5CAOA

Egfr kinase domain mutant "tmlr" with compound 29
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
323
structure length
300
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELTSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYREEDMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title Noncovalent Mutant Selective Epidermal Growth Factor Receptor Inhibitors: A Lead Optimization Case Study.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 300
sequence length 323
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5caoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5caoA01
4NUSA 5EOBA 5ETIA 3U6JA 4L52A 2JDTA 5DFPA 3IDCA 3ZLSA 4O21A 1H08A 5L8LA 4XNEA 4CQGA 1B6CB 4E8AA 2XRUA 3NW6A 4M67A 4HNIA 4ITHA 4M8TA 4R78A 3SDJA 2OFVA 2OXDA 5J9LA 3T9IA 4QMQA 4ZTNA 4NKSA 4FUYA 3ZO4A 1XKKA 3ETAA 2J50A 5B0XA 3O17A 5AP5A 5E90A 4FX3A 3GQLA 3V5TA 2XRWA 5CENA 4MBLA 4BTMA 4AFJA 4EHVA 4YTFA 4MXCA 3ZUUA 4W4XA 3T9TA 4DLIA 5AM6A 3TKUA 3S4QA 2CMWA 3R7EA 3C5IA 1G3NA 3ODZX 2IPXA 4IW0A 1YDTE 2QHMA 4FMQA 2VTIA 3V3VA 5HD7A 2Y4PA 4FZFB 3FLNC 3R01A 1YI3A 4IC8A 4RX9A 4JT3A 4FZAB 4NKAA 1LPUA 5GJGA 4X2FA 2C6MA 4NM7A 4WT6A 5TKDA 4IZYA 4DLJA 3IW7A 2X81A 3P5KA 4H39A 2V5QA 2YLFA 4WBBB 4EEVA 1W7HA 3ACKA 3DA6A 5FP6A 2QQ7A 2HOGA 2CHLA 2PMOX 3R73A 4FV8A 4B99A 2Z02A 5GIOE 4LMUA 5CYIA 1H8FA 1VYWA 3EN6A 1IASA 3BHVA 3L9MA 1TQIA 4BICA 2GFSA 2W06A 2O64A 3KXXA 5AIKA 5AAFA 4MD9E 3U54A 4DT9A 3FYKX 3Q9XA 2VWXA 2BZJA 4G9RA 2WD1A 4JAJA 5EQPA 5M56A 2G1TA 1OL6A 4OTPA 3BYOA 2JDOA 3BV2A 3JY9A 4IJ9A 3ZO1A 4HJOA 2B52A 2C5OA 4O7TA 5EW3A 1M2PA 3R0TA 4ITJA 2CGVA 1ZXEA 2V62A 2H34A 4HGLA 4MXOA 4XG9A 5AIRA 5DYJA 3NDMA 2AUHA 2C3KA 2C6EA 2QG5A 3MS9A 2CGUA 2CLXA 3BGQA 4ZSLA 3CY2A 4ZK5A 2BUJA 3LLAA 4BCIA 4IIRA 4XCUA 5DN3A 5I0BA 4L68A 3DK7A 4CEGA 3RGFA 2B53A 3FC2A 2CDZA 4RSSA 4CFXA 2VWIA 3IOKA 4KD1A 4AA0A 2OIBA 2C1BA 4BCMA 3RVGA 3KRWA 4MYGA 2C3LA 4EKLA 3D83A 3VN9A 5HO8A 4Y8DA 3H3CA 4EK4A 4DCEA 3AGMA 3BYUA 5FEQA 3FWQA 3WE4A 2XIRA 3PXQA 2C6IA 2YJSA 3TDVA 3RK9A 3UOKA 1IRKA 3L9PA 3OBJA 1XO2B 1GNGA 5AR3A 3UG1A 3E7VA 1PXOA 2FYSA 4V0GB 4BCOA 2WU6A 2CCIA 4C36A 2RSVA 4QYEA 4UEUA 4AQCA 4MF0A 1YQJA 1PXNA 4J96A 2IZRA 4C37A 1NY3A 3Q6WA 2C69A 4FV3A 2PMLX 3ZU7A 5FGKA 4WUNA 3LFSA 1SZMA 3HV5A 4BRXA 3KULB 2JIVA 1VJYA 4OTRA 4X3FC 4CD0A 2C68A 3D7TA 5DIAA 4IAYA 2RGPA 3AD4A 4II5A 1F5QA 3KXNA 3UZRA 4A4XA 3FQEA 1OIRA 1ZZ2A 3ZDIA 4ANQA 5CNOA 5HLPA 3MB7A 3C4EA 4NH1A 3ANRA 4ZP5A 5M57A 4NL0A 3MFRA 3UC4A 3ORPA 2VZ6A 3COKA 3NSZA 4WNKA 2CNQA 1CTPE 3HRBA 3QD0A 4XRLA 2QOBA 4ITIA 4HYUA 2X2KA 2ETRA 4FK3A 4O7LA 4IZ7A 4W8EA 5HE1A 3UOJA 3VQUA 2UW0A 3OT8A 1AQ1A 3O50A 4ASXA 5A14A 5HU3A 4JOAA 4J98A 3ZSIA 4YR8A 3A2CA 2QNJA 3I1AA 3KCFA 4XYFA 5HQ0A 1Q3DA 3G33A 3KL8A 4I92A 4YU2A 4AE6A 2EVAA 2WMWA 3BE2A 1YXVA 5CU6A 3WZEA 4MWHA 5J5TA 2R64A 2XUUA 3LCOA 4BCQA 2R9SA 3EFKA 4DH1A 4DFZE 5HCXA 4XV9A 2J0IA 1NVRA 1Q3WA 3E93A 4IHPA 3A7FA 2W5BA 3VWAA 4BWKA 4GEOA 3ENMA 2YCQA 1BI8A 4CFMA 4JRNA 5ANDA 2WNTA 3RI1A 4ZAUA 2Q0BA 1WFCA 4D2RA 3VNTA 4UWYA 4JNWA 5FG8A 2UW9A 3DBFA 3PTGA 2WTDA 4JVGA 4PMSA 2O8YA 4YHTA 5DA3A 3KY2A 4KB8A 3TCPA 1MRUA 4HOKA 3R7YA 3W2QA 5IA1A 4KIOA 2XM8A 3WOWA 4F6SA 4XLIA 2X0GA 2WKMA 5I5ZA 4HGSA 2UW6A 4M12A 5CVGA 1GZNA 4QMVA 4FIGA 1MUOA 3R6XA 5B2LA 2PUNA 4BGHA 2J0MB 2BRNA 5LVNA 2DS1A 4C4FA 3QQUA 4N6ZA 4FV7A 3BQCA 2OFUA 2WELA 4UZHA 4N57A 5HE3A 3IO7A 4IXPA 4M15A 3TNQB 3UIMA 5KMIA 5ITAA 5HBHA 4BDCA 3DPKA 3QTWA 1IA8A 3U8WA 4AZFA 4CGAA 3VS2A 2I0YA 3BGZA 2F9GA 5JSMA 1YI6A 4BY9E 4FSYA 4PNIA 3SW4A 2RKUA 4FTJA 5IA4A 4RA5A 4XG8A 3VBYA 3V51A 4UYNA 2VO7A 2JFMA 3CY3A 3VC4A 2ZMDA 5DH3A 4GKHA 3DTCA 2OH4A 1UU8A 3TV7A 1ZYCA 4BWPA 4O84A 4LMNA 4USFA 5JGDA 2CKOA 2XIXA 2YM3A 4M14A 1XH6A 4D5HA 3DNDA 2PMNX 3RAHA 3R63A 4V01A 3HRFA 1Y8GA 4NCTC 1OBGA 3HAMA 5EHYA 3IK3A 4RJ8A 4ZOGA 3UYTA 2QLUA 3E92A 3JVSA 3NCGA 4N70A 4QO9A 2HWPA 5J1WA 2H6DA 1M7NA 2JKQA 3A7JA 3O0GA 4QPSA 5HESA 3TNIA 3U55A 4MK0A 4YJTA 4MVFA 2PPQA 3IPHA 3GOPA 5BPYA 3MGYA 1ZMWA 2Z7SA 3IW6A 4FOCA 4M69A 3Q2MA 4ZLOA 5KHXA 3UMXA 2EWAA 3OXTA 4ANLA 1VYZA 2B4SB 1REJA 2W5HA 4AP7A 4ERWA 3QRIA 1Q41A 3W32A 2WQBA 1XQZA 1J7LA 4GK4A 3KMWA 4XV2A 5AV2A 4FTAA 3IW5A 4UX9A 4W9WA 2FB8A 3NR9A 3Q6UA 4O0WA 5C26A 3OW4A 3I6UA 5CY3A 1RDQE 4V05A 2J51A 1RQQA 1HCLA 4NIFB 3FPQA 2HK5A 3OCBA 3F7ZA 4APCA 3W33A 1O6KA 2VTNA 4L67A 4CFWA 1Q62A 3KB7A 3HMMA 2VTLA 4FNXA 4GT3A 4IAFA 3V01A 4ACHA 4F7NA 1FVRA 4WHZA 1W82A 4J97A 4L6QA 4O1OA 3GI3A 2HY0A 4QMLA 2WTVA 2JITA 4B4LA 3OTVA 2ITQA 2XNBA 3C1XA 4YZNA 5AV3A 2REIA 5AEPA 2QU5A 4P5ZA 1P4OA 1ZYLA 5HEZA 4AN2A 3HRCA 3I7CA 3Q4TA 3ZMMA 1JSTA 2CKPA 4U81A 4AOJA 3DQWA 2VTQA 3R83A 4IAAA 4RZWA 4YLKA 4F9YA 3GVUA 4YSJA 1R78A 3RCJA 5AR8A 4F64A 3L8VA 4FSUA 2XJ0A 4FZDB 5EI6A 4FV4A 3A8XA 4HPTE 4PTEA 2JD5A 3MFSA 2WQNA 4EYJA 3R71A 5L6WL 5C1QB 5I9VA 3DAEA 3VHKA 2WIHA 4EH2A 3NEWA 3ID6C 3R8LA 2QC6A 5IQIA 1Z57A 4G31A 4AF3A 3SGCA 3FY2A 2XEYA 3NIEA 1IEPA 4R6VA 3WF5A 4EH3A 4BTFA 3MV5A 3Q5ZA 3DJ5A 2PWLA 4L3LA 3DFCB 3V6SA 2GNFA 3PLSA 4TYEA 4YJUA 3ZCLA 5H2UA 4CFNA 3COHA 5DPVA 3RBWA 4G34A 4PNKA 2WEVA 4QRCA 4YTCA 5HICA 3FHRA 5A4CA 5JGAA 4KUJA 5BYLA 4L00A 4QT1A 2IWIA 3ZO3A 3LJ2A 4JLCA 4YUQA 3D7TB 4RVTA 3FXXA 2DWBA 2XKDA 3O51A 5HCZA 3TZ9A 5CF5A 5LWNA 3BPRA 2XIKA 4OTFA 5ICPA 2Y9QA 3H9RA 5H8GA 3UP7A 4WSYA 2A4LA 5EQEA 2E9OA 5K0XA 3PZEA 2HENA 4XJ0A 2ZOQA 1XWSA 4A4LA 3PY0A 1S9JA 2R3HA 4UWCA 1YXUA 3F3WA 5CVHA 2YZLA 5M53A 4GYGA 1J1BA 3PY1A 2NRUA 3O7LD 2QOOA 1A48A 3F66A 3GC7A 5GINE 4AX8A 2ITYA 4JX7A 4DEHA 1SNUA 4R8QA 4DYMA 1GIJA 3QKLA 4IBMA 3VO3A 4RC2A 3K3IA 2BROA 3I0OA 3KRJA 4FTKA 3O23A 4L46A 2FSLX 2PUPA 4Y73A 1DAYA 3D9VA 4Y83A 4WKQA 1A9UA 2ITVA 1OGUA 4X6RA 4J8MA 3O8PA 4P4CA 5JGBA 2GMXA 3FMLA 2PVHA 2JAVA 3PP1A 3RWQA 3PXRA 4D1XA 4IADA 1OB3A 4DFXE 4QMPA 3BLRA 2EB2A 2C6TA 4O0TA 5E8WA 5IG1A 2GNHA 5M51A 4H3QA 3EQDA 4DHFA 4O0VA 4RMZA 4TYJA 1Z5MA 5HHWA 4DBNA 4EHZA 1P5EA 3R2YA 5CX9A 5CAQA 3G9NA 3KXMA 5AP3A 3E5AA 4OT5A 1GJOA 4U5JA 4FEVA 3F2NA 3FMJA 1BMKA 1RE8A 2ITUA 4G3FA 4TXCA 3R8PA 2VX0A 1WVXA 1CDKA 3W2RA 4O7NA 1KE9A 4FNZA 1G8AA 2WMRA 4YP8A 2P33A 4LGGA 4U45A 2YA9A 4IZ5A 2C30A 4H3PA 4C3FA 5AUTA 2NPQA 2YISA 2W1DA 3EQBA 3C4CA 4OGRA 2HZIA 3KXHA 2X7GA 3C4XA 4NJ3A 4Y95A 5AUUA 2QG7A 3SV0A 2XNEA 4IJPA 4QTAA 2QOHA 3C13A 4GCJA 5BMSA 4BIEA 2R4BA 4I0TA 2UZDA 3DQXA 3PJ3A 5EW8A 4CYJA 4F7SA 5HVKA 5J8IA 1KE7A 2Z2WA 1FBNA 3K54A 5J1VA 2J0LA 1AGWA 4M68A 4HYHA 1REKA 4L8MA 4FZ7A 4D4VA 4EOMA 4UMPA 4AXAA 3R9OA 2C1AA 2BIYA 5CSVA 1M2QA 4DEEA 4I6HA 4FV0A 4IACA 4QQ5A 4CQEA 5IDPA 4DAWA 2BHEA 1SVEA 5KMOA 2YM6A 3PY3A 3NYNA 2EXCX 3AT2A 4FYNA 3CLYA 1YHVA 4X3JA 5FXSA 3R7GA 1BLXA 3MA3A 3AD5A 1FPUA 3POOA 2EB3A 3CIKA 3ERKA 5C4KA 1IAHA 5M4CA 4HCVA 5JH6A 1VR2A 2BZHB 3FMKA 4A9SA 4AW1A 3P7CA 5E8ZA 3DZQA 4RC4A 5C27A 2PZRA 2R0IA 2JDVA 4ZY6A 3R9DA 2G2HA 3HV3A 3D5XA 1H1RA 4FTQA 4W9XA 3LOKA 5DG5A 5HVJA 3ZLYA 1H0VA 4IE9A 1LEZA 3TUBA 2OICA 2VAGA 3AC1A 3IDBA 3TWJA 4NW6A 4M69B 4C33A 3ORNA 4G2FA 4EH5A 1V0PA 5LVOA 2JFLA 3W2OA 5JZNA 5CSHA 4QPAA 4ACCA 3OVVA 2OLCA 4IMYA 3R7UA 3NS9A 3EKNA 4IX6A 3CP9A 4OUCA 4ARKA 2R3NA 1KE5A 4FNWA 3HDNA 3LCTA 1FMKA 3QWKA 4IWDA 5IH6A 1OKYA 1IAJA 5M06A 4BI0A 4B6LA 2BALA 3IGGA 3NAXA 3ZFXA 3ELJA 3RMFA 4PMPA 4FSRA 4YNEA 5AA8A 1R39A 2W4OA 3R28A 4X3FA 2YJRA 4FSQA 2B9JA 3QF9A 5HI2A 3VS3A 1OIYA 3RPOA 3EQPA 4Z55A 3DOGA 3H10A 4CZTA 5FXRA 3PJCA 2PULA 4G3EA 3TJCA 3TDWA 3WZUA 2OW3A 4PPCA 1H1PA 4HCUA 3LFNA 2RIOA 4MBJA 4UBAA 4XLVA 4DTKA 5LVPA 3ODYX 4GU6A 4R7IA 5AR4A 3G15A 2GS6A 4O38A 4XOYA 3LFQA 3ROCA 4GUEA 4CZYB 5IEVA 4HPUE 3C50A 4KIQA 3E8EA 4JRVA 4X6QC 3UQFA 3I0QA 3EZVA 4QYHA 3GOKA 2ONLC 3OHTA 2R3QA 2WPAA 3GU6A 3NIZA 4K1BA 5E8VA 3RHXA 4C35A 1KV2A 1WBWA 3MSSA 3NW7A 4Q2AA 4YGAA 3TV4A 4ZTMA 3Q4CA 3VRZA 4AS0A 2O65A 2XK3A 3KMMA 3G2FA 4QYYA 2BHHA 3QZIA 4IAZA 4O0SA 4EI4A 2Q83A 5DOSA 3DB6A 2WOUA 5F4NA 1YDRE 3GC9A 1XR1A 3HP5A 4RFYA 5HZNA 4FT7A 4WUAA 4IX5A 4DC2A 3FL4A 3DBEA 1R0PA 3CPCA 5DMZA 5C8NA 3QQKA 3HKOA 4FTLA 4NT4A 3V5JA 3FZRA 3OT3A 2J6MA 2PVRA 3MDYA 3Q53A 5AP4A 2BFXA 5FDPA 3UQCA 2BAKA 2C0TA 5K0KA 4FR4A 4CLIA 4DGGA 4EZ5A 3PPJA 4WG5A 5DI1A 3F82A 3LMGA 3QXPA 4QMTA 3ZC6A 2E9PA 4NEUA 4O0XA 1H0WA 5CU0A 2JLDA 4D28A 2J9MA 5BVKA 3RAKA 2OBJA 3MBLA 5I9ZA 3QKMA 3NUAA 2ZV9A 3HMNA 3GCPA 3DBCA 4RX8A 2C47A 2J4ZA 1PXJA 2XP2A 2OU7A 2A19B 2JAMA 2W4KA 3QRKA 4G16A 4LYNA 3TXOA 4CTCA 4F1MA 1GZOA 2YWPA 4ZJJA 2HXLA 5CEQA 3SXSA 3PDTA 3I6WA 3ZM9A 2UZLA 1PXLA 1UA2A 3GC8A 3SAYA 4O27B 1YOJA 4FTIA 4WRGA 4X7QA 4AZWA 4LG4A 3PA4A 2OWBA 2UW3A 1WMKA 3ORIA 5AP0A 4ANOA 2R7BA 3NUPA 5CAUA 2PVLA 3P23A 5IKWA 3PPZA 4O1PA 3ZFYA 5TF9A 4DEGA 5KMMA 1WZYA 4YTHA 2C4GA 4BBFA 4S31A 4IWOA 3OWJA 4M0YA 1K3AA 4FV9A 2OGVA 2BRBA 4XBRA 5A4QA 5BUIA 2VN9A 3DDQA 5CTPA 2XH5A 4RJ4A 3FI4A 3QKKA 2GQGA 4DINA 4ZY4A 3TTIA 3F3ZA 4AOTA 1Q8TA 3NUUA 2PYWA 1Y6AA 3QQJA 5AA9A 4MX9A 5HNGA 5ANOA 5FXQA 5GHVA 3ZSGA 4D2VA 4YO6A 4U9AA 1H1QA 3BHUA 4X21A 4S33A 3COIA 4KAOA 4NCTA 2ITZA 1KE8A 3FXZA 3C0GA 5TO8A 3EWHA 4ACDA 4UV0A 4DEAA 3WYYA 4O7WA 3NYXA 3R1QA 1PXPA 4N4SA 3DCVA 3ZRKA 1JKLA 2WMTA 4BCFA 3B8QA 2R3GA 1M14A 1YWNA 2BVAA 1M7QA 2I1MA 2XNPA 4NFMA 3U6IA 2B9IA 4ZLYA 2PVYA 1WBSA 5CLPA 4YZMA 2JBPA 2XKCA 4AT3A 4F6WA 4AZVA 4DFYA 2J0KA 4U8ZA 4EK6A 1FINA 2VUWA 3LM0A 2IW9A 1F3MC 2WIPA 2IVTA 2OIQA 4KWPA 3FMMA 4C4EA 3BGPA 4OTGA 4HGTA 4YSMA 4GJ3A 2XK9A 3TNPC 5DT4A 4F9CA 5L8JA 4B8MA 2VTTA 4FTMA 2GNLA 5I9WA 1OPKA 4HVDA 2OG8A 3DBDA 3P9JA 5KZIA 4RWJA 4LRMA 4HVGA 2IZSA 1YW2A 5HKMA 4U44A 2OZOA 3FQHA 3BELA 2C5NA 2OKRA 4ANBA 4P90A 3LM5A 2X6DA 2J5EA 2ESMA 4L7SA 4FZ6A 4F9BA 3OXZA 4XH6A 3GT8A 5M07A 4L53A 1YDSE 3IKAA 3LCKA 2DUVA 4QP4A 3RP9A 4LGDA 3VF9A 3R1NA 3O2MA 5EM5A 3K5VA 3OF0A 1WBVA 3KFAA 2RL5A 1OUYA 2JDRA 4QYFA 3VRYA 4FODA 2VU3A 3BHHA 4CCUA 2VO3A 5JKGA 4PMMA 3R9RA 1U46A 2R3JA 1YI4A 3GXLA 2ITXA 3GBZA 4IB3A 4YZ9A 2LGCA 5DRDA 4FVPA 4D58A 3NAYA 3PIXA 4K6ZA 4BB4A 1BX6A 3VS5A 4YJOA 1XBAA 3CD8A 5FM2A 4EUUA 4XG7A 2QODA 1GY3A 3MJ2A 3EN7A 4U3YA 2J90A 5HNIX 5DGZA 2SRCA 4UMTA 4NIFA 4M84A 5FD2A 3BYMA 3SC1A 4D2WA 4ORKA 2VNWA 4R3PA 3DV3A 3PJ2A 2F7ZE 2W1IA 3RAIA 5ACBC 3QZHA 3BCEA 4PTCA 3ZFMA 4C59A 1G8SA 2VTPA 2A2AA 1UU9A 4CVAA 3BEAA 1I09A 3S3IA 5LJJA 1Q4LA 4Q5EA 3F3UA 3TIYA 5EK7A 3RZBA 3TZ8A 4EKKA 1CKPA 4RX7A 4GKIA 4LOOA 5AUVA 3VW8A 5LVMA 2QO9A 3TTJA 1OM1A 3KEXA 4FL2A 3CC6A 3FI3A 3KRXA 2VWBA 3QA0A 3DK3A 3NW5A 2FA2A 4ALUA 4DGLC 4JJRA 3W8LA 4EOKA 4RFZA 3UO6A 2NRYA 3QFVA 3FUPA 3ZEWA 4PDYA 3IONA 3CGOA 2XS0A 3ROYA 3KQ7A 4H58A 2WHBA 3NNWA 2C5VA 3C4ZA 5HG5A 4WG4A 3GCSA 3O8TA 4PRJA 5B2KA 3MW1A 4DEIA 2PZ5A 4RWKA 3MH2A 4X3FB 3U6HA 4FA2A 3D7ZA 5KO1A 5FBNC 4AT5A 4EK5A 1H07A 5DR2A 1ZMVA 2WTCA 4IANA 4EH8A 5A6OA 5JZJA 1O6YA 1URWA 2C3JA 5EYKA 2VTOA 2X2LA 3JYAA 1XH5A 3EQHA 3QD3A 4JR7A 2YIYA 5FTQA 1W83A 3DKFA 4J53A 4MNEB 3HUBA 4IFGA 4GIIA 4NFNA 5EDRA 2UZEA 3H9OA 4GIHA 5EYCA 4G3CA 3MY1A 3QWJA 4EZ3A 5BNJA 3Q5IA 3QRUA 3WZJA 4ANSA 4MTAA 3BYVA 3H30A 4FKIA 2HYYA 5JT2A 3MVLA 4KBAA 3E8CA 4RFMA 3ZBXA 3BBTB 3KK9A 1U5RA 4DFUA 5KMNA 4R1YA 5KMLA 2IW6A 4NK9A 2J2IB 2X6EA 4U97A 4WIHA 2PE1A 3WF9A 2CGWA 3IECA 1KOBA 3HA6A 5A4LA 3UBDA 3HVCA 4JL9A 3MB6A 5ANIA 5FTOA 2VV9A 4TNBA 1JNKA 5CT7A 3KREA 4GFOA 4TRLA 3NPCA 5DRBA 4W4VA 4D1ZA 5K5XA 3MVJA 4YZDA 5HE0A 3UQGA 4CMTA 4FKWA 3LQ8A 2PUIA 3VF8A 2WQOA 4GYIA 3EFLA 5GIPE 4FI1A 2PZIA 3UE4A 1J7IA 4WRSA 2W99B 3HZTA 2RG6A 3EN5A 5A4EA 2G9XA 5CS6A 1V0OA 3I79A 3Q9YA 4A06A 3BBWA 1V0BA 3LCDA 4DF3A 4JIKA 1T46A 5FLFA 3U4UA 4FIIA 5M55A 4EOOA 2BRGA 1ZYSA 4IAKA 5JK3A 4AOIA 3L9LA 4QMUA 4IB0A 4LOPA 4E4MA 3U51A 4F1OA 3A4OX 4LRJA 3UZTA 2WGJA 1OIUA 4Q9ZA 5CANA 4GL9A 1NA7A 2W1FA 4YJNA 3REPA 2WB8A 4RIWB 4HZRA 2UZWE 1K9AA 3ZSHA 3CPBA 1NT2A 1ZRZA 4MQ2A 3VJNA 5HX6A 2QR7A 2X4FA 3ITZA 4U41A 5IQGA 2WTWA 5DR9A 5CZHA 3S1HA 4X2JA 4XX9A 5CWZA 3WI6A 2Z7RA 5EM7A 5J95A 4I94A 4MD7E 1WCCA 3WF7A 3FKOA 4BCGA 4BZDA 4IDVA 4HCTA 4OTQA 5LARA 1ZOEA 4PPBA 3ZC5A 4PDPA 5DLSA 4P2KA 5T6KA 2CSNA 4DTAA 4TWPA 5D7VA 4QYGA 2XA4A 2YAKA 4MXXA 1PXIA 3KXGA 3G90X 3ORXA 5FDXA 5F95A 1OL5A 3F61A 2IN6A 3A7HA 3A60A 5HG8A 3EYHA 4QMZA 2VWVA 2YIQA 3ORTA 1W8CA 4DH8A 2YDKA 2QO2A 4CG9A 4WG3A 3ZBFA 4F0GA 4DBXA 4F09A 3OZ6A 4FKPA 3PZHA 4JBOA 3AGLA 5J87A 1TKIA 3WBLA 5KBQA 2YACA 2RFSA 4FL1A 1VZOA 5T68A 4MNFA 5EHOA 5H9BA 3ZDUA 3Q96A 3DBQA 4TYGA 4BIBA 5CALA 1UV5A 3W8QA 4XP2A 2QOLA 1U4DA 2WOTA 5TOZA 3UTOA 2NP8A 3EFJA 3RPSA 4RIYA 3CJGA 4XG4A 2VGOA 3BHYA 1M52A 2Y6MA 4OTDA 5IEXA 3NUYA 3MPTA 4GVAA 5AFVA 4JBQA 3DXNA 4D9TA 5AWMA 4L3JA 2C6KA 3NVMB 2JKOA 2DQ7X 2XK7A 1UWJA 3GGFA 3OCTA 4ID7A 4AA4A 4ZTLA 1UNHA 2PVKA 1W0XC 3FL5A 4S30A 4PL3A 5AP6A 4Z7GA 4UMUA 2CKQA 3UYSA 3BKBA 3R9HA 3RINA 3FLYA 4GFGA 4I6QA 4C0TA 5HO6A 4O7VA 2BFYA 4PP9A 4OW8A 3UP2A 4FKOA 2W9ZB 2A1AB 4K2RA 2ZVAA 2PTKA 2BAJA 1OMWA 3PIYA 5GZ9A 4C61A 4E4NA 4WNPA 3E62A 4O2ZA 1ZZLA 1PMUA 3QD2B 5DBXA 4XG3A 3DDPA 3SX9A 3E7OA 5IH4A 2XF0A 1VEBA 4FV1A 3I5NA 3TEIA 4OR5A 4EOLA 5IQCA 1WBNA 3GENA 3QBNA 3D94A 4BCNA 1Q8UA 3QXOA 3LQ3A 5CSPA 2FSOX 3W2SA 5HO7A 4BDKA 2UVYA 3M42A 4AACA 4QTEA 2ONLA 4GFMA 3KMUA 4GG5A 3QYWA 3KXZA 4ZJIA 4I24A 3RAWA 3V5PA 3ZUVA 3VQHA 5JFWA 5K4JA 3NYOA 4O2PA 2PZPA 5HBEA 1QPEA 3OWPA 1JKSA 4BFMA 3Q9WA 3QCYA 4GT5A 4JXFA 1JSUA 3MH1A 5AV4A 2QOQA 4DEDA 3FMDA 1YOMA 4E7WA 3CJFA 2EXMA 2WTIA 4AW2A 2ZB1A 3EYGA 4HNFA 4YPDA 2F7EE 5EH0A 1BL6A 1R3CA 2RFDA 2XEZA 2UZUE 5I9YA 3DTWA 1FVTA 5E8SA 5EM6A 4FYOA 4BR3A 5AX3A 4YNOA 3FEGA 3S2PA 3EMGA 4TWCA 3QQGA 1JSVA 3GU4A 2A0CX 3AC3A 2P3GX 3OMVA 3ANQA 4KA3A 2FSMX 4AGDA 5IQBA 1OECA 4E20A 2ZM4A 5CXZA 2AC5A 3QTXA 3LMIA 4CG8A 3ALNA 3CCNA 4DGOA 5L8KA 3PLAE 2OK1A 3RPYA 2W7XA 2VNYA 3IGOA 2BZIB 3SRVA 3RPRA 1ZYDA 3Q3BA 2Y6OA 3EZRA 4BDBA 2XKFA 5B2MA 1SM2A 2R3KA 4PX6A 3M1SA 4QP9A 3AMAA 4EYMA 4IVCA 2BILB 4M0ZA 2R3IA 3EFWA 3E63A 4IAIA 2FGIA 2WTKC 3TZ7A 4CMOA 3LCSA 1CSNA 1R1WA 5J79A 4ZZNA 3PSCA 4XUFA 4ASEA 4B9DA 2V7OA 2I7QA 4K9YA 4FTOA 4RWIA 4ZSGA 1BYGA 3KU2A 5ETCA 3G0EA 3W2PA 5M4FA 3DJ7A 3QRTA 3LXPA 4FV2A 1URCA 5CT0A 4ZXTA 3DNEA 4TY1A 4M66A 4CSVA 4CKIA 4GK3A 4QQCA 4UALA 3BU3A 2CGXA 3V8SA 4CFFA 3VUGA 3MIAA 4EK8A 1XH9A 4S32A 2BAQA 2OJJA 4LOQA 5IA2A 3IOPA 4QPMA 3EN4A 5FEDA 3VBVA 1A06A 2JDSA 4H36A 1HCKA 3A7GA 5DT0A 3ZXTA 1ZYJA 3OCGA 4KIPA 3HV4A 4P7EA 4LQMA 4USEA 5K3YA 2QKRA 3VUMA 4A9RA 2XM9A 2HY81 3CKWA 4BGGA 4XBUA 1OUKA 3Q04A 3FY0A 5DHJA 3WF8A 3UPZA 1DI8A 3P4KA 3ULZA 4FKTA 4L44A 3ZO2A 5CZIA 2BTRA 4WOVA 3R2BA 5IISA 5KCVA 2QR8A 2UZBA 3QUPA 3UGCA 4BDDA 3D0EA 4D9UA 4EH9A 4PP7A 3CEKA 4Z16A 5CXHA 4FV6A 4LV5A 5TT7A 2PSQA 1B39A 4KBKA 4FKGA 4KIKA 1AD5A 3LFDA 5JRSA 4YTIA 4BI2A 4EH6A 2W0JA 5C4LA 4DTBA 3N4UA 1JKTA 3CE3A 4PF4A 3R7VA 4M3QA 1IA9A 3H0YA 3P78A 4PDSA 4IFCA 3PIZA 4JR3A 2OXYA 3ORZA 3MIYA 4QP3A 1H27A 1H25A 3LXKA 2A27A 4JDKA 1XBCA 4BC6A 4HYSA 4RJ6A 3S0OA 4PUZA 4KSPA 1DS5A 5CQUA 1OL1A 2ZAZA 3U4WA 3GUBA 2BCJA 4TW9A 3RZFA 5BQ0A 4ZIMA 4QOXA 5IDNA 3S00A 3RKBA 2H9VA 5HLWA 1J91A 4J52A 4X2KA 1ERKA 4ACMA 3G0FA 3UOLA 1SNXA 3KC3A 2CN8A 3I7BA 2E9VA 4NM0A 3WZKA 3DKOA 4R3CA 2VTRA 5HG9A 3CKXA 2GPHA 4U6RA 4D0XA 2V0DA 2XCKA 3H0ZA 3UO5A 4O7YA 5LCKA 2GU8A 5IQFA 2WMQA 3PFQA 2XYNA 1YVJA 2KTYA 3QC9A 4R3RA 3DK6A 1JVPP 3FLSA 3PE2A 1MRVA 2X4ZA 2XK8A 4WSQA 2Z8CA 4I6FA 2YDJA 3FXWA 2PK9A 3R21A 3FHIA 3GFEA 3JUHA 2ITTA 3PRFA 4ZSAA 5IMEA 3JS2A 2AC3A 4M97A 4I1ZA 3MN3A 1UVRA 5IA5A 3T8OA 1PYXA 2E2BA 4TTHB 2X9FA 4BI1A 4RA4A 4MBIA 2J5FA 1BI7A 3AXWA 4FIEA 3D2IA 1FVVA 4HGEA 4RIYB 4RPVA 4FIFA 3TNHA 4P5QA 4KKGA 1KOAA 3BRBA 5EW9A 4BYIA 5K4IA 2GSFA 2P0CA 4FTUA 5HX8A 2YERA 5JFXA 3L1SA 5AV0A 4U43A 4RJ5A 3M11A 3KRRA 3UO4A 2PVMA 2C6DA 2X7OA 3G6HA 5DE2A 3TIZA 4BCHA 2UVZA 5AP7A 3ZOSA 3DJ6A 4IB5A 2P2IA 4I5CA 5F9EA 3Q60A 3U87A 4Z9LA 4IVAA 1FQ1B 2GDOA 2IVVA 1KSWA 4TL0A 4S34A 5A46A 4KNBA 3A4PA 5E8XA 3WIKA 1PYEA 2EUFB 5LMBA 3ZRLA 1JPAA 3HAVA 3IG7A 5M09A 1B38A 2ZV2A 3AMBA 4J1RA 3DKCA 4NZWB 2W4JA 4ZS0A 3NMUF 2JIIA 3FMHA 3KKVA 4ZTSA 3QX2A 2YCSA 2YM7A 3NUNA 5HLNA 3PUPA 1I44A 2R3MA 4W8DA 5HCYA 4H3BA 4NM5A 3VHEA 4BCJA 3DU8A 2W1ZA 3L8PA 4JQEA 2H96A 5HTBA 1APME 3ENHA 4FTNA 1J1CA 4C4IA 1OL2A 5EYMA 2XK6A 4EBWA 3ZLXA 3OFMA 4YLJA 3RK7A 4BVUA 5JMSA 5L4QA 4RG0A 4Z7HA 4E93A 1FOTA 2ZV7A 3UVPA 4D2PA 5KMJA 1Q99A 2B9HA 5CEOA 3P7AA 3ZZWA 5FTGA 2Y7JA 4QQJA 4D1SA 3I81A 1U54B 3MFUA 4CLJA 3PWDA 2B55A 2OJGA 4O91A 4YO4A 2YWVA 3F2RA 5L2SA 1SYKA 3QTZA 4PL4A 4Z3VA 2UW8A 2YABA 4RIOA 4ZTHA 5IH5A 2B0QA 3QTIA 4S2ZA 4YC8A 4JBVA 5AUXA 2X8DA 2YZAA 3D4QA 3Q32A 3NGAA 4QMWA 3OROA 1GIIA 4XV3A 2CJMA 4YC3A 5AUWA 5HGIA 4EK3A 2XNGA 3IS5A 2V55A 3ET7A 3F2AA 2Y4IB 2BMCA 1IR3A 3OOGA 3OS3A 4LL5A 4MNEA 3JY0A 4AAAA 3LKMA 4C4GA 4EONA 3D14A 2BRHA 3SRVB 3EQFA 3ZXZA 3AG9A 3WE8A 1G5SA 3UVRA 3CD3A 5BX0A 5I3OA 4R7HA 4BHZA 5I4NA 3GCVA 3HECA 2QI8A 2BRMA 2PE0A 1E1VA 4JQ8A 3TN8A 1STCE 4RIXB 4EOIA 2GHLA 5DWRA 3L8XA 2BZKB 4FSZA 1ZOGA 5ETAA 3COMA 2R5TA 1QL6A 2YIRA 3FMEA 3FV8A 3NUXA 2W1EA 4KS7A 4E6AA 5BUEA 3TV6A 5EDQA 2O2UA 5ANGA 3TUDA 3BLHA 4MF1A 3JPVA 5DNRA 4O6LA 5IUIA 4C02A 1H24A 5CF6A 4V04A 3EB0A 1LR4A 3D5WA 3MI9A 3PVBA 4ZLZA 3LAUA 2Y4IC 3NZ0A 5AP1A 4APPA 3MPAA 5BUJA 2ITNA 5KKRB 2PMIA 4I5PA 5LMKC 2WZJA 1HOWA 3MPMA 1GZ8A 2BKKA 3EL8A 4EOPA 5D41A 1EH4A 3V8WA 4I6BA 4RWLA 2UUEA 5BYZA 4EH7A 2O63A 2PE2A 4I0SA 1JWHA 4N6YA 1OIQA 1PMEA 3CTHA 4DITA 5A6NA 5CF4A 4QNAA 3MESA 2HXQA 3LZBA 4D4YA 3R30A 3DAKA 5C03A 4CMUA 4GMYA 5EM8A 4FVRA 5T3QA 5JQ8A 2X8IA 4RIWA 3U9NA 1Q8WA 5EKNA 4FGBA 5CI7A 1ND4A 3FZOA 1PKDA 1TVOA 3O7LB 3FC1X 3OP5A 4UWBA 4QP8A 5D12A 4F99A 5C9CA 1NVQA 2VTMA 4KIKB 4CFVA 4MXAA 5L3AA 2QOCA 2OJIA 4YHFA 2F4JA 4C62A 5A9UA 5E1SA 4LV8A 4QP1A 4AGWA 4FSMA 4UMRA 5B7VA 3VBQA 2VTHA 5KKRC 4CT1A 2H8HA 1QCFA 2F57A 5G6VA 4RJ7A 4KKEA 1WBTA 3QUEA 1MRYA 5TR6A 3VBXA 3HLLA 4E3CA 2GNIA 2VWYA 3QHWA 2J7TA 4RC3A 4MWIA 3C5UA 3EQGA 4I0RA 1JKKA 4LUEA 4RT7A 1YHWA 3TI1A 3UMWA 4BTJA 4E4XA 5JEBA 4FGRA 4KKHA 1XHAA 4YJPA 4FKLA 5TE0A 4O6EA 4EWQA 1E9HA 3OXIA 5ANJA 3VS0A 1KWPA 1QPJA 5J5SA 3H9FA 4E5WA 2X2MA 4R5YA 3WZDA 4GJ2A 4DFNA 5GJDA 2HIWA 1Y57A 3BZ3A 4ANNA 4FIJA 3SLSA 5AP2A 3WYXA 4FT9A 4YC6A 5KMKA 5D1JA 3QQHA 1ZOHA 2ITOA 2Z7QA 5ACKA 4L9IA 3QGYA 3GC0A 3KRLA 4PQNA 4EC9A 2I6LA 3FMNA 3PVUA 4IM0A 2IG7A 2HW7A 3LJ1A 4A4OA 4AGCA 5CEMA 2PU8A 4YHJA 3FZSA 1NXKA 3DXQA 4U0IA 4EJNA 5CU3A 4QMOA 4EWHA 4LI5A 4O7ZA 5I3RA 5KUPA 4EJ7A 2HWOA 1DAWA 4DFLA 4BWXA 2VWUA 3ZHPC 3OY3A 4O0RA 4TNDA 3UJGA 4FICA 4JBPA 2WMUA 4I4EA 1LP4A 4AUAA 3QTSA 4AW0A 2OJFE 4GH2A 4BBMA 4Y5QA 4FT0A 2YEXA 1OBDA 4QP7A 2OF4A 4I5HA 2ZV8A 3QQFA 3CQEA 3UODA 5AUYA 4XG6A 4G17A 4RLKA 2XBJA 4OTIA 5HG7A 3DFAA 2ERKA 2WEIA 4F7LA 2DYLA 4J8NA 2ITPA 4Y85A 2ZM1A 3LW0A 4U7ZA 5HTIA 4A9UA 2C0OA 2OZAB 2WU7A 3ZONA 3C4FA 3UZPA 4U80A 3UNJA 3C7QA 4BDEA 4O7SA 4G3GA 3KF7A 3BU6A 4OT6A 3R04A 1XBBA 5FBOA 4FKVA 4XG2A 4DT8A 2C5XA 5CASA 1UU7A 4HVIA 3BQRA 4AZTA 1SMHA 3KVXA 3QUDA 5CEIA 4C38A 3LHJA 4ZZOA 3FYJX 4YBJA 4C34A 4IVDA 1WVWA 4O7RA 3GCQA 4IM3A 4AWIA 2QOIA 3UIXA 2WMSA 3VBTA 4E4LA 5ETFA 5J9ZA 3DY7A 3TJDA 1BUHA 3E8DA 2B1PA 5D9HA 4DEBA 4C7TA 3GU8A 3HV6A 4C57A 4FEWA 1PXKA 4MQ1A 2X9EA 4E5BA 5CF8A 3P79A 4CT2A 2YAAA 3SXRA 1W84A 2W1GA 2RG5A 2QOKA 4CV8A 4G3DA 1YWRA 4GT4A 4IX4A 3AD6A 2PY3A 2XYUA 3FZTA 4HYIA 2JEDA 2FH9A 3MFTA 3MH3A 4TWOA 4YBKA 4ZSJA 4F0FA 4DH3A 4DCAA 2PUUA 4MCVA 1PMNA 4LGHA 4TWNA 3LFFA 4YZBA 2R3PA 2YLEA 5HD4A 1YKRA 1ZY5A 2ITWA 3QTQA 2KULA 1XH7A 4JX3A 4LM5A 3DT1A 3OG7A 3F3VA 4ZTQA 2GQRA 5DR6A 3UNKA 3UVQA 4XP3A 3BEGA 1Y8YA 3OWKA 2C3IB 2XKEA 4BCKA 2QHNA 3FI2A 3R8UA 3W2CA 4KBCA 3IW4A 4KABA 3R00A 4BGQA 1ZLTA 1ZMUA 4UXLA 3ZZEA 3KA0A 4BCPA 5L6PA 4QMNA 3FLZA 1OKZA 4YJSA 1RW8A 3C0IA 4UMQA 3OOMA 1JAMA 3OW3A 4WNMA 4HZSA 1OL7A 3N4VA 3CTQA 4BKZA 3FE3A 2WFYA 4ONAA 4B7TA 1R0EA 3A62A 1FGKA 2XCHA 4CFUA 1H4LA 2WAJA 3LJ0A 4ZMFA 2YFXA 4GG7A 2R0UA 1DI9A 3EJ1A 3FQSA 2QKWB 3HUCA 2XNNA 4E6QA 5AADA 1GOLA 3KVWA 4JAIA 5E9EA 5ANKA 5HU9A 2ZJWA 1RJBA 5EI2A 2O0UA 4QMSA 4WD5A 2P2HA 2VWWA 4YJRA 2V7AA 4DN5A 4JIAA 3MA6A 1MQBA 3F7WA 2OI4X 3W1FA 4XP0A 4F63A 5AR7A 3R02A 4RGJA 1L3RE 3F9NA 3D5VA 3LFBA 5M4IA 3V5WA 3RJCA 3NNUA 3O8UA 2BDFA 4FT5A 5CNNA 2OO8X 5BVEA 2PZYA 4C2VA 5F1ZA 3UC3A 4DH5A 4FF8A 2CNVA 2I0VA 4JDHA 1OKVA 4GU9A 3MH0A 2YCFA 3GEQA 5A3XA 4CRSA 3IQ7A 5GZ8A 4O81A 5LQFA 2CNUA 1T45A 3AT4A 3TKHA 3HV7A 3L9NA 4JQ7A 1OZ1A 5IUGA 1UU3A 3BE9A 4J99A 2HZNA 2R3OA 3PA5A 5CVFA 4EZ7A 4OAVB 2OIDA 5EHLA 5C01A 3W10A 3E87A 4O82A 4W4WA 4FE2A 2BIKB 3WIGA 3EQCA 1CKJA 5BYYA 2WXVA 3HYHA 1OI9A 4F6UA 5G1XA 4K18A 3NRMA 3DZOA 5KHWA 3F5XA 3TG1A 4RVLA 3JVRA 2XNMA 4JI9A 4L7FA 3ZH8A 2GCDA 4FKQA 5KZ0A 1XH8A 3QCSA 3OC1A 5JFSA 3HMIA 1ZY4A 3CSVA 4OBPA 4EHEA 3W16A 4AFEA 3TNWA 1PJKA 2OH0E 5L6OA 5K5NA 2XNOA 5H8BA 3DS6A 3OUNB 5DVRA 4J95A 2UZNA 2JIUA 3OWLA 3UG2A 4CRLA 1ZAOA 3POZA 4LRKA 3L8SA 5IA0A 2FO0A 4AA5A 3G9LX 2W96B 3GP0A 3SOCA 5L2IA 3IW8A 4CYIA 2C0IA 3OEZA 1GIHA 4FTTA 5L2QA 2GQSA 3QLGA 4FOBA 3LIJA 2F49A 4U79A 4FSNA 4MH7A 4FC0A 4AW5A 4FG7A 4BN1A 4GVJA 5LOHA 4R5SA 4G6LA 1Y91A 2AYPA 4FSWA 3R22A 4I5MA 2VTAA 3NYVA 1BKXA 3P1AA 5HTCA 1TQMA 5BVWA 3E3PA 3ATTA 2HELA 4W4YA 4CNHA 5F20A 1L8TA 3FPMA 3DLSA 1NVSA 4ZS4A 2O5KA 3DAJA 3ZS5A 3NWWA 2RFNA 4RQKA 5H3QA 4CXAA 4A7CA 1PMVA 4AU8A 2IVSA 2W9FB 4NWMA 2BDWA 3THBA 4F0IA 3HX4A 5AJQA 2G15A 4GRBA 5E1EA 4UYAA 3LMHA 3CQWA 4MXYA 4Q9SA 4FTCA 4BTKA 1K2PA 3OD6X 4QTDA 4O22A 3VULA 5JN2A 2VD5A 4F70A 2W17A 4F9AA 1Z9XA 3EQIA 3GQIA 5EYDA 4GUBA 2ETKA 4CKJA 5IQHA 4ANMA 4L3PA 4AZSA 5C8MA 3LLTA 5HOAA 1CM8A 2VTSA 4PPAA 4HVSA 2UZVA 4MKCA 1Q61A 2GNGA 3NX8A 4JG8A 4K11A 3RNIA 2OSCA 2CN5A 1M2RA 3KK8A 2W05A 4IZAA 3OTUA 3K2LA 3P7BA 4HW7A 4A07A 4GSBA 2QLQA 3LXNA 3ORLA 3ORMA 4C58A 4WA9A 2QCSA 3JR1A 4BZOA 2R7IA 3DGKA 3MJ1A 2ZDTA 3B2TA 4UB7A 3E8NA 3PVGA 3HNGA 4E26A 4TYHA 4DH7A 2NNWB 1GZKA 3FSKA 3VUKA 5E7RA 3SXFA 5AX9A 3W18A 3TZMA 2WMVA 1UNGA 3RM7A 5L2TA 4IDTA 3B8RA 2WQEA 3GCUA 3HEGA 3NCZA 3PG1A 2YITA 3PSDA 4O0UA 5HNBA 4BHNA 4E5AX 3ZUTA 2WQMA 3I4BA 2GS2A 2XMYA 2WTKB 3VIDA 5E4HA 1MQ4A 4F08A 5CAPA 2OF2A 4ZTRA 4I20A 5IA3A 3MY0A 1YOLA 3FLWA 1U54A 1WVYA 4DA5A 4UZDA 1P4FA 4JS8A 2YM4A 4BDAA 2F7XE 5BVFA 1W98A 2C5YA 4I21A 4XHKB 3C51A 3BWJA 1M17A 4IX3A 3LVPA 3GU7A 3KGAA 2B9FA 5E8TA 5AV1A 5IQDA 1NW1A 4F65A 1U5QA 3TM0A 5DEWA 2UW4A 2HW6A 3FBVA 4Y72A 4C8BA 4BZNA 4R1VA 5IPJA 2F2UA 2R2PA 1U59A 2CKEA 1E1XA 3CQUA 5HORA 2CCHA 4M13A 3SQQA 3AT3A 5LMKA 2VX1A 4BIDA 5H8EA 4I23A 4AGUA 4U40A 4PL5A 3LPBA 1XH4A 2B7AA 3OY1A 5AR2A 5GNKA 3BHTA 4BDJA 5KX8A 4QP2A 5LCJA 3QZGA 4L42A 4QNYA 4TT7A 1WBPA 3QA8A 2XBAA 5LMAA 4QMYA 3GB2A 4I41A 3TACA 1O6LA 4H1JA 4E6DA 2WMAA 4RIXA 3BU5A 3VUHA 1Q5KA 4YJQA 5CU4A 2JKMA 2W1CA 3LQ5A 3NLBA 3PA3A 3PG3A 3CR0A 1X8BA 4G9CA 4NTSA 1LUFA 2R3FA 2YM5A 3QALE 5JFVA 5IQAA 4NJDA 3MTLA 3PXFA 1UNLA 4NYEA 2VO0A 2IZUA 3FSFA 4QQTA 4F4PA 3FKLA 3O71A 2F2CB 4RX5A 4FEQA 4YMJA 4M7IA 5HBJA 2BR1A 5BMMA 3ZLWA 4CKRA 1JLUE 3DKGA 3E64A 1OITA 3VUDA 4ASDA 1Q8YA 2GHMA 3I5ZA 3TT0A 1YHSA 4PY1A 4RVKA 3P86A 4IQ6A 4IVBA 5E8YA 2Z60A 2B54A 2XZSA 3LFEA 3UIBA 5JRQA 4KINA 5DEYA 3I60A 1TQPA 1H1SA 3AMYA 3EKKA 4ZSEA 4YZCA 5J7BA 1YXXA 1S9IA 3QAME 4EH4A 3V5LA 3CBLA 4EQUA 3QCQA 5FEEA 4GS6A 2UV2A 4U3ZA 4AG8A 4ENXA 4AN3A 3LFAA 4MEDA 2QVSE 4OLIA 3ATSA 4GW8A 3SG8A 3RHKA 5HE2A 2YN8A 2E9UA 4I93A 1H1WA 4D5KA 4NTTA 4WBOA 3TKIA 4FKRA 1IG1A 2GTNA 4FVQA 5D7AA 4DG3E 4C3RA 5AAEA 4YJVA 2YIWA 1QMZA 2XVDA 3HP2A 3P08A 3QZFA 4ALWA 3FJQE 4D55A 3NVKI 4QP6A 5HIEA 1KUTA 5IUHA 3SA0A 2UW5A 3LFCA 1PW2A 3PJ8A 4L01A 4O86A 4WO5A 3OUKA 4AZEA 3P0MA 2WO6A 3QYZA 3R8ZA 2XB7A 3WILA 3R1YA 2FUMA 3F5UA 1FGIA 2Q0NA 4KSQA 4IEBA 3SKCA 3AC4A 5AM7A 5GZAA 5KBRA 3PP0A 4G6NA 2JKKA 5E92A 4YURA 1KE6A 4OBQA 4PTGA 4EHGA 3BLQA 3PPKA 4LFIA 4IWPA 2QURA 5BVOA 1PXMA 1QPDA 1OVEA 4NM3A 3V8TA 2UZOA 4K77A 2C6OA 2X8EA 4K0YA 4Y5HA 5IU2A 3CGFA 3Q9ZA 4ZMEA 3PXZA 2C6LA 4ENYA 1PKGA 4A9TA 2PVFA 3PE1A 2I0EA 5FUTA 2FSTX 2HAKA 1JQHA 4N0SA 3A61A 5EG3A 3VS1A 4RRVA 3SD0A 3F5PA 2XIYA 4G1WA 1UWHA 4WNOA 4XV1A 3C0HA 3ORKA 4Q5HA 4XOZA 4ACGA 3G6GA 3D15A 1J3HA 4OAUC 4H05A 3QRJA 3D2KA 4BKYA 1GAGA 2CPKE 2PL0A 5D10A 3FI8A 2WMXA 5EI8A 5AR5A 4G5PA 4EQMA 2JBOA 3V04A 3BWFA 5BVNA 4TKSA 4PV0A 5EQYA 2BTSA 3QCXA 4JDIA 3QX4A 4R77A 3B2WA 4FV5A 4NW5A 5HIBA 3QTUA 1XJDA 2BDJA 4X2GA 4CTBA 3LXLA 1F0QA 5F94A 5CI6A 4RJ3A 3CXWA 4X0MA 4FUXA 5ANEA 3DB8A 3VBWA 3ZRMA 3F3TA 3ALOA 1DM2A 4EL9A 4ERKA 4QMXA 5AUZA 4F1TA 3SG9A 3C4WA 2YM8A 3EQRA 3EOCA 3FZ1A 3H4JA 4FIHA 5FRIA 4B8LA 5BVDA 3TUCA 4BDGA 4X2NA 4FT3A 1H26A 3VUIA 1QPCA 2CLQA 2E9NA 2OZAA 3R8MA 2GHGA 3HDMA 5L2WA 5IMXA 1O9UA 2Z7LA 4TZRA 4IWQA 4D2SA 3BX5A 3LE6A 5CU2A 5M08A 1Q8ZA 3G5DA 1V1KA 3NNXA 4RLLA 1H01A 4OBOA 4USDA 2HZ0A 3HMPA 2YDIA 1P2AA 3EN9A 1ZARA 2VTJA 3AC5A 3VS6A 2VGPA 5IEYA 4IH8A 3RALA 4Y46A 2G2IA 4UY9A 4ZZMA 2IJMA 3Q4ZA 4AE9A 2PVNA 2WTJA 3MTFA 4FNYA 1FMOE 3N4TA 4FKJA 3N51A 4D4SA 3GFWA 3MWUA 5CSWA 4DG0E 3VS4A 3DXPA 5GJFA 5J7HA 1YWVA 2OXXA 3HL7A 3QHRA 4LL0A 3GNIB 4U42A 3BV3A 5IZFA 4J7BA 4XRJA 1BL7A 4TYHB 1MP8A 5E91A 5E8UA 3FKNA 2UW7A 3R1SA 3D5UA 2XK4A 3GU5A 1UKHA 2RF9A 3HA8A 3ZM4A 4KS8A 4O83A 1Q97A 1YXSA 4C2WA 5I9UA 2VRXA 5CAOA 4YPSA 4GK2A 4MD8E 4NU1A 2I40A 3O96A 4ZJVA 4FK6A 3QC4A 5KE0A 4BBEA 2GFCA 3K3JA 3PVWA 4BDIA 3R8VA 2JC6A 4EC8A 5A54A 3UDBA 3T3VA 4FL3A 4XEYA 4PMTA 5CQWA 3OCSA 4TYIA 4FKUA 4BL1A 4QTBA 2EU9A 3RWPA 4D4RA 4E73A 3PRIA 3PWYA 2QONA 4G6OA 5AMNA 3K5UA 3ZEPA 3VVHA 2QOFA 3FAAA 3W55A 3NNVA 5FP5A 1CKIA 2VWZA 3WARA 3ZTXA 4BKJA 4UN0C 4TN6A 3AQVA 4I4FA 4O0YA 2I0HA 1SVGA 4XMOA 4FG8A 4FKSA 2WMBA 5FWKK 1P14A 1OKWA 4FSTA 3PJ1A 2NO3A 4G5JA 4QMMA 3UPXA 3TL8A 3V6RA 3VJOA 4ALVA 3QU0A 4B0GA 4C4JA 3SOAA 3OBGA 2ZM3A 3ACJA 4L45A 2GNJA 4IB1A 3ZYAA 1H28A 4RQVA 5AAGA 3QTRA 3R7OA 5EOLA 3MVHA 4DGMA 4H1MA 4TPTA 3SVVA 4KRDA 1JBPE 3F88A 5LXMA 4F7JA 2GS7A 2W1HA 2IO6A 3FLQA 5IQEA 2YCRA 4FG9A 2OJ9A 3EHAA 4PDOA 4BF2A 3KCKA 2R3LA 5CEKA 4E1ZA 4EQCA 3F5GA 4V0GA 4OTWA 2UZTA 1J7UA 4RVMA 1YRPA 1PHKA 3CS9A 3PXYA 4RBLA 3A7IA 3HMOA 4E6CA 3R9NA 4YLLA 3RPVA 2BPMA 4J71A 1PY5A 2R3RA 3VAPA 3PXKA 5D11A 3Q2JA 2ETMA 3WF6A 4O96A 2EXEA 2RFEA 2YHVA 3F69A 1PRYA 3KN6A 5A4TA 5JQ5A 3KULA 3QD4A 3RTPA 4LUDA 4DE4A 3KF4A 2G01A 3AC2A 3RK5A 3S95A 5EKOA 3QQLA 4QD6A 4FEUA 2G2FA 4JG7A 4DGNA 5LVLA 1PF8A 3BIZA 3EIDA 4ZEGA 4FTRA 5J9YA 2GTMA 1KV1A 3PSBA 2IW8A 4A9YA 4PWNA 3FZPA 4JG6A 1ZWSA 3CTJA 3VW6A 4MAOA 3U9CA 2XJ2A 3RCDA 2Y8OA 3C9WA 4XS2A 3UIUA 5C8KA 4BDHA 4BDFA 4C3PA 3V5QA 2PVJA 2BKZA 3F6XA 5EDPA 4DFBA 3AOXA 5I9XA 4K8AA 4GV1A 2Y0AA 4OTHA 1ATPE 1SVHA 4MHAA 4UXQA 3UOHA 2J0JA 2QD9A 3M2WA 2X7FA 4L43A 4D0WA 4R7BA 2ZB0A 3KN5A 4CV9A 4DG2E 1H00A 1UKIA 3EL7A 3JXWA 3AC8A 3QGWA 4IC7A 3FDNA 4KRCA 2HZ4A 4I3ZA 2ZDUA 2PHKA 5M44A 2IZTA 4FBXA 3SHEA 4EORA 4AN9A 3UNZA 4QTCA 4NSTA 2JGZA 4K33A 1LEWA 3ULIA 5M4UA 3T3UA 3G51A 2QO7A 4ASZA 2P4IA 2VO6A 3EH9A 2UVXA 2XJ1A 3A99A 5DT3A 4C4HA 3NUSA 2W5AA 4I22A 2QU6A 2XIZA 3IDPA 2IVUA 3MVMA 3DLZA 5EFQA 1OPJA 3QLFA 4RZVA 2HCKA 3MYGA 3QL8A 5FQDC 4EUTA 2X39A 4ZY5A 3Q4UA 4EBVA 5KNJA 1WBOA 1Y6BA 2P55A 3BI6A 3MY5A 4EOJA 2ZYBA 4HVHA 2VX3A 4MXZA 5HIDA 3R7IA 4AT4A 4FEXA 3N9XA 1WAKA 3BYSA 3PYYA 5IF1A 4EOQA 4BYJA 2ACXA 4CZUA 5CSXA 2LAVA 3E88A 5LWMA 1OPLA 4IM2A 5FM3A 2X1NA 3II5A 3A8WA 2FVDA 2V22A 5K9IA 3RM6A 2ERZE 3E3BX 3HGKA 5HVYA 1JOWB 1YXTA 3OEFX 2ZMCA 3RNYA 5CAVA 2O3PA 4D2TA 5CEPA 1Q24A 3VUTA 3VS7A 4CCBA 4F9WA 1CMKE 4JDJA 2YIXA 3SW7A 3Q52A 4EOSA
chains in the Genus database with same CATH superfamily
4NUSA 5EOBA 5ETIA 3U6JA 4L52A 2JDTA 5DFPA 3IDCA 3ZLSA 4O21A 1H08A 5L8LA 4XNEA 4CQGA 1B6CB 4E8AA 2XRUA 3NW6A 4M67A 4HNIA 4ITHA 4M8TA 4R78A 3SDJA 2OFVA 2OXDA 5J9LA 3T9IA 4QMQA 4ZTNA 4NKSA 4FUYA 3ZO4A 1XKKA 3ETAA 2J50A 5B0XA 3O17A 5AP5A 5E90A 4FX3A 3GQLA 3V5TA 2XRWA 5CENA 4MBLA 4BTMA 4AFJA 4EHVA 4YTFA 4MXCA 3ZUUA 4W4XA 3T9TA 4DLIA 5AM6A 3TKUA 3S4QA 2CMWA 3R7EA 3C5IA 1G3NA 3ODZX 2IPXA 4IW0A 1YDTE 2QHMA 4FMQA 2VTIA 3V3VA 5HD7A 2Y4PA 4FZFB 3FLNC 3R01A 1YI3A 4IC8A 4RX9A 4JT3A 4FZAB 4NKAA 1LPUA 5GJGA 4X2FA 2C6MA 4NM7A 4WT6A 5TKDA 4IZYA 4DLJA 3IW7A 2X81A 3P5KA 4H39A 2V5QA 2YLFA 4WBBB 4EEVA 1W7HA 3ACKA 3DA6A 5FP6A 2QQ7A 2HOGA 2CHLA 2PMOX 3R73A 4FV8A 4B99A 2Z02A 5GIOE 4LMUA 5CYIA 1H8FA 1VYWA 3EN6A 1IASA 3BHVA 3L9MA 1TQIA 4BICA 2GFSA 2W06A 2O64A 3KXXA 5AIKA 5AAFA 4MD9E 3U54A 4DT9A 3FYKX 3Q9XA 2VWXA 2BZJA 4G9RA 2WD1A 4JAJA 5EQPA 5M56A 2G1TA 1OL6A 4OTPA 3BYOA 2JDOA 3BV2A 3JY9A 4IJ9A 3ZO1A 4HJOA 2B52A 2C5OA 4O7TA 5EW3A 1M2PA 3R0TA 4ITJA 2CGVA 1ZXEA 2V62A 2H34A 4HGLA 4MXOA 4XG9A 5AIRA 5DYJA 3NDMA 2AUHA 2C3KA 2C6EA 2QG5A 3MS9A 2CGUA 2CLXA 3BGQA 4ZSLA 3CY2A 4ZK5A 2BUJA 3LLAA 4BCIA 4IIRA 4XCUA 5DN3A 5I0BA 2AEGA 4L68A 3DK7A 4CEGA 3RGFA 2B53A 3FC2A 2CDZA 4RSSA 4CFXA 2VWIA 3IOKA 4KD1A 4AA0A 2OIBA 2C1BA 4BCMA 3RVGA 3KRWA 4MYGA 2C3LA 1W2DA 4EKLA 3D83A 2ZFYA 3VN9A 5HO8A 4Y8DA 3H3CA 4EK4A 4DCEA 3AGMA 4BJJB 3BYUA 5FEQA 3FWQA 3WE4A 2XIRA 3PXQA 2C6IA 2YJSA 3TDVA 3RK9A 3UOKA 1IRKA 3L9PA 3OBJA 1XO2B 1GNGA 5AR3A 3UG1A 3E7VA 1PXOA 2FYSA 4V0GB 4BCOA 2WU6A 2CCIA 4C36A 2RSVA 4QYEA 4UEUA 4AQCA 4MF0A 1YQJA 1PXNA 4J96A 2IZRA 4C37A 1NY3A 3Q6WA 2C69A 4FV3A 2PMLX 3ZU7A 5FGKA 4WUNA 3LFSA 1SZMA 3HV5A 2X0OA 4BRXA 3KULB 2JIVA 1VJYA 4OTRA 4X3FC 4CD0A 2C68A 3D7TA 5DIAA 3BL9A 4IAYA 2RGPA 3AD4A 4II5A 1F5QA 3KXNA 3UZRA 4A4XA 3FQEA 1OIRA 1ZZ2A 3ZDIA 4ANQA 2XAMA 5CNOA 5HLPA 3MB7A 3C4EA 4NH1A 3ANRA 4ZP5A 5M57A 4NL0A 3W0NA 3MFRA 3UC4A 1XMLA 3ORPA 2VZ6A 3COKA 3NSZA 4WNKA 2CNQA 1CTPE 3HRBA 3QD0A 4XRLA 2QOBA 4ITIA 4HYUA 2X2KA 2ETRA 4FK3A 4O7LA 4IZ7A 4W8EA 5HE1A 3UOJA 3VQUA 2UW0A 3OT8A 1AQ1A 3O50A 4ASXA 5A14A 5HU3A 4AXDA 4JOAA 4J98A 3ZSIA 4YR8A 3A2CA 2QNJA 3I1AA 3KCFA 4XYFA 5HQ0A 1Q3DA 3G33A 3KL8A 4AQKA 4I92A 4YU2A 4AE6A 2EVAA 2WMWA 3BE2A 1YXVA 5CU6A 3WZEA 4MWHA 5J5TA 2R64A 2XUUA 3LCOA 4BCQA 2R9SA 3EFKA 4DH1A 4DFZE 5HCXA 4XV9A 2J0IA 1NVRA 1Q3WA 3E93A 4IHPA 3A7FA 2W5BA 3VWAA 4BWKA 4GEOA 3ENMA 2YCQA 1BI8A 4CFMA 4JRNA 5ANDA 2WNTA 3RI1A 4ZAUA 2Q0BA 1WFCA 4D2RA 3VNTA 4UWYA 4JNWA 5FG8A 2UW9A 3DBFA 3PTGA 2WTDA 4JVGA 4PMSA 2O8YA 4YHTA 5DA3A 3KY2A 4KB8A 3TCPA 1MRUA 4HOKA 3R7YA 3W2QA 5IA1A 4KIOA 2XM8A 3WOWA 4F6SA 4XLIA 2X0GA 2WKMA 5I5ZA 4HGSA 2UW6A 4M12A 5CVGA 1GZNA 4QMVA 4FIGA 1MUOA 3R6XA 5B2LA 2PUNA 4BGHA 2J0MB 2BRNA 5LVNA 2DS1A 4C4FA 3QQUA 4N6ZA 4FV7A 3BQCA 2XALA 2OFUA 2WELA 4UZHA 4N57A 5HE3A 3IO7A 4IXPA 4M15A 3TNQB 3UIMA 5KMIA 5ITAA 5HBHA 4BDCA 3DPKA 3QTWA 4O4BB 1IA8A 3U8WA 4AZFA 4CGAA 3VS2A 2I0YA 2IEWA 2F9GA 3BGZA 5JSMA 1YI6A 4BY9E 4FSYA 4PNIA 3SW4A 2RKUA 4FTJA 5IA4A 4RA5A 4XG8A 3VBYA 3V51A 4UYNA 2VO7A 2JFMA 3CY3A 3VC4A 2ZMDA 5DH3A 4GKHA 3DTCA 2OH4A 1UU8A 3TV7A 1ZYCA 4BWPA 4O84A 4LMNA 4USFA 5JGDA 2CKOA 2XIXA 2YM3A 4M14A 1XH6A 4D5HA 3DNDA 2PMNX 3RAHA 3R63A 4V01A 3HRFA 1Y8GA 4NCTC 1OBGA 3HAMA 5EHYA 3IK3A 4RJ8A 4ZOGA 3UYTA 2QLUA 3E92A 3JVSA 3NCGA 4N70A 4QO9A 2HWPA 5J1WA 2H6DA 1M7NA 2JKQA 3A7JA 3O0GA 4QPSA 5HESA 3TNIA 3U55A 4MK0A 4YJTA 4MVFA 2PPQA 3IPHA 3GOPA 5BPYA 3MGYA 3W0MA 1ZMWA 2Z7SA 3IW6A 4FOCA 4M69A 3Q2MA 4ZLOA 5KHXA 3UMXA 2EWAA 3OXTA 4ANLA 1VYZA 2B4SB 1REJA 2W5HA 4AP7A 4ERWA 3QRIA 1Q41A 3W32A 2WQBA 1XQZA 1J7LA 4GK4A 3KMWA 4XV2A 5AV2A 4FTAA 3IW5A 4UX9A 4W9WA 2FB8A 3NR9A 3Q6UA 4O0WA 5C26A 3OW4A 3I6UA 5CY3A 1RDQE 4V05A 2J51A 1RQQA 1HCLA 4NIFB 3FPQA 2HK5A 3OCBA 3F7ZA 4APCA 3W33A 1O6KA 2VTNA 4L67A 4CFWA 1Q62A 3KB7A 3HMMA 2VTLA 4FNXA 4GT3A 4IAFA 3V01A 4ACHA 4F7NA 1FVRA 4WHZA 1W82A 4J97A 4L6QA 4O1OA 3GI3A 2HY0A 4QMLA 2WTVA 2JITA 4B4LA 3OTVA 2ITQA 2XNBA 3C1XA 4YZNA 5AV3A 2REIA 5AEPA 2QU5A 4P5ZA 1P4OA 1ZYLA 5HEZA 4AN2A 3HRCA 3I7CA 3Q4TA 3ZMMA 1JSTA 2CKPA 4U81A 4AOJA 3DQWA 2VTQA 3R83A 4IAAA 4RZWA 4YLKA 4F9YA 3GVUA 4YSJA 1R78A 1G8KA 3RCJA 5AR8A 4F64A 3L8VA 4FSUA 2XJ0A 4FZDB 5EI6A 4FV4A 3A8XA 4HPTE 4PTEA 2JD5A 3MFSA 2WQNA 4EYJA 3R71A 5L6WL 5C1QB 5I9VA 3DAEA 3VHKA 2WIHA 4EH2A 3NEWA 3ID6C 3R8LA 2QC6A 5IQIA 1Z57A 4G31A 4JMQA 4AF3A 3SGCA 3FY2A 2XEYA 3NIEA 1IEPA 4R6VA 3WF5A 4EH3A 4BTFA 3MV5A 3Q5ZA 4AXFA 3DJ5A 2PWLA 4L3LA 3DFCB 3V6SA 2GNFA 3PLSA 4TYEA 4YJUA 3ZCLA 5H2UA 4CFNA 3COHA 5DPVA 3RBWA 4G34A 4PNKA 2WEVA 4QRCA 4YTCA 5HICA 3FHRA 5A4CA 5JGAA 4KUJA 5BYLA 4L00A 4QT1A 2IWIA 3ZO3A 3LJ2A 4JLCA 4YUQA 3D7TB 4RVTA 3FXXA 2DWBA 2XKDA 3O51A 5HCZA 3TZ9A 5CF5A 5LWNA 3BPRA 2XIKA 4OTFA 5ICPA 2Y9QA 3H9RA 5H8GA 3UP7A 4WSYA 2A4LA 5EQEA 2E9OA 5K0XA 3PZEA 2HENA 4XJ0A 2ZOQA 1XWSA 4A4LA 3PY0A 1S9JA 2R3HA 4UWCA 1YXUA 3F3WA 5CVHA 2YZLA 5M53A 4GYGA 1J1BA 3PY1A 2NRUA 3O7LD 2QOOA 1A48A 3F66A 3GC7A 5GINE 4AX8A 2ITYA 4JX7A 4DEHA 1SNUA 4R8QA 4DYMA 1GIJA 3QKLA 4IBMA 3VO3A 4RC2A 3K3IA 2BROA 3I0OA 3KRJA 4FTKA 3O23A 4L46A 2FSLX 2PUPA 4Y73A 1DAYA 3D9VA 4Y83A 4WKQA 1A9UA 2ITVA 1OGUA 4X6RA 4J8MA 3O8PA 4P4CA 5JGBA 2A98A 2GMXA 3FMLA 2PVHA 2JAVA 3PP1A 3RWQA 3PXRA 4D1XA 4IADA 1OB3A 4DFXE 4QMPA 3BLRA 2EB2A 2C6TA 4O0TA 5E8WA 5IG1A 2GNHA 5M51A 4H3QA 3EQDA 4DHFA 4O0VA 4RMZA 4TYJA 1Z5MA 5HHWA 4DBNA 4EHZA 1P5EA 3R2YA 5CX9A 5CAQA 3G9NA 3KXMA 5AP3A 3E5AA 4OT5A 1GJOA 4U5JA 4FEVA 3F2NA 3FMJA 1BMKA 1RE8A 2ITUA 4G3FA 4TXCA 3R8PA 2VX0A 1WVXA 1CDKA 3W2RA 4O7NA 1KE9A 4FNZA 1G8AA 2WMRA 4YP8A 2P33A 4LGGA 1ST0A 4U45A 2YA9A 4IZ5A 2C30A 4H3PA 4O4CA 4C3FA 5AUTA 2NPQA 2YISA 2W1DA 3EQBA 3C4CA 4OGRA 2HZIA 3KXHA 2X7GA 3C4XA 4NJ3A 4Y95A 5AUUA 2QG7A 3SV0A 2XNEA 4IJPA 4QTAA 2QOHA 3C13A 4GCJA 5BMSA 4BIEA 2R4BA 4I0TA 2UZDA 3DQXA 3PJ3A 5EW8A 4CYJA 4F7SA 5HVKA 5J8IA 1KE7A 2Z2WA 1FBNA 3K54A 5J1VA 2J0LA 1AGWA 4M68A 4HYHA 1REKA 4L8MA 4FZ7A 4D4VA 4EOMA 4UMPA 4AXAA 3R9OA 2C1AA 2BIYA 5CSVA 1M2QA 4DEEA 4I6HA 4FV0A 4IACA 4QQ5A 4CQEA 5IDPA 4DAWA 2BHEA 1SVEA 5KMOA 2YM6A 3PY3A 3NYNA 2EXCX 3AT2A 4FYNA 3CLYA 1YHVA 4X3JA 5FXSA 3R7GA 1BLXA 3MA3A 3AD5A 1FPUA 3POOA 2EB3A 3CIKA 3ERKA 5C4KA 1IAHA 5M4CA 4HCVA 5JH6A 1VR2A 2BZHB 3FMKA 4A9SA 4AW1A 3P7CA 5E8ZA 3DZQA 1W2FA 4RC4A 5C27A 2PZRA 3UDTA 2R0IA 2JDVA 4ZY6A 3R9DA 2G2HA 3HV3A 3D5XA 1H1RA 4FTQA 4W9XA 3LOKA 5DG5A 5HVJA 3ZLYA 1H0VA 4IE9A 1LEZA 3TUBA 2OICA 2VAGA 3AC1A 3IDBA 3TWJA 4NW6A 4M69B 4C33A 3ORNA 4G2FA 4EH5A 1V0PA 5LVOA 2JFLA 3W2OA 5JZNA 5CSHA 4QPAA 4ACCA 3OVVA 2OLCA 4IMYA 3R7UA 3NS9A 3EKNA 4IX6A 3CP9A 4OUCA 4ARKA 2R3NA 1KE5A 4FNWA 3HDNA 3LCTA 1FMKA 3QWKA 4IWDA 5IH6A 1OKYA 1IAJA 5M06A 4BI0A 4B6LA 2BALA 3IGGA 3NAXA 3ZFXA 3ELJA 3RMFA 4PMPA 4FSRA 4YNEA 5AA8A 1R39A 2W4OA 3R28A 4X3FA 2YJRA 4FSQA 2B9JA 3QF9A 5HI2A 3VS3A 1OIYA 3RPOA 3EQPA 4Z55A 3DOGA 3H10A 4CZTA 5FXRA 3PJCA 2PULA 4G3EA 3TJCA 3TDWA 3WZUA 2OW3A 4PPCA 1H1PA 4HCUA 3LFNA 2RIOA 4MBJA 4UBAA 4XLVA 4DTKA 5LVPA 3ODYX 4GU6A 4R7IA 5AR4A 3G15A 2GS6A 4O38A 4XOYA 3LFQA 3ROCA 3W0SA 4GUEA 4CZYB 5IEVA 4HPUE 3C50A 4KIQA 3E8EA 4JRVA 4X6QC 3UQFA 3I0QA 3EZVA 4QYHA 3GOKA 2ONLC 3OHTA 2R3QA 2WPAA 3GU6A 3NIZA 4K1BA 5E8VA 3RHXA 4C35A 1KV2A 1WBWA 3MSSA 3NW7A 4Q2AA 4YGAA 3TV4A 4ZTMA 3Q4CA 3VRZA 4AS0A 2O65A 2XK3A 3KMMA 3G2FA 4QYYA 2BHHA 3QZIA 4IAZA 4O0SA 4EI4A 2Q83A 5DOSA 3DB6A 2WOUA 5F4NA 1YDRE 3GC9A 1XR1A 3HP5A 4RFYA 5HZNA 4AAYA 4FT7A 4WUAA 4IX5A 4DC2A 3FL4A 3DBEA 1R0PA 3CPCA 5DMZA 5C8NA 3QQKA 3HKOA 4FTLA 4NT4A 3UDSA 3V5JA 3FZRA 3OT3A 2J6MA 2PVRA 3MDYA 3Q53A 5AP4A 2BFXA 5FDPA 3UQCA 2BAKA 2C0TA 5K0KA 4FR4A 4CLIA 4DGGA 4EZ5A 3PPJA 4WG5A 5DI1A 3F82A 3LMGA 3QXPA 4QMTA 3ZC6A 2E9PA 4NEUA 4O0XA 1H0WA 5CU0A 2JLDA 4D28A 2J9MA 5BVKA 3RAKA 2OBJA 3MBLA 5I9ZA 3QKMA 3NUAA 2ZV9A 3HMNA 3GCPA 3DBCA 4RX8A 3KIOC 2C47A 2J4ZA 1PXJA 2XP2A 2OU7A 2A19B 2JAMA 2W4KA 3QRKA 4G16A 4LYNA 3TXOA 4CTCA 4F1MA 3W0OA 1GZOA 2YWPA 4ZJJA 2HXLA 5CEQA 3SXSA 3PDTA 3I6WA 3ZM9A 2UZLA 1PXLA 1UA2A 3GC8A 3SAYA 4O27B 1YOJA 4FTIA 4WRGA 4X7QA 4AZWA 4LG4A 3PA4A 2OWBA 2UW3A 1WMKA 3ORIA 5AP0A 4ANOA 2R7BA 3NUPA 5CAUA 2PVLA 3P23A 5IKWA 3PPZA 4O1PA 3ZFYA 5TF9A 4DEGA 5KMMA 1WZYA 4YTHA 3VONA 2C4GA 4BBFA 4S31A 4IWOA 3OWJA 4M0YA 1K3AA 4FV9A 2OGVA 2BRBA 4XBRA 5A4QA 5BUIA 2VN9A 3DDQA 5CTPA 2XH5A 4RJ4A 3FI4A 3QKKA 2GQGA 4DINA 4ZY4A 3TTIA 3F3ZA 4AOTA 1Q8TA 3NUUA 2PYWA 1Y6AA 3QQJA 5AA9A 4MX9A 5HNGA 5ANOA 5FXQA 5GHVA 3ZSGA 4D2VA 4YO6A 4U9AA 1H1QA 3BHUA 4X21A 4S33A 3COIA 4KAOA 4NCTA 2ITZA 1KE8A 3FXZA 3C0GA 5TO8A 3EWHA 4ACDA 4UV0A 4DEAA 3WYYA 4O7WA 3NYXA 3R1QA 1PXPA 4N4SA 3DCVA 3ZRKA 1JKLA 2WMTA 4BCFA 3B8QA 2R3GA 1M14A 1YWNA 2BVAA 1M7QA 2I1MA 2XNPA 4NFMA 3U6IA 2B9IA 4ZLYA 2PVYA 1WBSA 5CLPA 4YZMA 2JBPA 2XKCA 4AT3A 4F6WA 4AZVA 4DFYA 2J0KA 4U8ZA 4EK6A 1FINA 2VUWA 3LM0A 2IW9A 1F3MC 2WIPA 2IVTA 2OIQA 4KWPA 3FMMA 4C4EA 3BGPA 4OTGA 4HGTA 4YSMA 4GJ3A 2XK9A 3TNPC 5DT4A 4F9CA 5L8JA 4B8MA 2VTTA 4FTMA 2GNLA 5I9WA 4DHZA 1OPKA 4HVDA 2OG8A 3DBDA 3P9JA 5KZIA 4RWJA 4LRMA 4HVGA 2IZSA 1YW2A 5HKMA 4U44A 2OZOA 3FQHA 3BELA 2C5NA 2OKRA 4ANBA 4P90A 3LM5A 2X6DA 2J5EA 2ESMA 4L7SA 4FZ6A 4F9BA 3OXZA 4XH6A 3GT8A 5M07A 4L53A 1YDSE 3IKAA 3LCKA 2DUVA 4QP4A 3RP9A 4LGDA 3VF9A 3R1NA 3O2MA 5EM5A 3PUFC 3K5VA 3OF0A 1WBVA 3KFAA 2RL5A 1OUYA 2JDRA 4QYFA 3VRYA 4FODA 1VLRA 2VU3A 3BHHA 4CCUA 2VO3A 5JKGA 4PMMA 3R9RA 4AXCA 1U46A 2R3JA 1YI4A 3GXLA 2ITXA 3GBZA 4IB3A 1TZDA 4YZ9A 2LGCA 5DRDA 4FVPA 4D58A 3NAYA 3PIXA 4K6ZA 4BB4A 1BX6A 3VS5A 4YJOA 1XBAA 3CD8A 5FM2A 4EUUA 4XG7A 2QODA 1GY3A 3MJ2A 3EN7A 4U3YA 2J90A 5HNIX 5DGZA 2SRCA 4UMTA 4NIFA 4M84A 5FD2A 3BYMA 3SC1A 4D2WA 4ORKA 2VNWA 4R3PA 3DV3A 3PJ2A 2F7ZE 2W1IA 3RAIA 5ACBC 3QZHA 3BCEA 4PTCA 3ZFMA 4C59A 1G8SA 2VTPA 2A2AA 1UU9A 4CVAA 3BEAA 1I09A 3S3IA 5LJJA 1Q4LA 4Q5EA 3F3UA 3TIYA 5EK7A 3RZBA 3TZ8A 4EKKA 1CKPA 4RX7A 4GKIA 4LOOA 5AUVA 3VW8A 5LVMA 2QO9A 3TTJA 1OM1A 3KEXA 4FL2A 3CC6A 3FI3A 3KRXA 2VWBA 3QA0A 3DK3A 3NW5A 2FA2A 4ALUA 4DGLC 4JJRA 3W8LA 4EOKA 4RFZA 3UO6A 2NRYA 3QFVA 3FUPA 3ZEWA 4PDYA 3IONA 3CGOA 2XS0A 3ROYA 4DDGA 3KQ7A 4H58A 2WHBA 3NNWA 2C5VA 3C4ZA 5HG5A 4WG4A 3GCSA 3O8TA 4PRJA 5B2KA 3MW1A 4DEIA 2PZ5A 4RWKA 3MH2A 4X3FB 3U6HA 4FA2A 3D7ZA 5KO1A 5FBNC 4AT5A 4EK5A 1H07A 5DR2A 1ZMVA 2WTCA 4IANA 4EH8A 5A6OA 5JZJA 1O6YA 1URWA 2C3JA 5EYKA 2VTOA 2X2LA 3JYAA 1XH5A 3EQHA 3QD3A 4JR7A 2YIYA 3TMOA 5FTQA 1W83A 3DKFA 4J53A 4MNEB 3HUBA 4IFGA 4GIIA 4NFNA 5EDRA 2UZEA 3H9OA 4GIHA 5EYCA 4G3CA 3MY1A 3QWJA 4EZ3A 5BNJA 3Q5IA 3QRUA 3WZJA 4ANSA 4MTAA 3BYVA 3H30A 4FKIA 2HYYA 5JT2A 3MVLA 4KBAA 3E8CA 4RFMA 3ZBXA 3BBTB 3KK9A 1U5RA 4DFUA 5KMNA 4R1YA 5KMLA 2IW6A 4NK9A 2J2IB 2X6EA 4U97A 4WIHA 2PE1A 3WF9A 2CGWA 3IECA 1KOBA 3HA6A 5A4LA 3UBDA 3HVCA 4JL9A 3MB6A 5ANIA 5FTOA 2VV9A 4TNBA 1JNKA 5CT7A 3KREA 4GFOA 4TRLA 3NPCA 5DRBA 4W4VA 4D1ZA 5K5XA 3MVJA 4YZDA 5HE0A 3UQGA 4CMTA 4FKWA 3LQ8A 2PUIA 3VF8A 2WQOA 4GYIA 3EFLA 5GIPE 4FI1A 2PZIA 3UE4A 1J7IA 4WRSA 2W99B 3HZTA 2RG6A 3EN5A 5A4EA 2G9XA 5CS6A 1V0OA 3I79A 3Q9YA 4A06A 3BBWA 1V0BA 3LCDA 4DF3A 4JIKA 1T46A 5FLFA 3U4UA 4FIIA 5M55A 4EOOA 2BRGA 1ZYSA 4IAKA 5JK3A 4AOIA 3W0PA 3L9LA 4QMUA 4IB0A 4LOPA 4E4MA 3U51A 4F1OA 3A4OX 4LRJA 3UZTA 2WGJA 1OIUA 4Q9ZA 5CANA 4GL9A 1NA7A 2W1FA 4YJNA 3REPA 2WB8A 4RIWB 4HZRA 2UZWE 1K9AA 3ZSHA 3CPBA 1NT2A 1ZRZA 4MQ2A 3VJNA 5HX6A 2QR7A 2X4FA 3ITZA 4U41A 5IQGA 2WTWA 5DR9A 5CZHA 3S1HA 4X2JA 4XX9A 5CWZA 3WI6A 3UDZA 2Z7RA 5EM7A 5J95A 4I94A 4MD7E 1WCCA 3WF7A 3FKOA 4BCGA 4BZDA 4IDVA 4HCTA 4OTQA 5LARA 1ZOEA 4PPBA 3ZC5A 4PDPA 5DLSA 4P2KA 5T6KA 2CSNA 2XARA 4DTAA 4TWPA 5D7VA 4QYGA 2XA4A 2YAKA 4MXXA 1PXIA 3KXGA 3G90X 3ORXA 4QEBA 5FDXA 5F95A 1OL5A 3F61A 2IN6A 3A7HA 3A60A 5HG8A 3EYHA 4QMZA 2VWVA 2YIQA 3ORTA 1W8CA 4DH8A 2YDKA 2QO2A 4CG9A 4WG3A 3ZBFA 4F0GA 4DBXA 4F09A 3OZ6A 4FKPA 3PZHA 4JBOA 3AGLA 5J87A 1TKIA 3WBLA 5KBQA 2YACA 2RFSA 4FL1A 1VZOA 5T68A 4MNFA 5EHOA 5H9BA 3ZDUA 3Q96A 3DBQA 4TYGA 4BIBA 5CALA 1UV5A 3W8QA 4XP2A 2QOLA 1U4DA 2WOTA 5TOZA 3UTOA 2NP8A 3EFJA 3RPSA 4RIYA 3CJGA 4XG4A 2VGOA 3BHYA 1M52A 2Y6MA 4OTDA 5IEXA 3NUYA 3MPTA 4GVAA 5AFVA 4JBQA 3DXNA 4D9TA 5AWMA 4L3JA 2C6KA 3NVMB 2JKOA 2DQ7X 4O4DA 2XK7A 1UWJA 3GGFA 3OCTA 4ID7A 4AA4A 4ZTLA 1UNHA 2PVKA 1W0XC 3FL5A 4S30A 4PL3A 5AP6A 4Z7GA 4UMUA 2CKQA 3UYSA 3BKBA 3R9HA 3RINA 3FLYA 4GFGA 4I6QA 4C0TA 5HO6A 4O7VA 2BFYA 4PP9A 4OW8A 2X0PA 3UP2A 4FKOA 2IF8A 2W9ZB 2A1AB 4K2RA 2ZVAA 2PTKA 2BAJA 1OMWA 3PIYA 5GZ9A 4C61A 4E4NA 4WNPA 3E62A 4O2ZA 1ZZLA 3AKKA 1PMUA 3QD2B 5DBXA 4XG3A 3DDPA 3SX9A 3E7OA 5IH4A 2XF0A 1VEBA 4FV1A 3I5NA 3TEIA 4OR5A 4EOLA 5IQCA 1WBNA 3GENA 3QBNA 3D94A 4BCNA 1Q8UA 3QXOA 3LQ3A 5CSPA 2FSOX 3W2SA 5HO7A 4BDKA 3W0QA 2UVYA 3M42A 4AACA 4QTEA 2ONLA 4GFMA 3KMUA 4GG5A 3QYWA 3KXZA 4ZJIA 4I24A 3RAWA 3V5PA 3ZUVA 3VQHA 5JFWA 5K4JA 3NYOA 4O2PA 2PZPA 5HBEA 1QPEA 3OWPA 1JKSA 4BFMA 3Q9WA 3QCYA 4GT5A 4JXFA 1JSUA 3MH1A 5AV4A 2QOQA 4DEDA 3FMDA 2XAOA 1YOMA 4E7WA 3CJFA 2EXMA 2WTIA 4AW2A 2ZB1A 3EYGA 4HNFA 4YPDA 2F7EE 5EH0A 1BL6A 1R3CA 2RFDA 2XEZA 2UZUE 5I9YA 3DTWA 1FVTA 5E8SA 5EM6A 4FYOA 4BR3A 5AX3A 4YNOA 3FEGA 3S2PA 3EMGA 4TWCA 3QQGA 1JSVA 3GU4A 2A0CX 3AC3A 2P3GX 3OMVA 3ANQA 4KA3A 2FSMX 4AGDA 5IQBA 1OECA 4E20A 2ZM4A 5CXZA 2AC5A 3QTXA 3LMIA 4CG8A 3ALNA 3CCNA 4DGOA 5L8KA 3PLAE 2OK1A 3RPYA 2W7XA 2VNYA 3IGOA 2BZIB 3SRVA 3RPRA 1ZYDA 3Q3BA 2Y6OA 3EZRA 4BDBA 2XKFA 5B2MA 1SM2A 2R3KA 4PX6A 3M1SA 4QP9A 3AMAA 4EYMA 4IVCA 2BILB 4M0ZA 2R3IA 3EFWA 3E63A 4IAIA 2FGIA 2WTKC 3TZ7A 4CMOA 3LCSA 1CSNA 1R1WA 5J79A 4ZZNA 3PSCA 4XUFA 4ASEA 4B9DA 2V7OA 2I7QA 4K9YA 4FTOA 4RWIA 4ZSGA 1BYGA 3NFFB 3KU2A 5ETCA 3G0EA 3W2PA 5M4FA 3DJ7A 3QRTA 3LXPA 4FV2A 1URCA 5CT0A 4ZXTA 3DNEA 4TY1A 4M66A 4DHJA 4CSVA 4CKIA 4GK3A 4QQCA 4UALA 3BU3A 2CGXA 3V8SA 1TFFA 4CFFA 3VUGA 3MIAA 4EK8A 1XH9A 4S32A 2BAQA 2OJJA 4LOQA 5IA2A 3IOPA 4QPMA 3EN4A 5FEDA 3VBVA 1A06A 2JDSA 4H36A 1HCKA 3A7GA 5DT0A 3ZXTA 1ZYJA 3OCGA 4KIPA 3HV4A