4BI0A

Scaffold focused virtual screening: prospective application to the discovery of ttk inhibitor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
279
structure length
254
Chain Sequence
b'QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQQVGTVNYMPPEAIKDISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Scaffold-Focused Virtual Screening: Prospective Application to the Discovery of Ttk Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 254
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bi0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bi0A01
2BRNA 3OW3A 3W2SA 2F7XE 4F6WA 3IO7A 2VWIA 2ETRA 3LQ3A 4Q5HA 4QP6A 3OOGA 3N51A 2VD5A 4NTTA 1UKIA 3PZHA 2IVSA 4ZSLA 3M42A 3HMMA 5HU9A 1UNLA 4O6LA 3KXZA 5D9HA 3SXSA 4BDCA 2R5TA 2HW6A 3BU3A 4R7BA 3C0GA 4CRSA 4BDGA 5T68A 1PXLA 2BZJA 3DXPA 3AC8A 5AUYA 1KOBA 1OPLA 3F2AA 2EVAA 4IZAA 1R3CA 3MFRA 3AC3A 5BVDA 1RDQE 1FGIA 5KZIA 3WIKA 4F1TA 2WTDA 5H3QA 5J9ZA 4C4FA 2BTSA 1VYZA 3R30A 4XEYA 3ACJA 5EHLA 3DOGA 3HVCA 5CNNA 4CZYB 4YZCA 3EJ1A 3GNIB 3PPZA 5CF4A 3N4TA 3U9NA 4DEGA 3TUBA 2R0UA 3FL4A 3E87A 4IM2A 3TTIA 4OAUC 3S3IA 3FZPA 4ZTSA 4O0TA 4BVUA 1ZYSA 5LWMA 4FEWA 2WMWA 3BCEA 5F20A 1UV5A 2BVAA 2HCKA 2O63A 4C2VA 3NYVA 3L9PA 2VWBA 3R0TA 3UIUA 3WI6A 2R7IA 2YJSA 2X9EA 1UU7A 4L67A 4HVHA 5AA8A 3L8PA 4ORKA 3EFWA 3I5ZA 4XRJA 5JRSA 2C6IA 2ITQA 5DRBA 3CQEA 3FMLA 1Q8WA 1PXNA 2GNJA 3FC2A 4EONA 4O7SA 3I7CA 4E1ZA 2VU3A 2J0KA 5HLNA 2YM7A 3PZEA 1BKXA 2XRUA 1Y8GA 5FEQA 4DH5A 5IMXA 5L2WA 1GZOA 4TNDA 4YZDA 1ZYCA 5FP6A 4YJTA 2XEZA 4XNEA 3RM7A 4ZP5A 4JDJA 4C4HA 5IZFA 1YHWA 4G3GA 3KF7A 4I0SA 2PMOX 3M1SA 4EH6A 3G51A 4IMYA 4DE4A 3BBTB 3FY2A 4FUXA 2I0VA 2BDWA 4M68A 2W5AA 1Y6AA 4GU9A 4YJSA 3ZDIA 4CV9A 5BYLA 3Q32A 1YQJA 3NSZA 4PY1A 3MVLA 4Y72A 1J91A 4CMOA 4NWMA 4X6QC 4K9YA 3GCSA 4PMSA 4YNEA 3Q5IA 3TTJA 4BCQA 2W4JA 3SC1A 5A9UA 3KK8A 3M11A 4F0IA 4Z16A 5LMAA 4O7WA 3FMEA 3BIZA 3DDQA 3B2TA 3BHHA 3O8UA 4BYJA 1QPEA 5L4QA 1W7HA 3QZHA 3R1SA 4N6YA 4YZMA 5A3XA 1X8BA 2ZMDA 4NZWB 1KE7A 2F9GA 5ETIA 5HBJA 5LVLA 3UJGA 2GTNA 4L52A 4NCTC 4YZBA 2OG8A 4I4EA 3V51A 5HIBA 3DXQA 5CYIA 4FV7A 5AP5A 3AT2A 2UZNA 2R3GA 3E7OA 3QD0A 4RIYB 5EYMA 2GMXA 1H1QA 2OK1A 4NFMA 3VIDA 4YJUA 5TKDA 3WYXA 3EZRA 4IHPA 4Y73A 3W16A 3NUNA 1OKZA 5CZHA 4IWDA 5IISA 3G6GA 1H08A 2GQGA 4QYYA 4D2TA 5KMLA 5M06A 3DBCA 3PPKA 3LKMA 4ZY4A 3DS6A 3KQ7A 3QX4A 3MJ1A 4TYHB 1TKIA 5DR9A 3HLLA 4PP9A 4A07A 4USEA 3S00A 2JIIA 5K5NA 5FBNC 4X0MA 3QHRA 3KXHA 5CWZA 3GC0A 2ZV2A 4I0TA 5L6OA 2X2LA 2CDZA 1IG1A 3FZTA 3L9LA 5C1QB 3GUBA 3LCTA 2VV9A 2W05A 3FJQE 3MPAA 3NCZA 2QKWB 2XCKA 2PUNA 4WOVA 4LL0A 2Z02A 2NPQA 3ORXA 3FLWA 1XH5A 2RFNA 4BYIA 5AWMA 1K2PA 3KVWA 4FSQA 3GGFA 2JDRA 3BGPA 4F0GA 3BEAA 4FV2A 1R0EA 3SQQA 2VAGA 3HX4A 3VS3A 3OCTA 5GJDA 3K54A 3NUPA 4PDOA 5CQUA 5LCJA 3PXRA 2PUIA 3PP1A 4ANMA 4QP4A 4RJ6A 3OT8A 4Z7HA 3AT4A 4CFFA 4FKVA 1NVQA 2R3PA 1OB3A 1ZMVA 4NT4A 2FUMA 4DINA 1Q97A 2W1IA 4EK4A 5LMBA 4QRCA 4Z55A 3DBEA 4CG9A 2QOCA 3QLFA 4FL3A 4UXQA 3CLYA 4WG3A 1M2RA 3HUCA 5HCYA 3VVHA 4BGQA 4M0ZA 2QKRA 3ENHA 3E8CA 3K2LA 2HY81 3B2WA 4FTTA 4TYIA 3KRWA 2R64A 3IECA 4WNKA 3WE8A 2O8YA 4QYHA 4FSYA 5CEQA 3RAIA 3FYJX 5E1EA 3PWYA 5IQIA 4NYEA 1H1PA 4QTAA 3Q6UA 4LUDA 5CSHA 5IUHA 5M4IA 2WTVA 1PJKA 5B2MA 4B4LA 2HZ0A 3IW5A 4RWIA 1U59A 4FZ6A 4J53A 4PX6A 2YM3A 3TV4A 3ZBXA 2W1HA 4I22A 3C1XA 4BWPA 3PSBA 4GT5A 3PXQA 3O51A 3TWJA 4KBAA 1J7UA 4E6QA 3P7AA 1AQ1A 1RW8A 2W4OA 4O0YA 1JBPE 4Q2AA 5DHJA 5C9CA 3UIXA 5CAUA 2UZWE 2W1DA 4HW7A 1WBOA 3O8TA 3LCSA 4FNWA 4NJDA 4P5QA 4JJRA 1QL6A 2C6TA 2BRMA 3FHRA 3DNEA 3I5NA 4BF2A 3EQDA 4ZTMA 4DHFA 3RCJA 4HJOA 3MTFA 3QTSA 5H8BA 4NSTA 4E4XA 2R3LA 3WZUA 1ZYJA 3MFTA 4KIKB 1R78A 1GY3A 2QOIA 2VTMA 3VS5A 3Q52A 1JKKA 3F61A 4FBXA 4B6LA 3MIAA 4E5AX 1SVEA 5JFSA 5C27A 3CQWA 4FYOA 4JR3A 1KWPA 2C4GA 3R7IA 4E6CA 3HV5A 4D2VA 4CFUA 3GOKA 5CI6A 4GVJA 2GSFA 4A06A 2FGIA 2C6OA 4WNPA 2ITWA 4KINA 4IAKA 4YLLA 4JVGA 4X3FB 3UP2A 3LMIA 4D1SA 2EWAA 1M17A 3NR9A 3DKCA 3PXZA 4DLJA 5BVNA 2H96A 3FMNA 3R9HA 5HX8A 3SW4A 4PMMA 5HQ0A 4WSYA 3KGAA 3OMVA 2JDSA 3TNWA 4E5WA 5HIDA 4UN0C 2GFSA 4RIOA 3FMKA 3ZUTA 2IO6A 5IUGA 5IQHA 4BDKA 1XBAA 4FSRA 4ZSGA 4AW2A 4YP8A 3Q9ZA 3COHA 3WE4A 4FTKA 4EZ5A 4FTQA 2B54A 2GPHA 1H4LA 4Z7GA 2XNGA 2YJRA 4ZS4A 2R0IA 2R4BA 3NUSA 4KNBA 1OMWA 4BWKA 5EW9A 2VN9A 3NS9A 3R9DA 4HCTA 5CF5A 4L6QA 1FBNA 5IQGA 5AR8A 2UW5A 2QLUA 4AGWA 4KRCA 4C3PA 3AT3A 2YDIA 4N4SA 5I9UA 4KUJA 4U97A 3PP0A 2G01A 2RG6A 1YXTA 1LR4A 2PVNA 3GFEA 4U43A 5C8MA 4JX7A 4AOTA 4NM7A 4OBPA 4OW8A 4XV1A 5LCKA 3ZSIA 3BHVA 4BBEA 3KULA 4FV8A 3FPMA 3AG9A 2B53A 4JRVA 4AGCA 4EOPA 4CT1A 4I6FA 3CBLA 4C4JA 3R8VA 4O81A 1J3HA 2A27A 3CGFA 1DAYA 3C4XA 4PWNA 2JAMA 3VBYA 2VNYA 3LXNA 4DGOA 2G15A 5HBEA 3LAUA 4X21A 4EJNA 1ZWSA 4ZTHA 1ATPE 3HL7A 2GU8A 4LGDA 4CZTA 4K18A 4DG2E 4PF4A 3GI3A 3RZFA 4WUNA 5H8GA 3EH9A 4DEEA 3IPHA 1H00A 5AP0A 2YCQA 3UODA 4CEGA 4FICA 2V7OA 2V62A 4FYNA 3EKNA 2V0DA 3DB8A 5DPVA 3WF9A 2OJIA 1Z9XA 1YW2A 3RI1A 2ITTA 2XM9A 3NYNA 3IDBA 2QO2A 2HIWA 4FKIA 4ITHA 5CAPA 3BX5A 2ITOA 3FZSA 4FKOA 3DQWA 4GIIA 4RLKA 4XH6A 3NDMA 3L1SA 4EK3A 4EOKA 3LFFA 2UZBA 3IKAA 5KMMA 4MXOA 5LJJA 4RJ4A 4FT7A 3JXWA 2XK7A 2PVYA 3R1YA 5JKGA 5K4JA 4F7SA 5JFWA 3BQRA 3DY7A 3GU6A 3IW7A 3JVSA 3LVPA 4CTBA 3NUAA 5A4QA 1WBTA 3PA5A 1Q8YA 3JVRA 4AA4A 3D7TA 3AD5A 4DGLC 4Y8DA 2WIHA 4KA3A 4RA4A 4ZTLA 2VX1A 1DI9A 4ZTNA 3AGMA 5ANGA 4FNXA 5K0KA 1I44A 4PPCA 4FNYA 3BLHA 3MH3A 4RIWA 2FH9A 5AP3A 2B4SB 4X2FA 5GZ8A 5L2SA 4ZLZA 1U54A 3FLYA 3ALNA 4J98A 1K3AA 4U79A 4KWPA 1J1CA 3CP9A 5A46A 4DA5A 3OWLA 3UNZA 4D4RA 3W2RA 2JDVA 3Q5ZA 3F9NA 4QT1A 3C5IA 4M8TA 3GC7A 3P9JA 2BPMA 2OZAB 2GS2A 4FKPA 3WF8A 2VX0A 4EORA 3NVMB 2R3OA 2E9OA 1UNHA 4QD6A 1AD5A 2FVDA 2WOTA 1WBNA 5E8ZA 2ZV7A 4B9DA 4GUEA 4IB3A 1OKWA 5AV0A 3ROCA 2WFYA 4DEBA 4GYGA 4R3PA 4BDIA 3PSCA 4XCUA 4TYGA 4MNFA 4O0UA 2YA9A 3PPJA 4AG8A 5I9ZA 2XBAA 3PA4A 5DEYA 4FA2A 2C68A 2R7BA 4BCPA 4D9TA 3Q2JA 1I09A 2J6MA 1BI8A 5ANKA 5JSMA 4P4CA 4ZAUA 3ZO2A 5KKRB 3GBZA 3LLAA 3DBDA 4YMJA 3DTCA 1H25A 3OWJA 1R0PA 1PYEA 2WMAA 2PWLA 3FMMA 3UG1A 4IEBA 3ZUUA 5CU6A 2O0UA 2QOHA 5BYZA 3QL8A 3UOHA 1ZY5A 5L6PA 1PXPA 4O7YA 1JKTA 3MWUA 1KE9A 4IZYA 1PXOA 4GK3A 2UW9A 3HMPA 4FV3A 3RALA 3ZCLA 5E8TA 3FLQA 5GIOE 3QKKA 3UP7A 5KMKA 2BIKB 2UVZA 1VJYA 4PQNA 2WELA 4ZJJA 2J5EA 4AE9A 5L3AA 2BFYA 5DT0A 2OIQA 5AR7A 3PXFA 2UW8A 4RC4A 4EL9A 3MPTA 2VX3A 4IX4A 3E64A 5C4LA 5HE2A 5ANEA 3FKOA 4CSVA 2YITA 1GIHA 2H8HA 3GU7A 1DS5A 1XJDA 5CU3A 5H9BA 3Q9XA 3T3UA 2X8EA 1W0XC 5F95A 5DRDA 4A9UA 4DC2A 3TDWA 5IQCA 3AC1A 4I6BA 1YDRE 2CKOA 2VO6A 3LQ8A 5DR6A 1JLUE 3EOCA 3QAME 4TWOA 4OTHA 4IIRA 4E26A 1YKRA 4ERWA 2Q83A 2ZYBA 4EKLA 2UZLA 3C13A 3W2PA 4WT6A 5HZNA 3V6RA 4O96A 4JIKA 3ORKA 4QP3A 4RBLA 5AIKA 3E8EA 4F7LA 4BKJA 2Z60A 2G2HA 4UMPA 4XLIA 3R7YA 2YLEA 4CYIA 5KBRA 2OJ9A 4BY9E 2QCSA 1PKGA 2X7OA 2R3HA 3E93A 3H3CA 3MBLA 4BL1A 3A7IA 1MP8A 2Y4IC 5DG5A 3FAAA 1FVRA 5G1XA 3ZLSA 4V0GA 4W9XA 4I0RA 3TJDA 3R04A 4IWOA 4FV9A 5CZIA 3P1AA 4U5JA 3VC4A 4DFNA 2ZDTA 4XG8A 4LG4A 3QX2A 5I9YA 3U4WA 2IW8A 2J0MB 1WCCA 3LJ2A 1LEWA 4M14A 5CX9A 4FK6A 4MVFA 3FI2A 4WUAA 4D4VA 2AC3A 5AUTA 4UYAA 3Q6WA 4GRBA 3PVBA 2QO7A 2J0LA 3A2CA 2YCSA 4QTCA 3H0YA 5FD2A 1W82A 4FTLA 3F69A 4W8DA 3NRMA 4RGJA 3R28A 3TL8A 4TYJA 4TYHA 4EYMA 3ZO1A 3MH2A 4FG9A 5FXQA 3CTHA 3OG7A 4BTKA 3R9RA 3T8OA 5HO8A 2WOUA 4WNOA 2JAVA 3DCVA 3FL5A 4NKSA 3RAKA 5HTIA 2YM6A 3R8LA 2Z7LA 4C4EA 3UNKA 3TV6A 4NH1A 1B38A 3T9TA 4K1BA 4OTFA 2WMTA 3Q53A 1Y91A 4HVIA 4B7TA 3A4PA 3C4EA 3F7ZA 3WOWA 3SOCA 3LCKA 3VBVA 4O7LA 3W2QA 3HZTA 3NPCA 2H34A 4GFGA 4EK6A 1JNKA 5FDPA 1M2PA 2KULA 5E1SA 4LFIA 4DEHA 3MN3A 3AD6A 4XG4A 1Y8YA 2PZ5A 3TEIA 5C26A 1H28A 3QTWA 1FGKA 4BI1A 5TT7A 4H3PA 4D28A 4QMZA 4JAJA 2PY3A 4YJOA 2OO8X 4TRLA 2C3IB 3JUHA 4IB5A 4U45A 4HGEA 4PTCA 4A9TA 2WTJA 2QU6A 4TN6A 4GV1A 3Q4UA 3R21A 1VR2A 4KS7A 4FE2A 2WPAA 4A4LA 2EB2A 1GAGA 3NGAA 4AN2A 2UVYA 2PE0A 1CSNA 1SNXA 1JQHA 1WVYA 3PE1A 1Q3DA 3QTIA 4HNFA 3U9CA 3W8LA 4TL0A 4ANNA 3UO5A 3CSVA 4FTCA 3KF4A 2A4LA 4CD0A 3F3TA 3FC1X 3MVJA 4Y83A 3TT0A 3RJCA 2VWZA 5C8KA 1XH8A 2R3QA 4KIQA 5A14A 3M2WA 2JC6A 2O64A 4BRXA 4ID7A 4YNOA 4KKHA 3NWWA 2W17A 2O65A 3PY1A 2PVJA 3ZC6A 4M15A 2BRBA 4BIDA 3Q9WA 2WQMA 3I60A 5JFXA 4R5YA 3R8PA 3PIZA 4JX3A 5IKWA 3JS2A 2YM5A 5AP7A 3VN9A 4D0WA 3IS5A 4QMMA 2HZIA 2XK4A 4MD7E 1WVXA 2IN6A 4IX6A 4QMTA 5CAVA 5HVKA 3CD3A 2GS6A 3TJCA 3F66A 3RNIA 2BILB 4B8MA 3ZHPC 4R3RA 3IQ7A 4K0YA 2ITYA 2GNHA 2XH5A 4ONAA 5LVNA 3PFQA 2BHHA 4YTCA 3LXLA 3QHWA 2R3IA 3AQVA 3D0EA 4RJ3A 4ZJIA 2X81A 1KE8A 4IE9A 4D9UA 3HAVA 3R9OA 4ZXTA 5E91A 3BGZA 4IBMA 1OECA 2W9ZB 1P2AA 4LQMA 4ZY6A 3W1FA 3ROYA 1M14A 4KSPA 3BRBA 3KXNA 4UBAA 3ZH8A 4EZ7A 4WSQA 1BL6A 5M51A 2X8IA 1UWHA 2C47A 3U51A 4IM3A 3OY3A 4P2KA 3C4CA 3KULB 2ZB1A 4PRJA 3EL8A 4O0SA 4XG2A 5CU0A 5EQEA 1KOAA 3RZBA 4L3JA 3TCPA 2HENA 4A9YA 3CJGA 3H0ZA 4BI0A 3O50A 4K6ZA 3O96A 3COKA 4IH8A 5AR3A 4MEDA 2OXDA 2GDOA 1OITA 4HCVA 3OXZA 5F94A 4J99A 4QPAA 1OL1A 5ACKA 2YHVA 3WZKA 3CY2A 2VO0A 3DQXA 3QWJA 2XNEA 3QD4A 3ZMMA 4OT6A 5BVWA 3QZIA 2I1MA 4OTPA 5IUIA 5J9YA 2JLDA 4J95A 4RVKA 4J1RA 5CAOA 3C4WA 4QP7A 4BCOA 5HX6A 4C3FA 3MSSA 4CKIA 1OI9A 2XNNA 4AP7A 1Q5KA 3QC9A 3EN4A 3OUKA 5L2TA 4DFLA 2R3NA 2W1GA 3QBNA 1H0WA 2CKEA 3BHUA 1YXVA 2YISA 3BU5A 4FV1A 5HTCA 5KMOA 4XX9A 3LM5A 2W1EA 4QOXA 4CMUA 4YHJA 3LPBA 3ITZA 4I6HA 4QPMA 4G6NA 1KV1A 2WZJA 5DE2A 2GTMA 3OBGA 5CT7A 3WF5A 3V3VA 4AGUA 5CAQA 2ONLA 3LFDA 4EH7A 4YHTA 4CGAA 2UZDA 3QQJA 4X7QA 5HNBA 2GNIA 4JXFA 4AZTA 3KXMA 4ANOA 4KD1A 5AP2A 4QPSA 5IF1A 5EM7A 4BGHA 1NY3A 2C3KA 5JT2A 1OBGA 4GW8A 2JD5A 3D7TB 2PK9A 3QRJA 4JR7A 5DI1A 3F2NA 4AT5A 4EEVA 2WIPA 5LXMA 1SNUA 1UVRA 2BAJA 4L01A 4S32A 3D5VA 3DLZA 4O6EA 2FSOX 4LYNA 4RIWB 3WZJA 4MYGA 1U54B 2JDOA 3HMIA 4I3ZA 5FEEA 5K4IA 3AC5A 3FUPA 4FKSA 3G0FA 4C61A 4EBWA 1W84A 4XS2A 3LFNA 1TQMA 2XF0A 2B9HA 4U9AA 1UWJA 3ULZA 1JVPP 1U46A 4UMTA 4I5HA 3FQEA 3P7CA 4O91A 3KK9A 4B99A 2VTSA 4IVAA 3ZC5A 4BDAA 3PG1A 4EJ7A 3KMWA 2YDKA 3JY0A 2ERZE 3ZO3A 4DT9A 2Y6MA 2WU6A 4OBQA 3ZRKA 4I23A 5BPYA 5CU4A 2IZSA 3UGCA 3VUGA 4B0GA 5HD4A 2FYSA 4MBIA 3EN9A 1OKYA 2DWBA 3O7LB 1Q62A 3R1QA 3PJ8A 1YOJA 3FEGA 4ZTQA 3N4VA 1PYXA 3E88A 3CCNA 2YFXA 3S2PA 3BGQA 4DG3E 3F3VA 4TY1A 3VBTA 2ZM1A 4OT5A 4FTUA 4DTKA 4QP2A 4RQKA 4MKCA 3THBA 1G5SA 4OAVB 4I92A 2OZAA 4C4IA 4FTMA 2PZIA 3R9NA 2DQ7X 4RVMA 4BCIA 4Q5EA 3TUCA 4XP2A 4IDVA 4HCUA 4YLJA 5CVGA 4B8LA 4F9YA 4I24A 5AUVA 3RPSA 3I6UA 4H58A 4OTQA 3HMNA 3GU5A 4L42A 4X3FC 4M66A 4XG9A 3W2CA 4D55A 3QA0A 2PL0A 3PVGA 2OIDA 3I81A 4OTWA 4DG0E 5LARA 3ZDUA 3FDNA 3T3VA 3HV7A 3HA8A 5C03A 3PRFA 4AUAA 3KA0A 4KAOA 5IA2A 5GNKA 2C5YA 4TWPA 4UYNA 1ZY4A 3V5LA 2FB8A 4AQCA 4L68A 1JAMA 4RFMA 4EOIA 5EYCA 3VHKA 5AP1A 4E4MA 4CG8A 5D7VA 2ITXA 3QWKA 3SA0A 4U40A 1PY5A 2YZAA 3NUXA 4HVGA 1Y6BA 2LGCA 2GHGA 2XEYA 2I0HA 4MBLA 3W2OA 4AZSA 4C58A 2OH0E 4LMNA 4XLVA 5I9VA 3QKMA 3NNXA 3ORNA 3OBJA 3RK9A 3V8WA 3FMHA 1XQZA 4JNWA 4QQJA 4O83A 4V0GB 3DK7A 4BBMA 5E90A 4MNEA 3UO6A 4C59A 5A4LA 1H1RA 4XJ0A 5I5ZA 3ID6C 3GCPA 4HGTA 5HESA 4JLCA 3OEZA 4D2SA 3DKFA 4QNYA 4CFNA 2OIBA 1Q3WA 3ATSA 5AADA 4U8ZA 2I6LA 5BNJA 4YBKA 5EW3A 2ZV8A 5AUUA 3ANRA 2ZVAA 3OTVA 2YIRA 1CKIA 4DEIA 1PRYA 3G6HA 4HVSA 4DFZE 2QVSE 3GENA 3BELA 3C0IA 3SX9A 3UPZA 1DM2A 1T45A 3QRUA 1FINA 3PY0A 3AGLA 5E8SA 1Q61A 4AX8A 5J5SA 2J0JA 4ANLA 4APCA 1P4FA 5AFVA 4JT3A 3QGWA 3GC9A 5J79A 4N70A 2BZKB 3HA6A 5EG3A 2QOOA 3UC4A 4MHAA 4YJQA 5F1ZA 3PG3A 3QQHA 2OXXA 3VF9A 3UYSA 4MWHA 1ZXEA 2BUJA 2WMSA 4BZOA 4F64A 3RMFA 4F1MA 3VS1A 5BMSA 3VNTA 3OEFX 3UVPA 2WAJA 3CKXA 2EXEA 2VTJA 3PJCA 2BAKA 3K5UA 4YJVA 4JI9A 3RK5A 4MK0A 3TZ7A 2ESMA 3DFCB 5GZ9A 4JG6A 4ACGA 3QGYA 5DLSA 4QMYA 4M12A 4PMTA 3FYKX 5AX3A 4F6UA 2XJ2A 4WHZA 5I9XA 2G2IA 3OHTA 3R63A 4TWCA 3RAWA 4S2ZA 4WKQA 4QMXA 2X0GA 3W33A 4M13A 2V22A 4I93A 3LFEA 2W9FB 4C35A 5IQEA 2O2UA 3H9OA 3V5WA 2F7ZE 4EHGA 4U80A 1CKJA 5AV3A 4AT3A 1URWA 4R7IA 2F49A 3PA3A 5M56A 2CCHA 1BUHA 4NW5A 4LL5A 4DN5A 1MUOA 5FP5A 4DLIA 1Q24A 1MRUA 4M0YA 3COIA 1FQ1B 1PMUA 3QUEA 1J1BA 1OL7A 1R1WA 1IEPA 3GEQA 1FOTA 4JIAA 4O1PA 3KN6A 4L45A 1NVSA 3P7BA 2WQEA 2XCHA 4FC0A 4D1ZA 4Y5HA 1VYWA 3A8XA 1W8CA 3BYUA 3EQIA 4MCVA 3L9MA 4ANBA 5E8XA 4IQ6A 4FSMA 4WD5A 1JSUA 3ZFMA 1JSVA 3IK3A 4YSJA 2HXLA 4FKRA 1OPJA 1YWNA 4WG4A 2VRXA 4F9WA 3MESA 1OGUA 4FK3A 3Q4ZA 2WNTA 2BTRA 1Y57A 4RWLA 5DWRA 4ZJVA 3F5PA 3DK6A 2ERKA 3HMOA 2X2KA 2OJFE 2ZM3A 3DTWA 1OPKA 2VTTA 3O23A 5J87A 5FUTA 3FSKA 3ZTXA 4EOOA 5EQPA 5L8LA 3FZ1A 4ASDA 4BCMA 3SOAA 2HY0A 5CNOA 3W8QA 3A7HA 4ACMA 2DUVA 5KKRC 4IX3A 4GG7A 2RKUA 5FXRA 3FBVA 2XIRA 3ERKA 4FT9A 5G6VA 4CFVA 5IQBA 1YDSE 5LMKA 2W99B 4XRLA 3RPOA 3CS9A 1SVHA 4O38A 4AZVA 2B7AA 5E8UA 2V5QA 4D2PA 3BYMA 2CKQA 3GT8A 3W18A 5A4TA 3VW6A 4DITA 5LWNA 4ACCA 4XBRA 1WAKA 1HCLA 4N0SA 4IFCA 5DA3A 4BGGA 3PSDA 1FMKA 4H39A 4BC6A 2KTYA 4F4PA 1CDKA 4OTDA 4XYFA 3UTOA 3QLGA 5AV2A 5AP6A 4YGAA 4CV8A 1O9UA 1OIYA 2XYUA 4QP1A 3ZM9A 2EXMA 5EKNA 3UOKA 5ANIA 4N6ZA 2JITA 3MI9A 4FGBA 2DS1A 2W4KA 3HNGA 4X2GA 3E3BX 3LQ5A 3VW8A 3V8TA 4PDYA 2R3MA 2ITPA 4ANSA 4PTGA 1RE8A 1VEBA 3WIGA 4C02A 4FSZA 3D15A 3D7ZA 2ITUA 4BCHA 4AGDA 4D2WA 2VTPA 3S0OA 1IA8A 4O7RA 2B9IA 5GHVA 2CPKE 3LCDA 5CSVA 3QRTA 2W06A 3H30A 4YJNA 5CSXA 1SVGA 3AD4A 3F5GA 4FKJA 4U0IA 4WIHA 1OVEA 3UMWA 3VWAA 2OW3A 2PUUA 3C50A 1B39A 3TKHA 5T6KA 4LOPA 3DT1A 1GZ8A 2IVUA 3P08A 4O0RA 3E63A 4F7NA 5IEYA 2OLCA 5L6WL 4UV0A 4PL5A 3C9WA 3NUYA 2E9VA 2VZ6A 4BB4A 2W1CA 1ZOGA 3COMA 1GNGA 4RX7A 1M2QA 2VTLA 3HDMA 3R00A 5JEBA 3DBQA 3OD6X 4XV9A 4MQ1A 5HICA 5HIEA 4FIGA 3ATTA 1WBWA 2A1AB 1Q99A 3MA3A 3FY0A 4BDDA 4O84A 3OUNB 1YOMA 5E8WA 5EI2A 3PTGA 4OTRA 4FUYA 4AN9A 2WTWA 2QO9A 5ETAA 3ZXTA 1YI3A 3DLSA 5AAEA 3MGYA 3D5WA 3WZEA 3NCGA 3BQCA 3I1AA 4WO5A 5B0XA 3D14A 3FLZA 3TZMA 4G3FA 4RX5A 3G33A 5AX9A 4RJ5A 4CNHA 3C5UA 4FVRA 1XBBA 4QMOA 5A6OA 4BBFA 4TXCA 4EQUA 3R8MA 2YIYA 4QP9A 4L53A 2QOBA 2ZM4A 5IEXA 2HWPA 4M84A 1OKVA 4WBBB 3PDTA 4FZDB 4G3CA 3OY1A 3AXWA 1KSWA 2Z2WA 4OTIA 3E92A 4XG7A 4O2ZA 5HTBA 4PL3A 3H4JA 3PLSA 4GK2A 3HUBA 3WZDA 4FT0A 4UMUA 2JIVA 3G5DA 2YWVA 4D0XA 3I0QA 5GIPE 1PF8A 3QU0A 4AOIA 5K9IA 1LPUA 5CEPA 2CGXA 2ITZA 3F7WA 4KIPA 1SZMA 4M97A 3DKGA 4EH8A 3F3UA 3RTPA 4W9WA 4ZSAA 2XNMA 3NZ0A 4FMQA 4FV6A 4EUUA 1JKSA 1A9UA 4ALWA 2WQBA 1YXXA 2IZUA 4G3DA 2GNFA 1M52A 2HAKA 3AC2A 4CRLA 4USFA 4MF1A 5HBHA 2WD1A 1YVJA 3RGFA 1GOLA 2WMXA 3LJ1A 3R6XA 4I41A 4DCAA 5EW8A 4L3LA 2VWVA 1YOLA 3ZEPA 3BLQA 2QR7A 4HYIA 4E8AA 3A8WA 2CNQA 4XV2A 3SHEA 5M07A 4IADA 4MXYA 3BHYA 4DTBA 2XK9A 4UZDA 3V8SA 4C8BA 1XH7A 4GUBA 5BMMA 1XH4A 4GU6A 2W96B 4GCJA 3MVHA 3ETAA 3GU4A 4XG3A 2QHMA 2ZDUA 4RPVA 3GOPA 3RHXA 2RL5A 3CE3A 1UNGA 4XMOA 3QKLA 4S33A 3IG7A 1ZLTA 5CSWA 4BKZA 5AM6A 5JGDA 5C01A 5ANOA 1IASA 2PVRA 4I5CA 2C0TA 5DNRA 5EFQA 4LMUA 3UZTA 2WMBA 3MYGA 2CLXA 2WMRA 3EMGA 3HP5A 4EOSA 2QOKA 5IA3A 5IEVA 4ZS0A 2LAVA 4IJ9A 4TPTA 5C4KA 4FZ7A 2WEIA 3DFAA 4YHFA 1V1KA 2PUPA 5AA9A 2UUEA 4IVDA 3RINA 5DBXA 4EH3A 4K11A 4O7NA 3LZBA 2OWBA 2EUFB 3EFLA 3OW4A 4F6SA 2QU5A 4O82A 4G6LA 4MWIA 4G3EA 5HE3A 3QF9A 2XM8A 4FKTA 2UW0A 5ETCA 4QNAA 4IZ5A 2XNOA 2QG7A 4IZ7A 4GJ3A 3UNJA 5D10A 5HHWA 3QD3A 2W5HA 2P0CA 2X7FA 3Q4TA 5BUEA 2CNVA 1YXUA 2YCRA 4M3QA 4BDEA 4IAFA 1IA9A 3O17A 4GT4A 3F6XA 4WRSA 5TO8A 3QRKA 3LXKA 2YWPA 4E6AA 4O0VA 1WFCA 2Q0NA 4MXZA 5M55A 4ASZA 4MNEB 2A2AA 1ZYDA 2QNJA 2VWYA 1YI4A 3NW5A 4GSBA 4ERKA 3SGCA 3EQFA 4JRNA 3BI6A 4AW0A 3ZFXA 1VZOA 4EH9A 4WBOA 2RG5A 4MXAA 1LEZA 3EN5A 3EIDA 2WGJA 2RFEA 3BHTA 3K3IA 3V5PA 2E9UA 3MPMA 4IVBA 2OXYA 3KY2A 5HD7A 5CANA 5M4UA 2PSQA 3LFAA 4PMPA 2QOQA 4ZSJA 1XH6A 4PNIA 5KMNA 4IAIA 5LQFA 4X6RA 3FHIA 3MFSA 1KV2A 4BTFA 4FT3A 5FM3A 4HVDA 3D83A 5D41A 2XP2A 2QONA 3CQUA 3AMYA 4FTNA 3ZRMA 1O6YA 3BYOA 4JS8A 4TNBA 3WARA 4RG0A 3W55A 3E8NA 4C4GA 3UQGA 4G31A 3KRXA 3WYYA 4FTJA 3LOKA 4DT8A 5HLWA 1OUKA 3U55A 4NUSA 4O1OA 1URCA 3LHJA 4G5JA 3WF7A 4ZOGA 3EQRA 3KB7A 3C0HA 4MD9E 3VQHA 3ZLWA 5M4CA 3A61A 3VUTA 3FLSA 1STCE 2YAAA 4KBKA 5L2IA 3RWQA 4RWJA 2OF2A 5DIAA 5AV1A 5J7BA 4BDJA 2BFXA 1UA2A 4HZSA 5HG8A 1P14A 5CSPA 2Y7JA 1ERKA 2YCFA 1WBVA 4W4XA 2P3GX 3PIYA 4BFMA 4W4YA 5E8YA 4E73A 4CCUA 5CF8A 4O22A 1G8SA 2PULA 2WTKB 4ALUA 5CEIA 5DEWA 1PW2A 1GIIA 3QCSA 5EI6A 5B2KA 3POZA 4C38A 3UG2A 2Z7RA 3SW7A 3QXOA 4H1JA 4F9CA 1XHAA 5CENA 2REIA 2O3PA 1DI8A 4IAAA 4DF3A 3ORMA 3GFWA 4ZMFA 3MW1A 5KNJA 4H3BA 2BIYA 4YJPA 2PMLX 3CXWA 2WQNA 3ZSHA 5HO6A 3KMUA 5BUIA 2ZV9A 4UZHA 2GS7A 4L3PA 5GZAA 4L8MA 4KSQA 4AW1A 2BKKA 3IGOA 2JFLA 3KCFA 3GVUA 3QQFA 3E7VA 3L8VA 4UALA 2XNPA 2QLQA 3LW0A 3QQGA 3W10A 5FQDC 3NW6A 3NYOA 2Y0AA 4O7TA 4CVAA 4GT3A 4CQGA 4S30A 1H26A 4CKRA 4DGNA 3P0MA 5CU2A 3V6SA 3VRYA 5JQ5A 5CQWA 5CT0A 4FKLA 4H36A 1CTPE 4IAYA 2PVMA 4FEVA 1QPDA 3VBWA 5CXZA 5DYJA 2XKFA 5J1WA 4ZLYA 4FVQA 4BN1A 3Q3BA 3SXRA 4E5BA 3LE6A 1PKDA 4M69A 4MX9A 3GP0A 2VNWA 5TR6A 3V5TA 3KEXA 4YO4A 3A7JA 4EWHA 3NEWA 1ZARA 3MH0A 2OU7A 3NMUF 2PZPA 4FL2A 4BCFA 4BIBA 4N57A 3NVKI 3VBQA 5ANDA 1SMHA 4QO9A 3MTLA 2E2BA 2QHNA 3E3PA 3ODZX 1V0BA 2AUHA 2J4ZA 3V5QA 1PMVA 3OT3A 4CQEA 4YSMA 2PZYA 4X2JA 4II5A 3GC8A 5BVKA 4D4YA 2GQSA 3ZZWA 2YIWA 4IFGA 3NUUA 5EH0A 2Y9QA 3EHAA 3PIXA 3RM6A 4JBOA 3RKBA 3DNDA 2NP8A 4EWQA 2YAKA 5DOSA 1JKLA 4TW9A 2JFMA 4GJ2A 4AZFA 3FKNA 2R3KA 5FXSA 3ORLA 4CLJA 3NIZA 3KL8A 4F9BA 4FGRA 2FSLX 2GHLA 4K8AA 3I7BA 5EM8A 2IVTA 2HELA 1OIRA 2CGUA 4FEUA 4USDA 3IW8A 2G2FA 4YJRA 5L8KA 4R77A 3RCDA 4AE6A 4KS8A 1YWVA 4CKJA 2F7EE 3QCYA 4KKEA 5HNIX 1LUFA 4P7EA 3LMHA 3QD2B 2XRWA 1Q4LA 3QTZA 3UE4A 4J71A 4FKQA 1P5EA 2PYWA 4I5PA 1S9JA 3U6IA 1WMKA 1L3RE 2YDJA 3FI4A 4G9CA 3RVGA 3OOMA 1OIQA 3ZFYA 4LV5A 4CLIA 4LRMA 4AZWA 3WILA 4A4XA 4ZSEA 1QPCA 2XKCA 3TV7A 3TZ8A 2CGVA 1WBSA 2NRYA 5DFPA 4F70A 3V5JA 2Z7SA 4BHNA 2ETMA 4EOQA 1SM2A 3I0OA 3MY1A 5A4EA 4IWQA 4R7HA 3A7FA 3F82A 3OXTA 2R9SA 3BWJA 4L43A 2GCDA 5M44A 3FPQA 4PNKA 5HG7A 3DAJA 5H2UA 2XIZA 2QC6A 4FIJA 5AP4A 5TF9A 2YACA 4MH7A 4HYHA 2A0CX 4I21A 1U5RA 4BDFA 4BTJA 1BI7A 3RPVA 4BR3A 1F3MC 1CM8A 3RPRA 4BHZA 3OWPA 3OWKA 4J97A 3ENMA 2XS0A 5J95A 4P5ZA 2F2CB 3VS2A 4CMTA 3RK7A 3O7LD 3QZFA 4NL0A 4TTHB 3MB6A 3P79A 1Q8ZA 2J0IA 5DH3A 3VJOA 3A4OX 3HAMA 4RZWA 4QYGA 1CKPA 1JSTA 2Z8CA 2DYLA 1LP4A 5AR2A 3ZOSA 2IG7A 3PE2A 4U6RA 3OP5A 1OBDA 3CC6A 3EQHA 4AN3A 5M57A 2WO6A 2CCIA 2Y4IB 2UW3A 3R22A 4NCTA 4DH7A 2VTQA 1PXKA 2CJMA 2XVDA 2J2IB 2SRCA 4G5PA 1ZAOA 2BROA 2WKMA 2B52A 1YHVA 5K3YA 1M7NA 3DJ7A 2YLFA 3Q4CA 4WNMA 2JKQA 2XA4A 3HV3A 1IR3A 3P4KA 2BDJA 4J8NA 4UEUA 3ZONA 2HXQA 4XP3A 1H1SA 3B8RA 5HNGA 5IA4A 2BALA 3Q04A 4V04A 3TG1A 4AA0A 3MJ2A 3UOJA 4FSUA 3AC4A 3H10A 3HV4A 2C6DA 4OLIA 4EOMA 3SG8A 4ENXA 2XNBA 4FOCA 4ASXA 2B9JA 3R2BA 4GFOA 4JG7A 2CNUA 2NRUA 3VO3A 4P90A 2RFSA 3TI1A 5FBOA 3U4UA 3VHEA 1MQBA 2WTIA 4GVAA 2H6DA 3FI8A 3MA6A 3UPXA 4FODA 3R7UA 5FDXA 4RIXA 2CSNA 4FSNA 1KUTA 3TZ9A 4IB0A 4HNIA 3FMDA 2PMIA 5DT3A 3PXYA 2EB3A 2IZTA 4YC8A 2XK3A 2EXCX 3IDCA 5M4FA 5B2LA 4GMYA 3VS4A 5HG5A 2PU8A 2WMUA 4DGMA 4MXCA 3PRIA 2BZHB 4NW6A 4O0XA 1P4OA 2UV2A 4AF3A 2J7TA 3OCBA 1GZNA 3NYXA 3VBXA 3HRCA 3IGGA 4FVPA 4DFUA 3VS7A 3FI3A 5CEKA 3JPVA 2QODA 3LFQA 4YZNA 2P2IA 2HOGA 3IW6A 3R02A 1PXIA 4EHEA 3KC3A 5IU2A 4EH4A 4BCGA 5KO1A 3R7OA 4DH8A 1YDTE 1UU3A 2P4IA 3G2FA 3ORZA 4CTCA 4GKIA 4JBPA 2J50A 2OBJA 4DFBA 2W5BA 2YN8A 2R2PA 2YABA 3W32A 2XUUA 1NVRA 2Y6OA 5FTOA 2IVVA 4QQ5A 2B1PA 3SAYA 4QTBA 3IONA 4J8MA 3VULA 3LXPA 2UZUE 4FF8A 1G8AA 3MIYA 4E7WA 4UX9A 2GQRA 3NNVA 4J96A 4ZLOA 1GZKA 3KRLA 2RGPA 4RFZA 2W0JA 4ZZOA 3RBWA 2C6LA 3PVWA 5JFVA 3QTXA 3KN5A 4F99A 2C0IA 4HGLA 1IRKA 4LOOA 5FM2A 3VUHA 3KFAA 1F0QA 3UQCA 4RX9A 5CTPA 1Z57A 3LM0A 3R7GA 3SRVB 2W1FA 2C5OA 3EFJA 3EN7A 3ET7A 4I1ZA 3ZEWA 3A7GA 3EWHA 3ZSGA 1K9AA 1ZYLA 1OIUA 3BV2A 3ZBFA 5IH4A 3OS3A 4I6QA 2BDFA 4C37A 5HU3A 2FSMX 3VRZA 2JIUA 3ZS5A 4IXPA 3ZLXA 3LFSA 1Q41A 4D2RA 4EQMA 4JDIA 4LOQA 5HCZA 4E3CA 4MAOA 4GL9A 4EHZA 2F4JA 4UMRA 4YTIA 3UZRA 5KZ0A 3DK3A 2Y4PA 2IW9A 4QMSA 4AT4A 4CZUA 4KABA 5I4NA 2VWXA 2C3LA 3F2RA 4WG5A 4KBCA 2WTCA 2X7GA 5GJGA 3BWFA 4QYEA 3ZUVA 2WHBA 3UVQA 3DPKA 3E8DA 2YM4A 4M7IA 4DH1A 2C6KA 2XZSA 2ZMCA 3D4QA 3HP2A 3VJNA 4F09A 4ARKA 4I94A 4YU2A 1FMOE 3FXXA 4C33A 2I7QA 5HGIA 2QOFA 3C7QA 3R01A 4IM0A 4ACDA 4UWYA 4O7VA 1H1WA 2ONLC 5IG1A 4FZAB 3GQIA 4UY9A 2PE2A 2G9XA 4U3YA 5B7VA 2JKKA 4CCBA 3HRFA 5HE0A 3JYAA 4XBUA 5CF6A 3I79A 2IPXA 4ACHA 1FPUA 3OFMA 4QMPA 3SXFA 4QTEA 4G16A 5J8IA 3OZ6A 1WZYA 2GFCA 4A9RA 4JBQA 4RZVA 3U54A 1MQ4A 2F57A 5TE0A 3TN8A 3HGKA 4D5KA 4DGGA 4DTAA 5DGZA 3MS9A 1E1XA 4LUEA 1H07A 4F9AA 1MRVA 5BUJA 2BMCA 2XKDA 4ALVA 2OF4A 2YEXA 3CKWA 4A4OA 3QQUA 3QUDA 3MV5A 2GHMA 5HE1A 4AU8A 3KXGA 4RJ7A 5BVFA 3F3ZA 4FZFB 5AR5A 2XMYA 5I9WA 4I5MA 4MQ2A 1OZ1A 5BQ0A 3H9FA 4QMWA 5J7HA 3TM0A 4YBJA 4C7TA 3LFBA 4E4LA 4EYJA 3F3WA 4E4NA 4O7ZA 2C5NA 2H9VA 3LLTA 4FTRA 5IQFA 4XP0A 2JBOA 2V7AA 4HGSA 2HZNA 3SLSA 5CEMA 3KRJA 5BX0A 4Y46A 3GCVA 1ZZLA 2PHKA 1TQPA 3PY3A 4IW0A 5I0BA 2PMNX 4M69B 4RJ8A 3NW7A 3I4BA 2XIKA 4W4VA 1REJA 3R7EA 4RVLA 2OFVA 4UWBA 4F65A 4RC2A 3F5UA 3EN6A 1RQQA 5D1JA 1QCFA 4L46A 3R1NA 4CFMA 2VGPA 4FIEA 3GU8A 3EQBA 4QP8A 5EDRA 4ZZNA 3BV3A 2BRHA 2VTIA 1H24A 2PPQA 4RMZA 3U6JA 2BRGA 2OI4X 3DXNA 3LJ0A 3TIYA 4APPA 4U41A 4NIFA 5DR2A 5I3RA 2C3JA 4L7SA 2V55A 4FG7A 5EKOA 5IH5A 2P33A 3KCKA 2HK5A 3SVVA 4FSWA 3GB2A 3BEGA 4QQCA 4NFNA 2WXVA 5CVFA 2WEVA 4DEDA 3DJ6A 1JPAA 3A62A 4FTIA 1A06A 4Y85A 2IJMA 5LVMA 3UOLA 2QQ7A 5L8JA 2VTOA 4H3QA 3TNHA 5DVRA 5JK3A 3NAXA 4K2RA 3DZQA 4BICA 3CIKA 2QR8A 5M09A 3VS0A 3PXKA 4YPSA 5JQ8A 4QMQA 2RSVA 3FXZA 4FSTA 2AYPA 3UYTA 5EOBA 1PXMA 2X4ZA 3QFVA 3TNIA 5JZJA 1REKA 1UKHA 3QRIA 4DFYA 4TZRA 1XH9A 2XKEA 3ZXZA 4NM3A 4JDKA 4GIHA 2OGVA 3CY3A 2O5KA 2ACXA 3I6WA 3ODYX 4RWKA 2WB8A 5AJQA 5HLPA 3DV3A 3EQPA 5HI2A 3GXLA 1JOWB 4RX8A 5CY3A 3G9NA 3O2MA 3SD0A 3JR1A 2XB7A 2J90A 5HVJA 4FEQA 1ZOHA 4WRGA 4GH2A 1XWSA 2YERA 4AFJA 3SDJA 4AWIA 3T9IA 3D5UA 1NA7A 2CMWA 3D5XA 3SG9A 4IACA 5ETFA 4JQEA 4CYJA 3F88A 3TNPC 4FIFA 4HOKA 4C62A 2XJ1A 5EQYA 3KU2A 3JY9A 1WVWA 2RIOA 3AMAA 4J7BA 3L8XA 4BDBA 1YXSA 1V0OA 2C5VA 3GQLA 3QC4A 2C30A 3G15A 2X6EA 4DFXE 4FR4A 4EZ3A 4DBXA 3Q2MA 4BCNA 4LRKA 4E6DA 4K33A 2VTNA 4V05A 3E62A 3RPYA 5ITAA 3V01A 3TIZA 4OR5A 4CFWA 2I0EA 2ZOQA 3LCOA 4O0WA 1FVVA 3EZVA 4JG8A 4PDSA 3ZRLA 4QMNA 3KRRA 3QYWA 4ITIA 4BKYA 1OL6A 3TXOA 3TKIA 4RVTA 1J7LA 3QCQA 1H0VA 4KB8A 3ZLYA 4QMVA 2UZVA 3UDBA 4MXXA 5L2QA 4E93A 3O71A 5DN3A 3CD8A 2G1TA 4DCEA 4F08A 4FV5A 3FQSA 2ETKA 5EM6A 2WMQA 4DEAA 1XR1A 5BYYA 3RNYA 4BTMA 1OL5A 5AUXA 2YM8A 3BYVA 3FE3A 1SYKA 4W8EA 3HEGA 2C5XA 4A7CA 3U6HA 2A19B 2P2HA 1H01A 3CJFA 4YPDA 1APME 4AAAA 4Z9LA 5EHYA 3DA6A 5D12A 4ZEGA 2BHEA 1ZZ2A 4TWNA 2R3RA 2HWOA 2VUWA 2UZOA 4PL4A 2WTKC 4X3JA 3FSFA 1ZRZA 2UW7A 2CGWA 2ZB0A 4FIIA 3PLAE 3S4QA 5EM5A 4NEUA 4RLLA 4JBVA 4FIHA 4S34A 1YHSA 1YRPA 4L44A 4JQ8A 5T3QA 2UZTA 3RAHA 4KIOA 5M08A 4F63A 4R3CA 4RIXB 3UIMA 3B8QA 4QYFA 5IDNA 1TQIA 3EQGA 5ICPA 1UU8A 4M67A 1O6KA 3II5A 4BI2A 3QTQA 3Q60A 4AA5A 3MY0A 2B55A 2C1AA 3PVUA 3RWPA 1S9IA 2PZRA 3HV6A 2X1NA 3RP9A 1PMEA 3CEKA 3BKBA 4QTDA 4OGRA 3FLNC 4PP7A 5IA5A 5LOHA 1J7IA 1OM1A 4YC3A 4U42A 4UB7A 4O2PA 2B9FA 4X2KA 4KKGA 2J51A 4NJ3A 3C4ZA 2VTAA 5AR4A 3S95A 5JZNA 4R6VA 5IDPA 5CASA 4HYUA 2UW6A 2XBJA 3QUPA 4YTFA 4GYIA 3NLBA 2E9NA 4FKGA 4I4FA 4R1VA 4OTGA 3AMBA 5LMKC 3BU6A 2PVHA 5FRIA 3EYHA 2F2UA 4UMQA 3A99A 4L9IA 2XIXA 3G0EA 4D4SA 4O86A 1W83A 1RJBA 5BVOA 3L9NA 3NAYA 2VTHA 4G17A 3O0GA 4RC3A 1KE5A 4AS0A 4OUCA 4EQCA 4AFEA 1CMKE 5K5XA 3BZ3A 3IDPA 2HW7A 4CXAA 3D2IA 2CHLA 4HPTE 3K3JA 1BYGA 4U81A 4BZDA 5JRQA 3CR0A 5EK7A 2Z7QA 2CN5A 4MF0A 5FWKK 5AUWA 3ANQA 4ZZMA 4MD8E 3N9XA 4EHVA 5J5TA 3DBFA 2R3FA 4BWXA 5CALA 3CPCA 2GNLA 4S31A 1JWHA 4U7ZA 4D1XA 3PYYA 4HPUE 5D11A 4HZRA 3IOKA 3KXXA 3S1HA 2JKMA 4NK9A 4YUQA 2HZ4A 5E7RA 2CN8A 2C1BA 2OH4A 3PJ1A 4J52A 4NTSA 3UMXA 4G9RA 4BDHA 3E5AA 4YC6A 3HDNA 3IW4A 5H8EA 1GIJA 2ZJWA 2OJGA 2YIXA 3P5KA 4UXLA 1G3NA 2RFDA 1DAWA 3TNQB 2OKRA 5E8VA 3QYZA 1BLXA 1T46A 3NNWA 4WA9A 5HG9A 4ZY5A 5CEOA 3SRVA 4YZ9A 4EC8A 3TACA 3SKCA 3OC1A 5HO7A 4H05A 1PHKA 2UZEA 4IX5A 5IQDA 4YTHA 1NT2A 1B6CB 2PE1A 5HEZA 5E92A 4EK8A 3CPBA 3R8ZA 1O6LA 2W7XA 4DBNA 3D9VA 2Q0BA 5JGAA 4ZMEA 2JKOA 3F5XA 3ALOA 5A4CA 4GKHA 2J5FA 4D58A 4NM0A 3VQUA 2BAQA 2VTRA 4Q9ZA 4D5HA 2UVXA 4C34A 2XYNA 2C6EA 1M7QA 3AOXA 4FEXA 2QD9A 3FQHA 3QZGA 4QMUA 4IJPA 3UVRA 1QPJA 3G9LX 4CT2A 2ZAZA 3K5VA 4PTEA 5HCXA 2J9MA 3R71A 3EYGA 1TVOA 3LMGA 3BYSA 1FVTA 3ELJA 3DDPA 1WBPA 1U4DA 1NW1A 1HCKA 4R5SA 3ZZEA 4IWPA 4R8QA 2ITNA 4C0TA 3VUKA 4JOAA 3CTJA 1QMZA 1U5QA 2VWWA 2VWUA 3MDYA 5EYKA 4GG5A 3OXIA 4FKWA 4MBJA 4XG6A 4FG8A 4EH2A 4YO6A 5D7AA 4FTAA 4QMLA 4YR8A 4GEOA 4HYSA 5KX8A 2OFUA 5F9EA 1L8TA 2YZLA 3OROA 4AACA 5KHXA 4F0FA 3UBDA 2BZIB 4FL1A 3NIEA 2BKZA 2OJJA 3DKOA 4DH3A 5A54A 4G2FA 5FEDA 3HKOA 4EOLA 4XV3A 1E1VA 4JDHA 4UWCA 3OVVA 4JAIA 3P23A 3FWQA 4FNZA 5HVYA 3BBWA 2PTKA 2QI8A 4RIYA 3MVMA 3PJ2A 5BVEA 3SV0A 3FMJA 4EKKA 3ORIA 1XBCA 4FX3A 4Y95A 5AUZA 3R8UA 5CI7A 1EH4A 3QXPA 3HYHA 3R73A 3KVXA 5FG8A 5M53A 4PV0A 2JBPA 2WQOA 2WMVA 4RT7A 4PUZA 4AOJA 4AW5A 3QQKA 1H27A 1BMKA 2GNGA 4H1MA 3L8SA 4ANQA 4AZEA 2OZOA 4NU1A 3VF8A 2XK8A 4ZK5A 1XKKA 4E20A 4C2WA 5GINE 5IA0A 3LFCA 4YURA 3QTUA 4IC7A 4KRDA 4DAWA 3FKLA 3ORTA 4ZIMA 4EH5A 2X2MA 3CGOA 4NIFB 4YLKA 4A9SA 5KMJA 5IA1A 3R83A 2XJ0A 3ZU7A 4V01A 5EI8A 1OUYA 5EHOA 2OICA 2UW4A 1YWRA 3POOA 3Q96A 2BR1A 4DYMA 4F1OA 3LIJA 3R2YA 4PPBA 3OCSA 5E9EA 4TYEA 5AMNA 4Q9SA 1Q8UA 3H9RA 4X2NA 3VUMA 5I3OA 2JDTA 4IB1A 2QG5A 4EUTA 3EB0A 4RFYA 2VO3A 3EQCA 4TKSA 4L7FA 3D94A 5FGKA 2AC5A 5J9LA 2P55A 1A48A 2NNWB 3FV8A 4BZNA 4OBOA 4TT7A 2X39A 5IMEA 2QOLA 1H8FA 3KREA 5LVOA 5AM7A 1AGWA 1KE6A 3ORPA 5EDPA 4ASEA 4C36A 5CVHA 5F4NA 5IH6A 5FLFA 1IAJA 2C69A 4PPAA 4Y5QA 5C8NA 5KE0A 3D2KA 4G6OA 1IAHA 4EOJA 3BE9A 3BLRA 3EKKA 4FT5A 2PVFA 4L00A 2C0OA 1GJOA 2OSCA 3PWDA 2VO7A 5FTQA 4FOBA 4K77A 1ND4A 4AXAA 3VUDA 3OF0A 3DZOA 3QQLA 5AEPA 5DMZA 5J1VA 4LI5A 5TOZA 4RA5A 1YI6A 3ULIA 5ACBC 3EFKA 3QTRA 2BCJA 2FO0A 3MB7A 5EYDA 2VGOA 5AAGA 3QA8A 4GS6A 1MRYA 2X9FA 4IANA 4ZTRA 2HYYA 5HKMA 4NM5A 1F5QA 2YIQA 3MY5A 3R7VA 5KCVA 4MTAA 3DB6A 4O21A 2JEDA 2I40A 2JGZA 1W98A 4IC8A 3UC3A 5CLPA 3TUDA 2FSTX 5KMIA 4IDTA 2IWIA 4IAZA 4KIKA 5AIRA 3V04A 4C3RA 3EL7A 2R3JA 5LVPA 5HOAA 4FI1A 3IOPA 2XIYA 5AAFA 2EU9A 4LRJA 4QQTA 3PJ3A 3VS6A 2RF9A 3QALE 3QCXA 4GK4A 4XUFA 3UQFA 3G90X 3BE2A 5CXHA 4RRVA 5HORA 1ZMUA 3C4FA 5EOLA 3VAPA 3Q9YA 4GFMA 2PVLA 4NKAA 2XK6A 1OL2A 1BL7A 4C57A 3WF6A 4JL9A 4X3FA 3TKUA 5JGBA 2CKPA 5GJFA 5EDQA 3KKVA 3OCGA 1ZMWA 4F7JA 3DGKA 3ACKA 3C51A 3RHKA 4FTOA 4LGGA 1HOWA 5A6NA 4CFXA 2E9PA 3NNUA 3O8PA 4EK5A 5AV4A 4U3ZA 4XOYA 5JH6A 3FZOA 5FTGA 2I0YA 3UO4A 4ENYA 3CTQA 4PDPA 5KHWA 4FV4A 2WU7A 1PMNA 4RQVA 5IPJA 1R39A 1V0PA 1BX6A 1Z5MA 2B0QA 1ZOEA 4W4WA 3P86A 4IVCA 5CS6A 2CLQA 3A60A 3U87A 1Q8TA 4LGHA 2ITVA 1NXKA 4EC9A 3MH1A 4LM5A 5DT4A 4XHKB 2C6MA 3GCUA 4FKUA 3FXWA 5IQAA 4G34A 2X8DA 5ANJA 4EBVA 4R1YA 4RSSA 3TDVA 3ZYAA 2NO3A 2W1ZA 3DAEA 3BPRA 2PVKA 1UU9A 1E9HA 3U8WA 2Y8OA 3DJ5A 5K0XA 4ITJA 4EI4A 3ZM4A 4FV0A 5KUPA 3ZO4A 3OTUA 3HRBA 4U44A 3MFUA 3WBLA 4BCKA 3NX8A 3P78A 3PUPA 3REPA 5KBQA 4BCJA 3N4UA 4G1WA 5JN2A 3UZPA 3UIBA 2FA2A 4XOZA 4BIEA 5JMSA 3KMMA 1PXJA 4O27B 1XO2B 3DAKA 3DU8A 3GCQA 3VUIA 5E4HA 2IZRA 2X4FA 4JQ7A 2X6DA 4Z3VA 4LV8A 4I20A 2IW6A 3HECA 2QURA 3FZRA 4R78A
chains in the Genus database with same CATH superfamily
2BRNA 3OW3A 3W2SA 2F7XE 4F6WA 3IO7A 2VWIA 2ETRA 3LQ3A 4Q5HA 4QP6A 3OOGA 3N51A 2VD5A 4NTTA 1UKIA 3PZHA 2IVSA 4ZSLA 3M42A 3HMMA 5HU9A 1UNLA 4O6LA 3KXZA 5D9HA 3SXSA 4BDCA 2R5TA 2HW6A 3BU3A 4R7BA 5BV3A 3C0GA 4CRSA 4BDGA 5T68A 1PXLA 2BZJA 3DXPA 3AC8A 5AUYA 1KOBA 1OPLA 3F2AA 2EVAA 4IZAA 1R3CA 3MFRA 3AC3A 5BVDA 1RDQE 1FGIA 5KZIA 3WIKA 4F1TA 2WTDA 5H3QA 5J9ZA 4C4FA 2BTSA 1VYZA 3R30A 4XEYA 3ACJA 5EHLA 3DOGA 2A98A 3HVCA 5CNNA 4CZYB 4YZCA 3EJ1A 3GNIB 3PPZA 5CF4A 3N4TA 3U9NA 4DEGA 3TUBA 2R0UA 3FL4A 3E87A 4IM2A 3TTIA 4OAUC 3S3IA 3FZPA 4ZTSA 4O0TA 4BVUA 1ZYSA 5LWMA 4FEWA 2WMWA 3BCEA 5F20A 1UV5A 2BVAA 2HCKA 2O63A 4C2VA 3NYVA 3L9PA 2VWBA 3R0TA 3UIUA 3WI6A 2R7IA 2YJSA 2X9EA 1UU7A 4L67A 4HVHA 5AA8A 3L8PA 4ORKA 3EFWA 3I5ZA 4XRJA 5JRSA 2C6IA 2ITQA 5DRBA 4AAYA 3CQEA 3FMLA 1Q8WA 1PXNA 2GNJA 3FC2A 4EONA 4O7SA 3I7CA 4E1ZA 2VU3A 2J0KA 5HLNA 2YM7A 3PZEA 1BKXA 2XRUA 1Y8GA 5FEQA 4DH5A 5IMXA 5L2WA 1GZOA 4TNDA 4YZDA 1ZYCA 5FP6A 4YJTA 2XEZA 4XNEA 3RM7A 4ZP5A 4JDJA 4C4HA 5IZFA 1YHWA 4G3GA 3KF7A 4I0SA 2PMOX 3M1SA 4EH6A 3G51A 4IMYA 4DE4A 3BBTB 3FY2A 4FUXA 2I0VA 2BDWA 4M68A 2W5AA 1Y6AA 4GU9A 4YJSA 3ZDIA 4CV9A 5BYLA 3Q32A 1YQJA 3NSZA 4PY1A 3MVLA 4Y72A 1J91A 4CMOA 4NWMA 4X6QC 4K9YA 3GCSA 4PMSA 4YNEA 3Q5IA 3TTJA 4BCQA 2W4JA 3SC1A 5A9UA 3KK8A 3M11A 4F0IA 4Z16A 5LMAA 4O7WA 3FMEA 3BIZA 3DDQA 3B2TA 3BHHA 3O8UA 4BYJA 1QPEA 5L4QA 1W7HA 3QZHA 3R1SA 4AXEA 4N6YA 4YZMA 5A3XA 1X8BA 2ZMDA 4NZWB 1KE7A 2F9GA 5ETIA 5HBJA 5LVLA 3UJGA 2GTNA 4L52A 4NCTC 4YZBA 2OG8A 4I4EA 3V51A 5HIBA 3DXQA 5CYIA 4FV7A 5AP5A 3AT2A 2UZNA 2R3GA 3E7OA 3QD0A 4RIYB 2XANA 5EYMA 2GMXA 1H1QA 2OK1A 4NFMA 3VIDA 4YJUA 5TKDA 3WYXA 3EZRA 4IHPA 4Y73A 3W16A 3NUNA 1OKZA 5CZHA 4IWDA 5IISA 3G6GA 1H08A 2GQGA 4QYYA 4D2TA 5KMLA 5M06A 3DBCA 3PPKA 3LKMA 4ZY4A 3DS6A 3KQ7A 3QX4A 3MJ1A 4TYHB 1TKIA 5DR9A 3HLLA 4PP9A 4A07A 4USEA 3S00A 2JIIA 1TZDA 5FBNC 4X0MA 3QHRA 3KXHA 5K5NA 5CWZA 3GC0A 2ZV2A 4I0TA 5L6OA 2X2LA 2CDZA 1IG1A 3FZTA 3L9LA 5C1QB 3GUBA 3PFYA 3LCTA 2VV9A 2W05A 3FJQE 3MPAA 3NCZA 2QKWB 2XCKA 2PUNA 4WOVA 4LL0A 2Z02A 2NPQA 3ORXA 3FLWA 1XH5A 2RFNA 4BYIA 5AWMA 1K2PA 3KVWA 4FSQA 3GGFA 2JDRA 3BGPA 4F0GA 3BEAA 4FV2A 1R0EA 3SQQA 2VAGA 3HX4A 3VS3A 3OCTA 5GJDA 3K54A 3NUPA 4PDOA 5CQUA 5LCJA 3PXRA 2PUIA 3PP1A 4ANMA 4QP4A 4RJ6A 3OT8A 4Z7HA 3AT4A 4CFFA 4FKVA 4DDGA 1NVQA 2R3PA 1OB3A 1ZMVA 4NT4A 2FUMA 4DINA 1Q97A 2W1IA 4EK4A 5LMBA 4QRCA 4Z55A 3DBEA 4CG9A 2QOCA 3QLFA 4FL3A 4UXQA 3CLYA 4WG3A 1M2RA 3HUCA 5HCYA 3VVHA 4BGQA 4M0ZA 2QKRA 3ENHA 3E8CA 3K2LA 2HY81 3B2WA 4FTTA 4TYIA 3KRWA 2R64A 3IECA 4WNKA 3WE8A 2O8YA 4QYHA 4FSYA 5CEQA 3RAIA 3FYJX 5E1EA 3PWYA 5IQIA 4NYEA 1H1PA 4QTAA 3Q6UA 4LUDA 5CSHA 5IUHA 5M4IA 2WTVA 1PJKA 5B2MA 4B4LA 2HZ0A 3IW5A 4RWIA 1U59A 4FZ6A 4J53A 4PX6A 2YM3A 3TV4A 3ZBXA 2W1HA 4I22A 3C1XA 4BWPA 3PSBA 4GT5A 3PXQA 3O51A 3TWJA 4KBAA 1J7UA 4E6QA 3P7AA 1AQ1A 1RW8A 2W4OA 4O0YA 1JBPE 4Q2AA 5DHJA 5C9CA 3UIXA 5CAUA 2UZWE 2W1DA 4HW7A 1WBOA 3O8TA 3LCSA 4FNWA 4NJDA 4P5QA 3W0MA 4JJRA 1QL6A 2C6TA 2BRMA 3FHRA 3DNEA 3I5NA 4BF2A 3EQDA 4ZTMA 4DHFA 3RCJA 4HJOA 3MTFA 3QTSA 5H8BA 4NSTA 4E4XA 2R3LA 3WZUA 1ZYJA 3MFTA 4KIKB 1R78A 1GY3A 2QOIA 2VTMA 3VS5A 3Q52A 1JKKA 3F61A 4FBXA 4B6LA 3MIAA 4E5AX 1SVEA 5JFSA 5C27A 3CQWA 4FYOA 4JR3A 1KWPA 2C4GA 3R7IA 4E6CA 3HV5A 4D2VA 4CFUA 3GOKA 5CI6A 4GVJA 2GSFA 4A06A 2FGIA 2C6OA 4WNPA 2ITWA 4KINA 4IAKA 1VLRA 4YLLA 4JVGA 4X3FB 3UP2A 3LMIA 4D1SA 2EWAA 1M17A 3NR9A 3DKCA 3PXZA 4DLJA 5BVNA 2H96A 3FMNA 3R9HA 5HX8A 3SW4A 4PMMA 5HQ0A 4WSYA 3KGAA 3OMVA 2JDSA 3TNWA 4E5WA 5HIDA 4UN0C 2GFSA 4RIOA 3FMKA 3ZUTA 2IO6A 5IUGA 5IQHA 4BDKA 1XBAA 4FSRA 4ZSGA 4AW2A 4YP8A 3Q9ZA 3COHA 3WE4A 4FTKA 4EZ5A 4FTQA 2B54A 2GPHA 1H4LA 4Z7GA 2XNGA 2YJRA 4ZS4A 2R0IA 2R4BA 3NUSA 4KNBA 1OMWA 4BWKA 5EW9A 2VN9A 3NS9A 3R9DA 4HCTA 5CF5A 4L6QA 1FBNA 5IQGA 5AR8A 2UW5A 2QLUA 4AGWA 4KRCA 4C3PA 3AT3A 2YDIA 4N4SA 5I9UA 4KUJA 4U97A 3PP0A 2G01A 2RG6A 1YXTA 1LR4A 2PVNA 3GFEA 4U43A 5C8MA 4JX7A 4AOTA 4NM7A 4OBPA 4OW8A 4XV1A 5LCKA 3ZSIA 3BHVA 4BBEA 3KULA 4FV8A 3FPMA 3AG9A 2B53A 4JRVA 4AGCA 4EOPA 4CT1A 4I6FA 3CBLA 4C4JA 3R8VA 4O81A 1J3HA 2A27A 3CGFA 1DAYA 3C4XA 4PWNA 2JAMA 3VBYA 2VNYA 3LXNA 4DGOA 2G15A 5HBEA 3LAUA 4X21A 4EJNA 1ZWSA 4ZTHA 1ATPE 3HL7A 2GU8A 4LGDA 4CZTA 4K18A 4DG2E 4PF4A 3GI3A 3RZFA 4WUNA 5H8GA 3EH9A 4DEEA 3IPHA 1H00A 5AP0A 2YCQA 3UODA 4CEGA 4FICA 2V7OA 2V62A 4FYNA 3EKNA 2V0DA 3DB8A 5DPVA 2IF8A 3WF9A 2OJIA 1Z9XA 1YW2A 3RI1A 2ITTA 2XM9A 3NYNA 3IDBA 2QO2A 2HIWA 4FKIA 4ITHA 5CAPA 3BX5A 2ITOA 3FZSA 4FKOA 3DQWA 4GIIA 4RLKA 4XH6A 3NDMA 3L1SA 4EK3A 4EOKA 3LFFA 2UZBA 3IKAA 5KMMA 4MXOA 5LJJA 4RJ4A 4FT7A 3JXWA 2XK7A 2PVYA 3R1YA 5JKGA 5K4JA 4F7SA 5JFWA 3BQRA 3DY7A 3GU6A 3IW7A 3JVSA 3LVPA 4CTBA 3NUAA 5A4QA 1WBTA 3PA5A 1Q8YA 3JVRA 4AA4A 3D7TA 3AD5A 4DGLC 4Y8DA 2WIHA 4KA3A 4RA4A 4ZTLA 2VX1A 1DI9A 4ZTNA 3AGMA 5ANGA 4FNXA 5K0KA 1I44A 4PPCA 4FNYA 3BLHA 3MH3A 4RIWA 2FH9A 5AP3A 2B4SB 4X2FA 5GZ8A 5L2SA 4ZLZA 1U54A 3FLYA 3ALNA 4J98A 1K3AA 4U79A 4F78A 4KWPA 1J1CA 3CP9A 5A46A 3AKKA 4DA5A 3OWLA 3UNZA 4D4RA 3W2RA 2JDVA 3Q5ZA 3F9NA 4QT1A 3C5IA 4M8TA 3GC7A 3P9JA 2BPMA 2OZAB 2GS2A 4FKPA 3WF8A 2VX0A 4EORA 3NVMB 2R3OA 2E9OA 1UNHA 4QD6A 1AD5A 2FVDA 2WOTA 1WBNA 5E8ZA 2ZV7A 4B9DA 4GUEA 4IB3A 1OKWA 5AV0A 3ROCA 2WFYA 4DEBA 4GYGA 4R3PA 4BDIA 3PSCA 4XCUA 4TYGA 4MNFA 4O0UA 2YA9A 3PPJA 4AG8A 5I9ZA 2XBAA 3PA4A 5DEYA 4FA2A 2C68A 2R7BA 4BCPA 3O5AA 4D9TA 3Q2JA 1I09A 2J6MA 1BI8A 5ANKA 5JSMA 4P4CA 4ZAUA 3ZO2A 5KKRB 3GBZA 3LLAA 3DBDA 4YMJA 3DTCA 1H25A 3OWJA 1R0PA 1PYEA 2WMAA 2PWLA 3FMMA 3UG1A 4IEBA 3ZUUA 5CU6A 2O0UA 2QOHA 5BYZA 3QL8A 3UOHA 1ZY5A 5L6PA 1PXPA 4O7YA 1JKTA 3MWUA 1KE9A 4IZYA 1PXOA 4GK3A 2UW9A 3HMPA 4FV3A 3RALA 3ZCLA 5E8TA 3FLQA 5GIOE 3QKKA 3UP7A 5KMKA 2BIKB 2UVZA 1VJYA 4PQNA 2WELA 4ZJJA 2J5EA 4AE9A 5L3AA 2BFYA 5DT0A 2OIQA 5AR7A 3PXFA 2UW8A 4RC4A 4EL9A 3MPTA 2VX3A 4IX4A 3E64A 5C4LA 5HE2A 5ANEA 3FKOA 4CSVA 2YITA 1GIHA 2H8HA 3GU7A 1DS5A 1XJDA 5CU3A 5H9BA 3Q9XA 3T3UA 2X8EA 1W0XC 5F95A 5DRDA 4A9UA 4DC2A 3TDWA 5IQCA 3AC1A 4I6BA 1YDRE 2CKOA 2VO6A 3LQ8A 5DR6A 1JLUE 3EOCA 3QAME 4TWOA 4OTHA 4IIRA 4E26A 1YKRA 4ERWA 2Q83A 4MUQA 2ZYBA 4EKLA 2UZLA 3C13A 3W2PA 3VONA 4WT6A 5HZNA 3V6RA 4O96A 4JIKA 3ORKA 4QP3A 4RBLA 5AIKA 3E8EA 4F7LA 4BKJA 2Z60A 2G2HA 4UMPA 4XLIA 3R7YA 2YLEA 4CYIA 5KBRA 2OJ9A 4BY9E 2QCSA 1PKGA 2X7OA 2R3HA 3E93A 3H3CA 3MBLA 4BL1A 3A7IA 1MP8A 2Y4IC 5DG5A 3FAAA 1FVRA 5G1XA 3ZLSA 4V0GA 4W9XA 4I0RA 3TJDA 3R04A 4IWOA 4FV9A 5CZIA 3P1AA 4U5JA 3VC4A 4DFNA 2ZDTA 4XG8A 4LG4A 3QX2A 5I9YA 3U4WA 2IW8A 2J0MB 1WCCA 3LJ2A 1LEWA 4M14A 5CX9A 4FK6A 4MVFA 3FI2A 4WUAA 4D4VA 2AC3A 5AUTA 4UYAA 3Q6WA 4GRBA 3PVBA 2QO7A 2J0LA 3A2CA 2YCSA 4QTCA 3H0YA 5FD2A 1W82A 4FTLA 3F69A 4W8DA 3NRMA 4RGJA 3R28A 3TL8A 4TYJA 4TYHA 4EYMA 3ZO1A 3MH2A 4FG9A 5FXQA 3CTHA 3OG7A 4BTKA 3R9RA 3T8OA 5HO8A 2WOUA 4WNOA 2JAVA 3DCVA 3FL5A 4NKSA 3RAKA 5HTIA 2YM6A 3R8LA 2Z7LA 4C4EA 3UNKA 3KIOC 3TV6A 4NH1A 1B38A 3T9TA 4K1BA 4OTFA 2WMTA 3Q53A 1Y91A 4HVIA 4B7TA 3A4PA 3C4EA 3F7ZA 3WOWA 3SOCA 3LCKA 3VBVA 4O7LA 3W2QA 3HZTA 3NPCA 2H34A 4GFGA 4EK6A 1JNKA 5FDPA 1M2PA 2KULA 5E1SA 4LFIA 4DEHA 3MN3A 3AD6A 4XG4A 1Y8YA 2PZ5A 3TEIA 5C26A 1H28A 3QTWA 1FGKA 4BI1A 5TT7A 4H3PA 4D28A 4QMZA 4JAJA 2PY3A 4YJOA 2OO8X 4TRLA 2C3IB 3JUHA 4IB5A 4U45A 4HGEA 4PTCA 4A9TA 2WTJA 2QU6A 4TN6A 4GV1A 3Q4UA 3R21A 1VR2A 4KS7A 4FE2A 2WPAA 4A4LA 2EB2A 1GAGA 3NGAA 4AN2A 2UVYA 2PE0A 1CSNA 1SNXA 1JQHA 1WVYA 3PE1A 1Q3DA 3QTIA 4HNFA 4O4BB 3U9CA 3W8LA 4ANNA 4TL0A 3UO5A 3CSVA 4FTCA 3KF4A 2A4LA 4CD0A 3F3TA 3FC1X 3MVJA 4Y83A 3TT0A 3RJCA 2VWZA 5C8KA 1XH8A 2R3QA 4KIQA 5A14A 3M2WA 2JC6A 2O64A 4BRXA 4ID7A 4YNOA 4KKHA 3NWWA 2W17A 2O65A 3PY1A 2PVJA 3ZC6A 4M15A 2BRBA 4BIDA 3Q9WA 2WQMA 3I60A 5JFXA 4R5YA 3R8PA 3PIZA 4JX3A 5IKWA 3JS2A 2YM5A 5AP7A 3VN9A 4D0WA 3IS5A 4QMMA 2HZIA 2XK4A 4MD7E 3NFGB 1WVXA 2IN6A 4IX6A 4QMTA 5CAVA 5HVKA 3CD3A 2GS6A 3TJCA 3F66A 3RNIA 2BILB 4B8MA 3ZHPC 4R3RA 3IQ7A 4K0YA 2ITYA 2GNHA 4AXFA 2XH5A 4ONAA 5LVNA 3PFQA 2BHHA 4YTCA 3LXLA 3QHWA 2R3IA 3AQVA 3D0EA 4RJ3A 4ZJIA 2X81A 1KE8A 4IE9A 4D9UA 3HAVA 3R9OA 4ZXTA 5E91A 3BGZA 4IBMA 1OECA 2W9ZB 1P2AA 4LQMA 4O4EA 4ZY6A 3W1FA 3ROYA 1M14A 4KSPA 3BRBA 3KXNA 4UBAA 3ZH8A 4EZ7A 4WSQA 1BL6A 5M51A 2X8IA 1UWHA 2C47A 3U51A 4IM3A 3OY3A 4P2KA 3C4CA 3KULB 2ZB1A 4PRJA 3EL8A 4O0SA 4XG2A 5CU0A 5EQEA 1KOAA 3RZBA 4L3JA 3TCPA 2HENA 4A9YA 3CJGA 3H0ZA 4BI0A 3O50A 4K6ZA 3O96A 1ST4A 3COKA 4IH8A 5AR3A 4MEDA 2OXDA 2GDOA 1OITA 4HCVA 3OXZA 5F94A 4J99A 4QPAA 1OL1A 5ACKA 2YHVA 3WZKA 3CY2A 2VO0A 3DQXA 3QWJA 2XNEA 3QD4A 3ZMMA 4OT6A 5BVWA 3QZIA 2I1MA 4OTPA 5IUIA 5J9YA 2JLDA 4J95A 4RVKA 4J1RA 5CAOA 3C4WA 4QP7A 4BCOA 5HX6A 4C3FA 3MSSA 4CKIA 1OI9A 2XNNA 4AP7A 1Q5KA 3QC9A 3EN4A 3OUKA 5L2TA 4DFLA 2R3NA 2W1GA 3QBNA 1H0WA 2CKEA 3BHUA 1YXVA 2YISA 3BU5A 4FV1A 5HTCA 5KMOA 4XX9A 3LM5A 2W1EA 4QOXA 4CMUA 4YHJA 3LPBA 3ITZA 4I6HA 4QPMA 4G6NA 1KV1A 2WZJA 5DE2A 2GTMA 3OBGA 5CT7A 3WF5A 3V3VA 4AGUA 5CAQA 2ONLA 3LFDA 4EH7A 4YHTA 4CGAA 2UZDA 3QQJA 4X7QA 5HNBA 2GNIA 4JXFA 4AZTA 3KXMA 4ANOA 4KD1A 5AP2A 4QPSA 5IF1A 5EM7A 4BGHA 1NY3A 2C3KA 5JT2A 1OBGA 4GW8A 4AXDA 2JD5A 3D7TB 2PK9A 3QRJA 4JR7A 5DI1A 3F2NA 4AT5A 4EEVA 2WIPA 5LXMA 1SNUA 1UVRA 2BAJA 4L01A 4S32A 3D5VA 3DLZA 4O6EA 2FSOX 4LYNA 4RIWB 3WZJA 4MYGA 1U54B 2JDOA 3HMIA 4I3ZA 5FEEA 5K4IA 3AC5A 3FUPA 4FKSA 3G0FA 4C61A 4EBWA 1W84A 4XS2A 2XARA 3LFNA 1TQMA 1W2CA 2XF0A 2B9HA 4U9AA 1UWJA 3ULZA 1JVPP 1U46A 4UMTA 4I5HA 3FQEA 3P7CA 4O91A 3KK9A 4B99A 2VTSA 4IVAA 3ZC5A 4BDAA 3PG1A 4EJ7A 3KMWA 2YDKA 3JY0A 2ERZE 3ZO3A 4DT9A 2Y6MA 2WU6A 4OBQA 3ZRKA 4I23A 5BPYA 5CU4A 2IZSA 3UGCA 3VUGA 4B0GA 5HD4A 2FYSA 4MBIA 3EN9A 1OKYA 2DWBA 3O7LB 1Q62A 3R1QA 3PJ8A 1YOJA 3FEGA 4ZTQA 3N4VA 1PYXA 3E88A 3CCNA 2YFXA 3S2PA 3BGQA 4DG3E 3F3VA 4TY1A 3VBTA 2ZM1A 4OT5A 4FTUA 4DTKA 4QP2A 4RQKA 4MKCA 3THBA 1G5SA 4OAVB 4I92A 2OZAA 4DDIA 4C4IA 4FTMA 2PZIA 3R9NA 2DQ7X 4RVMA 4BCIA 4Q5EA 3TUCA 4XP2A 4IDVA 4HCUA 4YLJA 5CVGA 4B8LA 4F9YA 4I24A 5AUVA 3RPSA 3I6UA 4DHZA 4H58A 4OTQA 3HMNA 3GU5A 4L42A 4X3FC 4M66A 4XG9A 3W2CA 4D55A 3QA0A 2PL0A 3PVGA 2OIDA 3I81A 4OTWA 4DG0E 5LARA 3ZDUA 3FDNA 3T3VA 3HV7A 3HA8A 5C03A 3PRFA 4AUAA 3KA0A 4KAOA 5IA2A 5GNKA 2C5YA 4TWPA 4UYNA 1ZY4A 3V5LA 2FB8A 4AQCA 4L68A 1JAMA 4RFMA 4EOIA 5EYCA 3VHKA 5AP1A 4E4MA 5FRIA 3PUFC 4CG8A 5D7VA 2ITXA 3QWKA 3SA0A 4U40A 1PY5A 2YZAA 3NUXA 4HVGA 1Y6BA 2LGCA 2GHGA 2XEYA 2I0HA 4MBLA 3W2OA 4AZSA 4C58A 2OH0E 4LMNA 4XLVA 5I9VA 3QKMA 3NNXA 3ORNA 3OBJA 3RK9A 3V8WA 3FMHA 1XQZA 4JNWA 4QQJA 4O83A 4V0GB 3DK7A 4BBMA 5E90A 4MNEA 3UO6A 4C59A 5A4LA 1H1RA 4XJ0A 5I5ZA 3ID6C 3GCPA 4HGTA 5HESA 4JLCA 3OEZA 4D2SA 3DKFA 4QNYA 4CFNA 2OIBA 1Q3WA 3ATSA 5AADA 4U8ZA 2I6LA 4O4FA 5BNJA 4YBKA 5EW3A 2ZV8A 5AUUA 3ANRA 2ZVAA 3OTVA 2YIRA 1CKIA 4DEIA 1PRYA 3G6HA 4HVSA 4DFZE 2QVSE 3GENA 3BELA 3C0IA 3SX9A 3UPZA 1DM2A 1T45A 3QRUA 1FINA 3PY0A 3AGLA 5E8SA 1Q61A 4AX8A 5J5SA 2J0JA 4ANLA 4APCA 1P4FA 5AFVA 4JT3A 3QGWA 3GC9A 5J79A 4N70A 2BZKB 3HA6A 5EG3A 2QOOA 3UC4A 4MHAA 4YJQA 5F1ZA 3PG3A 3QQHA 2OXXA 3VF9A 3UYSA 4MWHA 1ZXEA 2BUJA 2WMSA 4BZOA 4F64A 3RMFA 4F1MA 3VS1A 5BMSA 3VNTA 3OEFX 3UVPA 2WAJA 3CKXA 2EXEA 2VTJA 3PJCA 2BAKA 3K5UA 4YJVA 4JI9A 3RK5A 4MK0A 3TZ7A 2ESMA 3DFCB 5GZ9A 4JG6A 4ACGA 3QGYA 5DLSA 4QMYA 4M12A 4PMTA 3FYKX 5AX3A 4F6UA 2XJ2A 4WHZA 5I9XA 2G2IA 3OHTA 3R63A 4TWCA 3RAWA 4S2ZA 4WKQA 4QMXA 2X0GA 3W33A 4M13A 2V22A 4I93A 3LFEA 2W9FB 4C35A 5IQEA 3BL9A 2O2UA 3H9OA 3V5WA 2F7ZE 4AXCA 4EHGA 4U80A 1CKJA 5AV3A 4AT3A 1URWA 4R7IA 2F49A 3PA3A 5M56A 2CCHA 1BUHA 4NW5A 4LL5A 4DN5A 1MUOA 5FP5A 4DLIA 1Q24A 1MRUA 4M0YA 3COIA 1FQ1B 1PMUA 3QUEA 1J1BA 1OL7A 1R1WA 1IEPA 3GEQA 1FOTA 4JIAA 4O1PA 3KN6A 4L45A 1NVSA 3P7BA 2WQEA 2XCHA 4FC0A 4D1ZA 4Y5HA 1VYWA 3A8XA 1W8CA 3BYUA 3EQIA 4MCVA 3L9MA 4ANBA 5E8XA 4IQ6A 4FSMA 4WD5A 1JSUA 3ZFMA 1JSVA 3IK3A 4YSJA 2HXLA 4FKRA 1OPJA 1YWNA 4WG4A 2VRXA 4F9WA 3MESA 1OGUA 4FK3A 3Q4ZA 2WNTA 2BTRA 1Y57A 4RWLA 5DWRA 4ZJVA 3F5PA 3DK6A 2ERKA 3HMOA 2X2KA 2ZM3A 2OJFE 3DTWA 1OPKA 2VTTA 3O23A 5J87A 5FUTA 3FSKA 3ZTXA 4EOOA 5EQPA 5L8LA 3FZ1A 4ASDA 4BCMA 3SOAA 2HY0A 5CNOA 3W8QA 3A7HA 4ACMA 2DUVA 5KKRC 4IX3A 4GG7A 2RKUA 5FXRA 3FBVA 2XIRA 3ERKA 4FT9A 5G6VA 4CFVA 5IQBA 1YDSE 5LMKA 2W99B 4XRLA 3RPOA 3CS9A 1SVHA 4O38A 4AZVA 2B7AA 5E8UA 2V5QA 4D2PA 3BYMA 2CKQA 3GT8A 3W18A 5A4TA 3VW6A 4DITA 5LWNA 4ACCA 4XBRA 1WAKA 1HCLA 4N0SA 4IFCA 5DA3A 4BGGA 3PSDA 1FMKA 4H39A 4BC6A 3W0SA 2KTYA 4F4PA 1CDKA 4OTDA 4XYFA 3UTOA 3QLGA 5AV2A 5AP6A 4YGAA 4CV8A 1O9UA 1OIYA 2XYUA 4QP1A 3ZM9A 2EXMA 5EKNA 3UOKA 5ANIA 4N6ZA 2JITA 3MI9A 4FGBA 2DS1A 2W4KA 3HNGA 4X2GA 3E3BX 3LQ5A 3VW8A 3V8TA 4PDYA 2R3MA 2ITPA 4ANSA 4PTGA 3BLAA 1RE8A 1VEBA 3WIGA 4C02A 4FSZA 3D15A 3D7ZA 2ITUA 4BCHA 4AGDA 4D2WA 2VTPA 3S0OA 1IA8A 4O7RA 2B9IA 5GHVA 2CPKE 3LCDA 5CSVA 3QRTA 2W06A 3H30A 4YJNA 5CSXA 1SVGA 3AD4A 3F5GA 4FKJA 4U0IA 4WIHA 1OVEA 3UMWA 3VWAA 2OW3A 2PUUA 3C50A 1B39A 3TKHA 5T6KA 4LOPA 3DT1A 1GZ8A 2IVUA 3P08A 4O0RA 3E63A 4F7NA 5IEYA 2OLCA 5L6WL 4UV0A 4PL5A 3C9WA 3NUYA 2E9VA 2VZ6A 4BB4A 2W1CA 1ZOGA 3COMA 1GNGA 4RX7A 1M2QA 2VTLA 3HDMA 3R00A 5JEBA 3DBQA 3OD6X 4XV9A 4MQ1A 5HICA 5HIEA 4FIGA 3ATTA 1WBWA 2A1AB 1Q99A 3MA3A 3FY0A 4BDDA 4O84A 3OUNB 1YOMA 5E8WA 5EI2A 3PTGA 4OTRA 4FUYA 4AN9A 2WTWA 2QO9A 5ETAA 3ZXTA 1YI3A 3DLSA 5AAEA 3MGYA 3D5WA 4O4CA 3WZEA 3NCGA 3BQCA 3I1AA 4WO5A 5B0XA 3D14A 3FLZA 3TZMA 4G3FA 4RX5A 3G33A 5AX9A 4RJ5A 4CNHA 3C5UA 4FVRA 1XBBA 4QMOA 5A6OA 4BBFA 4TXCA 4EQUA 3R8MA 2YIYA 4QP9A 4L53A 2QOBA 2ZM4A 5IEXA 2HWPA 4M84A 1OKVA 4WBBB 3PDTA 4FZDB 4G3CA 3OY1A 3AXWA 1KSWA 2Z2WA 4OTIA 3E92A 4XG7A 4O2ZA 5HTBA 4PL3A 3H4JA 3PLSA 4GK2A 3HUBA 3WZDA 4FT0A 4UMUA 2JIVA 3G5DA 2YWVA 4D0XA 3I0QA 5GIPE 1PF8A 3QU0A 4AOIA 5K9IA 1LPUA 5CEPA 2CGXA 2ITZA 3F7WA 4KIPA 1SZMA 3W0QA 4M97A 3DKGA 4EH8A 3F3UA 3RTPA 4W9WA 4ZSAA 2XNMA 3NZ0A 4FMQA 4FV6A 4EUUA 1JKSA 3W0OA 1A9UA 4ALWA 2WQBA 1YXXA 2IZUA 4G3DA 2GNFA 1M52A