A 2GQRA 4BTKA 2BTRA 2YCRA 3FKLA 1GIIA 1P4FA 5BVWA 4BZDA 1OL6A 5I9UA 3FSKA 2VZ6A 3I81A 3QTSA 5BVKA 4BC6A 3VS4A 1YKRA 1Y8YA 2AYPA 5F9EA 2EXEA 2VV9A 3I6WA 4YSJA 3PFYA 3PG3A 5E7RA 3WZJA 3PY3A 2PE0A 4FKRA 4X2FA 2R3LA 4G9RA 5AP6A 1R78A 4WNPA 4EC9A 2Y4IC 2OBJA 3UDZA 2YZAA 3O71A 3VS6A 5JKGA 2XAMA 3SDJA 5HE1A 1WMKA 3IPHA 3QD0A 1ZYLA 5ANDA 4I1ZA 2XNMA 3GVUA 3EQRA 3G2FA 4GJ2A 5D9HA 4UX9A 2QODA 5LVMA 3DQXA 5GIPE 3BE2A 4AT4A 3KY2A 3MJ2A 4NH1A 3G15A 5CNOA 1H4LA 1Y57A 2C68A 3HYHA 4XBUA 5GZ8A 5T3QA 4S31A 4XHKB 1QPEA 1XMMA 5CAOA 2O64A 4QMXA 4WIHA 2I0VA 5CXHA 3R2BA 4I4EA 3GNIB 4FT7A 4FV8A 4QP3A 3UOHA 2BCJA 4ZP5A 4B6LA 5TKDA 4FG9A 2PMLX 4NIFA 5E8SA 2X1NA 5DRBA 2R3PA 1FPUA 4EUTA 4FIHA 3CD3A 2BRNA 3PP0A 4CT1A 2JBPA 1V1KA 1XBCA 2RKUA 2F2UA 4NW6A 4WG4A 3SQQA 4D9TA 1WVWA 1H25A 3MVHA 5K5NA 2CCHA 2QG5A 3AT4A 2PE1A 4X2NA 4TY1A 4YJPA 4C2VA 2UZDA 3N4UA 3H9FA 4QMQA 4BCHA 5EDRA 5L6WL 4JL9A 3DK3A 3A62A 3TNWA 4X3FB 3ZEWA 4M12A 4BWKA 3RCDA 4RJ8A 5DRDA 3EJ1A 2KULA 3FYJX 5IEXA 1XWSA 4S32A 2GQGA 2EUFB 1PHKA 3ML1A 4UWBA 3IONA 3QTZA 4F7LA 1OIUA 1OPJA 1H28A 1ZY5A 2OF2A 2W1FA 4X2KA 2ZDUA 2CCIA 3PUPA 4H39A 4JVGA 2EWAA 3NZ0A 4R5SA 3VW6A 1F3MC 3G51A 4ZJIA 1NVSA 3PSBA 4U6RA 1PW2A 4F65A 5CSXA 4KIOA 4F1TA 4FC0A 3D9VA 3R9NA 3A8XA 3W2RA 1YW2A 2OZOA 4RVKA 5BPYA 4R3CA 4X6RA 3FHRA 3KA0A 4PF4A 3RPRA 3RGFA 2XH5A 4BDIA 4IJ9A 4MNEB 3RZBA 4AGDA 1URCA 3BIZA 3HMIA 2UW8A 2VWIA 3MH2A 4BDFA 1YHWA 4C3FA 2I40A 4FV5A 4G17A 5ANJA 3PVGA 4DG3E 2W1ZA 3I7CA 4O84A 4QTDA 3TUDA 3CTJA 2B9IA 3AC5A 5E91A 3W0RA 2HW7A 1YOLA 3BYVA 5HE3A 4TYGA 3R83A 3LKMA 1R39A 2IN6A 3QLGA 4L7FA 3F7ZA 4RA5A 5KNJA 1Y8GA 1J1CA 3MA3A 4O91A 5EHYA 4DGOA 4XV1A 2VTNA 4IWDA 1PXMA 1OIQA 3AQVA 1OGUA 3OWJA 3W32A 5J5TA 4DFBA 2YM7A 3MFSA 2WFYA 4WNOA 3W2PA 5K5XA 4XG4A 4GVAA 4EI4A 4IZ7A 4MXCA 4MBLA 2IW9A 5CF5A 5IA0A 3FZTA 5FXRA 4DITA 2GQSA 5LMBA 3UBDA 1J3HA 3EB0A 3GI3A 3SX9A 4AZVA 4F0FA 4EZ3A 2YISA 1YXSA 2VWBA 1K9AA 3JUHA 5J7BA 5CAVA 4NEUA 4WHZA 4IWPA 5KHXA 5I4NA 4AGUA 3R8PA 3EN6A 4EH6A 2Y6OA 2PTKA 3QQGA 4AAYA 1WBNA 2QLQA 3G6GA 4UWCA 2PZPA 2GS6A 5AR4A 4U0IA 5DT0A 5AUWA 4GJ3A 2R3GA 4KBCA 4C4EA 2J4ZA 3F61A 3Q6WA 3GU4A 3NNWA 4GIHA 3P7AA 4O21A 4EOSA 4A9TA 3W2OA 5H8EA 2CNQA 4UYNA 1M2PA 3CR0A 4AP7A 3R8MA 4FX3A 4KKEA 4L8MA 4OAUC 5AUTA 4BKJA 5AR2A 2BZIB 1NT2A 4GT4A 2G9XA 3PSDA 2OH0E 3GCPA 1WAKA 3HV7A 1ND4A 5AP0A 4BDGA 3M11A 4DEAA 4HVSA 2JDSA 4O7NA 1WVXA 4I6HA 1VYZA 4I6FA 4G3CA 3NYVA 4RPVA 4D4SA 3KMWA 2RGPA 2WELA 2QHNA 3GUBA 4FZFB 4M14A 3S2PA 3QZIA 4D4YA 5T6KA 2R64A 4DG2E 3TUCA 5HIBA 3Q9ZA 3BLRA 4KRCA 1OIRA 3W0SA 4FV6A 4O81A 1KWPA 3L9LA 1YXTA 1REKA 1KE9A 5KE0A 4AE6A 3BGPA 4V04A 3KCKA 4W9XA 1OITA 5CVHA 4HZRA 2VU3A 2W5BA 4HGLA 4O1OA 2ZFYA 3UO4A 4XV2A 3TN8A 2QKWB 3LFCA 3VS2A 4ENXA 1G8SA 1T46A 5DNRA 5DLSA 3RAIA 4D2VA 3H9OA 5M06A 4W8DA 1YQJA 2V7AA 1TQPA 3LJ2A 2C3KA 1LEZA 3FMJA 4K1BA 4NSTA 3ZUUA 3LZBA 5KMOA 3S1HA 2YCSA 4U3ZA 3LQ8A 3UODA 3DFCB 4G3FA 3SHEA 3R01A 5KHWA 3EFJA 3FDNA 4TPTA 4WG5A 2R5TA 3UDTA 2Y4PA 4MQ1A 2B55A 5HICA 4RIYB 5IISA 3O8UA 5AA8A 4CV9A 2ITTA 4MXZA 1OBDA 5CU3A 4I5CA 2OXYA 3UOJA 4EZ7A 4ALWA 4FTMA 2IVSA 4GL9A 4HGSA 3HAVA 1GY3A 4CKRA 3QUEA 3TKUA 2PULA 3MW1A 5EH0A 1W8CA 3N4TA 2GMXA 3IW7A 4J1RA 2AC3A 4JDHA 2YA9A 2W9FB 4R3RA 4YJUA 4GH2A 3H3CA 5D7VA 5FP5A 1MP8A 4BDEA 4I6LA 3CTHA 3NS9A 3D2KA 3C1XA 4I94A 5AJQA 4E5BA 3DLZA 4EOKA 2PVHA 3I0QA 2E9OA 4W4YA 3VVHA 5C26A 5I0BA 4O7RA 1H24A 4CMTA 3II5A 2RG5A 4Q9SA 3RI1A 2WQNA 4QDVA 3ACKA 3MGYA 4U79A 2QO9A 3FBVA 3CY3A 3R2YA 3PIZA 1P4OA 1TKIA 3NCZA 2XRWA 3FL5A 4ANBA 4CKIA 1URWA 4YZNA 4M0ZA 5A54A 3UP7A 4ZMEA 5E8TA 1JWHA 5JN2A 2QHMA 4HGTA 4O86A 1Z5MA 2C5VA 3VJOA 3S0OA 5DT4A 5I9XA 2R4BA 2XCHA 5CU2A 2YDJA 4JI9A 4O6EA 4WOVA 4QDEA 2R3RA 3Q5ZA 4PDOA 3DK7A 3BU5A 1H0WA 1YDTE 5HO6A 2BRGA 1OUYA 3QF9A 5CEKA 4IADA 4RX5A 3Q52A 4F9BA 4F99A 3JYAA 3D5VA 3P79A 4ZAUA 3UVQA 4QPMA 4IZYA 4FTCA 3NVMB 3GFWA 4BCJA 3A4OX 4NYEA 2QI8A 4E6DA 4HVHA 1CMKE 1XH8A 4RJ7A 4RLLA 4DFUA 4NJDA 5HBJA 5CAQA 5JFXA 4AT3A 5F94A 4DHJA 2IZTA 4OBOA 5HO8A 5AP7A 5IA5A 2WOUA 3WOWA 4BCMA 2VWWA 4KA3A 3D7TA 4R7BA 4ITJA 2UW7A 5EFQA 2PVFA 3MY5A 3A7FA 5AUYA 5FP6A 2HZIA 2IW6A 2WTDA 4CQEA 5HEZA 3D5WA 5CI7A 1F0QA 5M57A 3PA4A 4XLVA 1WBVA 5CF8A 4QYFA 3U6IA 3R1QA 5KO1A 1U54B 1OL1A 1UKHA 1UWHA 1QPJA 2GDOA 4XBRA 5JZNA 3R7YA 3UJGA 1Q8WA 4O0XA 4XV9A 3VC4A 3QHWA 3G0FA 5E92A 4H3QA 4C38A 4FSRA 3RAHA 5IQAA 4FNXA 4EWHA 2ETRA 2XP2A 3KL8A 2C3JA 4EC8A 4IB0A 5EW8A 3E8EA 4EH2A 4O1PA 3L9NA 4R8QA 2W1DA 5JZJA 4I3ZA 1W7HA 3NFFB 3RWQA 1U5QA 5TOZA 4NK9A 3KULA 3JY0A 3P78A 3SRVA 3W0MA 3DBQA 1YI4A 3RPYA 4CSVA 2BDJA 2BHHA 1MQ4A 2BROA 4CVAA 4RC2A 2GHGA 3Q04A 3BL7A 3UNZA 2P2IA 3PJCA 2F2CB 4F6SA 4YBKA 4BDJA 4L3JA 4Q5HA 4N0SA 4FSQA 4I6BA 4MD8E 4AN2A 5BVEA 5M08A 2C69A 4CTCA 1CKPA 1RE8A 4FKGA 3UPZA 4U5JA 3ATSA 2R9SA 4RJ3A 2EB3A 5ANOA 4QMWA 4EHEA 4OTPA 3GU5A 3RAWA 1UNHA 4G34A 4O7ZA 2PUPA 4ZLZA 1SZMA 4R1VA 2JLDA 3D0EA 3NYNA 4KKHA 4M15A 3VN9A 3DBEA 5J79A 2CLXA 4EK3A 3ENMA 3ORZA 4WUNA 3ALNA 4ALUA 4MF0A 3LM0A 1YI3A 5JGAA 2JITA 3SLSA 2CLQA 3IG7A 1V0BA 4IB5A 4LRMA 2OF4A 1IG1A 3DTCA 4FKLA 4W8EA 1GIHA 1A06A 3ZH8A 5EQPA 4EH3A 5I5ZA 4D4VA 3EN9A 4HJOA 5FWKK 1QPDA 1YRPA 3LXPA 5H3QA 2BRHA 4LRKA 3RPVA 3OWKA 3VBQA 4LM5A 1GZ8A 2XYUA 3QQLA 5IQFA 3H10A 2BFXA 4Y46A