1MRYA

Crystal structure of an inactive akt2 kinase domain
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
295
structure length
270
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-beta serine/threonine kinase
publication title Crystal structure of an inactive akt2 kinase domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 270
sequence length 295
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1mryA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1mryA02
3HMNA 1DAYA 1IA9A 2VZ6A 4UMRA 3BI6A 2ZV7A 3BWJA 5M4FA 3QL8A 2CHLA 2Y8OA 4ANQA 2WQEA 2OK1A 2OZAA 3FMEA 4DEHA 4HGLA 4R3CA 3WF8A 5KO1A 2ONLC 4IEBA 3S3IA 4EBVA 5AV0A 3Q2JA 4G1WA 2AUHA 4QMLA 3E7VA 1SMHA 2R3OA 2JDOA 2ITYA 2QKRA 3FQSA 4PL3A 5AAFA 4AW2A 1ZYDA 2PUPA 3GXLA 1YDSE 5CEPA 1ZXEA 2W7XA 2OH0E 3KK9A 4N6ZA 3FZOA 1OL2A 5AA8A 2XS0A 4BKZA 3AT4A 3V8TA 5IQIA 3QKLA 4FYNA 3GQLA 2NP8A 5E92A 3IW4A 4ZSEA 3VAPA 1Y8GA 4BHNA 4NH1A 5EI8A 5AUWA 3VQHA 2W4JA 3GCUA 4I4FA 3Q4CA 2W1EA 4IANA 4C4GA 3C5IA 5BQ0A 4N4SA 5AX9A 1SNUA 2B53A 4ASEA 1ZZ2A 4ALWA 4H3QA 3RNYA 5ACBC 3OTVA 5ANJA 5J1WA 4GFGA 4S33A 3RJCA 5AUTA 2QOKA 3PPJA 4LGGA 3Q6UA 2WTKB 4NSTA 5JFWA 2OJ9A 3A8XA 2VAGA 2GS7A 5FP6A 2F2CB 3PPKA 5EM8A 3T3VA 1M17A 2R0IA 1E1XA 3O96A 4NM3A 3R7EA 4GV1A 5CF4A 3FI3A 4GSBA 2VO7A 4HZSA 5CENA 1ERKA 4ACMA 2UZLA 4IX6A 2UZDA 1PXKA 4KIPA 4X2NA 1VEBA 4BCPA 5KZ0A 4HVHA 3LLAA 1Q8ZA 4G6OA 4JBVA 4LRJA 4Z7GA 3DJ5A 3HDMA 5L6WL 4RA4A 3U9NA 2OG8A 5CALA 1ZAOA 4RJ8A 3V6SA 4BRXA 4DEDA 1WCCA 1I44A 2JBPA 3IKAA 2R0UA 3NW5A 2YZLA 4DGNA 1JLUE 2Y0AA 4WNKA 4D5KA 4XJ0A 4G5PA 3UIUA 2OU7A 4Q9ZA 1ZYSA 4EOMA 2FVDA 4DTKA 4M0YA 2QU6A 3TNPC 5M06A 1JQHA 2CMWA 3IQ7A 1JWHA 4BCIA 3MVLA 4NTSA 3BV3A 3GT8A 1VZOA 4FZDB 1BUHA 3FPQA 3ZC6A 4BL1A 5CASA 4MH7A 4HJOA 3RPRA 2HCKA 3ZXZA 3DTCA 4JRNA 3NZ0A 3EFJA 3G9LX 2QOCA 2J51A 2REIA 1UWHA 4QMZA 5CSHA 5ANOA 5BVFA 1Q99A 3QD4A 3RKBA 3JUHA 4YJQA 1TKIA 3R01A 3PTGA 5I3OA 5C8NA 2GNJA 2OLCA 3QBNA 3O7LB 4P90A 2YWPA 2YFXA 3O8TA 5AR8A 2R3KA 3MA3A 4R7HA 4M7IA 2ZV8A 4AU8A 1PMVA 4JAIA 3D83A 4ONAA 3CJGA 4UN0C 5LVOA 2OF2A 4FTUA 3V8WA 5JFXA 4FTLA 3LXLA 1Q8WA 2GTNA 3MWUA 4RVTA 5LVLA 1ZOEA 2IZRA 2J50A 1H27A 3A99A 1QPCA 3ODZX 3UZTA 5EQEA 4D4RA 4FI1A 3HRFA 5TE0A 4C2VA 1GJOA 2PU8A 4LOQA 1M7NA 4IIRA 2XNOA 3K54A 2C3JA 3G0EA 4U5JA 4F1OA 4UEUA 5BMSA 4W4WA 5EYDA 5AUVA 4KABA 5HI2A 3A60A 4IWOA 4RFYA 4DFNA 3F61A 2XRWA 1OIUA 3FZTA 3PRFA 4LRMA 4QP9A 3TDWA 3PJ3A 2WMUA 4H05A 2X4FA 4IAKA 2XZSA 3R7YA 5CAOA 4YC6A 5GINE 4EH7A 3V5JA 5DT4A 3UOHA 3NVKI 2YAKA 4IFGA 5HX8A 4O7YA 5DBXA 1P4FA 3NUNA 2WTJA 2WMVA 3DTWA 3MS9A 2IO6A 2UZBA 2E9VA 2HWPA 4N70A 3QTWA 3QQKA 3LM0A 3OOGA 3LOKA 4JQ7A 3CD3A 5LMAA 1PXOA 5LMBA 2JKQA 4JBQA 3KXXA 4F0GA 4ASZA 3DAJA 4GW8A 3R9HA 3VW8A 2JAVA 5EH0A 3MGYA 4L42A 2HWOA 3MBLA 4O6EA 5AIKA 2W5BA 4ACGA 2P2HA 3HV3A 3RMFA 4WSQA 2OIBA 4FR4A 5CEKA 2QU5A 3TV4A 3OD6X 2AC3A 3Q9WA 4YURA 2VUWA 4WA9A 2RL5A 2QCSA 5H9BA 5T6KA 3NS9A 3V5QA 3Q04A 2C0IA 4IBMA 4LV8A 5TOZA 4DGLC 3OY1A 4MBLA 3GCQA 3OHTA 1FVVA 1GIHA 4XBRA 4TWCA 1FMOE 1R39A 3D5UA 3MW1A 4RSSA 3UVPA 5B2MA 3CBLA 4ZZMA 4XG7A 2A19B 3HECA 4CG9A 1FQ1B 3DAEA 3SGCA 5AX3A 4L46A 3DK7A 4RIXB 4KKHA 2BPMA 4JG7A 4KS8A 2XK4A 2X81A 5CI6A 1VYZA 2ZM1A 3OEFX 4E4NA 5A54A 2W1HA 3FZPA 2BZKB 4TYHA 3VHEA 4PMPA 1YHWA 4Q9SA 1H8FA 4FV8A 4XNEA 2V7OA 5DI1A 4D5HA 3UOKA 4MD8E 4BHZA 4DH1A 3OROA 4MD7E 4PPAA 3CS9A 4FSQA 4FTOA 4FA2A 1UU9A 2HK5A 5E8XA 4AE9A 2WELA 1UNLA 4H1MA 3C4XA 2YCRA 2WQBA 3FXXA 4YTIA 2HY0A 3SV0A 4CG8A 5E8YA 4MXZA 3E87A 1XWSA 1K3AA 4RIOA 5CEQA 4EZ5A 2XNEA 5L8JA 5CAPA 5HE2A 3I81A 1PRYA 4XUFA 3U51A 4XS2A 4CFNA 2J7TA 4D0WA 3I6WA 3RPYA 4M12A 4DEIA 4PTEA 3ZYAA 4I5HA 4D28A 3NUYA 3TG1A 2BDJA 5J95A 3GC0A 2VTMA 2R64A 2R7BA 1KWPA 4RJ6A 4XP3A 3TNHA 1PXIA 3MTLA 4KIKB 4TWPA 2W1IA 2E9OA 3WARA 3R0TA 3DLSA 5CU6A 4J8MA 5HNIX 4KBKA 2HELA 2QOFA 3H9RA 3PLSA 4JDKA 4O91A 5CQUA 5FWKK 2YDKA 3D7TB 2QLQA 5IA5A 3CGOA 3JS2A 3BWFA 5I9VA 5AEPA 3G0FA 3TTJA 3CD8A 2C5XA 3ORLA 2R3HA 1W0XC 4Y95A 1PHKA 2CGUA 5CF5A 4RWLA 4MYGA 2YABA 4R6VA 1PYXA 4RG0A 4RVMA 3V01A 5IH4A 2YCQA 1O6KA 3II5A 5J7BA 3HMMA 4XX9A 4FVRA 5M55A 1YRPA 4NKAA 5D9HA 3R83A 3C9WA 3TM0A 3R8ZA 5HCXA 3QD0A 2W9FB 4ITIA 3Q4UA 4JXFA 4X3JA 4FTKA 2QO7A 4RQKA 1JKTA 2YITA 5TT7A 3ACJA 2OI4X 5FXQA 5AUXA 3P7AA 2DYLA 3FLZA 2J9MA 2PZPA 3LQ8A 1OIQA 3P9JA 4XRJA 3DBEA 3NUSA 3TKUA 3AT3A 4CMTA 3F2RA 3JVSA 2G9XA 2PMIA 4JI9A 3IOKA 5I9XA 4AN3A 3DDPA 3R6XA 3L8PA 4WRGA 4YJNA 3BIZA 3QD3A 3ODYX 4BIEA 1BKXA 5GHVA 3JPVA 2RFEA 2RFSA 4RJ5A 1H26A 4QMOA 4UWCA 5EI6A 3ETAA 3SOAA 3ATTA 4OGRA 4DF3A 4YPSA 3C4WA 3IONA 3V5WA 4CXAA 3LXPA 3I5NA 4D9TA 2OZAB 4ZTMA 3R1QA 3UNKA 3FKNA 4G6NA 4J98A 4JQEA 1NW1A 4FV3A 3WF9A 3O0GA 1L8TA 4QP4A 2C1BA 2PWLA 2DQ7X 3F9NA 3L8XA 1GY3A 4FV4A 3AMAA 2BRBA 3R30A 4AFEA 2DWBA 4RX5A 3ENMA 3FUPA 2ZVAA 3FBVA 3FZRA 4ZZNA 5HEZA 3O8UA 5L6PA 1U54B 3QLGA 2YM8A 3ZO1A 5J9YA 1E1VA 3CTJA 3F3VA 4FT9A 2GQSA 3VULA 4EKLA 1Z57A 2C0TA 3BHVA 5CU4A 5LMKC 4CCUA 1ZOGA 2VX3A 3PVGA 1PXNA 1R0EA 2AC5A 4UV0A 3WE8A 2GU8A 5D12A 3DQWA 1WVWA 3MVMA 4B9DA 4I93A 3OOMA 4NK9A 4TWOA 5KHXA 3MSSA 5DRBA 4BIBA 4DFUA 4RJ4A 1R1WA 1RE8A 2NRUA 2ONLA 4NJ3A 5IH5A 1H1QA 3I1AA 2I0EA 5KCVA 1YW2A 5BPYA 4FV0A 3PFQA 4TZRA 4UBAA 3G51A 3NAYA 2BAQA 5KBRA 3QC9A 2XNBA 4QYFA 1J7LA 2VWWA 3FMKA 4GFMA 4EOOA 1SNXA 2PVJA 4L43A 5JRSA 4D1XA 3AD4A 1W83A 1OIRA 2R3MA 3P79A 5BVWA 4EBWA 1U5RA 4JIAA 1FGKA 4AW0A 3LQ5A 1PY5A 5I9UA 4Z9LA 4AP7A 1U46A 1L3RE 4NZWB 5CEIA 4ANMA 1PYEA 2BILB 3AD6A 4FIGA 4ENYA 3DB8A 5CAVA 5HD4A 2ZB0A 3R9OA 5GZAA 1ZARA 3EQPA 5EQYA 1W7HA 4C57A 3L9MA 2WEIA 3PWYA 3G6GA 5F1ZA 2WMRA 4GK4A 4P7EA 3MA6A 2VWBA 3AMBA 2B9JA 3R8MA 3VS1A 4M97A 5AFVA 1F3MC 4MWIA 4OT6A 4ZY4A 1GIJA 3HL7A 3V6RA 2CNVA 4O81A 4XV1A 1FGIA 1WVYA 4R1YA 2ITUA 3FJQE 3GU7A 3MB7A 4RVLA 4U3ZA 5LCKA 3VVHA 4A4LA 4E20A 2HAKA 1OKZA 2XKFA 2XMYA 4C3FA 3PJ1A 4E6CA 3V8SA 3QTIA 4Z7HA 3VUTA 3REPA 5EHOA 5IKWA 3KXMA 5LVPA 1XBCA 1TQPA 4NFMA 4YSJA 2PULA 2UW3A 3O51A 1FMKA 4LV5A 4MWHA 2QG7A 2IJMA 2IN6A 2B9IA 5L2QA 3FQHA 3Q60A 1YXSA 3TDVA 4O7WA 5EKNA 5CSXA 4GVAA 4F0IA 4O7LA 3KRXA 2G2FA 4NKSA 3FPMA 1FOTA 3RZFA 4CZTA 4EQUA 5HBHA 5K0XA 2YDJA 4F08A 3ZC5A 4IC8A 3RPVA 4L6QA 5E8TA 4ZTLA 4EK3A 2JD5A 2BZHB 1OVEA 4PPCA 5A46A 4ACCA 2XNPA 2UZVA 3LFBA 4D4VA 2P2IA 2W1FA 4NCTC 3GQIA 4HGTA 2J6MA 5E90A 2XK7A 2JIUA 5M4CA 3EN6A 4HGEA 4B8LA 3V3VA 4AE6A 2B55A 4E6QA 5FRIA 4UMTA 3C50A 2GNLA 2IPXA 2XJ2A 4FSTA 4IC7A 3O71A 3VF8A 2Q83A 3QQFA 3A7GA 3LCSA 2BDFA 2HIWA 3ZSHA 3KA0A 4AOIA 3KU2A 4GCJA 4JDHA 4YGAA 4UYAA 3EYGA 5A4QA 2Y9QA 3BYSA 4CFWA 5AA9A 5I5ZA 3KULA 4IX3A 4YBJA 1YI4A 4E4LA 4LMUA 3F5PA 4GL9A 3P0MA 3MYGA 4D58A 1M2QA 4C4IA 4NFNA 4L68A 5JKGA 5A6OA 1Q3DA 4GIHA 3W2RA 4OBOA 3NNVA 4WBBB 3ZUUA 1A06A 3FEGA 5KNJA 3PA4A 3D15A 2ETMA 4WG3A 4GIIA 2V7AA 4O0WA 2BDWA 4NM5A 5DR2A 1Q8YA 2WTDA 2YIRA 3SHEA 5CSVA 2IZUA 3OFMA 3POZA 2UZUE 3WF6A 5CEOA 2GTMA 1W82A 5IUIA 3ZLYA 5L2WA 4J7BA 2OFVA 3BHHA 3PY0A 1XH4A 5TR6A 5CU3A 3QWKA 4FKIA 2C5NA 3NNWA 4I41A 4E4MA 2YLEA 1QPJA 4PNIA 4ZAUA 5CVGA 5L8KA 3PSDA 3O8PA 1VYWA 2QKWB 5AP7A 4X7QA 4YZCA 3OBGA 3V51A 3EL8A 5HU9A 3N4TA 2CNQA 4ZTSA 4K11A 4GU9A 2UW4A 4M67A 3MVJA 4AX8A 2PMNX 4FVQA 5DLSA 3O2MA 4C0TA 5B2LA 5L2TA 4GUEA 3R1YA 4MF1A 5EFQA 4F0FA 4DH8A 4LYNA 1OBDA 3UNJA 2H6DA 3JYAA 4O0XA 3EQDA 2PVLA 3T9IA 5IA3A 5KMIA 4V05A 3TZMA 5J5TA 2W0JA 5BVNA 3BYMA 3FI4A 3GC7A 2OWBA 3RK9A 2XNNA 2BVAA 3QWJA 4BWKA 3UBDA 5JK3A 3QXOA 4HNFA 4D2TA 4CEGA 2R3LA 4FKOA 4YSMA 4M3QA 3QGWA 2F49A 1Y6BA 2XK9A 2WB8A 5IMEA 5CZHA 4J8NA 4TRLA 5CT7A 1G8AA 3CCNA 4IZ5A 2W4KA 3TACA 4C58A 4P4CA 4B99A 4FTRA 2RSVA 5HGIA 4YZMA 2QD9A 4XEYA 4YU2A 3W1FA 3NUAA 1AQ1A 1YXTA 2J0MB 4LRKA 4YHTA 2JKOA 4DTBA 4EH4A 1OZ1A 4EL9A 2CLXA 3SVVA 4LI5A 3AC4A 2BIKB 2FSLX 4BCKA 2UW9A 2V0DA 4O0RA 4JLCA 2JDSA 3LZBA 4BDGA 4C4FA 3PG1A 1NY3A 5D10A 2SRCA 3VRZA 1S9JA 4DEEA 3BHYA 4FVPA 2R7IA 5CY3A 3R7VA 3TEIA 4F70A 5L4QA 3BELA 3MJ1A 4FEVA 4ID7A 2LAVA 4A07A 3LKMA 1ZYJA 4K18A 4I21A 3MPTA 3KRJA 4RIXA 3R8LA 3G15A 3PP1A 3PZEA 4QMYA 4CSVA 5KX8A 3W2OA 3TJCA 4OLIA 4K8AA 4XG4A 3L9LA 2VD5A 3PY3A 2W06A 1MP8A 4ZSLA 5G6VA 1F0QA 3BKBA 2GHLA 2ZYBA 4U8ZA 2WMTA 1OL1A 2YIYA 4QP8A 4LOOA 4EC8A 4QMTA 5DEYA 5CWZA 4EK6A 2V5QA 3ROCA 4QYEA 5AM7A 3QUEA 2QG5A 3ZO2A 1P4OA 5J87A 4BDFA 4YUQA 5DHJA 4FIFA 3DB6A 3IGGA 5CX9A 1XBBA 2ITQA 4ZTRA 4YO6A 4EH3A 3GEQA 4YZNA 2HW7A 3GFEA 1U4DA 3DLZA 2C6DA 2ZB1A 4M13A 5F20A 5GJFA 5AAGA 2CN8A 2XYUA 4EOSA 5EHYA 5HVJA 3KRWA 4FV9A 3UJGA 4EKKA 3BX5A 3D5VA 1JOWB 3WF7A 3QLFA 3UIMA 2P0CA 4GH2A 4IAZA 1AGWA 3COMA 4DTAA 3JXWA 2WIPA 3B2TA 3EFKA 2ZOQA 5BVOA 2YEXA 4LOPA 4DHFA 4KIKA 2W96B 4O96A 1GZOA 5J9LA 3RAHA 3I5ZA 2WMQA 3TWJA 3P5KA 5KMOA 5ACKA 2YA9A 4FTTA 4AGWA 3T8OA 2QHNA 3UYTA 3QHWA 1FBNA 4IB5A 4FV6A 4XP2A 2OSCA 4F9WA 3D7TA 2WGJA 4EH6A 4RJ3A 3NNXA 3LFEA 3PJ2A 5DVRA 4R3RA 4HCVA 3DGKA 5HTIA 2HYYA 2J5FA 3RHKA 4DLIA 4CTCA 3RM6A 1YXXA 3IPHA 4JBOA 3NYVA 4U7ZA 5FM3A 4RIYB 4WUAA 2ZV9A 3ORMA 4YHFA 3PDTA 4QP2A 5BX0A 5K4IA 2UW8A 4XCUA 4FZ7A 4JJRA 3PSBA 1Y6AA 3EJ1A 4W8DA 1OGUA 3VS0A 4GK2A 3B2WA 2E9PA 5TKDA 3E63A 2ZV2A 4H1JA 2VWUA 3GI3A 4QTBA 2X4ZA 3SRVA 1OB3A 4EK5A 4IH8A 3ORKA 3HMPA 1M14A 2PPQA 3E3PA 2YAAA 2PZYA 3BQCA 3D7ZA 4F64A 3NMUF 5M07A 4EK4A 4GKHA 3ZDUA 5FTOA 3UO5A 3R1NA 2ZM3A 3DKCA 3OCGA 3VS6A 2PYWA 3KXHA 3A7HA 4FKWA 5AUZA 5BVEA 3ZS5A 3D4QA 1WAKA 3F2NA 4RLKA 2NNWB 4QP6A 5HTCA 2CKOA 3UZRA 3BYOA 4W8EA 2W17A 4KSPA 3RVGA 2R3NA 4IW0A 3ZLXA 4BTKA 4FIHA 5J5SA 1KSWA 4FZFB 4R7BA 3MFSA 2VWVA 4GU6A 4LG4A 3SAYA 3CSVA 3T9TA 4BKYA 5IDNA 4ZLOA 2CKPA 2ITOA 3SOCA 4DE4A 5FGKA 1Q8UA 3FL5A 4PMMA 5JRQA 3OVVA 5DNRA 4FTMA 2OO8X 4FKSA 1W98A 4WIHA 3VS2A 2IW6A 3BGQA 2WMWA 4F9AA 4QQ5A 3UIBA 4O83A 4ZMFA 5T68A 3FSKA 2C6MA 3F5UA 5H8BA 4YJOA 4B6LA 4QP1A 5IQGA 3VS3A 4ITHA 2C0OA 2VU3A 2X8EA 5DT0A 3IK3A 1SVHA 4IMYA 1JAMA 1U54A 2QOHA 4Z3VA 2PE2A 4HCUA 2UUEA 5HESA 1SYKA 2Z2WA 5LMKA 4K1BA 2VO6A 4CVAA 3ZRMA 5ANEA 5AV2A 5CNNA 3GBZA 4FT7A 5G1XA 1WBPA 4PDPA 4YZBA 3P7BA 3MDYA 4XYFA 4KSQA 4UWBA 4B4LA 4FTAA 4CMUA 4BCFA 2CN5A 5E8UA 3FKLA 3FY0A 5D7AA 3TT0A 4FNWA 4APPA 3P86A 1CM8A 2PSQA 3PYYA 4U9AA 3SW4A 4ACDA 1U5QA 4ORKA 1WBSA 4PP9A 2QI8A 2PZIA 4IDTA 3PY1A 3VUMA 3LQ3A 5ANDA 4BDHA 4ASDA 3QTUA 3QCSA 1J7IA 3LXKA 4L3PA 1REKA 4J95A 4ALUA 4IAIA 1P14A 5E7RA 4BCQA 2PTKA 5IG1A 1Z9XA 4YR8A 2Z7RA 2VWYA 2GS6A 3UODA 5JSMA 2BALA 4S30A 3BPRA 4YTFA 3KXNA 4J1RA 3KEXA 3U6HA 1NVRA 3NDMA 4JBPA 4O1PA 4C7TA 1CKJA 4BB4A 2BROA 1PKDA 4IWPA 1KE8A 1Q41A 3DBDA 4JDJA 5AUUA 1YOLA 1XH5A 2PVNA 2CPKE 2WD1A 3QTRA 3QRKA 3UQGA 4GEOA 4S32A 5J8IA 4IDVA 3ORXA 4W4XA 5F4NA 2YM3A 4HYUA 4OT5A 3FYKX 4KINA 3BU3A 5EOLA 5A4EA 3RCDA 3NVMB 4FGRA 2O3PA 1TVOA 3MPAA 3NRMA 3OT3A 2GNHA 4G16A 4ITJA 3HNGA 4TTHB 4Y73A 2BHEA 3QKKA 2BR1A 3FI8A 3OW3A 2ZMDA 1I09A 3RK7A 1K9AA 3OXTA 3R73A 3KULB 3OWKA 4FEQA 4AGCA 2HOGA 4AZTA 3LE6A 2A2AA 2YIXA 4P5QA 5BUIA 3MN3A 4WO5A 4PQNA 4XG2A 2HZIA 3W10A 2UV2A 4II5A 4WNPA 5CVHA 3HA6A 3QGYA 2WMAA 2C30A 4F7LA 2JDTA 3GU6A 3L9PA 3LJ0A 4ZTNA 5GJGA 5B0XA 3RTPA 4E4XA 4RWKA 2OJFE 3W8LA 4BCGA 3QQJA 3WZDA 4JL9A 4ERKA 4AW5A 4F1TA 4BDIA 4CLIA 4E3CA 4NCTA 3NR9A 4L7FA 3Q9XA 5F94A 5HLNA 3KKVA 4KA3A 1UVRA 2C69A 5KZIA 1UV5A 3HRBA 5HIDA 3ULIA 2DS1A 2WMXA 4QTDA 2VO3A 2F7ZE 3NW7A 2IVTA 5EDQA 2WMBA 4L3JA 4WSYA 3ZLWA 1Q8TA 5EYKA 1LPUA 4G9RA 3S0OA 3EQGA 4UXLA 4C62A 5AJQA 2XNMA 4F7NA 5I9ZA 2PZ5A 1CMKE 4K2RA 2CGXA 5IZFA 5KMKA 3U6IA 2QNJA 5LXMA 4TNDA 4FK3A 5DRDA 3UMXA 3ZUVA 1TQMA 3QRUA 1V0BA 4NU1A 4GJ2A 1JKLA 2FSTX 5M57A 3VS4A 3I0OA 5DFPA 3VS7A 1LR4A 4F9CA 4IX5A 2WU7A 1JVPP 2YLFA 3DY7A 1YWNA 4RGJA 4NM0A 3UQFA 2JBOA 5ETFA 3ZH8A 2VV9A 3E7OA 3D9VA 3OUNB 3FZSA 4RWIA 3VS5A 3ENHA 1SZMA 3H30A 4XV9A 5F95A 3CEKA 4IAAA 2UW7A 2V62A 2VTAA 4XG6A 4KIOA 5JZJA 3HMIA 3R28A 3OZ6A 1IEPA 4C4HA 3KVWA 1YWVA 4XLIA 5BMMA 4U81A 2XF0A 2VRXA 3OCBA 4IE9A 3A61A 5DOSA 3I7CA 4MTAA 4D0XA 4M0ZA 4DYMA 4Y72A 2WQMA 3NCZA 3BBTB 4YJPA 4U41A 3GU4A 4OTQA 5I9YA 3LCDA 3NPCA 3W18A 1DM2A 2X2KA 4XOZA 2R5TA 1JNKA 4KNBA 4QYGA 4JIKA 2FYSA 2X2MA 3L1SA 3OEZA 3PIYA 4RC4A 4AT4A 2GS2A 3ZDIA 4YMJA 3F88A 4DH5A 4CMOA 4TYGA 2XVDA 3FMJA 3G9NA 4E1ZA 2F4JA 3PXRA 3F69A 1PXMA 2JDVA 5D41A 4G34A 2PVFA 5FP5A 3TKIA 4FE2A 3TV7A 2BMCA 4EOIA 4AG8A 3DBFA 1H0VA 2BCJA 3NYXA 4PV0A 4YJVA 3QF9A 2H34A 2O0UA 3CY2A 4JVGA 2CDZA 3DNDA 3SKCA 4EHEA 3ZHPC 4L52A 4RFZA 4HYSA 4D2RA 4X2JA 5A9UA 3ELJA 4WT6A 3H0ZA 2C3IB 5AIRA 2HW6A 5IEYA 3C5UA 3BEAA 3PRIA 4FSRA 3G33A 1Y8YA 1FPUA 3F7WA 3PZHA 3UOJA 3F5GA 1M7QA 3MTFA 4RBLA 4FT3A 2BKZA 3Q4ZA 4DFXE 5LWMA 3Q52A 1O6LA 2IZSA 2Y4IB 5EK7A 4A9UA 3P7CA 2YM7A 3UIXA 5CEMA 5CSWA 2Y4IC 4FKLA 3FXWA 3PVWA 5C1QB 1OKYA 2C6IA 4YNOA 4EOKA 4HYHA 2RG5A 4KIQA 5HO7A 2Y6MA 4PNKA 2YACA 4AA0A 1OECA 1GOLA 4IACA 5EHLA 4Y46A 3CC6A 4PTGA 2GMXA 3GGFA 5JGBA 1PF8A 2ETKA 2C6KA 2WTWA 4YBKA 4EOQA 4IQ6A 4GYGA 2FA2A 4QP3A 3SD0A 4FEXA 4PL4A 3TZ9A 1SVGA 3V5PA 4MVFA 4UMQA 2V22A 4FOCA 3KREA 4DCAA 2BFXA 4GS6A 1BI7A 3OWLA 5H8EA 4GYIA 3AC8A 4QRCA 4PTCA 3C7QA 4YLLA 5E8SA 4A9TA 5JFVA 2QOQA 4IWDA 2XCKA 4A7CA 4M8TA 3V5TA 3ZO3A 1QPEA 3MPMA 3UC4A 3MIYA 4R77A 3E93A 3ZBFA 2UVZA 4U3YA 1UKIA 3R8UA 4MKCA 3W2QA 3ERKA 4I5PA 5FTQA 2W9ZB 3FE3A 3VIDA 4HYIA 3VBVA 3D94A 2HXQA 4C8BA 3SRVB 4G5JA 3NX8A 4KAOA 4ASXA 2F7EE 4EQMA 2YZAA 1H08A 4X21A 4ANOA 4QTCA 3QX4A 4DFZE 2PVMA 3HUCA 2XUUA 3RM7A 4FTQA 3WYXA 1RQQA 5JQ5A 2VTJA 2R3JA 4LFIA 5K9IA 4WUNA 3H3CA 2P33A 1W8CA 5HLPA 4D4SA 3LFNA 2C3LA 3A7JA 2UZTA 5M53A 1UNHA 3QHRA 5C03A 4AOTA 2XM9A 3PPZA 2E9UA 3TJDA 3E64A 5HKMA 4IVAA 2PE1A 3SG9A 3TNWA 3VNTA 4G3GA 3TUCA 3R9RA 4BTFA 4ANSA 4OTGA 4O6LA 5FBNC 2GHGA 5GZ9A 2C47A 5CAQA 1Q97A 4RIYA 5LQFA 4M66A 2GNFA 4CFMA 1BX6A 2RFDA 2I6LA 3ULZA 3GOPA 3UE4A 3E5AA 4QMNA 3K5VA 4AN2A 4D2WA 3DXPA 3ORZA 5AR2A 2VTTA 2C5OA 2W5AA 2C5YA 5HNGA 4MXYA 3UVQA 1OKVA 1ZMUA 1DAWA 5EYCA 4CQEA 4HVIA 3HV6A 4YJSA 4RPVA 2C68A 3U87A 4AFJA 4CCBA 1ZMVA 3TUBA 4ZMEA 2XB7A 3D14A 3FV8A 5CSPA 1QMZA 4XG3A 3R9DA 3NGAA 3VRYA 4I6FA 2CKEA 3LJ2A 5CANA 5AM6A 2ITPA 4WNOA 3VJNA 4FV2A 2XBJA 5HOAA 4YTHA 5M56A 2PE0A 3FMMA 2QHMA 3E88A 5ETAA 2EXMA 3KK8A 4UXQA 4QD6A 4AWIA 1URWA 4QYYA 4FKUA 3S00A 3NIZA 4AGDA 2IVVA 3PSCA 2B7AA 4FG7A 4IZ7A 3VBXA 3MV5A 3VBYA 1OL5A 3UVRA 5GNKA 3UO6A 3PIZA 3HAMA 2BAKA 3H10A 3RPSA 3UGCA 4NWMA 2IW9A 1UU3A 1STCE 3KRRA 4J97A 4O27B 2G1TA 3EQFA 4FOBA 1XQZA 2XIRA 5HE0A 4CZYB 4FKTA 3TUDA 3UPZA 5IQAA 5GIOE 2C6LA 3QUPA 3R2YA 4FV1A 2VGOA 3IO7A 4KWPA 4QMWA 3EYHA 4MX9A 3U4WA 3ZO4A 2JC6A 1M52A 2Y6OA 3KY2A 4W4YA 3BBWA 1WBTA 4RC3A 4Y85A 4BGGA 4JAJA 4YTCA 4EHGA 5EKOA 1OM1A 4G17A 4U97A 4BDDA 4YPDA 4DINA 2ZJWA 4FTCA 1YHSA 3L8VA 4DGGA 3DJ6A 4K77A 2GHMA 4L45A 5EW8A 3C1XA 4I20A 4WNMA 4USDA 4R5SA 2RF9A 1OI9A 2GNIA 3RWPA 5LWNA 1ND4A 1T45A 3EOCA 3R00A 4JG8A 1QL6A 3EB0A 3SQQA 3ZM4A 1ZY4A 2QLUA 5GJDA 4P2KA 3AGLA 1ZYLA 3BGZA 4LQMA 4S34A 5DGZA 5EW9A 1H1PA 3WIGA 2WOUA 2YIQA 3G2FA 3QCQA 5AR3A 1R78A 4D2SA 4EH9A 3DXQA 4O86A 1Z5MA 2B54A 4MF0A 2W1ZA 1G8SA 4UZHA 5FUTA 3CTQA 5IF1A 2A27A 3QYWA 3HP5A 4FKGA 4ZIMA 5IISA 4CFUA 1U59A 4NJDA 2ITTA 4ZLZA 5LCJA 1SVEA 2FSOX 2O65A 4EQCA 3QQHA 5ANGA 5HU3A 4I5CA 3EHAA 5HG9A 3RNIA 2YISA 4NUSA 5CVFA 3ACKA 4RRVA 5BNJA 4C3RA 1CSNA 3KGAA 4BDKA 4DN5A 4U0IA 4OBQA 5EDRA 5DE2A 1P2AA 2J0KA 3VUIA 4TY1A 4QTAA 4L3LA 2P4IA 3BRBA 5KBQA 3EL7A 4O38A 4M68A 4QMXA 4O2ZA 1J7UA 4G3FA 4FC0A 3FSFA 4KBCA 3SXSA 3R1SA 4RJ7A 5ETCA 3PVBA 4WOVA 4AQCA 4FNYA 3JR1A 3OBJA 3R8PA 1GZNA 4KRDA 4MXOA 1ZYCA 2ITNA 5L2SA 3NW6A 4BBEA 4O7TA 3QCXA 1DI8A 2OJIA 2VX1A 4KS7A 5CXHA 2XM8A 3ZUTA 4F4PA 3EH9A 2HXLA 5C4KA 4Y83A 1H4LA 4UY9A 5JZNA 3ZZEA 4R78A 3R7IA 4D4YA 5IQFA 2QOBA 4AA4A 2OJJA 3ZMMA 5CXZA 4E7WA 3MI9A 4DH7A 1YXVA 1V0PA 4ERWA 2X1NA 2WU6A 3S4QA 4BDEA 3OWPA 2XIKA 4EHVA 1YKRA 2X39A 3A7FA 4QMMA 4XHKB 4BWPA 3DV3A 4C02A 1RDQE 2F57A 3PUPA 4DAWA 3BE2A 3UP2A 3QALE 2YIWA 3ZBXA 4BIDA 4AT5A 5HG7A 4BCMA 2UVXA 5DA3A 4IZAA 4CKJA 2FB8A 5CYIA 3AC3A 4ARKA 3LMIA 5KMJA 2OXXA 5DR9A 1BL6A 3LW0A 5E8VA 1BL7A 2B4SB 5C27A 3FMHA 4AGUA 4BCHA 4QPSA 4CT2A 1WZYA 3CTHA 4EK8A 4O7VA 4ZS4A 2ACXA 3A8WA 4EHZA 2V55A 2WTIA 5BYLA 3PXZA 3WILA 2OIQA 4PMTA 5H8GA 3QTSA 5KHWA 3DBQA 5JMSA 5EG3A 4BYIA 3OWJA 3ORTA 5CF8A 5LJJA 3Q5IA 2O64A 2QR8A 2PVKA 4OTFA 4C36A 1PMEA 5EDPA 1OKWA 2GQRA 3G6HA 4CKIA 3PWDA 4YO4A 2HZNA 1UWJA 3CXWA 5FXRA 2HZ4A 2FGIA 3IW5A 4FL1A 5K3YA 4G31A 4I0RA 3TZ8A 3JY9A 4B7TA 2YM5A 2J0JA 1YXUA 2WNTA 1J91A 2BZJA 4JR3A 4UWYA 2OBJA 4D55A 4ZSJA 4UZDA 4CZUA 5FQDC 3P4KA 2XCHA 4CNHA 3AC2A 3E62A 3CQEA 3ET7A 3W16A 2AYPA 3Q96A 1IA8A 2JGZA 2VTQA 3D0EA 4I4EA 4QMPA 1TQIA 5C8KA 3QZHA 3MFTA 3Q9ZA 3A4OX 3H4JA 4TN6A 4AN9A 4FSWA 2HY81 5FEQA 3QRJA 3GCSA 3NUUA 3MY5A 2WEVA 4BI1A 1KUTA 3FLWA 2HENA 3COHA 4PUZA 5TF9A 4PP7A 5ANIA 2BHHA 2UW5A 2XK3A 5FLFA 3GUBA 1JKSA 2Z02A 3SG8A 4Y5QA 4YZ9A 4BDCA 3KC3A 5IA2A 2J0LA 4QOXA 4FL2A 4DFBA 2C6OA 3F3UA 2RFNA 3F2AA 1H1WA 3TN8A 4F65A 1RW8A 5FM2A 3LMGA 1OPKA 3O50A 4MNFA 2XEYA 3OCSA 1GZKA 3LFCA 5IEVA 2G2HA 3VBWA 5HTBA 4H3PA 3HKOA 2PMLX 5K5NA 2VNYA 3RAWA 4Z16A 3EQHA 2QODA 3NYNA 2BKKA 2I0HA 5ITAA 5L3AA 1HOWA 1MRUA 3DS6A 3DU8A 3OW4A 2PUUA 1UNGA 5HO8A 4EWQA 2W1DA 4ZJVA 2OXYA 4E5AX 4N6YA 4Q5HA 4TYEA 2JAMA 4EOJA 4AZVA 4QT1A 5IQBA 3LJ1A 4TL0A 4F9YA 4CFVA 4E73A 3KCFA 4B8MA 1PXJA 3BCEA 5AR7A 3UG1A 4RIWA 1CDKA 5M44A 2UVYA 2OFUA 2BZIB 3R22A 4ZY6A 3CY3A 3I79A 4YC3A 5DG5A 4W9XA 3FL4A 4HPTE 3RAIA 5J7HA 1WBWA 1Q24A 3HYHA 3IW7A 3VUDA 4D9UA 3AGMA 3CPBA 5F9EA 5E4HA 3GNIB 4CFFA 4Y8DA 3N4UA 3DPKA 1PMUA 2R3FA 2QO2A 4USEA 1XR1A 2JDRA 3HRCA 3OMVA 2G01A 2OGVA 2YN8A 3EFWA 2QR7A 3GCVA 4CD0A 4JG6A 3LAUA 4MQ2A 4O22A 3TTIA 4F09A 4LL5A 3LFDA 4PMSA 4MHAA 4BF2A 5IQCA 4PL5A 4DGMA 2BFYA 4YLJA 4FTIA 4K6ZA 3FC1X 4CQGA 4QPMA 3IGOA 4A9YA 2H96A 4FT5A 3QUDA 4DLJA 1F5QA 2CCHA 2CCIA 5EYMA 4DBNA 3HMOA 2W1CA 5HG5A 4C37A 5IQDA 2ERZE 3CQWA 3W2PA 3KN6A 5CAUA 4FL3A 4DG3E 4N57A 5LVMA 2BAJA 4DCEA 5B7VA 4F99A 3ITZA 5E1EA 3D2KA 3RCJA 1H25A 4BZNA 2A4LA 3I0QA 3UPXA 1JKKA 5AP5A 3MH3A 5JQ8A 2BRNA 4EJ7A 4RX8A 2EB3A 3DKOA 3CKWA 3OY3A 4BKJA 4WG4A 3OXIA 2PHKA 3CLYA 4FTJA 3LFFA 5HCZA 4BBFA 3BHTA 2PVYA 3NNUA 2VTSA 2EWAA 3LPBA 4C3PA 2VGPA 1H01A 3RZBA 4DC2A 1IASA 2J0IA 3ORIA 4WBOA 4OAUC 4D2VA 2C4GA 4R5YA 5IA0A 4IVBA 3BLRA 2QO9A 4G9CA 4O7SA 5EM7A 3IW8A 4ZEGA 5JT2A 4C35A 3IDCA 2WQOA 1BYGA 5AP3A 4S31A 1B6CB 2GSFA 4L44A 3ZEWA 1NT2A 2YM6A 3ZONA 1H24A 3VJOA 2CLQA 4A9RA 2I1MA 3V5LA 4JX7A 2EU9A 3P23A 4X3FC 4XOYA 2ESMA 2GCDA 2OH4A 4GJ3A 3FHIA 3PXQA 4M69B 5AP2A 4FUXA 3MH2A 3ZRLA 4ZZOA 2B52A 3E92A 4FG8A 4YZDA 4WG5A 2O8YA 4DH3A 2XA4A 4K0YA 4RC2A 4I24A 5M4UA 3R7GA 3NUPA 5EQPA 3NIEA 2A1AB 2R3IA 2RIOA 4YP8A 4WRSA 2UW6A 3OS3A 3DOGA 3GU8A 3N4VA 3DT1A 4MQ1A 5H2UA 1GNGA 2EB2A 4I6HA 4FV7A 5AV4A 1M2RA 3Q53A 5FG8A 4AS0A 4DGOA 4GMYA 4H39A 4EJNA 5IMXA 1IAJA 3D2IA 4A4XA 4MXXA 4FEUA 3NLBA 3R71A 3BU5A 3R2BA 1UKHA 3KXZA 1ZOHA 4U42A 3BEGA 2CSNA 3SW7A 3L8SA 2ITZA 3POOA 4Z55A 2QC6A 3M42A 4O0SA 3C0GA 4RT7A 4F6WA 4JNWA 4QQTA 5KUPA 3WE4A 3WBLA 3Q32A 4E6AA 3ZM9A 4BI0A 5LARA 1RJBA 3I60A 3CIKA 1LUFA 2YERA 1FVRA 1NA7A 1V0OA 2JEDA 4E5WA 4O7RA 3MFUA 4RZWA 4YJUA 3AD5A 2I40A 3COKA 2Q0NA 3R9NA 3C0HA 4CTBA 2KTYA 4C61A 1IR3A 2QOOA 3QTQA 4MK0A 3ANRA 4GK3A 4IB0A 1Q4LA 2W1GA 3FAAA 4KBAA 4QMVA 1XJDA 5AR4A 5HO6A 2RGPA 4F1MA 4L8MA 2WTVA 3ALNA 4L9IA 3EQBA 1XH6A 2WTKC 3ZU7A 4BZOA 3LHJA 3QQLA 4AZFA 4NYEA 3ANQA 3IDBA 4PWNA 5HX6A 4EZ3A 3U6JA 4HGSA 3A7IA 3VHKA 4FGBA 3S2PA 5H3QA 3KVXA 4J99A 1Q61A 3FKOA 5KMNA 2B9HA 2RG6A 5AV3A 3DFCB 4FUYA 4BVUA 4JX3A 2WQNA 3HLLA 2JITA 4IM3A 3QKMA 4FKPA 5I9WA 3F3ZA 4BFMA 5JH6A 4MNEA 4RFMA 4HPUE 1R0PA 2NO3A 3EKKA 4I0SA 5J1VA 4NIFB 4DEGA 1WVXA 3EMGA 4EYMA 2PK9A 3U9CA 4FIEA 2QVSE 2H8HA 4IJ9A 4XV3A 3FLNC 4L01A 4BTJA 4IAFA 3DZQA 3WZEA 2EXEA 4FIJA 1J1BA 2LGCA 4QMSA 1O9UA 1JPAA 3LFSA 5LOHA 3O23A 4Y5HA 3WOWA 3TZ7A 4MD9E 5M09A 5IQHA 4XG9A 4O7ZA 3LVPA 3HA8A 4IB1A 4JRVA 2X7FA 4NW6A 5HICA 4C2WA 3NSZA 4XLVA 3KB7A 3MIAA 3PXFA 1T46A 3SDJA 2PMOX 2F7XE 2OF4A 1HCKA 4OW8A 4EH2A 3KF4A 4GFOA 2X6EA 3M11A 2ITVA 1E9HA 1GZ8A 5A6NA 3CQUA 4CV9A 1LP4A 4ANBA 5CQWA 3GC8A 5EI2A 2XKDA 4L7SA 3BZ3A 3FY2A 3AXWA 4BDBA 2X2LA 4J53A 4ZY5A 4HOKA 2IG7A 4O0TA 5HZNA 4KUJA 3CKXA 1G3NA 3EFLA 4F6SA 1ZY5A 2J5EA 3HP2A 4I6BA 4X2KA 5AV1A 1KV1A 4ZTQA 3OXZA 2CGVA 5EM5A 2OKRA 4CV8A 3F66A 3I4BA 4FKQA 3LM5A 2X7OA 3H9FA 3ROYA 4OTHA 4C4EA 4RLLA 4EUUA 1JSTA 1MQBA 4ZXTA 2W4OA 2WKMA 4IZYA 2JIIA 4JOAA 3W55A 3ALOA 3ZTXA 3QTZA 4YNEA 5AAEA 3HEGA 3OP5A 3EN7A 5IA4A 1FVTA 1H0WA 1CKPA 2Z60A 4IJPA 2XIXA 3AC5A 4MXCA 3TKHA 3DA6A 5LVNA 3TV6A 4UMUA 2WMSA 4X2FA 3SLSA 4LL0A 5HVKA 2CGWA 2QURA 5HBEA 5JFSA 1KE7A 4K33A 4ZJJA 5KKRB 1B38A 3SC1A 2PUIA 5I0BA 3DK3A 4RZVA 4V0GB 3IOPA 5FEEA 5KKRC 3NEWA 2PVRA 2XYNA 4NTTA 3TIZA 3HV7A 4EUTA 2X9FA 5M08A 1YHVA 1JBPE 2X9EA 3WIKA 3OT8A 3BLHA 4BGQA 4QTEA 1H1RA 3C4EA 4FNZA 3EN9A 4Q5EA 4HNIA 4JT3A 4X2GA 3FXZA 3HVCA 2XK8A 3PVUA 4DT8A 4R3PA 4AZSA 2E9NA 2VN9A 2I0VA 1KE9A 3FMNA 2QQ7A 4AZWA 4E26A 3PP0A 4ACHA 3PJ8A 3FYJX 4O84A 1WBOA 3PA3A 1H1SA 4JR7A 4NEUA 4LUEA 4FSNA 5CT0A 3LLTA 4FSYA 5CLPA 2FSMX 3AMYA 3ZSGA 5J79A 1ZRZA 5E8WA 2ITWA 4KD1A 4EOPA 2EVAA 2VTPA 3H9OA 5D7VA 5HIBA 1PXLA 4FKRA 5BUJA 2ITXA 1H07A 4TW9A 4IWQA 3EZVA 5ICPA 4LGHA 3FHRA 3GENA 1BI8A 3QX2A 4MXAA 3VQUA 4RIWB 4V04A 4IXPA 5DMZA 4AUAA 3EQIA 2GFCA 4H36A 2B9FA 4JDIA 4O0VA 3RBWA 4ALVA 5E1SA 2OZOA 5AP0A 4UMPA 4O0YA 1OUYA 2W05A 4RVKA 4UALA 3BYUA 3VO3A 1XO2B 4XP0A 4C38A 4EWHA 4ANNA 2R3RA 2UZWE 2WIHA 3E8CA 3RP9A 3TNQB 1QPDA 3DZOA 2VWXA 1A48A 4ZOGA 2WZJA 1QCFA 4I0TA 2OXDA 2XRUA 4G3DA 2EUFB 2IW8A 4IHPA 4TXCA 4U79A 4BY9E 1MRYA 3ORNA 1GIIA 5C8MA 4O7NA 4AXAA 1S9IA 1H00A 4FX3A 3VUGA 3GU5A 3TNIA 2IWIA 3KCKA 4EEVA 1OIYA 3F82A 4V01A 4FBXA 2OJGA 4I22A 3W32A 4OTRA 4P5ZA 4CFXA 2ZM4A 3MVHA 1KOAA 3BV2A 5I3RA 3RAKA 4RX9A 3C51A 4GT4A 3KFAA 3O17A 3HX4A 4GG5A 4L53A 5DT3A 5TO8A 4DG2E 3HV5A 2IVUA 3M1SA 5CU2A 2JKKA 3I7BA 3DJ7A 4FIIA 4TYJA 2PUNA 3JVRA 5IEXA 4FSMA 3BYVA 3RK5A 3HAVA 3QFVA 4AW1A 3MY0A 1LEZA 2Z7SA 3KRLA 4I5MA 4J96A 5KMMA 2GNGA 4X6RA 5C9CA 4PDOA 5IUHA 4L67A 1XHAA 5HVYA 2P3GX 3DQXA 3R8VA 2VTOA 4XG8A 4OR5A 3F3WA 2Y4PA 4U45A 4FMQA 3HUBA 4QNAA 5C01A 2FH9A 3UOLA 2C3KA 5JEBA 1YOJA 3FWQA 2DUVA 3OF0A 4FSUA 4TWNA 2X0GA 3C4FA 3OCTA 1PJKA 2ZMCA 1Q62A 1WBNA 4U6RA 5EOBA 2YCFA 3ZSIA 1WMKA 4BC6A 5CI7A 2EXCX 3F5XA 3OG7A 3WI6A 3LIJA 4OTIA 4E6DA 4AAAA 3UDBA 2Y7JA 3LFQA 4XBUA 3FMDA 4A4OA 1HCLA 3N51A 3IW6A 4FEWA 3TXOA 3LFAA 2BRHA 5AP4A 5FEDA 5E91A 3GC9A 1XH9A 4XMOA 4U40A 5EW3A 3SA0A 4HW7A 3TIYA 3PJCA 1ZLTA 3IDPA 3KXGA 1YOMA 3VBQA 5AR5A 4EYJA 1G5SA 5HCYA 4F9BA 4I94A 5DPVA 2PVHA 4X6QC 1KE5A 4DEBA 3QZIA 4K9YA 3AOXA 5KMLA 5HORA 4TKSA 1UU8A 4QYHA 4OTPA 4X3FA 5AMNA 4PRJA 1LEWA 2VTHA 2XIZA 4LM5A 3EZRA 2VNWA 3CE3A 3RI1A 1IAHA 4G6LA 1KOBA 2PZRA 4USFA 2BRGA 4M69A 2YHVA 4E5BA 4BI2A 3R02A 1WBVA 2UZNA 5GIPE 4MCVA 4IFCA 4J71A 4HVGA 1J1CA 2PY3A 3M2WA 4OTDA 4E8AA 5JN2A 5CS6A 5IDPA 2VWIA 4FKVA 4PX6A 3ZXTA 2R4BA 3QZGA 3W2SA 4KRCA 4E93A 3EIDA 1OPJA 1VR2A 3MH0A 4QO9A 3BU6A 3E8NA 4NL0A 5FDPA 3PLAE 5BVDA 4FSZA 2B0QA 4CLJA 3QRIA 2VWZA 3W2CA 4YJRA 5FBOA 5L6OA 3CR0A 2VX0A 3ZFMA 4A06A 2J2IB 4FTNA 4BYJA 4DFYA 3PE1A 1BMKA 3C13A 3CJFA 3IG7A 3WYYA 2J4ZA 4BICA 2JFMA 2QONA 3MJ2A 3WF5A 3Q2MA 5BUEA 3Q3BA 4GG7A 3VW6A 4UX9A 1IG1A 3F3TA 3MY1A 4IB3A 4C4JA 3D5WA 5IQEA 4QQJA 4BZDA 2Z7LA 5BYZA 3UNZA 2XKCA 2P55A 5AWMA 4L00A 3E8EA 3C4ZA 3A4PA 5IU2A 5CU0A 5ETIA 3BQRA 4OBPA 4WD5A 3FLYA 4ANLA 4OAVB 3B8QA 4FICA 3QRTA 4IX4A 3W8QA 3TCPA 4N0SA 2XH5A 1XH7A 1XKKA 4CRLA 4ENXA 1YI3A 2QOLA 4MNEB 2OW3A 4IAYA 3ZEPA 4QQCA 1MRVA 3FQEA 2C5VA 2O5KA 3G90X 4DA5A 3AG9A 3QD2B 5L2IA 3KMUA 5BVKA 3SXRA 3KF7A 4PDSA 5L8LA 1CKIA 2R3PA 5HHWA 4BDAA 4AOJA 3ORPA 4DG0E 4YC8A 5GZ8A 4ZSGA 3IECA 3FC2A 4BGHA 4QNYA 4R8QA 1Y91A 3ZRKA 5HG8A 4ZK5A 2W5HA 3WZKA 4D1SA 4FKJA 3DK6A 4GRBA 5BYYA 1P5EA 1FINA 3RALA 4MAOA 1W84A 5DWRA 3VWAA 1R3CA 3P78A 4EH5A 4FV5A 2YJSA 3EQCA 5CTPA 2JFLA 3Q6WA 4DFLA 2BTRA 3QXPA 4FK6A 4YJTA 3BLQA 2R2PA 1WFCA 1PKGA 4M84A 2I7QA 5KE0A 3GCPA 2F9GA 4QP7A 5AUYA 3KQ7A 2C1AA 2Z8CA 4Q2AA 1PMNA 4WHZA 3R21A 5EM6A 4R7IA 1XBAA 2E2BA 3GVUA 1VJYA 4CRSA 4EH8A 3LMHA 4DBXA 4NIFA 3A62A 1NVQA 1EH4A 3SXFA 4B0GA 4D2PA 4FNXA 1M2PA 3P1AA 4G2FA 2FUMA 2CKQA 2Q0BA 3OUKA 3U4UA 2IVSA 3VF9A 3GB2A 4BCNA 5M4IA 4EI4A 3RGFA 4GKIA 1OL7A 2XNGA 4U44A 2XJ1A 4ZTHA 1REJA 3VBTA 4C59A 5CF6A 5JGDA 3QA0A 5DR6A 3FI2A 2WPAA 3MH1A 5FDXA 5HNBA 2WFYA 1BLXA 3PG3A 1ATPE 4EORA 2XK6A 2XBAA 3H0YA 3KN5A 2NPQA 3V04A 1YI6A 4CGAA 5C4LA 4O0UA 2H9VA 3TI1A 3L9NA 5DEWA 2B1PA 3HDNA 4H58A 1OITA 2Z7QA 2UW0A 2X7GA 3C4CA 3WZUA 3W33A 2VO0A 4LUDA 3QA8A 1KV2A 1YVJA 4NW5A 5DN3A 2NRYA 3A2CA 1H28A 4I23A 3DKGA 4I1ZA 5E8ZA 5HLWA 5DIAA 2ZAZA 4RX7A 3ATSA 2JIVA 2VTRA 3RHXA 3ZCLA 4IADA 1J3HA 3C0IA 5DH3A 5FXSA 4AT3A 2W99B 2J90A 5B2KA 2O63A 4CT1A 1KE6A 1YQJA 2WO6A 4GUBA 4U43A 1DI9A 3VC4A 3E3BX 2XJ0A 3T3UA 4AA5A 3AT2A 3QQUA 3JY0A 2XKEA 3U8WA 4EOLA 5E9EA 4FODA 2BTSA 3EQRA 4TNBA 2WOTA 2BUJA 2JKMA 1CTPE 4BCOA 4KKEA 4RWJA 5T3QA 4AF3A 2BIYA 1JSUA 3FDNA 3R7OA 5A4CA 1V1KA 3SX9A 4X0MA 5AADA 3G5DA 4FT0A 3NCGA 5A4TA 3FMLA 1PW2A 1OMWA 2ETRA 3IS5A 4FF8A 2WTCA 5C26A 3K5UA 4HCTA 4G3EA 5HIEA 3U55A 2VTNA 3E8DA 3PA5A 4V0GA 4W4VA 4YLKA 4ZJIA 4C34A 3KMWA 3QTXA 4EONA 4F63A 5JGAA 4LMNA 1MQ4A 4TYHB 3CGFA 4UB7A 3UYSA 2YM4A 2HZ0A 3DCVA 1UU7A 4XV2A 4TYIA 4HVDA 3R63A 3UQCA 4KKGA 3AQVA 4QMQA 3HZTA 3DAKA 3DDQA 4DEAA 1ZWSA 2GFSA 2I0YA 3DBCA 3GFWA 4M14A 3PIXA 4BDJA 4F6UA 2FO0A 3ID6C 3D5XA 4CYJA 1Q5KA 2BRMA 3UZPA 4DT9A 2IZTA 3B8RA 4H3BA 4IM0A 4O21A 4UYNA 4AZEA 4CYIA 4GT3A 4TT7A 4WKQA 3KL8A 1APME 2KULA 2ERKA 3QAME 5CZIA 4ZP5A 3O7LD 4M15A 4PF4A 2RKUA 5AP1A 1K2PA 2X8IA 3RWQA 5IPJA 3VUHA 3MESA 3ZZWA 3K2LA 1OPLA 5HQ0A 2GQGA 4MBIA 3QQGA 2G2IA 1OUKA 4BCJA 4IVDA 5AP6A 2OIDA 2F2UA 3BHUA 4O1OA 5IA1A 3R04A 4MEDA 4PY1A 2WXVA 3N9XA 4YHJA 3WZJA 4ZLYA 5M51A 3K3IA 4OTWA 4OUCA 1B39A 5DYJA 3CPCA 2C6EA 4KB8A 1X8BA 3LCKA 4I6QA 2YJRA 1IRKA 1XH8A 4FZ6A 5HD7A 2UZOA 5I4NA 3NAXA 4U80A 2WAJA 5A14A 2G15A 3HV4A 4PDYA 3U54A 3AC1A 3DKFA 3EN5A 1YWRA 3EWHA 4NT4A 4HVSA 4LGDA 4R1VA 3BE9A 5K4JA 4EC9A 4IVCA 2X6DA 4JS8A 3DFAA 4BBMA 4F7SA 1UA2A 4BR3A 2OICA 3QU0A 3ZFYA 1URCA 3Q4TA 3UMWA 3UP7A 1NVSA 4O2PA 3LCOA 5FTGA 4FG9A 4PPBA 3ZFXA 1Q3WA 4QMUA 4S2ZA 3FZ1A 4A9SA 1Y57A 5D11A 2CNUA 4F7JA 2WHBA 5HBJA 4XRLA 4W9WA 3NWWA 5IH6A 4O82A 3LXNA 3DNEA 3KMMA 3NUXA 2ZDUA 1YDRE 2YDIA 1SM2A 3QC4A 4FYOA 4RQVA 3Q5ZA 4EZ7A 3OC1A 4CKRA 2VTLA 4MBJA 2R3GA 4BWXA 3F6XA 1YDTE 4ZSAA 3FLSA 4I3ZA 4APCA 3I6UA 3QYZA 5FD2A 3UTOA 3VN9A 4GT5A 1OBGA 3THBA 4DITA 1OL6A 2R3QA 5CNOA 4QPAA 3Q9YA 1DS5A 3FLQA 2XIYA 3LCTA 4FZAB 5J9ZA 4G3CA 3P08A 4C33A 3PXYA 2XEZA 1A9UA 2R9SA 2GPHA 3QCYA 3VUKA 3UC3A 3RINA 2UZEA 3HGKA 3PXKA 4JQ8A 3DXNA 3K3JA 3QZFA 4TPTA 4BN1A 1O6YA 2XP2A 3CP9A 3GP0A 3PE2A 2A0CX 3MB6A 5HE1A 4X3FB 2C6TA 1JSVA 5D1JA 3R7UA 3ZLSA 5HE3A 4AACA 5ANKA 1AD5A 3TL8A 5IUGA 3MFRA 4HZRA 4BTMA 2O2UA 2YCSA 3NYOA 3UG2A 4ZS0A 3BGPA 4D1ZA 2GDOA 2YWVA 2X8DA 2ZDTA 5A4LA 5K5XA 4I92A 1MUOA 3EKNA 1ZMWA 3EN4A 3RPOA 3S95A 3S1HA 2JLDA 2VTIA 3GOKA 1PXPA 3UO4A 4GVJA 3ZOSA 3F7ZA 2QOIA 3OTUA 3COIA 4RMZA 4RA5A 5A3XA 2CJMA 5K0KA 4NM7A 4J52A 1ZZLA 2PL0A 4XH6A 1GAGA 4IM2A 1NXKA
chains in the Genus database with same CATH superfamily
3HMNA 1DAYA 1IA9A 2VZ6A 4UMRA 3BI6A 2ZV7A 3BWJA 5M4FA 3QL8A 2CHLA 2Y8OA 4ANQA 2WQEA 2OK1A 2OZAA 3FMEA 4DEHA 4HGLA 4R3CA 3WF8A 5KO1A 2ONLC 4IEBA 3S3IA 4EBVA 5AV0A 3Q2JA 4G1WA 2AUHA 4QMLA 3E7VA 2NYAA 1SMHA 2R3OA 2JDOA 2ITYA 2QKRA 3FQSA 4PL3A 5AAFA 4AW2A 1ZYDA 2PUPA 3GXLA 1YDSE 5CEPA 1ZXEA 2W7XA 2OH0E 3KK9A 4N6ZA 3FZOA 1OL2A 5AA8A 2XS0A 4BKZA 3AT4A 3V8TA 5IQIA 3QKLA 4FYNA 3GQLA 2NP8A 5E92A 3IW4A 4ZSEA 3VAPA 1Y8GA 4BHNA 4NH1A 5EI8A 5AUWA 3VQHA 2W4JA 4BJJA 3GCUA 4I4FA 3Q4CA 2W1EA 4IANA 4C4GA 3C5IA 5BQ0A 4N4SA 5AX9A 1SNUA 2B53A 4ASEA 1ZZ2A 4ALWA 4H3QA 3RNYA 5ACBC 3OTVA 5ANJA 5J1WA 4GFGA 4S33A 3RJCA 5AUTA 2QOKA 3PPJA 4LGGA 3Q6UA 2WTKB 4NSTA 5JFWA 2OJ9A 3A8XA 2VAGA 2GS7A 5FP6A 2F2CB 3PPKA 5EM8A 3T3VA 1M17A 2R0IA 1E1XA 3O96A 4NM3A 3R7EA 4GV1A 5CF4A 3FI3A 4GSBA 2VO7A 4HZSA 5CENA 1ERKA 4ACMA 2UZLA 4IX6A 2UZDA 1PXKA 4KIPA 4X2NA 1VEBA 4BCPA 5KZ0A 4HVHA 3LLAA 1Q8ZA 4G6OA 4JBVA 4LRJA 4Z7GA 3DJ5A 3HDMA 5L6WL 3UDTA 4RA4A 3U9NA 2OG8A 5CALA 1ZAOA 4RJ8A 3V6SA 4BRXA 4DEDA 1WCCA 1I44A 2JBPA 4QDEA 3IKAA 2R0UA 3NW5A 3W0NA 2YZLA 4DGNA 1JLUE 2Y0AA 4WNKA 4D5KA 4XJ0A 4G5PA 3UIUA 2OU7A 4Q9ZA 1ZYSA 4EOMA 2FVDA 4DTKA 4M0YA 2QU6A 3TNPC 5M06A 1JQHA 2CMWA 3IQ7A 1JWHA 4BCIA 3MVLA 4NTSA 3BV3A 3GT8A 1VZOA 4FZDB 1BUHA 3FPQA 3ZC6A 4BL1A 5CASA 4MH7A 4HJOA 3RPRA 2HCKA 3ZXZA 3DTCA 4JRNA 3NZ0A 3EFJA 3G9LX 2QOCA 2J51A 2REIA 1UWHA 4QMZA 5CSHA 5ANOA 5BVFA 1Q99A 2X0PA 3QD4A 3RKBA 3JUHA 2XAMA 4YJQA 1TKIA 3R01A 3PTGA 5I3OA 5C8NA 2GNJA 2OLCA 3QBNA 3O7LB 4P90A 2YWPA 2YFXA 3O8TA 5AR8A 2R3KA 3MA3A 4R7HA 4M7IA 2ZV8A 4AU8A 1PMVA 4JAIA 3D83A 4ONAA 3CJGA 4UN0C 5LVOA 2OF2A 4FTUA 3BLAA 3V8WA 3AKLA 5JFXA 4FTLA 3LXLA 1Q8WA 2GTNA 3MWUA 4RVTA 5LVLA 1ZOEA 2IZRA 2J50A 1H27A 3A99A 1QPCA 3ODZX 3UZTA 5EQEA 4D4RA 4FI1A 3HRFA 2AQXA 5TE0A 4C2VA 1GJOA 2PU8A 4LOQA 1M7NA 4IIRA 2XNOA 3K54A 2C3JA 3G0EA 4U5JA 4F1OA 4UEUA 5BMSA 4W4WA 5EYDA 5AUVA 2IF8A 4KABA 5HI2A 3A60A 4IWOA 4RFYA 4DFNA 3F61A 2XRWA 1OIUA 3FZTA 3PRFA 4LRMA 4QP9A 3TDWA 3PJ3A 2WMUA 4H05A 2X4FA 4IAKA 2XZSA 3R7YA 5CAOA 4YC6A 5GINE 4EH7A 3V5JA 5DT4A 3UOHA 3NVKI 2YAKA 4IFGA 5HX8A 4O7YA 5DBXA 1P4FA 3NUNA 2WTJA 2WMVA 3DTWA 3MS9A 2IO6A 2UZBA 2E9VA 2HWPA 1OGYA 4N70A 3QTWA 3QQKA 3LM0A 3OOGA 3LOKA 4JQ7A 3CD3A 5LMAA 1PXOA 5LMBA 2JKQA 4JBQA 4AXFA 3KXXA 4F0GA 4ASZA 3DAJA 4GW8A 3R9HA 3VW8A 2JAVA 5EH0A 3MGYA 4L42A 2HWOA 3MBLA 4O6EA 5AIKA 2W5BA 4ACGA 2P2HA 3HV3A 3RMFA 4WSQA 2OIBA 4FR4A 5CEKA 2QU5A 3TV4A 3OD6X 2AC3A 3Q9WA 4YURA 2VUWA 4WA9A 2RL5A 2QCSA 5H9BA 5T6KA 3NS9A 3V5QA 3Q04A 2C0IA 4IBMA 4LV8A 5TOZA 4DGLC 3OY1A 4MBLA 3GCQA 3OHTA 1FVVA 4QEBA 1GIHA 4XBRA 4TWCA 1FMOE 1R39A 3D5UA 3MW1A 4RSSA 3UVPA 5B2MA 3CBLA 4ZZMA 3TMOA 4XG7A 2A19B 3HECA 4CG9A 1FQ1B 3DAEA 3SGCA 5AX3A 4L46A 3DK7A 4RIXB 4KKHA 2BPMA 4JG7A 4KS8A 2XK4A 2X81A 5CI6A 1VYZA 2ZM1A 3OEFX 4E4NA 5A54A 2W1HA 3FZPA 2BZKB 4TYHA 3VHEA 4PMPA 1YHWA 4Q9SA 1H8FA 4FV8A 4XNEA 2V7OA 5DI1A 4D5HA 3UOKA 4MD8E 1W2DA 4BHZA 4DH1A 3OROA 4MD7E 4PPAA 3CS9A 4FSQA 4FTOA 4FA2A 1UU9A 2HK5A 5E8XA 4AE9A 2WELA 1UNLA 4H1MA 3C4XA 2YCRA 2WQBA 3FXXA 4YTIA 2HY0A 3SV0A 4CG8A 5E8YA 4MXZA 3E87A 1XWSA 1K3AA 4RIOA 5CEQA 4EZ5A 2XNEA 5L8JA 5CAPA 5HE2A 3I81A 1PRYA 4XUFA 3U51A 4XS2A 4CFNA 2J7TA 4D0WA 3I6WA 3RPYA 4M12A 4DEIA 4PTEA 3ZYAA 4I5HA 4D28A 3NUYA 3TG1A 2BDJA 5J95A 3GC0A 2VTMA 2R64A 2R7BA 1KWPA 4RJ6A 4XP3A 3TNHA 1PXIA 3MTLA 4KIKB 4TWPA 2W1IA 2E9OA 3WARA 3R0TA 3DLSA 5CU6A 4J8MA 5HNIX 4KBKA 2HELA 2QOFA 3H9RA 3PLSA 4JDKA 4O91A 5CQUA 5FWKK 2YDKA 3D7TB 2QLQA 5IA5A 3CGOA 3JS2A 3BWFA 5I9VA 5AEPA 3G0FA 3TTJA 3CD8A 2C5XA 3ORLA 2R3HA 1G8JA 1W0XC 4Y95A 1PHKA 2CGUA 5CF5A 4RWLA 4MYGA 2YABA 4R6VA 1PYXA 4RG0A 4RVMA 3V01A 5IH4A 2YCQA 1O6KA 3II5A 5J7BA 3HMMA 4XX9A 4FVRA 5M55A 1YRPA 4NKAA 5D9HA 3R83A 3C9WA 3TM0A 3R8ZA 5HCXA 3QD0A 2W9FB 4ITIA 3Q4UA 4JXFA 4X3JA 4FTKA 2QO7A 4RQKA 1JKTA 2YITA 5TT7A 3ACJA 2OI4X 5FXQA 5AUXA 3P7AA 2DYLA 3FLZA 2J9MA 2PZPA 3LQ8A 1OIQA 3P9JA 4XRJA 3DBEA 3NUSA 3TKUA 3AT3A 4CMTA 3F2RA 3JVSA 2G9XA 2PMIA 4JI9A 3IOKA 5I9XA 4AN3A 3DDPA 3R6XA 3L8PA 4WRGA 4YJNA 3BIZA 3QD3A 3ODYX 4BIEA 1BKXA 5GHVA 3JPVA 2RFEA 2RFSA 4RJ5A 1H26A 4QMOA 4UWCA 5EI6A 3ETAA 3SOAA 3ATTA 4OGRA 4DF3A 4YPSA 3C4WA 3IONA 3V5WA 4CXAA 3LXPA 3I5NA 4D9TA 2OZAB 4ZTMA 3R1QA 3UNKA 3FKNA 4G6NA 4J98A 4JQEA 1NW1A 4FV3A 3WF9A 3O0GA 1L8TA 4QP4A 2C1BA 2PWLA 2DQ7X 3F9NA 3L8XA 1GY3A 4FV4A 3AMAA 2BRBA 3R30A 4AFEA 3NFGB 2DWBA 4RX5A 3ENMA 3FUPA 2ZVAA 3FBVA 3FZRA 4ZZNA 5HEZA 3O8UA 5L6PA 1U54B 3QLGA 2YM8A 3ZO1A 5J9YA 1E1VA 2AEGA 3CTJA 3F3VA 4FT9A 2GQSA 3VULA 4EKLA 1Z57A 2C0TA 3BHVA 5CU4A 5LMKC 4CCUA 4BJJB 1ZOGA 2VX3A 3PVGA 1PXNA 1R0EA 2AC5A 4UV0A 3WE8A 2GU8A 5D12A 3DQWA 1WVWA 3MVMA 4B9DA 4I93A 3OOMA 4NK9A 4TWOA 5KHXA 3MSSA 5DRBA 4BIBA 4DFUA 4RJ4A 1R1WA 1RE8A 2NRUA 2ONLA 4NJ3A 5IH5A 1H1QA 3I1AA 2I0EA 5KCVA 1YW2A 5BPYA 4FV0A 3PFQA 4TZRA 4UBAA 3G51A 3NAYA 2BAQA 5KBRA 3QC9A 2XNBA 4QYFA 1J7LA 2VWWA 3FMKA 4GFMA 4EOOA 1SNXA 2PVJA 4L43A 5JRSA 4D1XA 3AD4A 1W83A 1OIRA 2R3MA 3P79A 5BVWA 4EBWA 1U5RA 4JIAA 1FGKA 4AW0A 3LQ5A 1PY5A 5I9UA 4Z9LA 4AP7A 1U46A 1L3RE 4NZWB 5CEIA 4ANMA 1PYEA 2BILB 3AD6A 4FIGA 4ENYA 3DB8A 5CAVA 5HD4A 2ZB0A 3R9OA 5GZAA 1ZARA 3EQPA 5EQYA 1W7HA 4C57A 3L9MA 2WEIA 3PWYA 3G6GA 5F1ZA 2WMRA 4GK4A 4P7EA 3MA6A 2VWBA 3AMBA 2B9JA 3R8MA 3VS1A 4M97A 5AFVA 1F3MC 4MWIA 4OT6A 4ZY4A 1GIJA 3HL7A 3V6RA 2CNVA 4O81A 4XV1A 1FGIA 1WVYA 4MUQA 4R1YA 2ITUA 3FJQE 3GU7A 3MB7A 4RVLA 4U3ZA 5LCKA 3VVHA 4A4LA 4E20A 2HAKA 1OKZA 2XKFA 2XMYA 4C3FA 3PJ1A 4E6CA 3V8SA 4AXEA 3QTIA 4Z7HA 3VUTA 3REPA 5EHOA 5IKWA 3KXMA 5LVPA 1XBCA 1TQPA 4NFMA 4YSJA 2PULA 3AKJA 2UW3A 3O51A 1FMKA 4LV5A 4MWHA 2QG7A 2IJMA 2IN6A 2B9IA 5L2QA 3FQHA 3Q60A 1YXSA 3TDVA 4O7WA 5EKNA 5CSXA 4GVAA 4F0IA 4O7LA 3KRXA 2G2FA 4NKSA 3FPMA 1FOTA 3RZFA 4CZTA 4EQUA 5HBHA 5K0XA 2YDJA 4F08A 3ZC5A 4IC8A 3RPVA 4L6QA 5E8TA 4ZTLA 4EK3A 2JD5A 2BZHB 1OVEA 4PPCA 5A46A 4ACCA 2XNPA 2UZVA 3LFBA 4D4VA 2P2IA 2W1FA 4QDVA 4NCTC 3GQIA 4HGTA 2J6MA 5E90A 2XK7A 2JIUA 5M4CA 3EN6A 4HGEA 4B8LA 3V3VA 4AE6A 2B55A 4E6QA 5FRIA 4UMTA 3C50A 2GNLA 2IPXA 2XJ2A 4FSTA 4IC7A 3O71A 3VF8A 2Q83A 3QQFA 3A7GA 3LCSA 2BDFA 2HIWA 3ZSHA 3KA0A 4AOIA 3KU2A 4GCJA 4JDHA 4YGAA 4UYAA 3EYGA 5A4QA 2Y9QA 3BYSA 4CFWA 5AA9A 5I5ZA 3KULA 4IX3A 4YBJA 1YI4A 4E4LA 4LMUA 3F5PA 4GL9A 4JMQA 3P0MA 3MYGA 4D58A 1W2FA 1M2QA 4C4IA 1VLRA 4NFNA 4L68A 5JKGA 5A6OA 1Q3DA 4GIHA 3W2RA 4OBOA 3NNVA 4WBBB 3ZUUA 1A06A 3FEGA 5KNJA 3PA4A 3D15A 2ETMA 4WG3A 4GIIA 2V7AA 4O0WA 2BDWA 4NM5A 5DR2A 1Q8YA 2WTDA 2YIRA 3SHEA 5CSVA 2IZUA 3OFMA 3POZA 2UZUE 2XANA 3WF6A 5CEOA 2GTMA 1W82A 5IUIA 3ZLYA 5L2WA 4J7BA 2OFVA 3BHHA 3PY0A 1XH4A 5TR6A 5CU3A 3QWKA 4FKIA 2C5NA 3NNWA 4I41A 4E4MA 2YLEA 1QPJA 4PNIA 4ZAUA 5CVGA 5L8KA 3PSDA 3O8PA 1VYWA 2QKWB 5AP7A 4X7QA 4YZCA 3OBGA 3V51A 3EL8A 5HU9A 3N4TA 2CNQA 4ZTSA 4K11A 4GU9A 2UW4A 4M67A 3MVJA 4AX8A 2PMNX 4FVQA 5DLSA 3O2MA 4C0TA 5B2LA 5L2TA 4GUEA 3R1YA 4MF1A 5EFQA 4F0FA 4DH8A 4LYNA 1OBDA 3UNJA 2H6DA 3JYAA 4O0XA 3EQDA 2PVLA 3T9IA 5IA3A 5KMIA 4V05A 3TZMA 5J5TA 2W0JA 5BVNA 3BYMA 3FI4A 3GC7A 2OWBA 3RK9A 2XNNA 2BVAA 3QWJA 4BWKA 3UBDA 5JK3A 3QXOA 4HNFA 4D2TA 4CEGA 2R3LA 4FKOA 4YSMA 4M3QA 3QGWA 2F49A 1Y6BA 2XK9A 2WB8A 5IMEA 5CZHA 4J8NA 4TRLA 5CT7A 1G8AA 3CCNA 4IZ5A 2W4KA 3TACA 4C58A 4P4CA 4B99A 4FTRA 2RSVA 5HGIA 4YZMA 2QD9A 4XEYA 4YU2A 3W1FA 3NUAA 1AQ1A 1YXTA 2J0MB 4LRKA 4YHTA 2JKOA 4DTBA 4EH4A 1OZ1A 4EL9A 2CLXA 3SVVA 4LI5A 3AC4A 2BIKB 2FSLX 4BCKA 2UW9A 2V0DA 4O0RA 4JLCA 2JDSA 3LZBA 4BDGA 4C4FA 3PG1A 1NY3A 5D10A 2SRCA 3VRZA 1S9JA 4DEEA 3BHYA 4FVPA 2R7IA 5CY3A 3R7VA 3TEIA 4F70A 5L4QA 3BELA 3MJ1A 4FEVA 4ID7A 2LAVA 4A07A 3LKMA 1ZYJA 4K18A 4I21A 3MPTA 3KRJA 4RIXA 3R8LA 3G15A 3PP1A 3PZEA 4QMYA 4CSVA 5KX8A 3W2OA 3TJCA 4OLIA 4K8AA 4XG4A 3L9LA 2VD5A 3PY3A 2W06A 1MP8A 4ZSLA 5G6VA 1F0QA 3BKBA 2X0OA 2GHLA 2ZYBA 4U8ZA 2WMTA 1OL1A 2YIYA 4QP8A 4LOOA 4EC8A 4QMTA 5DEYA 5CWZA 4EK6A 2V5QA 3ROCA 4QYEA 5AM7A 3QUEA 2QG5A 3ZO2A 1P4OA 5J87A 4BDFA 4YUQA 5DHJA 4FIFA 3DB6A 3IGGA 5CX9A 1XBBA 2ITQA 4ZTRA 4YO6A 4EH3A 3GEQA 4YZNA 2HW7A 3GFEA 1U4DA 3DLZA 2C6DA 2ZB1A 4M13A 5F20A 5GJFA 5AAGA 2CN8A 2XYUA 4EOSA 5EHYA 5HVJA 3KRWA 4FV9A 3UJGA 4EKKA 3BX5A 3D5VA 1JOWB 3WF7A 3QLFA 3UIMA 2P0CA 4GH2A 4IAZA 1AGWA 3COMA 4DTAA 3JXWA 2WIPA 3B2TA 3EFKA 2ZOQA 5BVOA 2YEXA 4LOPA 4DHFA 4KIKA 2W96B 4O96A 1GZOA 5J9LA 3RAHA 3I5ZA 2WMQA 3TWJA 3P5KA 5KMOA 5ACKA 2YA9A 4FTTA 4AGWA 3T8OA 2QHNA 3UYTA 3QHWA 1FBNA 4IB5A 4FV6A 4XP2A 2OSCA 4F9WA 3D7TA 2WGJA 4EH6A 4RJ3A 3NNXA 3LFEA 3PJ2A 5DVRA 4R3RA 4HCVA 3DGKA 5HTIA 2HYYA 2J5FA 3RHKA 4DLIA 4CTCA 3RM6A 1YXXA 3IPHA 4JBOA 3NYVA 4U7ZA 5FM3A 4RIYB 4WUAA 2ZV9A 3ORMA 4YHFA 3PDTA 4QP2A 5BX0A 5K4IA 2UW8A 4XCUA 4FZ7A 4JJRA 3PSBA 1Y6AA 3EJ1A 4W8DA 1OGUA 3VS0A 4GK2A 3B2WA 2E9PA 5TKDA 3E63A 2ZV2A 4H1JA 2VWUA 3GI3A 4QTBA 2X4ZA 3SRVA 1OB3A 4EK5A 4IH8A 3ORKA 3HMPA 1M14A 2PPQA 3E3PA 2YAAA 1TZDA 2PZYA 3BQCA 3W0RA 3D7ZA 4F64A 3NMUF 5M07A 4EK4A 4GKHA 3ZDUA 5FTOA 3UO5A 3R1NA 2ZM3A 3DKCA 3OCGA 3VS6A 2PYWA 3KXHA 3A7HA 4FKWA 5AUZA 5BVEA 3ZS5A 2ZFYA 3D4QA 1WAKA 3F2NA 4RLKA 2NNWB 4QP6A 5HTCA 2CKOA 3UZRA 3BYOA 4W8EA 2W17A 4KSPA 3RVGA 2R3NA 4IW0A 3ZLXA 4BTKA 4FIHA 5J5SA 1KSWA 4FZFB 4R7BA 3MFSA 2VWVA 4GU6A 4LG4A 3SAYA 3CSVA 3T9TA 4BKYA 5IDNA 4ZLOA 2CKPA 2ITOA 3SOCA 4DE4A 5FGKA 1Q8UA 3FL5A 4PMMA 5JRQA 3OVVA 5DNRA 4FTMA 2OO8X 4FKSA 1W98A 4WIHA 3VS2A 2IW6A 3BGQA 2WMWA 4F9AA 4QQ5A 3UIBA 4O83A 4ZMFA 5T68A 3FSKA 2C6MA 3F5UA 5H8BA 4YJOA 4B6LA 4QP1A 5IQGA 3VS3A 4ITHA 2C0OA 2VU3A 2X8EA 5DT0A 3IK3A 1SVHA 4IMYA 1JAMA 1U54A 2QOHA 4Z3VA 2PE2A 4HCUA 2UUEA 5HESA 1SYKA 2Z2WA 5LMKA 4K1BA 2VO6A 4CVAA 3ZRMA 5ANEA 5AV2A 5CNNA 3GBZA 4FT7A 5G1XA 1WBPA 4PDPA 4YZBA 3P7BA 3MDYA 4XYFA 4KSQA 4UWBA 4B4LA 4FTAA 4CMUA 4BCFA 2CN5A 5E8UA 3FKLA 3FY0A 5D7AA 3TT0A 4FNWA 4APPA 3P86A 1CM8A 2PSQA 3PYYA 4U9AA 3SW4A 4ACDA 1U5QA 4ORKA 1WBSA 4PP9A 2QI8A 2PZIA 4IDTA 3PY1A 3VUMA 3LQ3A 5ANDA 4BDHA 4ASDA 3QTUA 3QCSA 1J7IA 3LXKA 4L3PA 1REKA 4J95A 4ALUA 4IAIA 1P14A 5E7RA 4BCQA 2PTKA 5IG1A 1Z9XA 4YR8A 2Z7RA 2VWYA 2GS6A 3UODA 5JSMA 2BALA 4S30A 3BPRA 4YTFA 3KXNA 4J1RA 3KEXA 3U6HA 1NVRA 3NDMA 4JBPA 4O1PA 4C7TA 1CKJA 4BB4A 2BROA 1PKDA 4IWPA 1KE8A 1Q41A 3DBDA 4JDJA 5AUUA 1YOLA 1XH5A 2PVNA 2CPKE 2WD1A 3QTRA 3QRKA 3UQGA 4GEOA 4S32A 5J8IA 4IDVA 3ORXA 4W4XA 5F4NA 2YM3A 4HYUA 4OT5A 3FYKX 4KINA 3BU3A 5EOLA 5A4EA 3RCDA 3NVMB 4FGRA 2O3PA 1TVOA 3MPAA 3NRMA 3OT3A 2GNHA 4G16A 4ITJA 3HNGA 4TTHB 4Y73A 2BHEA 3QKKA 2BR1A 4DHIB 3FI8A 3OW3A 2ZMDA 1I09A 3RK7A 1K9AA 3OXTA 3R73A 3KULB 3OWKA 4FEQA 4AGCA 2HOGA 4AZTA 3LE6A 2A2AA 2YIXA 4P5QA 5BUIA 3MN3A 4WO5A 4PQNA 4XG2A 2HZIA 3W10A 2UV2A 4II5A 4WNPA 5CVHA 3HA6A 3QGYA 2WMAA 2C30A 4F7LA 4O4DA 2JDTA 3GU6A 3L9PA 3LJ0A 4ZTNA 5GJGA 5B0XA 3RTPA 4E4XA 4RWKA 2OJFE 3W8LA 4BCGA 3QQJA 3WZDA 4JL9A 4ERKA 4AW5A 4F1TA 4BDIA 4CLIA 4E3CA 4NCTA 3NR9A 4L7FA 3Q9XA 5F94A 5HLNA 3KKVA 4KA3A 1UVRA 2C69A 5KZIA 1UV5A 3HRBA 5HIDA 3ULIA 2DS1A 2WMXA 4QTDA 2VO3A 2F7ZE 3NW7A 2IVTA 5EDQA 2WMBA 4L3JA 4WSYA 3ZLWA 1Q8TA 5EYKA 1LPUA 4G9RA 3S0OA 3EQGA 4UXLA 4C62A 5AJQA 2XNMA 4F7NA 5I9ZA 2PZ5A 1CMKE 4K2RA 2CGXA 5IZFA 5KMKA 3U6IA 2QNJA 5LXMA 4TNDA 4FK3A 5DRDA 3UMXA 3ZUVA 1TQMA 3QRUA 1V0BA 4NU1A 4GJ2A 1JKLA 2FSTX 5M57A 3VS4A 3I0OA 5DFPA 3VS7A 1LR4A 4F9CA 4IX5A 2WU7A 1JVPP 2YLFA 3DY7A 1YWNA 4RGJA 4NM0A 3UQFA 2JBOA 5ETFA 3ZH8A 2VV9A 3E7OA 3D9VA 3OUNB 3FZSA 4RWIA 3VS5A 3ENHA 1SZMA 3H30A 4XV9A 5F95A 3CEKA 4IAAA 2UW7A 2V62A 2VTAA 4XG6A 4KIOA 5JZJA 3HMIA 3R28A 3OZ6A 1IEPA 4C4HA 3KVWA 1YWVA 4XLIA 5BMMA 4U81A 2XF0A 2VRXA 3OCBA 4IE9A 3A61A 5DOSA 3I7CA 4MTAA 2XAOA 4D0XA 4M0ZA 4DYMA 4Y72A 2WQMA 3NCZA 3BBTB 4YJPA 4U41A 3GU4A 4OTQA 5I9YA 3LCDA 3NPCA 3W18A 1DM2A 2X2KA 4XOZA 2R5TA 1JNKA 4KNBA 4QYGA 4JIKA 2FYSA 2X2MA 3L1SA 3OEZA 3PIYA 4RC4A 4AT4A 3P5JC 2GS2A 3ZDIA 4YMJA 3F88A 4DH5A 4CMOA 4TYGA 2XVDA 3FMJA 3G9NA 4E1ZA 2F4JA 3PXRA 3F69A 1PXMA 2JDVA 5D41A 4G34A 2PVFA 5FP5A 3TKIA 4FE2A 3TV7A 2BMCA 4EOIA 4AG8A 3DBFA 1H0VA 2BCJA 3NYXA 4PV0A 4YJVA 3QF9A 2H34A 2O0UA 3CY2A 4JVGA 2CDZA 3DNDA 3SKCA 4EHEA 3ZHPC 4L52A 4RFZA 4HYSA 4D2RA 4X2JA 5A9UA 3NFFB 3ELJA 4WT6A 3H0ZA 2C3IB 5AIRA 2HW6A 5IEYA 4LV7A 3C5UA 3BEAA 3PRIA 4FSRA 3G33A 1Y8YA 1FPUA 4F78A 3F7WA 3PZHA 3UOJA 3F5GA 1M7QA 3MTFA 4RBLA 4FT3A 2BKZA 3Q4ZA 4DFXE 5LWMA 3Q52A 1O6LA 2IZSA 2Y4IB 5EK7A 4A9UA 3P7CA 2YM7A 3UIXA 5CEMA 5CSWA 2Y4IC 4FKLA 3FXWA 3PVWA 5C1QB 1OKYA 2C6IA 4YNOA 4EOKA 4HYHA 2RG5A 4KIQA 5HO7A 2Y6MA 4PNKA 2YACA 4DDGA 4AA0A 1OECA 1GOLA 4IACA 5EHLA 4Y46A 3CC6A 4PTGA 2GMXA 3GGFA 5JGBA 1PF8A 2ETKA 2C6KA 2WTWA 4YBKA 4EOQA 4IQ6A 4GYGA 2FA2A 4QP3A 3SD0A 4FEXA 4O4CA 4PL4A 3TZ9A 1SVGA 2XARA 3V5PA 4MVFA 4UMQA 2V22A 4FOCA 3KREA 4DCAA 2BFXA 4GS6A 1BI7A 3OWLA 5H8EA 4GYIA 3AC8A 4QRCA 4PTCA 3C7QA 4YLLA 5E8SA 4A9TA 5JFVA 2QOQA 4IWDA 2XCKA 4A7CA 4M8TA 3V5TA 3ZO3A 1QPEA 3MPMA 3UC4A 3MIYA 4R77A 3E93A 3ZBFA 2UVZA 4U3YA 1UKIA 3R8UA 4MKCA 3W2QA 3ERKA 4I5PA 5FTQA 2W9ZB 3FE3A 3VIDA 4HYIA 3VBVA 3D94A 4AXCA 2HXQA 4C8BA 3SRVB 4G5JA 3NX8A 4KAOA 4ASXA 2F7EE 4EQMA 2YZAA 1H08A 4X21A 4ANOA 4QTCA 3QX4A 4DFZE 2PVMA 3HUCA 2XUUA 3RM7A 4FTQA 3WYXA 1RQQA 5JQ5A 2VTJA 2R3JA 4LFIA 5K9IA 4WUNA 3H3CA 2P33A 1W8CA 5HLPA 4D4SA 3LFNA 2C3LA 3A7JA 2UZTA 5M53A 1UNHA 3QHRA 5C03A 4AOTA 2XM9A 3PPZA 2E9UA 3TJDA 3E64A 5HKMA 4IVAA 2PE1A 3SG9A 3TNWA 3VNTA 4G3GA 3TUCA 3R9RA 4BTFA 4ANSA 4OTGA 1W2CA 4O6LA 5FBNC 2GHGA 5GZ9A 2C47A 5CAQA 1Q97A 4RIYA 5LQFA 4M66A 2GNFA 4CFMA 1BX6A 2RFDA 2I6LA 3ULZA 4AAYA 3GOPA 3UE4A 3E5AA 4QMNA 3K5VA 4AN2A 4D2WA 2XALA 3DXPA 3ORZA 5AR2A 2VTTA 2C5OA 2W5AA 2C5YA 5HNGA 4MXYA 3UVQA 1OKVA 1ZMUA 1DAWA 5EYCA 4CQEA 4HVIA 3HV6A 4YJSA 4RPVA 2C68A 3U87A 4AFJA 4CCBA 1ZMVA 3TUBA 4ZMEA 2XB7A 3D14A 3FV8A 5CSPA 1QMZA 4XG3A 3R9DA 3NGAA 3VRYA 4I6FA 2CKEA 3LJ2A 5CANA 5AM6A 2ITPA 4WNOA 3VJNA 4FV2A 2XBJA 5HOAA 4YTHA