1MRYA

Crystal structure of an inactive akt2 kinase domain
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
295
structure length
270
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RAC-beta serine/threonine kinase
publication title Crystal structure of an inactive akt2 kinase domain
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 270
sequence length 295
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1mryA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1mryA02
1KSWA 3F7ZA 2J51A 3ZH8A 2PYWA 3IOKA 3RAHA 2BZJA 4ANSA 3W8LA 4LOPA 3WE8A 2VV9A 4ID7A 3AXWA 4N6ZA 3EL7A 4B9DA 4ZZMA 4O0WA 2CJMA 5B0XA 3VBXA 3DGKA 3QTUA 4ZY5A 3LPBA 4IFGA 3KCFA 3WILA 4XH6A 5HVJA 2PVYA 2IVVA 2OI4X 4J98A 3O23A 1BLXA 2ITTA 4IZYA 3NUAA 4YJRA 3U4WA 4NTSA 3R7OA 3DTCA 5DN3A 2H96A 3VHKA 5LVPA 4OTQA 3P4KA 2YAAA 3EQRA 4RPVA 1Q8TA 4O86A 4BTFA 1UNLA 2CGXA 4V01A 5DA3A 2PVNA 2QI8A 1GIHA 4F7SA 4XS2A 5CLPA 4E5BA 4BFMA 4WNKA 3C4FA 4PL4A 3SOCA 4Z7HA 2ZM4A 1IAJA 3LLTA 3OWJA 1JSTA 3EN9A 3TL8A 4QP2A 4F1MA 2CN5A 1QCFA 3U6IA 5C26A 2R7IA 2YCRA 3F5GA 3UOJA 3N4TA 5GIPE 4BGQA 5CSPA 1PXPA 5ANOA 4GYGA 4YJPA 4PTEA 4RJ4A 4F7JA 5AADA 4AT3A 2BCJA 4EEVA 3UNZA 1J3HA 4AZTA 4DFBA 3R6XA 4NFMA 2DYLA 3NPCA 3OY3A 4DEDA 4USFA 2X2LA 5LXMA 5CQWA 3BI6A 4NM5A 3WF6A 3NWWA 3NMUF 2J9MA 2XS0A 3GC7A 5CEQA 2PU8A 3CPBA 2W96B 3CY2A 5CF4A 1MRYA 4D5HA 3QKKA 4ITIA 2B1PA 2YERA 5GZ9A 4TRLA 2YM8A 2B9HA 2QO7A 4G6OA 4D55A 2X8IA 1PXJA 4MNEB 4BDEA 2R3GA 3QU0A 4FV2A 2C68A 3TV7A 2PE1A 3SGCA 2WTKB 2W9FB 4DGLC 2B52A 5DG5A 3NYVA 2OZAA 1B39A 2YA9A 1PMUA 2WFYA 3BGPA 4D1XA 2BROA 3ATSA 2XNGA 2F2UA 2X2MA 4FTCA 2YLEA 4IB0A 5G1XA 3WF9A 4C62A 3TUBA 1SMHA 4M8TA 1CM8A 1R0EA 2UVZA 5IH4A 4QTCA 2I0YA 3R21A 3ZDIA 3HV5A 3L9PA 4DTKA 4J8NA 3DT1A 5J9YA 2WU6A 3D14A 4S2ZA 5E8TA 1R78A 3MGYA 4YTIA 3RAIA 3UZPA 4ACDA 2R3QA 3UQFA 2A27A 1STCE 3NDMA 5JT2A 3QQHA 4H3PA 3RM6A 4AAAA 4HYIA 1H08A 2XKDA 2Y6OA 4BDCA 2B9IA 5CVHA 3VUDA 2WTIA 3CQWA 3MS9A 3OY1A 4F4PA 4CCBA 4GVAA 3VUTA 1J7UA 3OMVA 3K54A 3H0YA 4TXCA 1HOWA 4GT3A 4I0RA 1XBAA 4Y73A 5HCXA 1J1BA 2ZMDA 5EDRA 2CKOA 5IDNA 4X2NA 3WARA 2W05A 2OIBA 4W9XA 4UMRA 4F64A 2J4ZA 4ZK5A 5J7HA 3HA8A 5ANKA 4JOAA 2BRMA 2HOGA 3ZOSA 2CKQA 3QQUA 2PVKA 5HG8A 5J1VA 5EYMA 5FWKK 5LARA 5IF1A 4XV1A 3RK7A 3NUUA 5AM6A 1U59A 3LXLA 3BU5A 2C4GA 3ZRLA 3PPKA 4IAYA 4E7WA 3I0OA 1CKIA 2YLFA 1ZYCA 3F88A 3PJ8A 4R3RA 4DGNA 4B8MA 3PLAE 3BU6A 2XK4A 4PTGA 3WZUA 4PDSA 4PPAA 2WIPA 4I1ZA 3QTSA 2R5TA 2VGOA 3OXTA 4WIHA 3FPQA 3WIGA 4C3PA 4F1TA 2UVXA 2YDKA 4NYEA 1R1WA 2F57A 2JDOA 4DFLA 3PXFA 4GG5A 1Q8WA 3PZEA 3U8WA 4AA4A 3VRZA 3BYSA 4YHFA 1NA7A 3ITZA 3S4QA 3ZXTA 4EKKA 2W7XA 3BWFA 3ODZX 3ZFMA 1XHAA 2C6IA 3MA6A 3TV4A 3ZBXA 1Q3WA 5BVOA 4JBOA 3UG1A 1QPDA 1JVPP 5HTCA 1H00A 1U5RA 5FTQA 3DS6A 2OF4A 3LCSA 5DR2A 3EIDA 4BR3A 1JKKA 3RINA 3LJ1A 2IJMA 2JBOA 2C6KA 3RI1A 3C9WA 4JT3A 1B38A 5DE2A 1KE5A 3WZJA 2GQSA 4TYIA 2JEDA 2JFLA 4ACMA 1H0WA 4K33A 4CFXA 4UMQA 4J7BA 3VUGA 4BKJA 1H1WA 5CS6A 1ZAOA 4BDAA 3QXOA 3UOHA 2UW4A 3K3IA 4G16A 2C6LA 1CSNA 4KKEA 3FLYA 2YFXA 5HIDA 5HE0A 2GTMA 4D1ZA 4HVIA 1NVQA 4LI5A 3EN4A 4IJPA 4BN1A 2OSCA 5M4FA 4IZAA 2ZV7A 5JFSA 3KL8A 4XJ0A 2C6MA 1QPEA 3VF9A 3DBQA 1T45A 3DFCB 3AC5A 3F3TA 4C38A 5DT3A 2YM7A 3A60A 3F3VA 2J50A 3NYXA 3PY1A 4CFVA 3ACKA 3FV8A 2JDSA 3QQJA 3T9IA 1O9UA 3N51A 5I4NA 5GZ8A 1RW8A 1NXKA 3HV4A 4JNWA 4BI1A 2OH0E 4Y8DA 4C35A 3Q4TA 5CVGA 2H8HA 2AUHA 3QUDA 1YOLA 1R3CA 2WQOA 3R1SA 5EHYA 2XA4A 4KS7A 5J79A 2KULA 4L3PA 4ZSGA 1M14A 5CQUA 4O7YA 3LZBA 3W2CA 3ULIA 1XO2B 4M15A 3JR1A 3DKOA 3FMHA 3BHVA 3O8TA 5AWMA 3V5PA 4YHJA 2R64A 4BCOA 5AMNA 1JQHA 4I5HA 3ZO1A 4ZAUA 1Q4LA 5AR2A 3V5JA 4EK4A 2UV2A 2XK8A 2IZUA 3LFCA 3VUKA 4AS0A 2RL5A 3D4QA 4A4XA 5A4CA 4N57A 4M12A 5T3QA 3V5LA 4O81A 4C4IA 3R7YA 4NK9A 5DRBA 2ZV8A 5A4QA 3CLYA 1H0VA 2OICA 1YKRA 2VTHA 2W1EA 2XIRA 5ETCA 4D2TA 1WBPA 3VC4A 2FYSA 4BB4A 3SDJA 4O7SA 2BILB 4EQCA 3TG1A 3DY7A 1YI4A 3G15A 4DG2E 5BYYA 4I24A 2YCFA 2GMXA 2V5QA 4XMOA 4MBJA 4NUSA 3KMWA 4ZS0A 4AFEA 1PKDA 2QOLA 3D9VA 5DEYA 4EK3A 3RPSA 4I6FA 3P23A 2BDFA 5C8NA 2VO7A 5FXRA 2RGPA 2VTAA 4YSJA 3PUPA 1P5EA 2BIKB 2ITWA 3OROA 4FVQA 3O7LD 3OT3A 3I60A 1YHWA 3TN8A 4HJOA 4EJ7A 3SX9A 5IMXA 3WE4A 4V04A 4O7NA 3I81A 1K2PA 4JBQA 4RIOA 4OTFA 5EOLA 3CQEA 3VS6A 4CLJA 3TUCA 4YLJA 1RE8A 2X7OA 3FZPA 3L8PA 2DUVA 3F2NA 3ODYX 4O0YA 4R6VA 5CU3A 5BUIA 4C36A 1MRUA 4XBRA 4CYJA 4RJ7A 4BCQA 3G0FA 1KOAA 4XRLA 3FQEA 4FNZA 2QOIA 5DT0A 2BVAA 3KREA 1U54B 4U41A 4YJQA 3TKIA 1QMZA 3ZCLA 1O6LA 5TO8A 3P7AA 5D7AA 3QAME 4BBMA 5LWNA 3EFKA 5LJJA 4TWNA 3UNKA 5CY3A 2YN8A 2IW8A 3L9NA 5BNJA 3GB2A 1PKGA 3CTHA 5AR3A 4OT5A 2JDTA 3HVCA 4RWKA 2Z7QA 2PMIA 2BRHA 5CNNA 2C6EA 2DWBA 3C4CA 4FNYA 4P5ZA 3D5XA 3RGFA 3QRTA 4ZMFA 4PL3A 2QOBA 3DTWA 5KZIA 1YXSA 3LW0A 2BFXA 3TEIA 3AGMA 2PVJA 4FTJA 4RA4A 3ZZEA 3ZYAA 4G9CA 2ITPA 3JVRA 3FYJX 3IONA 2VX3A 3AMAA 4ACCA 3OXIA 2G1TA 4E73A 5IKWA 4G34A 4CFMA 4BDGA 1OL6A 3P5KA 3QBNA 4NM7A 4QTAA 3RWPA 2QQ7A 2GHGA 5FBOA 5HQ0A 5E8VA 1TKIA 5AR8A 4BWKA 3D2KA 3EFWA 2VTTA 3ENHA 3W2OA 3RWQA 2UW8A 3BGZA 1NT2A 4RA5A 4V0GB 4AUAA 2OO8X 2QVSE 4G3CA 5J87A 4UMPA 3FZ1A 4MXOA 3TNWA 3GC9A 4AGUA 5JKGA 3CIKA 4J52A 4O7ZA 3MIYA 3VS2A 2R3NA 3W16A 3OTVA 4FZDB 2HW6A 5E8UA 3A62A 3BYOA 3PG1A 3WZEA 1ZZ2A 3DOGA 5A3XA 4BZNA 4EOMA 2W99B 2WD1A 1V1KA 4LGDA 3O7LB 3K5UA 3OWKA 2BR1A 3QHWA 4EYJA 4EZ5A 4I6BA 1JSUA 1V0BA 3DBEA 3I5ZA 3PYYA 4N6YA 4AQCA 3MESA 2GNGA 3FKNA 5EFQA 3JS2A 5FEEA 3TT0A 4AGCA 3NGAA 4TWOA 5CWZA 5GJGA 2W1FA 2QHNA 2YWPA 2ZV2A 3KXMA 4RVTA 4TYEA 4ZIMA 3OS3A 2JIVA 3R8VA 4YBKA 4ZZNA 4JL9A 4DLIA 3BHTA 5KHWA 3W1FA 3V5QA 4GEOA 4FICA 3H4JA 3QTIA 3BGQA 4QQJA 2VRXA 5FQDC 3UIBA 3HGKA 3ORMA 4FEVA 5FDPA 2XNEA 3LM5A 3VBWA 4D0XA 4EOJA 2I7QA 3KXXA 4K6ZA 4MAOA 2CKPA 3PY3A 4GCJA 3W2PA 2WMTA 3MPAA 3OP5A 4GV1A 4E6QA 3S0OA 4IH8A 3CJFA 3K5VA 4ASDA 2RFEA 3MPTA 1IAHA 4HCUA 1Q97A 1LR4A 1PXKA 4APPA 3GVUA 1WAKA 2XVDA 3ZONA 4TN6A 4ZSAA 5AP1A 2JAVA 3PPZA 3B2WA 1YHSA 2PZ5A 4FSYA 4JJRA 4DYMA 2WKMA 3KXZA 1H1PA 4ASXA 5CEMA 3U9CA 2CHLA 4K18A 4CEGA 3LXNA 4IAKA 4MD9E 3MV5A 2BTSA 3EN5A 3RPOA 4D4SA 1O6YA 4L00A 1WBNA 4H58A 3A7GA 4QYHA 4AWIA 4HVHA 4M0ZA 3RNIA 5I9ZA 2XEZA 5KMOA 4D2RA 2WEVA 3IGOA 3TI1A 3IDCA 2R4BA 3ORPA 2H34A 2PWLA 3H9RA 4A9RA 4F0IA 4CQGA 1UV5A 2R3OA 3PDTA 1M2QA 4YPDA 2R3HA 3ET7A 3R63A 3TM0A 4N4SA 3DBDA 4M97A 4U81A 3QF9A 3GU7A 1KV1A 5AIKA 4YTFA 1OMWA 2CDZA 2GTNA 2VU3A 5CSVA 4ZTHA 2W1IA 4Z55A 3FSKA 1A9UA 4KSQA 4M13A 2XIKA 2WPAA 4EC8A 1OUKA 5EG3A 4EI4A 4CT2A 4E6CA 3QD0A 4XOZA 2ITZA 2GS6A 5ANIA 1NW1A 2PE2A 4QMTA 5EW8A 5JEBA 4IQ6A 3CQUA 3BHUA 4QMVA 5DI1A 4ORKA 4MX9A 3ROCA 2YCSA 4FKSA 1J1CA 3P7BA 4QO9A 3D7TB 2PPQA 1OVEA 4O2ZA 2QODA 3VS0A 3AMYA 1ZARA 4BDDA 2VTNA 3EQDA 2ZDUA 3KULB 5DYJA 4CVAA 4MNFA 3ORXA 5HKMA 4BTKA 4D2VA 4YTCA 3QALE 1REJA 2QOHA 3HRCA 3MJ1A 4F0GA 3G90X 5E4HA 1LEZA 4FV0A 4AW2A 3QQLA 2O63A 1VYZA 3QYZA 3UVPA 3R04A 3OBGA 5C4KA 2VX1A 3FEGA 3E87A 4FTNA 2RG5A 4E93A 2B7AA 2VTQA 4JRNA 3PSDA 1BI7A 5KMNA 3LLAA 1UNHA 4EH8A 5ANJA 3RVGA 5HU9A 1H26A 2W06A 3JUHA 5AP3A 5FDXA 5LCKA 5FLFA 1UU9A 4ALUA 1OL2A 4DEBA 4EH4A 3FZOA 3MB6A 2FO0A 3SW7A 3PE2A 2B54A 2H6DA 2QLUA 4ZY4A 2E9UA 3VHEA 2JLDA 3ZLSA 3MVLA 3QWKA 1FVTA 4ANLA 1PF8A 2W1ZA 4BDBA 3QRIA 5CAVA 5HX8A 5A9UA 3CE3A 4GMYA 5DIAA 4YURA 4A4LA 3UO6A 5J5TA 4ZLOA 3V8SA 3R2BA 2JKKA 3LFNA 4O96A 4OT6A 5ACBC 3BE2A 3NZ0A 5KKRC 2WMQA 4YPSA 3UNJA 4BZOA 5JFVA 2VTIA 3L8VA 4NM0A 4OBQA 4CRLA 4A9UA 4X3FB 1DS5A 4O0TA 5BVWA 4CTCA 3IGGA 4FT3A 1XJDA 4FL2A 3VS7A 4ZOGA 5K4JA 3AC4A 1YXUA 3S2PA 1F0QA 3C50A 4BICA 4FZFB 5JGAA 5AV3A 4RX8A 5JRQA 5B2LA 4F63A 2YIXA 5CT7A 4I0SA 2UZWE 4TWCA 3HLLA 4B7TA 5D7VA 4PUZA 4FKRA 4C2VA 4OTHA 3TZ7A 4BI2A 2VNYA 4X2KA 4E6AA 3VS3A 1OPKA 4A9YA 5ICPA 2P55A 2EUFB 3SV0A 4HCTA 3R9OA 5GZAA 5IA3A 4J99A 5IEXA 2B0QA 2I0HA 3ERKA 3MH1A 5BQ0A 2W5AA 5EW3A 2VO6A 4NKSA 4QP8A 4W8EA 4QPAA 2FUMA 2VX0A 4QP4A 2XEYA 5BPYA 4RJ6A 2PUPA 5JMSA 3G6GA 2QOKA 3W18A 3IDBA 4JVGA 3PJ3A 1REKA 2ITNA 4JDKA 3QC9A 4E20A 2XJ0A 1BI8A 2KTYA 1YOMA 4B6LA 4RGJA 1NVSA 4K2RA 3PPJA 3DXPA 4FKGA 4OLIA 3HP5A 4ENXA 1JKLA 2YZAA 3PFQA 4G9RA 3P1AA 3HECA 1UWHA 4W4XA 4Y72A 3RHXA 2C69A 3WF7A 3MY5A 1X8BA 3VS4A 5A4LA 3TACA 5IQIA 2C47A 1H8FA 3GOKA 3HMMA 3NYOA 5EYKA 5HX6A 5IUHA 1M7QA 5L4QA 4QOXA 4OTGA 3UC3A 3Q5ZA 1HCKA 3GCVA 4UZDA 3PTGA 2UW9A 3UYSA 3O51A 3ZS5A 2WO6A 4X0MA 4AFJA 3CXWA 3R1QA 2J0IA 1YDTE 4G3EA 2C0OA 4FKPA 4BCFA 4GIIA 4L67A 5E7RA 2P3GX 4A9TA 1FBNA 4C3FA 4X6RA 4R8QA 4KUJA 4FTMA 3LMIA 2QKWB 2ITOA 2AYPA 4L6QA 1I09A 3QQFA 1FINA 3QRUA 2XRUA 1H1QA 3PVWA 4YZ9A 4L3LA 5LOHA 2Z02A 1UWJA 3H9OA 3HX4A 4U6RA 1YI6A 4XG3A 5FM2A 4DG0E 3ENMA 2R9SA 3UVRA 4N0SA 4BIEA 4K1BA 2YABA 4EYMA 3TDVA 4QT1A 1H1RA 3EQBA 3N9XA 4MK0A 4P90A 3V3VA 2ACXA 2J0LA 4HGSA 4LOQA 4JG7A 3V01A 2EXMA 4QMWA 3QUPA 2J0JA 4RJ5A 3NIEA 1RDQE 2PE0A 4D4YA 4C4HA 2C0IA 3RHKA 3NEWA 3UE4A 2JIIA 3CD3A 4CT1A 4UYAA 3UO4A 3CGOA 2Y4IB 2VTPA 4FTQA 4O21A 3GENA 5ANGA 4MF1A 4HOKA 3HAMA 2R3MA 2V55A 3LHJA 2WIHA 4IB5A 5EI2A 3W8QA 3SVVA 3KRRA 1OKZA 3OUKA 4PQNA 5JFWA 3QTXA 2E9PA 3SW4A 5EI8A 4F0FA 4HVGA 2W1CA 4OTIA 4L7FA 3E7OA 4QYEA 4PNKA 3V5WA 1OKWA 5HG7A 4IC8A 3QTZA 3GUBA 5DR9A 3F7WA 2A19B 2OG8A 5CU0A 2FSLX 3BV3A 4IVBA 2DQ7X 4L52A 5J95A 3DB6A 3EN6A 3EQCA 1U46A 3LM0A 2ZAZA 3C7QA 3PVBA 3RALA 3CKXA 3DPKA 3NX8A 2O0UA 4RSSA 4S33A 4EONA 2C3LA 3R8UA 4YC6A 4AGDA 5M57A 2O3PA 5HESA 4FSWA 3R9HA 2O65A 4F6SA 3QRKA 3R1NA 1SNUA 1RJBA 4JRVA 1KE9A 4LV8A 2JD5A 4FSZA 4I3ZA 1G3NA 5KUPA 4ZEGA 2BZHB 1TVOA 4W4VA 4L44A 5TR6A 2J2IB 4EUTA 2OXXA 3UZRA 3VW6A 4Z3VA 2BRNA 2WU7A 3WOWA 4PF4A 5IH5A 4J1RA 3PXZA 3QTRA 1I44A 4C4GA 3ULZA 4DAWA 4M66A 4H1JA 2EWAA 3SA0A 1J7LA 2W1DA 4RZWA 2XUUA 4XX9A 4DBNA 4MYGA 2XK7A 1TQMA 4U79A 1YI3A 4O6EA 1XH7A 2OW3A 3AT2A 3HV3A 3NUYA 2HIWA 4C8BA 4AN9A 1JBPE 1MP8A 1ZZLA 2O5KA 5KMJA 4BVUA 1FOTA 1IA9A 4MTAA 5CF6A 4ZLZA 3FHIA 4O1PA 2X9FA 5CXHA 3HEGA 4WO5A 4B0GA 2QOOA 2R3KA 4BDHA 5KMKA 3HMPA 3PXQA 3C4WA 3FMMA 3UTOA 5BUJA 2V0DA 3ORZA 3DK3A 4RQVA 4R77A 3FI3A 3A8WA 4FEXA 4X3JA 2HENA 4FKTA 5F95A 4OBOA 4YJSA 3SQQA 5C8MA 3AMBA 4FKJA 4LOOA 4BCGA 1ZLTA 3R02A 4IXPA 1Q3DA 5AX9A 1PYXA 5L2WA 3FXXA 4AA5A 4RMZA 2EU9A 3HUBA 1B6CB 2CMWA 4O2PA 1FPUA 2WMWA 4BCMA 4HPTE 3U54A 5EM5A 4YGAA 2QO2A 4DH5A 4FG9A 2VO3A 4I94A 2BPMA 5D11A 5M4UA 2C1AA 3DKGA 5FUTA 2F49A 3TUDA 3OFMA 3GQIA 5DH3A 5EM6A 1PXMA 4KRDA 4DH8A 4CKJA 5L2TA 3VIDA 1XWSA 2CGUA 2ERKA 2PVHA 4FV3A 4GS6A 3NYNA 4FTRA 4GIHA 2GU8A 4K8AA 5KMLA 3FUPA 4IC7A 4M68A 3E92A 1O6KA 4RIWA 5D9HA 4MXAA 4FIHA 5IA0A 1FMOE 4FUYA 5DBXA 4DH7A 4LRKA 1E9HA 4LUEA 4ZJVA 3E8DA 3II5A 1JKTA 3ZXZA 3F9NA 4KA3A 2PZPA 5H9BA 4RWJA 3UDBA 3VQUA 5L2IA 3R8LA 5F4NA 2WGJA 4FGBA 5LWMA 2BKZA 4BIDA 3V8WA 3L1SA 1YWNA 4KINA 4OTDA 4U8ZA 2WTWA 5KHXA 3BBWA 5CEPA 2OZAB 4G5PA 3NVMB 4EBWA 3WBLA 3P08A 2BAQA 2GCDA 3NR9A 3QXPA 1VYWA 4FV5A 2ESMA 4JDIA 4JLCA 4DEAA 3KRJA 2J7TA 4YJVA 4DFZE 4G17A 3A99A 3NIZA 5KBRA 5IQCA 2FVDA 2QD9A 3EHAA 5J9LA 1OPJA 3O8UA 1P2AA 4PY1A 1OGUA 3NCGA 4JI9A 3TTJA 1PW2A 4RQKA 4BF2A 3WF8A 3BYUA 1GIJA 3UC4A 3R83A 4YNOA 5E1SA 4IANA 4I93A 4CYIA 5T6KA 4I5MA 4IWOA 4BDFA 1P4OA 3HZTA 3QCXA 4BY9E 2JIUA 2NO3A 2XP2A 4KNBA 4QP9A 4E5AX 4AGWA 2J5FA 1G8AA 2WTVA 2UW0A 2Y0AA 1VR2A 3MIAA 4L3JA 4TPTA 4DFUA 5E90A 4TKSA 2R7BA 5IQEA 2I0EA 2XM9A 3QL8A 3DJ5A 4IM0A 3NVKI 2EXEA 4O7TA 2JAMA 3FI4A 3P86A 4PX6A 3RJCA 2GPHA 3DJ7A 2CCHA 4CMUA 3O2MA 1KWPA 4EJNA 2E9VA 2NRYA 4QMLA 2P33A 4WSYA 4A9SA 2WTJA 4IZ5A 3DU8A 3A4PA 3DK6A 3CSVA 2VWIA 3CY3A 3P7CA 4C02A 4RZVA 3F3UA 1WBVA 3R7UA 5HO7A 2A0CX 4WA9A 4G1WA 1M7NA 1ZMVA 4CFFA 4EHZA 5AP5A 3OTUA 2VTMA 4CV8A 3PJ2A 4GU6A 4JIKA 5KNJA 1AQ1A 2OXYA 4CNHA 3FL5A 2C1BA 4J8MA 5L8KA 1W0XC 2UZBA 2XKFA 4MKCA 4ANQA 4C0TA 4EH9A 1GZ8A 3N4VA 4NW6A 3AD6A 3QKMA 5IA4A 4MXZA 1W7HA 2CCIA 2OLCA 3B2TA 3TXOA 2VWWA 2R0IA 4BHNA 3FMLA 4UXQA 3CTJA 5HO6A 1GZNA 4L46A 3SRVA 2QCSA 1MQBA 4QMYA 2W4OA 3O96A 5IQBA 1YDRE 3Q9ZA 2YDIA 4H05A 2YM3A 2YM4A 3ORNA 2FH9A 1WVYA 5HU3A 3VJNA 4M0YA 4U5JA 4HNIA 1BKXA 3Q04A 4AN3A 1UU7A 1PMVA 4FV9A 3SAYA 4BDIA 3TJCA 5E8WA 1OIYA 4CXAA 5GNKA 2UZNA 2YEXA 4FYNA 5JZNA 3R7EA 3LMHA 4JXFA 5HG9A 2UZLA 4MWIA 5D12A 4YO4A 4DGOA 4ZS4A 2RFNA 4PV0A 5I0BA 3ZRMA 3EJ1A 1JPAA 3QQGA 2OIDA 2YM6A 1YXVA 2GS2A 3SG9A 1XKKA 4CKIA 2PL0A 4D0WA 1H01A 4FKVA 2C30A 4XHKB 4I92A 4AW0A 4C57A 2XK3A 2RKUA 5JK3A 3PIZA 2PZYA 4FTOA 2PULA 2WMSA 4W4WA 3FC1X 2F2CB 4KIOA 4NCTC 3MA3A 5HHWA 3TIYA 4LL0A 3V5TA 4O7RA 4HYUA 5AA8A 3MI9A 2BAJA 2X9EA 3MWUA 3JVSA 3OHTA 4M7IA 4EZ7A 5M09A 3POZA 4DG3E 2Q0BA 5CEKA 2E9OA 2VZ6A 1ZWSA 4IJ9A 3EMGA 3MY0A 2VWZA 2QKRA 5IISA 3LFFA 4YLLA 3FSFA 4FUXA 4XUFA 3PP1A 4E4XA 4C4FA 3EKKA 4U44A 2ONLC 1Q8ZA 4X7QA 5I5ZA 4A06A 3CPCA 3KY2A 4AXAA 5BMSA 5I9XA 4YR8A 4GYIA 4NJDA 4AP7A 4IB1A 2QHMA 4O7WA 4IVDA 2YWVA 4I4EA 3QGWA 2WAJA 4NWMA 3ZSIA 3GCSA 3QX4A 5KE0A 1YVJA 3PG3A 4G3DA 5HNGA 3RNYA 3JY9A 3ZSGA 2PMNX 4EOKA 3D83A 4WBBB 4GKHA 3C4ZA 4XV2A 3UO5A 4XP2A 4DTAA 4YJUA 4CZUA 4GFGA 3OEZA 5GHVA 4BTMA 2QO9A 3F3ZA 2OIQA 2XM8A 3A7HA 3EZVA 3Q5IA 3R9NA 4IWQA 4O0SA 5L6PA 2ZMCA 3OBJA 1Q62A 4GH2A 2W9ZB 2FGIA 3FMDA 4C59A 4BGHA 4AZVA 3FKLA 3ALOA 1KE6A 4IWPA 4EOOA 4DINA 3RCJA 1OUYA 3QX2A 2XBAA 4QTBA 2B4SB 4IMYA 2XKEA 1ZYSA 3Q2MA 5DGZA 5HG5A 4EQMA 5CXZA 4GT5A 2Q0NA 2R2PA 4ERKA 1ERKA 2PSQA 3UP2A 4CLIA 2UW5A 1T46A 2C3JA 4L45A 3FDNA 4UZHA 1BL7A 4U40A 1Q8YA 3LKMA 1XR1A 4FK6A 2GNFA 2J6MA 2R3JA 4RIYA 4Y5HA 1P14A 3FPMA 4L8MA 2ITXA 2JKQA 4IAIA 3FZRA 4WNOA 4KAOA 2R3RA 2BDWA 2PZRA 3G33A 4EOIA 5TF9A 5EHLA 3GU8A 4QD6A 4E3CA 3TNHA 1YXTA 3C51A 1SNXA 2W4JA 2ZM1A 4KBCA 4LUDA 4BC6A 5BX0A 2QG7A 1ZOEA 5AP6A 1JLUE 2WXVA 2X39A 4U97A 2G9XA 4AOTA 4A07A 3KK8A 4D28A 1RQQA 3RM7A 4E4LA 4IB3A 3IS5A 4OAVB 4LQMA 4USDA 4FSUA 2RFSA 4IACA 5HLPA 2BHHA 4EUUA 2AC3A 4UWYA 3SXRA 3PY0A 4QTEA 5CASA 2QU6A 2FA2A 2PVMA 5LVNA 2HAKA 5IZFA 4FKIA 3DLSA 4E6DA 3KF7A 2WMUA 4AOIA 2X4FA 4DLJA 5A4EA 1W84A 3KU2A 3WI6A 4NIFA 2ZB1A 3OW4A 4O6LA 3C0GA 4MF0A 4DC2A 5JH6A 4FK3A 3GCPA 4NH1A 3RPVA 3SLSA 3A61A 3CC6A 5I3RA 3AG9A 1VEBA 4HYHA 4E5WA 1A06A 3OCSA 4FG7A 2V22A 1Q24A 3EWHA 5E91A 5LQFA 3AC2A 4KKGA 5E9EA 3OOGA 3R7GA 1Y57A 4FSRA 4Q2AA 4DGGA 4NKAA 3UBDA 2XJ1A 4CCUA 1IA8A 2BALA 1OZ1A 1OL7A 3SXSA 3LIJA 1XH9A 1MUOA 2WNTA 4PP9A 5K0KA 3S00A 4XNEA 3GC8A 4Y46A 3ZUUA 3Q96A 5HE2A 2F7XE 4Q9SA 3D94A 4NW5A 3FY2A 5EDQA 5HBEA 5AP7A 3BLRA 2QNJA 5H8EA 4EK6A 4QQTA 1UA2A 4RIXA 4E1ZA 2WTCA 3C13A 3DAEA 3VW8A 5IQFA 1GY3A 4IX3A 5M44A 4B4LA 2XF0A 2XKCA 4BCJA 4EH3A 2HZ4A 2ITYA 3QCQA 3Q52A 4TL0A 3S1HA 3PA5A 5DRDA 2OBJA 4I6HA 4KBAA 4II5A 3WZDA 2OJ9A 2B53A 4FZAB 4GFOA 4DCAA 2WTKC 5CT0A 2QG5A 3FLSA 1G8SA 2VWVA 2YISA 3BE9A 5A4TA 4D2SA 4U42A 4WRSA 4QMSA 4K77A 4UEUA 3GQLA 2X1NA 3BHYA 3ZFYA 3FY0A 4H36A 5HTIA 1UKIA 2CGVA 1L3RE 3MH0A 4GJ2A 3QD4A 5HO8A 3W2RA 3T3UA 4A4OA 3ANQA 3FAAA 5ETFA 4PPBA 4O7LA 4I5CA 4XBUA 4FOBA 4XEYA 4LGHA 4QMMA 2CLXA 3Q9WA 1ZYJA 4PDOA 3RK9A 4RC3A 2I6LA 4R7BA 4I21A 4BRXA 2VNWA 3LJ0A 4FTLA 1L8TA 3Q9YA 4AX8A 4F99A 2WEIA 4WOVA 4IWDA 4P5QA 3ELJA 4GG7A 5JN2A 4RWIA 3DZQA 3BX5A 5TE0A 2JBPA 5CSHA 2FSMX 3KGAA 3ZLYA 3NUNA 4WUNA 3R9RA 4CGAA 4QRCA 4PRJA 5CYIA 3DLZA 3NLBA 3BKBA 4F9YA 4R1VA 4DFNA 3ZDUA 3CBLA 1M2PA 3SC1A 4DE4A 4XG6A 1V0OA 1OL1A 1E1VA 1NY3A 5CF8A 4FYOA 4CFWA 5H3QA 2A1AB 4PNIA 3B8RA 3H3CA 4ITHA 2JITA 3GGFA 3A8XA 4ENYA 3E64A 2A2AA 5FBNC 3LCDA 3RZBA 4C34A 5IQDA 3IG7A 3OCBA 4CZYB 2OJJA 5KO1A 3EQGA 4R3CA 4MHAA 4EZ3A 4RX7A 5F20A 2NPQA 4BL1A 3UOLA 4IAAA 4XG4A 5AP2A 2ZVAA 3HV6A 2VTLA 4RRVA 5L8JA 3DB8A 3C1XA 1UU3A 3CJGA 5BVNA 3LFQA 4ANOA 4IAFA 1APME 3CEKA 3E7VA 4WG3A 4EHEA 4CD0A 5I3OA 2WQMA 3GI3A 4MBIA 4LM5A 3UIXA 4QNAA 1H24A 4FZ7A 4FC0A 3OWPA 3F6XA 2GNJA 5FP6A 1OBGA 3OVVA 4RLKA 3QWJA 2HXQA 3I0QA 4KS8A 4BDKA 2BZKB 4R7HA 1IR3A 4GUEA 3THBA 3NNUA 4GU9A 2BTRA 1BUHA 4PP7A 5CEOA 3HAVA 4ACGA 3WF5A 5B2MA 4CFUA 5L6OA 2JDRA 3GU4A 4DHFA 2O2UA 4YJTA 5C9CA 1Z5MA 3OCTA 4FA2A 3PLSA 4JBVA 5BYLA 2BIYA 2X8EA 3IQ7A 3ID6C 2P0CA 3FLZA 3NAYA 3QZFA 3QZHA 4I4FA 4DTBA 3CGFA 2WQEA 3LXPA 3PA4A 3FL4A 3BLQA 5KBQA 4DT8A 3Q4CA 2ZOQA 2GNLA 3IO7A 3TZ8A 1VJYA 4XCUA 5DR6A 3OC1A 1ZRZA 2WQNA 4BCKA 3EN7A 3FZSA 5CU4A 4FKOA 4KABA 3BU3A 3NW7A 3VQHA 4FNXA 2WMBA 3Q53A 4E4NA 3E3BX 3VWAA 1K9AA 4YTHA 3R9DA 3ACJA 3U6JA 3A7FA 4X3FA 3EFJA 5AM7A 2Z7RA 4DBXA 4ANMA 4DN5A 2NRUA 3H10A 2WOUA 3FMNA 4ZY6A 3VO3A 3G51A 3I5NA 4MCVA 5FG8A 1ND4A 4P4CA 5CI7A 2HELA 4RFYA 4FV8A 3U55A 3G6HA 3PZHA 3QGYA 3G0EA 5HGIA 2X4ZA 2J90A 2IW6A 4OTWA 4PPCA 2HZIA 2OF2A 3A2CA 4FTKA 3UODA 2HYYA 3Q6WA 1R39A 5BVEA 4BWXA 2BDJA 3KKVA 3VS1A 4KD1A 1JOWB 3MTLA 3F82A 3EQIA 4EOSA 3ZC5A 4NSTA 1IG1A 2R3LA 5AAFA 4RC4A 2LGCA 1J91A 2HCKA 2G2FA 4J95A 4O1OA 3RAKA 3PVGA 4TW9A 1WBWA 4MD7E 4FIFA 3UG2A 3C5UA 4Q5HA 3VBVA 1OKVA 4M69A 3KXNA 3KEXA 4E4MA 2GQRA 4YNEA 2JFMA 1LP4A 3FMKA 1CMKE 1ATPE 4LMUA 5BUEA 2X0GA 5LMAA 3IKAA 3FMJA 4TT7A 1PMEA 5M51A 2FB8A 4JX3A 4C33A 3MVMA 3EB0A 4AE6A 5HOAA 4EHGA 3UZTA 4F65A 2WZJA 2C3IB 3PXKA 4KB8A 3R8ZA 4O82A 3E3PA 3OOMA 5L2SA 2VO0A 2VWUA 3JXWA 3OW3A 4YZDA 4NCTA 4Z16A 3I4BA 2Q83A 5AP0A 3R7VA 4EH2A 4I0TA 5E8YA 1SYKA 3KRWA 5HBHA 3DNEA 3EL8A 4DFXE 4JBPA 4IX4A 4D2WA 4ZTMA 4LMNA 5EYDA 5AUYA 2IW9A 3R28A 4NTTA 5EDPA 2C5XA 3DJ6A 4YU2A 3L9MA 4FT7A 4JS8A 4ALVA 3HYHA 1WVXA 4FEQA 4JQ8A 5AAGA 4ZXTA 3VN9A 1M52A 3FC2A 3FQHA 3OG7A 3QHRA 2UZTA 4H39A 4UALA 5CNOA 4ZTSA 5TKDA 5AIRA 2ONLA 4FIEA 3LQ3A 4FZ6A 2X7GA 3DZOA 1PMNA 5FEQA 1GIIA 4FF8A 5FRIA 2GNIA 3G5DA 2J0KA 4K9YA 2E9NA 1FQ1B 1WZYA 3DAJA 3WYYA 4XLVA 5IH6A 2OWBA 4KIKA 4WRGA 4AZEA 3LCKA 1AGWA 4RFMA 3NRMA 3OZ6A 3GEQA 1KE8A 2YACA 3MFSA 3U51A 2BKKA 2IZSA 3KN5A 1YWVA 4FODA 4UV0A 4WG4A 1PXIA 2I1MA 4Q9ZA 4YHTA 1OKYA 2HWPA 2XCKA 4XV9A 5FM3A 2C6TA 3TNQB 5LMKA 4GKIA 3SD0A 3ZLWA 5GIOE 2WMAA 3LFEA 3SKCA 3ZEWA 4I41A 3UIMA 4TYHA 3WIKA 1DI8A 3MH3A 1H25A 5EYCA 4AW5A 4BCIA 4FTIA 3EQHA 5AUXA 4FSMA 3MVHA 3C0IA 1PXLA 3HA6A 2Z2WA 3DAKA 4PMTA 3BBTB 2WELA 4YSMA 5M07A 1JSVA 4D1SA 4Q5EA 3C0HA 1ZY5A 3LJ2A 3GP0A 4DEEA 4AN2A 2C5VA 4K0YA 5FTOA 2XIXA 3FBVA 3MTFA 4FT0A 2YITA 3DKFA 3E8CA 3QTQA 5DOSA 4MQ1A 3FMEA 3RMFA 4QTDA 5IA1A 2IO6A 3QA8A 3V6SA 4F6UA 1JAMA 4ACHA 3AC1A 4CMTA 1WCCA 5J7BA 3PXRA 4AG8A 2AC5A 1YQJA 1GAGA 3DFAA 4YJNA 3P0MA 5K5XA 2CPKE 5IUGA 5TOZA 2B9JA 2CNQA 3MFRA 3ZBFA 3EYGA 2RSVA 4Z7GA 1DI9A 5DEWA 4DH1A 4G5JA 3EFLA 3O50A 5TT7A 3QZIA 4EH5A 3CS9A 2W17A 5HIEA 2I40A 4CRSA 3IECA 4WKQA 2Z8CA 3VUHA 3ZM4A 2YM5A 4G2FA 2OH4A 4UX9A 4OW8A 2QU5A 2OJIA 1PY5A 3IW7A 4D4VA 5EQPA 3G9NA 3KQ7A 4BYIA 5B7VA 1OITA 3M11A 4QMPA 3AGLA 4GJ3A 4Y95A 3ZM9A 4CG9A 4FV7A 4IW0A 4WSQA 2ETMA 5JFXA 4QMXA 2ITVA 3AC3A 2BFYA 3AQVA 5JRSA 2V7OA 5BMMA 3E8EA 3L8SA 2HXLA 3IK3A 4O0VA 3LOKA 4YLKA 4QP6A 3IW6A 5AX3A 4BHZA 4JR3A 3LXKA 4HVDA 5EQYA 4F70A 2PUIA 4S32A 4UB7A 5LCJA 2OXDA 2W5BA 2OK1A 1F3MC 1YW2A 4G6NA 2BAKA 4YBJA 3GCQA 4CZTA 3KXGA 2F4JA 4BCPA 4O0XA 3D5WA 2YCQA 3DV3A 1BMKA 2G2HA 5EKNA 1XH5A 3HMNA 3MB7A 2XH5A 5ANDA 3NCZA 4TTHB 3GU6A 4W8DA 4GW8A 4QQCA 3TZMA 4BWPA 3NUPA 2YIQA 1YOJA 5LVLA 4EOLA 1CTPE 2VD5A 4X2FA 4EQUA 1MQ4A 2OGVA 4FG8A 1WBOA 2O64A 2GFSA 2UVYA 2W1HA 3EYHA 3E88A 1IRKA 4FSTA 1OIRA 2YHVA 3D2IA 4ASEA 1GJOA 4GK3A 1NVRA 4UYNA 2ZDTA 3BCEA 4GVJA 2EB3A 4QMOA 5DVRA 2XIZA 3PSCA 5F94A 3TDWA 5CAOA 2ZJWA 3BPRA 4F7NA 3BYMA 3F61A 4MNEA 2DS1A 1Q41A 3D5UA 4RVKA 4EBVA 5D10A 4F9AA 3KVXA 2YIWA 3HMIA 5H8GA 2IZRA 2XNNA 3UQCA 4L42A 4ZJIA 2WMVA 4LL5A 3TTIA 2BRBA 3R22A 4KSPA 4BI0A 3R71A 2G2IA 3JYAA 3P78A 2QONA 3GFWA 5IU2A 4RIWB 3DKCA 3MFTA 3UMXA 4DEHA 3W2QA 4R5YA 4CQEA 3UPZA 5A46A 3GXLA 4FV1A 4FOCA 5F9EA 5CAPA 1XBCA 3VVHA 5CI6A 4OBPA 2VWBA 2X6EA 5M06A 3ZSHA 1SZMA 2J5EA 1W8CA 4GSBA 4AZSA 4PMSA 5BVKA 1VZOA 1GOLA 1ZOGA 4FL3A 2IPXA 3DDQA 5JQ8A 3K3JA 4GFMA 1GNGA 5AEPA 4O84A 2JKOA 5FXQA 5LVMA 3LCTA 4MVFA 4ANNA 5FGKA 3COHA 4IM3A 4I20A 5LMBA 3U4UA 1KE7A 3D7ZA 5IUIA 5CANA 3LFDA 4RX9A 5CSXA 1OL5A 1K3AA 2UUEA 3BELA 4L01A 5AR4A 5KX8A 3OWLA 4OAUC 3BHHA 3ZFXA 1OIUA 3F5PA 4IDTA 3VULA 5C03A 1MRVA 3C4XA 3DXNA 4NM3A 1UNGA 4XV3A 2Z7SA 2GHMA 4G3FA 4IIRA 3LFSA 1WMKA 2BUJA 5E92A 4ERWA 4FV6A 5EM7A 2ZB0A 5IEYA 2FSOX 2XYUA 4HNFA 3SOAA 5JGBA 3R0TA 2ETKA 5AV1A 4QMZA 1SVHA 4EWHA 3FKOA 4ANBA 3NSZA 1URCA 3MJ2A 4FI1A 2C5YA 2ETRA 4C61A 4DCEA 5HNIX 1UU8A 4CG8A 2CSNA 4IBMA 4U3YA 4NFNA 2CNUA 3BV2A 3CD8A 5FTGA 1JNKA 4IX6A 5EKOA 4X2JA 2WHBA 5HD7A 2IN6A 2C3KA 2XNBA 4X3FC 4XG2A 3A7JA 3IPHA 4O38A 2BZIB 3PP0A 4IZ7A 3ZEPA 3KB7A 4MXXA 4ZTNA 1OM1A 4D4RA 2ZV9A 5AJQA 3QZGA 3WYXA 2W1GA 4AT4A 4AW1A 3HDMA 4XLIA 3KMUA 4A7CA 5A6OA 2GFCA 3D15A 3KCKA 4ZSLA 3V51A 3ORLA 3QYWA 4O22A 1PRYA 3MYGA 3W32A 2X6DA 4QMNA 3NUSA 4JG8A 5K9IA 1PXNA 5M08A 4ITJA 2HY81 2WB8A 4TYJA 2P2HA 4FL1A 4H3QA 1H07A 3JY0A 3VAPA 1IEPA 4WNMA 5A6NA 2OJFE 2RFDA 1EH4A 2VTRA 4PMPA 4O7VA 3LFBA 4LYNA 2SRCA 4GK4A 5K3YA 3UYTA 4DT9A 3QLGA 3TCPA 3RZFA 3FXZA 5EOBA 4OTPA 3SRVB 3VNTA 3COKA 4P7EA 4EOQA 3MVJA 4IEBA 5HE3A 4YO6A 4L68A 3ZO4A 3I79A 5FP5A 3NNXA 5I9WA 1W82A 4WG5A 3ZC6A 1XH6A 4BYJA 3TNIA 1G5SA 4U3ZA 5CZIA 3LFAA 4FNWA 4QYYA 4IE9A 2VTJA 3W10A 3OCGA 5CEIA 2PUNA 2O8YA 5AFVA 4JDJA 3VJOA 4R1YA 4LV5A 4O0RA 3Q60A 1URWA 5KKRB 2R3IA 3I7CA 4JR7A 2EXCX 2XZSA 3QFVA 5M55A 2HK5A 3JPVA 3DA6A 4WD5A 3D5VA 5IA2A 2HWOA 2RG6A 3OXZA 4E26A 4KBKA 1P4FA 4D9TA 3HNGA 5AUTA 4DGMA 3E63A 2CGWA 4IVCA 5AUVA 4FKQA 4OGRA 1ZOHA 4RVLA 1ZMWA 3BWJA 3S3IA 3U9NA 2PVLA 3FXWA 3EZRA 2X8DA 5IQAA 1PJKA 3IW8A 3ZUTA 4XRJA 2PVFA 4F7LA 1YHVA 2WQBA 4I23A 5I9YA 4DA5A 1Q99A 2OU7A 4IHPA 1Z57A 2R3FA 3NUXA 2QOQA 3HRFA 4BBFA 1FVVA 4TZRA 5EHOA 3AC8A 4L9IA 3V04A 5AUWA 2PVRA 2GDOA 3MN3A 4HZRA 3IOPA 4XP3A 3G9LX 4B8LA 2PK9A 2WOTA 3CP9A 4WNPA 4CMOA 5CALA 2UZDA 4R5SA 4EH7A 4D9UA 5AUUA 3IW5A 4WHZA 5KMMA 4M3QA 4TY1A 3V8TA 5HD4A 1KUTA 3ZO3A 4PDYA 1Y8YA 3POOA 5H8BA 5LMKC 5I9VA 1V0PA 2EVAA 1WFCA 3PVUA 4B99A 4QYFA 2QLQA 1DM2A 2PMOX 2OKRA 1Y8GA 2Y4IC 3BQCA 5IDPA 4JQEA 2Y4PA 3BLHA 4U0IA 2UZVA 3I6WA 4M67A 2UZEA 2GNHA 3PXYA 5ITAA 3PJCA 5CX9A 3QKLA 4W9WA 3MY1A 4ZSJA 4AF3A 3DDPA 1XBBA 3LCOA 5DMZA 3Q6UA 4RBLA 5DHJA 4Y5QA 4QNYA 4DEGA 4QMQA 3LE6A 3E62A 3LMGA 2XBJA 3QQKA 1S9IA 4FV4A 5IMEA 1OI9A 4IX5A 1U54A 4FTTA 3GT8A 3Q2JA 4BIBA 4U80A 3VBYA 5K5NA 4EK8A 2NNWB 5E1EA 3GC0A 5HORA 3ANRA 2ITUA 2QR8A 3Q4ZA 3ATTA 3FI8A 3MW1A 4F08A 2XB7A 3O17A 1UKHA 4FTUA 3PRIA 3O71A 3ZRKA 4RIYB 3F5XA 4G31A 3FE3A 4RLLA 4C37A 5FD2A 2GQGA 3F5UA 3C4EA 3FLQA 5D1JA 4C4EA 4EHVA 4ZJJA 1FGKA 4TWPA 4R78A 4G3GA 1TQIA 4RJ3A 1H1SA 1IASA 2JC6A 4FVPA 1OBDA 2YIRA 2X81A 3R1YA 4U43A 2VWYA 3U6HA 3KA0A 3BRBA 4LRMA 5H2UA 3PWDA 4UWBA 3PWYA 4UXLA 3DCVA 2IG7A 3F69A 3QCSA 3M1SA 4V0GA 5AUZA 3MDYA 3F2AA 4NT4A 1FGIA 4UMTA 5EM8A 4L43A 5AV2A 4ZTLA 3UOKA 4C7TA 1JWHA 4AA0A 3RP9A 3HUCA 3PSBA 1YWRA 5HZNA 3MBLA 4J71A 3EOCA 4AOJA 3SG8A 3LAUA 3WZKA 3E93A 3BEAA 4PWNA 2I0VA 5CVFA 4RFZA 5DLSA 5EH0A 3N4UA 3RKBA 4C3RA 4IADA 4JIAA 2PTKA 4FKWA 4LFIA 2VWXA 3LVPA 5I9UA 4V05A 4XG7A 4YC3A 4R3PA 4NIFB 3SXFA 4NL0A 4W4YA 5AR5A 3NAXA 4FKUA 4CKRA 2X7FA 5IQGA 4M14A 2OJGA 3VUIA 3KK9A 1XH8A 5KCVA 4O0UA 3PJ1A 1M17A 5M56A 4I5PA 4CTBA 2CN8A 3GCUA 3QA0A 1SVGA 4H1MA 3AOXA 4AU8A 5A14A 3KVWA 2B55A 2IVTA 4PDPA 1TQPA 4OTRA 4O27B 4P2KA 4WT6A 3FHRA 4FKLA 4NZWB 5CAUA 3VUMA 2G01A 4QPSA 3RBWA 3ORTA 3AD4A 1YXXA 3TZ9A 2GS7A 4JG6A 4IVAA 4QP1A 5DFPA 4EKLA 3TKHA 4LGGA 3KRLA 4IM2A 5JZJA 4ONAA 3CKWA 5ETAA 4USEA 3ORIA 3ZTXA 5HCYA 3RK5A 4RIXB 2J0MB 5HBJA 4FE2A 4ZP5A 4J97A 3ZHPC 4FTAA 4CV9A 5IEVA 5HI2A 4H3BA 3ZU7A 5ACKA 2OFUA 3UPXA 2C6OA 5AV0A 3GBZA 3FLNC 3ROYA 4AZWA 3QD3A 5J1WA 5EI6A 1U4DA 3H0ZA 4RVMA 5HICA 4YZCA 1Y91A 2Z7LA 4HGLA 5M53A 3FWQA 2Y6MA 3QRJA 3GOPA 4ASZA 5JGDA 4ZMEA 3S95A 5M4IA 5K0XA 3M42A 2W5HA 5HNBA 4F9WA 2PY3A 3ZO2A 4E8AA 1AD5A 3D0EA 3DK7A 3I7BA 4O83A 3COIA 5B2KA 2VTSA 1S9JA 1QPCA 2IVSA 3HKOA 3KXHA 4TNBA 5E8XA 5CENA 4YJOA 4D5KA 4DEIA 2W0JA 1SM2A 2NP8A 3GNIB 4BGGA 4L53A 3NW5A 4UMUA 1LUFA 4RG0A 4N70A 4JDHA 2XRWA 4EK5A 4XG8A 4XG9A 2C5NA 3RPYA 4G6LA 4M84A 4YZBA 2JKMA 3COMA 1GZKA 3RTPA 2REIA 3DQWA 3L8XA 4HGTA 2X2KA 4X21A 2XK9A 5IA5A 5AV4A 1ZYDA 5JQ5A 4F6WA 3F2RA 5FXSA 4KWPA 3BQRA 3HMOA 1WVWA 4CSVA 3B8QA 1Z9XA 3FJQE 4BZDA 4WBOA 4D58A 1CDKA 4RT7A 2ERZE 4RWLA 4TNDA 1BL6A 1LPUA 3ZMMA 2UW3A 5BYZA 3KN6A 4QPMA 4U9AA 3R30A 5IQHA 2HZNA 3KRXA 3O0GA 1W83A 3D7TA 4GK2A 2VN9A 3FI2A 4FBXA 4KKHA 1SVEA 3UQGA 2YAKA 2PZIA 2FSTX 3PA3A 2Z60A 1JKSA 3KULA 4IDVA 1WBTA 4DF3A 3FZTA 2OZOA 3L9LA 2F7EE 4EWQA 4KIQA 3SHEA 3UGCA 4DITA 2VAGA 1OECA 4QYGA 3FQSA 3P79A 3TIZA 3W33A 4EH6A 1PHKA 5CZHA 5F1ZA 3PRFA 2JDVA 3VBQA 3W2SA 3BEGA 5HIBA 2Y8OA 2ZM3A 2UZOA 4IFCA 2IWIA 5CF5A 3Q32A 2XIYA 4FR4A 3MH2A 4FIGA 2V7AA 5HCZA 2PHKA 4LRJA 2XYNA 4MH7A 3CR0A 4ZSEA 3TNPC 3ALNA 3E8NA 3HV7A 4UN0C 3KFAA 2YJRA 5GJDA 4IAZA 3TJDA 4ZLYA 2C6DA 5KZ0A 4PTCA 4MQ2A 5C8KA 5LVOA 3DNDA 3MFUA 3QLFA 3R73A 1PXOA 2VTOA 3ZLXA 4BKYA 3R7IA 1XH4A 1GZOA 3F66A 1A48A 2VUWA 2HZ0A 4QMUA 5L8LA 4JAIA 4UWCA 5DPVA 3PIXA 4U45A 5HVYA 3BZ3A 4K11A 4QQ5A 5ANEA 5C01A 3Q4UA 4BTJA 3AT3A 4DH3A 3HP2A 2F7ZE 1H4LA 2GHLA 3TWJA 5GJFA 3GU5A 3RCDA 4BDJA 4APCA 4AACA 3QUEA 4U7ZA 3IW4A 2WMXA 4EC9A 3PIYA 4ZTQA 3IDPA 4J96A 3MPMA 3ORKA 4ARKA 3EKNA 3QC4A 5AP4A 4ZZOA 2R0UA 4GL9A 2GSFA 5D41A 1Y6AA 5CU2A 2A4LA 4RX5A 4C4JA 1HCLA 2XMYA 3DQXA 5ETIA 2UW7A 3U87A 3FLWA 3OF0A 1OIQA 2E2BA 4QP7A 2WMRA 3KMMA 4FGRA 1KV2A 1Q8UA 3CTQA 3TV6A 4FMQA 4L7SA 3KF4A 4S34A 4AT5A 2Y9QA 1U5QA 4JQ7A 5G6VA 3I6UA 4KRCA 1Q5KA 4BKZA 5HVKA 1DAWA 2YZLA 5E8ZA 2JGZA 5J5SA 1E1XA 2W4KA 4PMMA 2Y7JA 3H9FA 3O8PA 4HZSA 3VS5A 1LEWA 2XNMA 4O91A 3H30A 4XP0A 5L2QA 4D2PA 5EK7A 4EORA 4MWHA 4XYFA 5L3AA 2ITQA 1XQZA 3R00A 3KC3A 4NU1A 5CSWA 2IVUA 4ZTRA 1OB3A 3NS9A 5C4LA 1KOBA 4FSQA 2YIYA 1YRPA 4MD8E 4BCHA 1BX6A 2XCHA 4I6QA 4GRBA 2P4IA 2R3PA 4EL9A 3R8MA 2V62A 3T8OA 3A4OX 1YDSE 4YUQA 4FX3A 1QPJA 2B9FA 2BMCA 2LAVA 3HL7A 3VF8A 3LQ8A 5GINE 2C0TA 2XNOA 4HW7A 5HEZA 4FT9A 3UMWA 4M69B 4R7IA 2G15A 4CFNA 3NNVA 1F5QA 4HYSA 3EQFA 5J9ZA 2UW6A 4YC8A 4S30A 5FEDA 4JAJA 4MXCA 3V6RA 5J8IA 4FIJA 3AT4A 1DAYA 2ZYBA 4YMJA 2EB2A 4J53A 3PE1A 3DBFA 3HRBA 5KMIA 1BYGA 2UZUE 2BRGA 2PUUA 3EH9A 1W98A 5BVDA 1CKPA 4YZMA 3T3VA 3ZZWA 5AA9A 5HLWA 5AR7A 5C1QB 2HY0A 2CLQA 1ZMUA 3QTWA 3P9JA 2YJSA 3QD2B 4QP3A 3RAWA 5AAEA 2PMLX 4UBAA 4F9BA 4Y83A 3R2YA 2H9VA 5DT4A 4BCNA 5CU6A 3OT8A 2RIOA 3FYKX 5CAQA 4HCVA 3RPRA 4PL5A 2QOCA 4UY9A 3G2FA 5C27A 4X2GA 3R01A 4HPUE 4YZNA 2QC6A 5CTPA 3VBTA 3T9TA 1WBSA 4NEUA 1Q61A 2CNVA 2YDJA 3TKUA 3UIUA 4DFYA 3A7IA 5L6WL 3I1AA 5DNRA 4MXYA 2XJ2A 1ZY4A 3E5AA 4GUBA 1H28A 1Y6BA 5E8SA 1OPLA 5A54A 4KIPA 3UP7A 4FIIA 4EOPA 5HE1A 4F09A 2CKEA 3MSSA 3OUNB 2BHEA 2F9GA 4OR5A 4KIKB 4Z9LA 1PYEA 3NNWA 4FT5A 3BIZA 4S31A 3Q9XA 4HGEA 1ZXEA 3EQPA 2XNPA 4AE9A 4ALWA 4FEUA 4YP8A 2VGPA 3DBCA 4MEDA 3VRYA 5BVFA 4C58A 3ETAA 4RJ8A 3F3WA 4RC2A 3M2WA 3UJGA 1CKJA 2RF9A 3R8PA 1M2RA 2HW7A 3LQ5A 2C5OA 4TYHB 5EQEA 4NJ3A 1UVRA 3OD6X 5IG1A 5M4CA 4F1OA 2QURA 4C2WA 3OEFX 3NW6A 4JX7A 3W55A 3ZUVA 2QR7A 4XOYA 5K4IA 3UVQA 5HLNA 4BBEA 5EW9A 4GT4A 3GFEA 2QOFA 3Q3BA 1R0PA 2IZTA 3QCYA 4X6QC 1J7IA 4FEWA 4FSNA 5IPJA 5JSMA 1QL6A 4I22A 4OUCA 3K2LA 4AZFA 3DXQA 1FMKA 3HDNA 4Y85A 4TYGA 2XK6A 3AD5A 4FVRA 1H27A 4MBLA 2P2IA 4HVSA 2OFVA 4WUAA 5DWRA 3BYVA 4LG4A 4F9CA 3C5IA 5HTBA 5T68A 3REPA 1FVRA 1ZYLA 2WTDA 3CCNA
chains in the Genus database with same CATH superfamily
1KSWA 3F7ZA 2J51A 3ZH8A 2PYWA 3IOKA 3RAHA 2BZJA 4ANSA 3W8LA 4LOPA 3WE8A 2VV9A 4ID7A 3AXWA 4N6ZA 3EL7A 4B9DA 4ZZMA 4O0WA 2CJMA 5B0XA 3VBXA 3DGKA 3QTUA 4ZY5A 3LPBA 4IFGA 3KCFA 3WILA 4XH6A 5HVJA 2PVYA 2IVVA 2OI4X 4J98A 3O23A 1BLXA 2ITTA 4IZYA 3NUAA 4YJRA 3U4WA 4NTSA 3R7OA 3DTCA 5DN3A 2H96A 3VHKA 5LVPA 4OTQA 3P4KA 2YAAA 3EQRA 4RPVA 1Q8TA 4O86A 4BTFA 1UNLA 2CGXA 4V01A 5DA3A 2PVNA 2QI8A 1GIHA 4F7SA 4XS2A 5CLPA 4E5BA 4BFMA 4WNKA 3C4FA 4PL4A 3SOCA 4Z7HA 2ZM4A 1IAJA 3LLTA 3OWJA 1JSTA 3EN9A 3TL8A 4QP2A 4F1MA 2CN5A 1QCFA 3U6IA 5C26A 2R7IA 2YCRA 3F5GA 3UOJA 3N4TA 5GIPE 4BGQA 5CSPA 1PXPA 5ANOA 4GYGA 4YJPA 4PTEA 4RJ4A 4F7JA 5AADA 4AT3A 2BCJA 4EEVA 3UNZA 1J3HA 4AZTA 4DFBA 3R6XA 4NFMA 2DYLA 3NPCA 2X0OA 3OY3A 4DEDA 4USFA 2X2LA 5LXMA 5CQWA 3BI6A 4NM5A 3WF6A 3NWWA 3NMUF 2J9MA 2XS0A 3GC7A 5CEQA 2PU8A 3CPBA 2W96B 3CY2A 5CF4A 1MRYA 4D5HA 3QKKA 4ITIA 2B1PA 2YERA 5GZ9A 4TRLA 2YM8A 2B9HA 2QO7A 4G6OA 4D55A 3PFYA 2X8IA 1PXJA 4MNEB 4BDEA 2R3GA 3QU0A 4FV2A 2C68A 3TV7A 2PE1A 3SGCA 2WTKB 2W9FB 4DGLC 2B52A 5DG5A 3NYVA 2OZAA 1B39A 2YA9A 1PMUA 2WFYA 3BGPA 4D1XA 3NFGB 2BROA 3ATSA 2XNGA 2F2UA 2X2MA 4FTCA 2YLEA 4IB0A 5G1XA 3WF9A 4C62A 3TUBA 1SMHA 4M8TA 1CM8A 1R0EA 2UVZA 5IH4A 4QTCA 2I0YA 3R21A 3ZDIA 3HV5A 3L9PA 4DTKA 4J8NA 2XAMA 3DT1A 5J9YA 2WU6A 3D14A 4S2ZA 5E8TA 1R78A 3MGYA 4YTIA 3RAIA 3UZPA 4ACDA 2R3QA 3UQFA 2A27A 1STCE 3NDMA 5JT2A 3QQHA 4H3PA 3RM6A 4AAAA 4HYIA 1H08A 2XKDA 2Y6OA 4BDCA 3W0RA 2B9IA 5CVHA 3VUDA 2WTIA 3CQWA 3MS9A 3OY1A 4F4PA 4CCBA 3UDSA 4GVAA 3VUTA 1J7UA 3OMVA 3K54A 3H0YA 4TXCA 1HOWA 4GT3A 4I0RA 1XBAA 4Y73A 5HCXA 1J1BA 2ZMDA 5EDRA 2CKOA 5IDNA 4X2NA 3WARA 2W05A 2OIBA 4W9XA 4UMRA 4F64A 2J4ZA 4ZK5A 5J7HA 3HA8A 5ANKA 4JOAA 2BRMA 2HOGA 3ZOSA 2CKQA 3QQUA 2PVKA 5HG8A 5J1VA 5EYMA 5FWKK 5LARA 5IF1A 4XV1A 3RK7A 3NUUA 5AM6A 1U59A 3LXLA 3BU5A 2C4GA 3ZRLA 3PPKA 4IAYA 4E7WA 3I0OA 1CKIA 2YLFA 1ZYCA 3F88A 3PJ8A 4R3RA 4DGNA 4B8MA 3PLAE 3BU6A 2XK4A 4PTGA 3WZUA 4PDSA 4PPAA 2WIPA 4I1ZA 3QTSA 2R5TA 2VGOA 3OXTA 4WIHA 3FPQA 3WIGA 4C3PA 4F1TA 2UVXA 2YDKA 4NYEA 1OGYA 1R1WA 2F57A 2JDOA 4DFLA 3PXFA 4GG5A 1Q8WA 3PZEA 3U8WA 4AA4A 3VRZA 3BYSA 4O4FA 1NA7A 3ITZA 4YHFA 3S4QA 3ZXTA 2W7XA 4EKKA 3BWFA 3ODZX 4F78A 3ZFMA 1XHAA 2C6IA 3MA6A 3TV4A 3ZBXA 1Q3WA 5BVOA 4JBOA 3UG1A 1QPDA 1JVPP 5HTCA 1H00A 1U5RA 5FTQA 3DS6A 2OF4A 3LCSA 5DR2A 3EIDA 4BR3A 1JKKA 3RINA 3LJ1A 2IJMA 2JBOA 2C6KA 3RI1A 3C9WA 4JT3A 1B38A 5DE2A 1KE5A 3WZJA 2GQSA 4TYIA 2JEDA 2JFLA 4O4DA 4ACMA 1H0WA 4K33A 4CFXA 4UMQA 4J7BA 3VUGA 4BKJA 1H1WA 5CS6A 1ZAOA 4BDAA 3QXOA 3UOHA 2UW4A 3K3IA 4G16A 2C6LA 1CSNA 4KKEA 3FLYA 2YFXA 5HIDA 5HE0A 2GTMA 4D1ZA 4HVIA 1NVQA 4LI5A 3EN4A 4IJPA 4BN1A 2OSCA 5M4FA 4IZAA 2ZV7A 5JFSA 3KL8A 4XJ0A 4BJJA 2C6MA 1QPEA 3VF9A 2A98A 1T45A 3DBQA 3DFCB 3AC5A 3F3TA 4C38A 5DT3A 2YM7A 3A60A 3F3VA 2J50A 3NYXA 3PY1A 4CFVA 3ACKA 3FV8A 2JDSA 3QQJA 3T9IA 1O9UA 3N51A 5I4NA 5GZ8A 1RW8A 1NXKA 3HV4A 4JNWA 4BI1A 2OH0E 4Y8DA 4C35A 3Q4TA 5CVGA 2H8HA 2AUHA 3QUDA 1YOLA 1R3CA 2WQOA 3R1SA 5EHYA 2XA4A 4KS7A 5J79A 2KULA 4L3PA 4ZSGA 1M14A 4AAYA 5CQUA 4O7YA 3LZBA 3W2CA 3ULIA 1XO2B 4M15A 3JR1A 3DKOA 3FMHA 3BHVA 3O8TA 5AWMA 3V5PA 4YHJA 2R64A 4BCOA 4FJVA 5AMNA 1JQHA 4I5HA 3ZO1A 4ZAUA 1Q4LA 5AR2A 3V5JA 4EK4A 2UV2A 2XK8A 3UDZA 2IZUA 3LFCA 3VUKA 4AS0A 2RL5A 3D4QA 4A4XA 5A4CA 4N57A 4M12A 5T3QA 3V5LA 4O81A 4C4IA 3R7YA 4NK9A 5DRBA 2ZV8A 5A4QA 3CLYA 1H0VA 2OICA 1YKRA 2VTHA 2W1EA 2XIRA 5ETCA 4D2TA 1WBPA 3VC4A 2FYSA 4BB4A 3SDJA 4O7SA 2BILB 4EQCA 3TG1A 3DY7A 1YI4A 3G15A 4DG2E 5BYYA 4I24A 2YCFA 2GMXA 2V5QA 4XMOA 4MBJA 4AXEA 4NUSA 3KMWA 4ZS0A 4AFEA 1PKDA 2QOLA 3D9VA 5DEYA 4EK3A 3RPSA 4I6FA 3P23A 2BDFA 5C8NA 3TYKA 2VO7A 5FXRA 2RGPA 2VTAA 4YSJA 3PUPA 1P5EA 2BIKB 2ITWA 3OROA 4FVQA 3O7LD 3OT3A 3I60A 1YHWA 3TN8A 4HJOA 4EJ7A 3SX9A 5IMXA 3WE4A 4V04A 4O7NA 3I81A 1K2PA 4JBQA 4RIOA 4OTFA 5EOLA 3CQEA 3VS6A 4CLJA 3TUCA 4YLJA 1RE8A 2X7OA 3FZPA 3L8PA 2DUVA 3F2NA 3ODYX 4O0YA 4R6VA 5CU3A 5BUIA 4C36A 1MRUA 4XBRA 4CYJA 4RJ7A 4BCQA 3G0FA 1KOAA 4XRLA 3FQEA 4FNZA 2QOIA 5DT0A 2BVAA 3KREA 1U54B 4U41A 4YJQA 3TKIA 1QMZA 3ZCLA 1O6LA 5TO8A 3P7AA 5D7AA 3QAME 4BBMA 5LWNA 3EFKA 5LJJA 4TWNA 3UNKA 5CY3A 2YN8A 2IW8A 3L9NA 5BNJA 3GB2A 1PKGA 3CTHA 5AR3A 4OT5A 2JDTA 3HVCA 4RWKA 2Z7QA 4DDIA 2PMIA 2BRHA 5CNNA 2C6EA 4DHJA 2DWBA 3C4CA 4FNYA 4P5ZA 3D5XA 3RGFA 3QRTA 4ZMFA 4PL3A 2QOBA 3DTWA 5KZIA 1YXSA 3LW0A 2BFXA 3TEIA 3AGMA 2PVJA 4FTJA 4RA4A 3ZZEA 3ZYAA 4G9CA 2ITPA 3JVRA 3FYJX 3IONA 2VX3A 3AMAA 4ACCA 3OXIA 2G1TA 4E73A 5IKWA 4G34A 4CFMA 4BDGA 1OL6A 3P5KA 3QBNA 4NM7A 4QTAA 3RWPA 2QQ7A 2GHGA 5FBOA 5HQ0A 5E8VA 1TKIA 5AR8A 4BWKA 3D2KA 3EFWA 2VTTA 3ENHA 3W2OA 3RWQA 2UW8A 3BGZA 1NT2A 4RA5A 4V0GB 4AUAA 2OO8X 2QVSE 4G3CA 5J87A 4UMPA 3FZ1A 4MXOA 3TNWA 3GC9A 4AGUA 5JKGA 3CIKA 4J52A 4O7ZA 3MIYA 3VS2A 2R3NA 3W16A 3OTVA 4FZDB 2HW6A 5E8UA 3A62A 3BYOA 3PG1A 3WZEA 1ZZ2A 3DOGA 5A3XA 4BZNA 4EOMA 2W99B 2WD1A 1V1KA 4LGDA 3O7LB 3K5UA 3OWKA 2BR1A 3QHWA 4EYJA 4EZ5A 4I6BA 1JSUA 1V0BA 3DBEA 3I5ZA 3PYYA 4N6YA 4AQCA 3MESA 2GNGA 3FKNA 5EFQA 3JS2A 5FEEA 3TT0A 4AGCA 3NGAA 4TWOA 5CWZA 5GJGA 2W1FA 2QHNA 2YWPA 2ZV2A 3KXMA 4RVTA 4TYEA 4ZIMA 4AXCA 3OS3A 2JIVA 3R8VA 4YBKA 4ZZNA 4JL9A 4DLIA 3BHTA 5KHWA 3W1FA 3V5QA 4GEOA 4FICA 3H4JA 3QTIA 3BGQA 4QQJA 2VRXA 5FQDC 3UIBA 3HGKA 3ORMA 4FEVA 5FDPA 2XNEA 3LM5A 3VBWA 4D0XA 4EOJA 2I7QA 3KXXA 4K6ZA 4MAOA 2CKPA 3PY3A 4GCJA 3W2PA 2WMTA 3MPAA 3OP5A 4GV1A 4E6QA 3S0OA 4IH8A 3CJFA 3K5VA 4ASDA 2RFEA 3MPTA 1IAHA 4HCUA 1Q97A 1LR4A 1PXKA 4APPA 3GVUA 1WAKA 2XVDA 3ZONA 4TN6A 4ZSAA 5AP1A 2JAVA 3PPZA 3B2WA 1YHSA 2PZ5A 4FSYA 4JJRA 4DYMA 2WKMA 3KXZA 1H1PA 4ASXA 5CEMA 3U9CA 2CHLA 4K18A 4CEGA 3LXNA 4IAKA 4MD9E 3MV5A 2BTSA 3EN5A 3RPOA 4D4SA 1O6YA 2XANA 4L00A 1WBNA 4H58A 3A7GA 4QYHA 4AWIA 4HVHA 4M0ZA 3RNIA 5I9ZA 2XEZA 5KMOA 4D2RA 2WEVA 3IGOA 3TI1A 3IDCA 2R4BA 3ORPA 2H34A 2PWLA 3H9RA 4A9RA 4F0IA 4CQGA 1UV5A 2R3OA 3TMOA 3PDTA 1M2QA 4YPDA 4I6LA 2R3HA 3ET7A 3R63A 3TM0A 4N4SA 3DBDA 4M97A 4U81A 3QF9A 3GU7A 1KV1A 5AIKA 4YTFA 1OMWA 2CDZA 2GTNA 2VU3A 5CSVA 4ZTHA 2W1IA 4Z55A 3FSKA 1A9UA 4KSQA 4M13A 2XIKA 2WPAA 4EC8A 1OUKA 1XMLA 5EG3A 4EI4A 4CT2A 4E6CA 3QD0A 4XOZA 2ITZA 2GS6A 4JMQA 5ANIA 1NW1A 2PE2A 4QMTA 5EW8A 5JEBA 4IQ6A 3CQUA 3BHUA 4QMVA 5DI1A 4ORKA 4MX9A 3ROCA 2YCSA 4FKSA 1J1CA 3P7BA 4QO9A 3D7TB 2PPQA 1OVEA 4O2ZA 2QODA 3VS0A 3O5AA 3AMYA 1ZARA 4BDDA 2VTNA 3EQDA 2ZDUA 3KULB 5DYJA 4CVAA 4MNFA 3ORXA 5HKMA 4BTKA 4D2VA 4YTCA 3QALE 1REJA 2QOHA 3HRCA 3MJ1A 4F0GA 3G90X 5E4HA 1LEZA 4FV0A 4AW2A 3QQLA 2O63A 1VYZA 3QYZA 3UVPA 3R04A 1G8KA 3OBGA 5C4KA 2VX1A 3FEGA 3E87A 4FTNA 2RG5A 4E93A 2B7AA 2VTQA 4JRNA 3PSDA 1BI7A 5KMNA 3LLAA 1UNHA 4EH8A 5ANJA 3RVGA 5HU9A 1H26A 2W06A 3JUHA 5AP3A 5FDXA 5LCKA 5FLFA 1UU9A 4ALUA 1OL2A 4DEBA 4EH4A 3FZOA 3MB6A 2FO0A 3SW7A 3PE2A 2B54A 2H6DA 2QLUA 4ZY4A 2E9UA 3VHEA 2JLDA 3ZLSA 3MVLA 3QWKA 1FVTA 4ANLA 1PF8A 2W1ZA 4BDBA 3QRIA 5CAVA 5HX8A 5A9UA 3CE3A 4GMYA 5DIAA 4YURA 4A4LA 3UO6A 5J5TA 4ZLOA 3V8SA 3R2BA 2JKKA 3LFNA 4O96A 4OT6A 5ACBC 3BE2A 3NZ0A 5KKRC 2WMQA 4YPSA 3UNJA 4BZOA 5JFVA 2VTIA 3L8VA 4NM0A 4OBQA 4CRLA 4A9UA 4X3FB 1DS5A 4O0TA 5BVWA 4CTCA 3IGGA 4FT3A 1XJDA 4FL2A 3VS7A 4ZOGA 5K4JA 3AC4A 1YXUA 3S2PA 1F0QA 3C50A 4BICA 4FZFB 5JGAA 5AV3A 4RX8A 5JRQA 5B2LA 4F63A 2YIXA 5CT7A 4I0SA 2UZWE 4TWCA 3HLLA 4B7TA 5D7VA 4PUZA 4FKRA 4C2VA 4OTHA 3TZ7A 4BI2A 2VNYA 4X2KA 4E6AA 3VS3A 1OPKA 4A9YA 5ICPA 2P55A 2EUFB 3SV0A 4HCTA 3R9OA 5GZAA 5IA3A 4J99A 5IEXA 2B0QA 2I0HA 3ERKA 3MH1A 5BQ0A 2W5AA 5EW3A 2VO6A 4NKSA 4QP8A 4W8EA 4QPAA 2FUMA 2VX0A 4QP4A 2XEYA 5BPYA 4RJ6A 2PUPA 5JMSA 3G6GA 2QOKA 3W18A 3IDBA 4JVGA 3PJ3A 1REKA 2ITNA 4JDKA 3QC9A 4E20A 2XJ0A 1BI8A 2KTYA 1YOMA 4B6LA 4RGJA 1NVSA 3W0OA 4K2RA 3PPJA 3DXPA 4FKGA 4OLIA 3HP5A 4ENXA 1JKLA 2YZAA 3PFQA 4G9RA 3P1AA 3HECA 1UWHA 4W4XA 4Y72A 3RHXA 2C69A 3WF7A 3MY5A 1X8BA 3VS4A 5A4LA 3TACA 5IQIA 2C47A 1H8FA 3GOKA 3HMMA 3NYOA 5EYKA 5HX6A 5IUHA 1M7QA 5L4QA 4QOXA 4OTGA 3UC3A 3Q5ZA 1HCKA 3GCVA 4UZDA 3PTGA 2UW9A 3UYSA 3O51A 3ZS5A 2WO6A 4X0MA 4AFJA 3CXWA 3R1QA 2J0IA 1YDTE 4G3EA 2C0OA 4FKPA 4BCFA 4GIIA 4L67A 5E7RA 2P3GX 4A9TA 1FBNA 4C3FA 4X6RA 4R8QA 4KUJA 4FTMA 3LMIA 2QKWB 2ITOA 2AYPA 4L6QA 1I09A 3QQFA 1FINA 3QRUA 2XRUA 1H1QA 3PVWA 4YZ9A 4L3LA 5LOHA 2Z02A 1UWJA 3H9OA 3HX4A 4U6RA 1YI6A 4XG3A 5FM2A 4DG0E 3ENMA 2R9SA 3UVRA 4N0SA 4BIEA 4K1BA 2YABA 4EYMA 3TDVA 4QT1A 1H1RA 3EQBA 3N9XA 4MK0A 4P90A 3V3VA 2ACXA 2J0LA 4HGSA 4LOQA 4JG7A 3V01A 2EXMA 4QMWA 3QUPA 2J0JA 4RJ5A 3NIEA 1RDQE 2PE0A 4D4YA 4C4HA 2C0IA 3RHKA 3NEWA 3UE4A 2JIIA 3CD3A 4CT1A 4UYAA 3W0PA 3UO4A 3CGOA 2Y4IB 2VTPA 4FTQA 4O21A 3GENA 5ANGA 4MF1A 4HOKA 3HAMA 2R3MA 2V55A 3LHJA 2WIHA 4IB5A 5EI2A 3W8QA 3SVVA 3KRRA 1OKZA 3OUKA 4PQNA 5JFWA 3QTXA 2E9PA 3SW4A 5EI8A 4F0FA 4HVGA 2W1CA 4OTIA 4L7FA 3E7OA 4QYEA 4PNKA 3V5WA 1OKWA 5HG7A 4IC8A 3QTZA 3GUBA 5DR9A 3F7WA 2A19B 2OG8A 5CU0A 2FSLX 3BV3A 4IVBA 2DQ7X 4L52A 5J95A 3DB6A 3EN6A 3EQCA 1U46A 3LM0A 2ZAZA 3C7QA 3PVBA 3RALA 3CKXA 3DPKA 3NX8A 2O0UA 4RSSA 4S33A 4EONA 2C3LA 3R8UA 4YC6A 4AGDA 5M57A 2O3PA 5HESA 4FSWA 3R9HA 2O65A 4F6SA 3QRKA 3R1NA 1SNUA 1RJBA 4JRVA 1KE9A 4LV8A 2JD5A 4FSZA 4I3ZA 1G3NA 5KUPA 4ZEGA 2BZHB 1TVOA 4W4VA 4L44A 5TR6A 2J2IB 4EUTA 2OXXA 3UZRA 3VW6A 4Z3VA 2BRNA 2WU7A 3WOWA 4PF4A 5IH5A 4J1RA 3PXZA 3QTRA 1I44A 4C4GA 3ULZA 4DAWA 4M66A 4H1JA 2EWAA 3SA0A 1J7LA 2W1DA 4RZWA 2XUUA 4XX9A 4DBNA 4MYGA 2XK7A 1TQMA 4U79A 1YI3A 4O6EA 1XH7A 2OW3A 3AT2A 3HV3A 3NUYA 2HIWA 4C8BA 4AN9A 1JBPE 1MP8A 1ZZLA 2O5KA 5KMJA 4BVUA 1FOTA 1IA9A 4MTAA 5CF6A 4ZLZA 3FHIA 4O1PA 2X9FA 5CXHA 3HEGA 4WO5A 4B0GA 2QOOA 2R3KA 4BDHA 5KMKA 3HMPA 3PXQA 3C4WA 3FMMA 3UTOA 5BUJA 2V0DA 3ORZA 3DK3A 4RQVA 4R77A 3FI3A 3A8WA 4FEXA 4X3JA 2HENA 4FKTA 5F95A 4OBOA 4YJSA 3SQQA 5C8MA 3AMBA 4FKJA 4LOOA 4BCGA 1ZLTA 3R02A 4IXPA 1Q3DA 5AX9A 1PYXA 5L2WA 3FXXA 4AA5A 4RMZA 2EU9A 3HUBA 1B6CB 2CMWA 4O2PA 1FPUA 2WMWA 4BCMA 4HPTE 3U54A 5EM5A 4YGAA 2QO2A 4DH5A 4FG9A 2VO3A 4I94A 2BPMA 5D11A 5M4UA 2C1AA 3DKGA 5FUTA 2F49A 3TUDA 3OFMA 3GQIA 5DH3A 5EM6A 1PXMA 4KRDA 4DH8A 4CKJA 5L2TA 3VIDA 1XWSA 2CGUA 2ERKA 2PVHA 4FV3A 4GS6A 3NYNA 4FTRA 4GIHA 2GU8A 4K8AA 5KMLA 3FUPA 4IC7A 4M68A 3E92A 1O6KA 4RIWA 5D9HA 4MXAA 4FIHA 5IA0A 1FMOE 4FUYA 5DBXA 4DH7A 4LRKA 1E9HA 4LUEA 4ZJVA 3E8DA 3II5A 1JKTA 3ZXZA 3F9NA 4KA3A 2PZPA 5H9BA 4RWJA 3UDBA 3VQUA 5L2IA 3R8LA 5F4NA 4LDTA 2WGJA 4FGBA 5LWMA 2BKZA 4BIDA 3V8WA 3L1SA 1YWNA 4KINA 4OTDA 4U8ZA 2WTWA 5KHXA 3BBWA 5CEPA 2OZAB 4G5PA 3NVMB 4EBWA 3WBLA 3P08A 2BAQA 2GCDA 3NR9A 3QXPA 1VYWA 4FV5A 2ESMA 4JDIA 4JLCA 4DEAA 3KRJA 2J7TA 4YJVA 4DFZE 4G17A 3A99A 3NIZA 5KBRA 5IQCA 2FVDA 2QD9A 3EHAA 5J9LA 1OPJA 3O8UA 1P2AA 4PY1A 1OGUA 4QDVA 3NCGA 4JI9A 3TTJA 1PW2A 4RQKA 4BF2A 3WF8A 3BYUA 1GIJA 3UC4A 3R83A 4YNOA 5E1SA 4IANA 4I93A 4CYIA 5T6KA 4I5MA 4IWOA 4BDFA 1P4OA 3HZTA 3QCXA 4BY9E 2JIUA 2NO3A 2XP2A 4KNBA 4QP9A 4E5AX 4AGWA 2J5FA 1G8AA 2WTVA 2UW0A 2Y0AA 1VR2A 3MIAA 4L3JA 4TPTA 4DFUA 5E90A 4TKSA 2R7BA 5IQEA 2I0EA 2XM9A 3QL8A 3DJ5A 4IM0A 3NVKI 2EXEA 4O7TA 2JAMA 3FI4A 3P86A 4PX6A 3RJCA 2GPHA 3DJ7A 2CCHA 4CMUA 3BL7A 3O2MA 1KWPA 4EJNA 2E9VA 2NRYA 4QMLA 2P33A 4WSYA 4A9SA 2WTJA 4IZ5A 3DU8A 3A4PA 3DK6A 3CSVA 2VWIA 3CY3A 3P7CA 4C02A 4RZVA 3F3UA 1WBVA 3R7UA 5HO7A 2A0CX 4WA9A 2NYAA 4G1WA 1M7NA 1ZMVA 4CFFA 4EHZA 5AP5A 3OTUA 2VTMA 4CV8A 3PJ2A 4GU6A 4JIKA 5KNJA 1AQ1A 2OXYA 4CNHA 3FL5A 2C1BA 4J8MA 5L8KA 1W0XC 2UZBA 2XKFA 4MKCA 4ANQA 4C0TA 4EH9A 1GZ8A 3N4VA 4NW6A 3AKLA 3AD6A 3QKMA 5IA4A 4MXZA 1W7HA 3ML1A 2CCIA 2OLCA 3B2TA 3TXOA 2VWWA 2R0IA 4BHNA 3FMLA 4UXQA 3CTJA 5HO6A 1GZNA 4L46A 3SRVA 2QCSA 1MQBA 4QMYA 2W4OA 3O96A 5IQBA 1YDRE 3Q9ZA 2YDIA 4H05A 2YM3A 2YM4A 3W0QA 3ORNA 2FH9A 1WVYA 5HU3A 4DDGA 3VJNA 4M0YA 4U5JA 3W0MA 4HNIA 1BKXA 3Q04A 4AN3A 1UU7A 1PMVA 4FV9A 3SAYA 4BDIA 3TJCA 5E8WA 1OIYA 4CXAA 5GNKA 2UZNA 2YEXA 4FYNA 5JZNA 3R7EA 3LMHA 4JXFA 5HG9A 2UZLA 4MWIA 5D12A 4YO4A 4DGOA 4ZS4A 2RFNA 4PV0A 5I0BA 3ZRMA 3EJ1A 1JPAA 3QQGA 2OIDA 2YM6A 1YXVA 2GS2A 3SG9A 2X0PA 1XKKA 4CKIA 2PL0A 4D0WA 1H01A 4FKVA 2C30A 4XHKB 4I92A 4AW0A 4BJJB 4C57A 2XK3A 2RKUA 5JK3A 3PIZA 2PZYA 4FTOA 2PULA 2WMSA 4W4WA 3FC1X 2F2CB 4KIOA 4NCTC 3MA3A 5HHWA 3TIYA 4LL0A 3V5TA 4O7RA 4HYUA 5AA8A 3MI9A 2BAJA 2X9EA 3MWUA 3JVSA 3OHTA 4M7IA 4EZ7A 5M09A 3POZA 4DG3E 2Q0BA 5CEKA 2E9OA 2VZ6A 2ZFYA 1ZWSA 4IJ9A 3EMGA 3MY0A 2VWZA 2QKRA 5IISA 3LFFA 4YLLA 3FSFA 4FUXA 4XUFA 3PP1A 4E4XA 4C4FA 3EKKA 4U44A 2ONLC 1Q8ZA 1W2DA 4X7QA 5I5ZA 4A06A 3CPCA 3KY2A 4AXAA 5BMSA 5I9XA 4YR8A 4GYIA 4NJDA 4AP7A 4IB1A 2QHMA 4O7WA 4IVDA 2YWVA 4I4EA 3QGWA 2WAJA 4NWMA 3ZSIA 3GCSA 3QX4A 5KE0A 4AXFA 1YVJA 3PG3A 4G3DA 5HNGA 3RNYA 3JY9A 3ZSGA 2PMNX 4EOKA 3D83A 4WBBB 4GKHA 3C4ZA 4XV2A 3UO5A 4XP2A 4DTAA 4YJUA 4CZUA 4GFGA 3OEZA 5GHVA 4BTMA 2QO9A 3F3ZA 2OIQA 2XM8A 3A7HA 3EZVA 3Q5IA 3R9NA 4IWQA 4O0SA 5L6PA 2ZMCA 3OBJA 1Q62A 4GH2A 2W9ZB 2FGIA 3FMDA 4C59A 4BGHA 4AZVA 3FKLA 3ALOA 1KE6A 4IWPA 4EOOA 4DINA 3RCJA 1OUYA 3QX2A 2XBAA 4QTBA 2B4SB 4IMYA 2XKEA 1ZYSA 3Q2MA 2AQXA 5DGZA 5HG5A 4EQMA 5CXZA 4GT5A 2Q0NA 2R2PA 4ERKA 1ERKA 2PSQA 3UP2A 4CLIA 2UW5A 1T46A 2C3JA 4L45A 3FDNA 4UZHA 1BL7A 4U40A 1Q8YA 3LKMA 1XR1A 4FK6A 2GNFA 2J6MA 2R3JA 4RIYA 4Y5HA 1P14A 3FPMA 4L8MA 2ITXA 2JKQA 4IAIA 3FZRA 4WNOA 4KAOA 2R3RA 2BDWA 2PZRA 3G33A 4EOIA 5TF9A 5EHLA 3GU8A 4QD6A 4E3CA 3TNHA 1YXTA 3C51A 1SNXA 2W4JA 2ZM1A 4KBCA 4LUDA 4BC6A 5BX0A 2QG7A 1ZOEA 5AP6A 1JLUE 2WXVA 2X39A 4U97A 2G9XA 4AOTA 4A07A 3KK8A 4D28A 1RQQA 3RM7A 4E4LA 4IB3A 3IS5A 4OAVB 4LQMA 4USDA 4FSUA 3W0NA 2RFSA 4IACA 5HLPA 2BHHA 4EUUA 2AC3A 4UWYA 3SXRA 3PY0A 4QTEA 5CASA 2QU6A 2FA2A 2PVMA 5LVNA 2HAKA 5IZFA 4FKIA 3DLSA 4E6DA 3KF7A 2WMUA 4AOIA 2X4FA 4DLJA 5A4EA 1W84A 3KU2A 3WI6A 4NIFA 2ZB1A 3OW4A 4O6LA 3C0GA 4MF0A 4DC2A 5JH6A 4FK3A 3GCPA 4NH1A 3RPVA 3SLSA 3A61A 3CC6A 5I3RA 3AG9A 1VEBA 4HYHA 4E5WA 1A06A 3OCSA