5CAOA

Egfr kinase domain mutant "tmlr" with compound 29
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
323
structure length
300
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELTSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYREEDMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Noncovalent Mutant Selective Epidermal Growth Factor Receptor Inhibitors: A Lead Optimization Case Study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 300
sequence length 323
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5caoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5caoA01
1IRKA 1GIHA 4NH1A 4EBWA 2WEVA 3OF0A 5EM8A 4EOLA 2WTKB 3R73A 5C27A 2QO9A 2UVYA 4GL9A 4O84A 3RPRA 2AC5A 2JKOA 4CCUA 3UODA 4K77A 3THBA 3FBVA 1H1PA 2CPKE 4IVDA 4N57A 4WO5A 4JR7A 2P55A 2Y8OA 5JZJA 1ND4A 3A4OX 1ZYLA 2QODA 2A1AB 3LFDA 3PVUA 3FMLA 4R3CA 3AC3A 2C6MA 4IE9A 4IANA 3I7BA 4F0FA 5CASA 1OBDA 2B9FA 4QOXA 2HK5A 2WIHA 3KXHA 4JX3A 4WHZA 3MFSA 1ZYJA 1WMKA 1RQQA 1IEPA 4FIEA 3KCKA 4JNWA 2W1GA 3NR9A 5AIRA 4A4XA 4B7TA 4UMUA 5JQ8A 4MXOA 2CGWA 4J53A 2J90A 3AT2A 1UKIA 2IW6A 2YAAA 4E1ZA 3UO5A 5CF6A 2GNJA 2WQBA 2X4FA 3OTUA 4W9WA 3NZ0A 2R3RA 3DKFA 2JC6A 3ZUTA 2R3IA 1QCFA 2QOOA 4GRBA 4ZLOA 3WZJA 3ZU7A 3OMVA 3CE3A 4X2NA 3EFWA 1FMKA 5AV1A 4F9WA 3MIYA 3Q5IA 3DLZA 3ZLWA 4BDAA 4KBCA 4ACDA 4AE9A 4BGQA 1FOTA 4KS8A 3U6JA 4TWCA 5HX6A 4QT1A 3TN8A 2J51A 4AF3A 4JDHA 3B8QA 4BF2A 1YHSA 3ZXZA 4CTCA 4DN5A 3IOKA 4RGJA 4MHAA 5C9CA 3WZDA 4X3JA 2O3PA 3KY2A 4FX3A 3LIJA 3Q9YA 5J95A 4JQ8A 4LRKA 3F3ZA 4NEUA 2JKKA 4PMMA 1PY5A 5LOHA 3UP7A 4YLJA 5AWMA 3Q9WA 3W8QA 2NO3A 4BI1A 4CRLA 4M0YA 4CLJA 4ITIA 2RSVA 2ZB0A 4FSZA 2CJMA 3VW8A 4ANOA 4APCA 4E6CA 3EH9A 4CMTA 2OK1A 1KE8A 3ORZA 2UZNA 2UZUE 4GG5A 4PP9A 5DBXA 2RKUA 4RLKA 4FL3A 1TVOA 3D15A 2X4ZA 2WMQA 4RPVA 1ZOHA 1PXMA 3PRFA 5CU6A 4BCGA 1GY3A 3QKKA 1PMNA 2XUUA 5AP4A 5JRQA 3TNIA 4MTAA 3P7AA 5AR5A 4OBOA 2IVTA 3DFAA 1YKRA 4FIJA 4JR3A 2W1EA 4PL4A 2UZEA 5DT0A 4FZAB 2OXDA 5K4IA 1SM2A 3ANRA 5HZNA 4IC8A 2R3NA 2UVZA 2BHHA 3EYGA 2V22A 2XK9A 3P7BA 1S9IA 5A4LA 4CZUA 3HEGA 3A2CA 4FKLA 4G2FA 2DYLA 4AAAA 4QNAA 4UX9A 4YO4A 4X0MA 4WNMA 3EN9A 4ASEA 3HV6A 4I5PA 5F20A 3W8LA 1UU9A 4GK3A 4JBQA 3IQ7A 1Q61A 5CALA 1KOBA 4R1VA 3HRBA 4MF0A 4DG3E 3QUEA 3BZ3A 3ET7A 2AC3A 2BZHB 2F57A 4Y83A 4CFNA 2G1TA 2WTCA 4K11A 3ZO1A 3FXXA 4IZ5A 4RT7A 2PSQA 2QLUA 3FHIA 3UJGA 2R64A 4ZJJA 4R5YA 2CN5A 3FKOA 3QXPA 1U54B 3OCTA 4BKJA 4ZZMA 4TXCA 5IG1A 3R63A 4ACGA 3VUKA 4TYHB 4XG9A 1B6CB 3GT8A 4DEHA 3B2TA 4IHPA 4RVKA 4E5AX 4F9CA 2XEZA 5M09A 5DVRA 1FPUA 4R3PA 1MRVA 3RVGA 4B0GA 4M8TA 4RC3A 3LJ0A 3AT4A 4QP4A 3TZMA 4FEXA 4D5HA 3MVHA 5HBJA 4YBKA 5B7VA 3LM5A 1U46A 3MWUA 3TIZA 3BI6A 4F9BA 5IDPA 1QPEA 4I21A 2XIZA 5E92A 3QBNA 5EW3A 5KO1A 4FK6A 1H8FA 3EFKA 5KKRB 4O81A 4MBIA 3QQHA 3DXPA 3M1SA 2FO0A 1SZMA 3LMGA 3MJ1A 3PY0A 2VWZA 3FZPA 2VTPA 4FV9A 3MFRA 5DT4A 3V6SA 3W33A 3FSKA 3EN7A 4ZTNA 3MN3A 3GGFA 3PXKA 3PP1A 3R8PA 5LVOA 2PZRA 1PMEA 3CKWA 4AFEA 5FEQA 4RJ8A 5HVYA 3MA3A 4MXZA 3T3VA 2XNEA 4TT7A 4KBKA 1IG1A 5HE3A 3ZO4A 3O96A 5ETFA 3KXGA 3V3VA 5BUEA 4PTGA 2PVJA 4MX9A 3ID6C 5M07A 4G6LA 4TNDA 3DT1A 3TIYA 3U6IA 3AT3A 3QUDA 3PG1A 4LUEA 4ACCA 4CG9A 4U42A 4WUNA 1AGWA 4RX8A 5CQWA 3FDNA 4D55A 3K54A 2QR8A 2C6OA 2V7OA 5D1JA 5FTOA 3W55A 3CPCA 2JD5A 4DGGA 5JK3A 3PVWA 4CG8A 4QTAA 3M11A 3KRRA 4QMVA 4ACHA 3C4ZA 5L6WL 5T68A 5JGDA 2VTNA 3G90X 4W4XA 3IOPA 4G17A 3IDCA 4Q9ZA 5LQFA 1UNHA 3F3WA 4QYEA 4XP2A 4J97A 4J95A 4P4CA 5HOAA 5HE1A 3F5UA 4G6NA 4EJNA 4D5KA 5CEPA 2EU9A 3I0QA 2WB8A 4CNHA 4IAFA 1TQPA 1ZYSA 2GS2A 2OJFE 1NW1A 1PYEA 3HL7A 1P4FA 4C34A 3RALA 5JFSA 4U3ZA 4QQ5A 3EQFA 2HY0A 4BDEA 5AUUA 4HGLA 4BKZA 3O50A 3UVRA 4DH1A 4YJSA 5EH0A 5FBOA 4RZVA 3U8WA 5BPYA 3ZOSA 1LP4A 3MTLA 3O23A 3SOAA 4BCPA 3GCSA 5CEKA 4A9TA 5ITAA 2VTTA 3PZEA 4KRCA 4E93A 5D12A 3E8EA 2OO8X 5CSWA 4FTOA 2XIYA 4NFNA 2WQEA 5DH3A 3KEXA 3VBTA 4FOCA 2XZSA 3DTWA 3OCBA 4U41A 5AR3A 4D4SA 1WBSA 2J0KA 1ZYDA 2R3MA 5KMJA 1YHWA 4NSTA 2W1IA 3EQDA 3OXZA 4CEGA 1JAMA 3P7CA 4FNWA 2Q0NA 5B2LA 3HMIA 5DE2A 4YHFA 2HY81 2FA2A 3LJ1A 4TY1A 4MBLA 2RIOA 4O0UA 3CXWA 4BZNA 1OKWA 3C4XA 1NT2A 5KUPA 4O6EA 5JMSA 3Q3BA 5A46A 1IAJA 5ANIA 3LCSA 3NX8A 3F3UA 5IMEA 1WFCA 3TV7A 3H0YA 2GNLA 2HXLA 4AW0A 5BYYA 2CSNA 3RAWA 1K3AA 4RVMA 3PXYA 3ZUUA 3BYVA 2HXQA 4GU6A 4TYIA 4NJDA 1PKGA 5B2KA 4G5JA 2O2UA 4X7QA 4BBFA 3OY1A 3QRKA 2Z7QA 3E7VA 5EYCA 3OEFX 2VO0A 3RTPA 3TCPA 3BGPA 2PZPA 2ETRA 5AV3A 3RINA 4UV0A 4ARKA 5EYMA 2QC6A 4DLJA 4RX5A 2GPHA 2XYNA 3OEZA 1XH9A 5LMAA 4B4LA 4D2SA 3F2AA 1ZOEA 3ITZA 3O8TA 3UOHA 3SG8A 4C35A 4AN2A 4R7BA 4TRLA 2C30A 4H3BA 2X6EA 2OIQA 4FEWA 3MJ2A 4FZDB 3ZLYA 4XOYA 4NL0A 4F6SA 4JJRA 3CIKA 3FKNA 2G9XA 2RG6A 3F5PA 3QTWA 4Y5QA 3SXRA 5FEDA 3V6RA 2G15A 4XV3A 3WF6A 3IW7A 3BKBA 2JLDA 3NW5A 2PZ5A 1P4OA 3ORMA 4I6BA 4KKHA 1OKZA 5HNIX 1ZRZA 2I0HA 1OUKA 4E4NA 3FZTA 3UVPA 3CEKA 3Q9XA 3MA6A 4FKOA 3V5LA 4J71A 2WO6A 4Y8DA 5FG8A 2Z8CA 5CEQA 3KRLA 5E8UA 1AD5A 4J8NA 4M84A 4IQ6A 3TEIA 3MV5A 3ZC5A 4C4IA 3G33A 3QHWA 5I3OA 5GZ8A 3OBJA 3MH1A 2UW0A 3ELJA 3FLWA 1H25A 3MBLA 3LXNA 3LFBA 5I9XA 4C57A 4GT4A 4BDBA 2PL0A 2V7AA 3MW1A 4WD5A 4MXXA 4GEOA 3FPQA 3DBCA 3GQLA 4DH3A 4EOJA 1XR1A 3R9DA 1Y8YA 2BZJA 5CZIA 4GFGA 5CEIA 2R3HA 5BVOA 3MDYA 3AGMA 3CGOA 3O51A 4FF8A 5I9UA 2AUHA 3RK7A 3GUBA 4RWLA 2GTMA 2VUWA 5E8WA 3WIGA 4BIEA 1OIQA 4LM5A 4KIKA 1REJA 3DZQA 3IS5A 5CXHA 4E4XA 3D7ZA 5AA8A 5HIBA 5JRSA 1GZ8A 4XHKB 4YJQA 3QD4A 5H8BA 4S32A 4BYJA 5GJGA 4H39A 4X21A 5HVJA 3UC4A 5C1QB 4F64A 3Q32A 1M2PA 3I81A 2EXEA 3QA0A 3RKBA 2LAVA 4ZSAA 4FKRA 3R8MA 2VTHA 2WU7A 2KTYA 3D7TA 3MESA 4YJTA 4IX6A 2P0CA 1KUTA 4KWPA 3S00A 3D4QA 1M7QA 4EKLA 4TPTA 2JBOA 5K9IA 2W4JA 2BRHA 2J0LA 5B2MA 4TW9A 3BEGA 2VX0A 4RFZA 3NIZA 1HCLA 3VF8A 2GNIA 3F3TA 4DEGA 1YXXA 4X3FA 4FKWA 5HU9A 4FV2A 3FYKX 4ZJVA 5IQIA 4ZTMA 1YWRA 4DG2E 2ITQA 4I0RA 2OLCA 3TNHA 4EWHA 3BPRA 2PE0A 4FBXA 4XUFA 4JQEA 4O22A 3L8VA 2WMTA 4P2KA 1DAWA 4IX5A 2HWOA 4L3PA 1QL6A 4IB1A 4WRGA 2Z7RA 4EI4A 4O1OA 3NNXA 5AJQA 3PPKA 4A9UA 3PJ3A 3A62A 4RJ7A 2J4ZA 5I9WA 4Q5HA 4RJ3A 2Y0AA 2HZ4A 2VU3A 3OROA 3RK5A 2OH4A 3VAPA 4BTJA 2BKKA 2J9MA 2VTLA 1ZLTA 3VS6A 3FZSA 4WBOA 3V51A 2G2HA 1Q4LA 3DAJA 3MFTA 3W32A 5J9ZA 2WTJA 3UPZA 4JBOA 4L53A 2JAVA 2VV9A 3FZOA 4ZTLA 1WBOA 3AC8A 5IMXA 4OTWA 2QVSE 3UNZA 4GT3A 3DJ6A 5M4UA 4D2WA 5FP5A 4GV1A 4FV6A 4NYEA 4LOPA 3FZ1A 5HO7A 3DOGA 4LG4A 3AC5A 5M56A 2OFVA 4EK6A 3S95A 5TE0A 3WILA 2ACXA 3T9IA 2YCQA 4NKSA 3CQUA 4OBPA 4XYFA 4HCUA 5KZ0A 5A4EA 2BFYA 1WBWA 2OGVA 4ERWA 2X7OA 5AV0A 4GG7A 4MEDA 4AT5A 4E4LA 2I7QA 3SXFA 4BR3A 5C4LA 3ZMMA 2CKPA 3O71A 3VUDA 4FTUA 4FZFB 2GNFA 3SA0A 1BUHA 4BTKA 4PPCA 2X8DA 2CNQA 4BDDA 4KIQA 3EN5A 1UV5A 2XNPA 4GK4A 3VRZA 3VUHA 2VWVA 5GJDA 5HG7A 4XJ0A 2FVDA 4JT3A 5ETCA 4TYGA 4FNYA 2YEXA 4K9YA 5EI6A 4AZEA 3UPXA 3DNDA 5CY3A 5AAFA 4PPAA 2BCJA 3Q4ZA 1QMZA 1J91A 3L1SA 4XV1A 2XVDA 3FI3A 4MQ2A 4RZWA 4XP0A 4FKJA 4YTFA 5LMKC 1UWHA 1Q8UA 3EQBA 1XHAA 4OT6A 3NUYA 3C0HA 2YCSA 5ANJA 5KMIA 3QUPA 5M4IA 2ITOA 4U0IA 4O7LA 4L8MA 3LFSA 5LVPA 2UZOA 4PNKA 3G5DA 5HGIA 2H8HA 2YM3A 5IF1A 2OJGA 5CU2A 3BHTA 2GHGA 4O83A 4JS8A 4YZNA 4EBVA 3IW4A 4YUQA 3DNEA 4D0XA 3SC1A 5HLWA 3PE1A 3NIEA 1H27A 4CKJA 4FTAA 3SRVA 5AIKA 2WMWA 4PMTA 3KMWA 5H9BA 2X1NA 2WTIA 3R9NA 4AZVA 3C5UA 1ZZLA 3VC4A 3A61A 5DOSA 3D5VA 3G0FA 4QO9A 4CLIA 4F1TA 3H3CA 3CLYA 4FIIA 3RBWA 1ZXEA 4QRCA 3PJ2A 3Q2MA 4X2FA 4X6RA 1H07A 3MPTA 4RIYA 4F7JA 5M53A 4MH7A 1KWPA 2YISA 3MPAA 3EN4A 2YFXA 2C3KA 3R0TA 4UXLA 3TZ9A 5AFVA 3ZEWA 4F4PA 1T45A 4I92A 4M3QA 4FKGA 4J8MA 4DEEA 4IAZA 2WMRA 2RFEA 3Q52A 4G1WA 2R3QA 3HYHA 3ORXA 4FL1A 4IDTA 3ORPA 3A8WA 1XBAA 4QQJA 5DN3A 5LWMA 1W8CA 5DIAA 4BCJA 5DT3A 3W1FA 2BZKB 5KMMA 3CQWA 3ORNA 5CF8A 2XNOA 2C6KA 5L2QA 1YOJA 3RZBA 4C37A 2PUIA 2PUNA 3TZ7A 3Q04A 4GIHA 5IZFA 4ZS4A 3IDBA 4EOPA 3U6HA 4PL5A 3BLQA 5CAPA 2A27A 2XB7A 3SGCA 2GS7A 3F88A 3PXFA 3ZYAA 4EH9A 5M06A 2QOCA 4AOJA 3FI2A 1BI7A 4DGMA 3R2BA 1U5RA 5EM5A 1YRPA 3NGAA 4BCIA 4M68A 3I0OA 3KA0A 2HENA 2PVKA 5DRDA 5AP7A 2QO7A 3ENMA 2VN9A 3QXOA 1QPCA 4Y73A 4YTIA 3TWJA 3UNJA 1Q8TA 4YO6A 3RAKA 5I0BA 5A9UA 4KIKB 1XBCA 2Z7LA 1H1RA 1ZY5A 4NU1A 4IAKA 4ZY5A 1WAKA 3L9PA 3HV4A 2OW3A 2JIVA 3MVJA 5KX8A 4B6LA 1H24A 3UO4A 4MQ1A 4WNOA 2XRUA 1F5QA 4FC0A 3QAME 5HKMA 2QD9A 2YN8A 4CVAA 4ID7A 4NCTC 1NXKA 1XH6A 4LFIA 2C6TA 4X2KA 3RCDA 3TZ8A 4BWXA 3NVMB 4JG7A 1T46A 4H05A 2Z2WA 4EHGA 5DYJA 3D7TB 5F1ZA 4ZIMA 3DS6A 1OBGA 4M15A 5E8XA 1RW8A 2YHVA 5JFWA 3KREA 1OPJA 5K0KA 1WBVA 2X8EA 4I24A 3QQGA 3FLNC 2JDTA 4WKQA 5EG3A 3SKCA 2QONA 3CPBA 3OOGA 4WG4A 2BKZA 3GNIB 5DFPA 4V04A 4PNIA 3OHTA 3BWFA 2G01A 4F1MA 5LXMA 2ZVAA 5D10A 2VWXA 2X0GA 4X3FB 3P23A 4HPTE 3LCTA 3FLQA 4Q5EA 5BVKA 1BLXA 2C3JA 3UVQA 4C3PA 2P4IA 5K0XA 2F7ZE 4QPAA 3C5IA 2JFLA 3W16A 2VO7A 3BV3A 2RFSA 2P3GX 2XKCA 3BRBA 3PJCA 4PX6A 4GW8A 4J99A 3GU5A 4CRSA 2UUEA 3OXIA 3W10A 3QGWA 1WBPA 3HECA 1J7LA 1UU8A 3WIKA 1PF8A 2R2PA 2B9JA 3BYMA 4L7SA 4RWJA 5LVLA 4W4YA 3F66A 1OM1A 4O0SA 3EQPA 3IKAA 4W8EA 5J8IA 4B8LA 5BVDA 3H0ZA 4NK9A 3A7GA 3FMMA 4BBMA 4MAOA 3R1SA 3O17A 4A9RA 4CYJA 2RL5A 3FY2A 4FZ7A 3BYOA 3HUCA 1H1QA 2J0JA 3G51A 1PXOA 4HCVA 4QP1A 2DQ7X 2HIWA 3VULA 4I23A 3HKOA 1O9UA 4AXAA 3GBZA 5JFXA 5L2SA 1OITA 3BHYA 3GB2A 4DH5A 5IA1A 3ZSIA 1I09A 4QMXA 4AE6A 4FKQA 1BYGA 4JX7A 1W84A 1DM2A 3LCDA 4P90A 3UQGA 1RJBA 2FSTX 4BKYA 1V0OA 2ITXA 2PVYA 2WU6A 2ZJWA 4CFWA 4EOIA 5JT2A 4E7WA 1H01A 3TUBA 5ANDA 1SNUA 1PJKA 2B55A 2X2LA 3Q5ZA 5AR4A 4ZK5A 3TT0A 2E9UA 2HAKA 3V8WA 4OAUC 3VJOA 2ONLA 4ZTHA 3LM0A 2PWLA 4BCHA 2IG7A 3KK8A 5AM7A 4U40A 2X2KA 4FTMA 4EH2A 5CEOA 3N4TA 3ZO2A 4YPDA 5KMLA 1J7IA 3ZM4A 5HCZA 4X2GA 3QZHA 4JLCA 5HCXA 5JGAA 3F5GA 3F6XA 3FV8A 4HOKA 4LOQA 4I0SA 2HZ0A 5EW9A 1PXLA 1W0XC 3RGFA 1FVRA 3DK7A 2GCDA 3HA8A 1E1VA 3E7OA 2XIRA 1CSNA 3OWPA 4C2WA 4YZDA 3GFWA 4QP9A 2PVMA 3JUHA 5G1XA 2UZBA 4Y46A 2ZV7A 2FSOX 3COMA 3PPZA 4U8ZA 4YTHA 4EK5A 4YHJA 5CI7A 2PMLX 4R7IA 3NUUA 3SOCA 3TG1A 4DYMA 4IDVA 4QPSA 2QR7A 3L8XA 3FC2A 3TUDA 3KL8A 3KN5A 3Q6UA 4MKCA 5E1SA 3V5QA 5KE0A 3WARA 4BB4A 4QMWA 5AP3A 4BRXA 3TUCA 5I9ZA 2ETKA 3T8OA 4CV8A 4YJOA 3TJDA 5ANKA 4FTTA 2JGZA 4IZYA 1YI6A 2Z60A 4JDIA 4RVLA 3M2WA 4QYHA 5IEYA 3OZ6A 2NNWB 5D41A 2YIWA 3OCGA 4XNEA 5AADA 2BDFA 3OD6X 5DWRA 3SD0A 1FBNA 2QHMA 1Q8WA 4ENXA 4LRJA 4IWDA 1H1SA 5HE0A 4C59A 4RJ6A 2BRBA 3SRVB 3HRFA 4JBVA 5I9YA 1P2AA 3A7HA 3C4FA 4ANSA 4ITHA 2QQ7A 1OL5A 4I6QA 1RE8A 4TYJA 3S0OA 2VTIA 5DGZA 3CTHA 4M97A 4E3CA 3UZPA 4DBXA 3TKHA 2UW7A 4D1ZA 3BLRA 4RIYB 5HE2A 5A54A 3UG2A 3P78A 4JQ7A 4DAWA 2GFCA 2GDOA 3QQLA 4H3PA 4CFVA 2W1ZA 4FKSA 3G0EA 5C8NA 4JRNA 5A6NA 3C13A 5IA2A 3TV6A 1Q8YA 3BX5A 3QLFA 2CN8A 3GCQA 4FSWA 4GCJA 4BHNA 4D4YA 2ZV8A 3BYUA 2C68A 3R71A 3R02A 1B39A 3GENA 4O7TA 5EI8A 4HW7A 3CD8A 1VR2A 3QQFA 3ERKA 4BYIA 4E26A 3MTFA 2C69A 3VBQA 4AOTA 3OTVA 3R8VA 2IVUA 4LMNA 3ZHPC 4DITA 3IECA 4KKGA 1M7NA 2W4OA 2PVHA 3KGAA 5DI1A 4ZSGA 3GC7A 4LGHA 2VWUA 3R8LA 4O21A 3DA6A 4RG0A 3SQQA 5FQDC 5H2UA 1YQJA 3NAYA 2QOQA 3I7CA 3LXPA 4ORKA 1GAGA 4RSSA 5G6VA 3UQCA 4OTHA 1X8BA 2QOHA 3FQSA 3AOXA 3F3VA 3BE2A 3OWJA 3MIAA 3QLGA 2Y4PA 3RP9A 3HDNA 3NW6A 3FL5A 3PUPA 4S2ZA 3R28A 1UKHA 2W4KA 3DTCA 2VAGA 2BAJA 2W9FB 3GU7A 5ANOA 3OT8A 3KXNA 3Q60A 5D7AA 5FGKA 4YZCA 4MBJA 4EH5A 3ZFXA 4DFXE 4DINA 4FTJA 3IONA 2P2HA 4JAIA 3HMNA 1MUOA 4S34A 2W5AA 3EQIA 4YR8A 3D83A 2E9VA 3PIZA 2OF4A 5AP1A 2ZMCA 3RAIA 2W5HA 4QQCA 3F9NA 5AP0A 4AW2A 3PJ1A 5IQGA 3QHRA 5HX8A 3T3UA 3FLSA 3PVGA 4GFMA 1UA2A 2UZWE 4QMQA 2QOFA 3H9FA 4HNFA 3ZRKA 3ATTA 3DJ5A 4F6WA 1YDTE 4FT7A 2JITA 3C4EA 4ASZA 4O0WA 4IWOA 5CEMA 3KF7A 3DKCA 3S2PA 3GC9A 4NM0A 4GUEA 4O0TA 1IA9A 2PTKA 3QQUA 4GU9A 4EHEA 2OBJA 1XO2B 2YM8A 2J2IB 2JAMA 3PLAE 4HYHA 3H9OA 3DXNA 2EWAA 2SRCA 1W82A 2ZDUA 3OW3A 3MGYA 3G9NA 5LWNA 3P79A 3AQVA 4IVCA 4RA5A 4C3RA 1Q99A 2B9HA 4ZY4A 5ETIA 2J0IA 4I5MA 2E9PA 3GCUA 5E8SA 5KMOA 3MH0A 2H96A 3B8RA 3LJ2A 3PA3A 4FSTA 3G15A 3TDVA 4O2ZA 4DFNA 4TTHB 4Z9LA 4AACA 3QRIA 4AGDA 1FVTA 4F09A 3GU4A 3KC3A 3VO3A 3C4WA 2I0YA 1HOWA 2ITTA 4GIIA 4A9SA 4AZWA 5BVNA 3PXRA 1OL6A 2W96B 1B38A 4G16A 3ZH8A 3V01A 3BLHA 3KF4A 2Y9QA 4KD1A 4O38A 4WUAA 4QTBA 4XCUA 4KS7A 4KAOA 4L52A 3FI8A 3VUMA 4WA9A 3ZUVA 3LQ8A 1UNLA 4I5CA 4RBLA 2C5XA 3DY7A 5FXRA 3U54A 2YA9A 3AC4A 5K5XA 4N6YA 1LR4A 2WEIA 2YJRA 4OTQA 4YHTA 2XS0A 3QGYA 1Q24A 3RPSA 5E9EA 2GQRA 4EQMA 4KIOA 5AR2A 1M2QA 2CCIA 4E8AA 2R5TA 4L3JA 1PMUA 4FR4A 2O63A 4N6ZA 3MPMA 1U5QA 1UU7A 3PTGA 5CX9A 5AX3A 5HCYA 4XG2A 2XKEA 2OIBA 1Q8ZA 2W05A 3R01A 4FUXA 4KNBA 4NW5A 5L8KA 3D5XA 2OKRA 2FGIA 3D14A 1MQ4A 4LUDA 3WF7A 2C1BA 4L42A 3VUTA 4LMUA 3KCFA 3OUKA 4H1JA 3COIA 4O7WA 3TNWA 3KMMA 4CCBA 1V1KA 4YU2A 4DLIA 3R1QA 3OY3A 5A4QA 3W2PA 3AGLA 4LGDA 1VEBA 4XBRA 3DDQA 3LFAA 2WIPA 4P5ZA 5ACBC 4AN9A 4EC8A 1OUYA 3O8PA 2FYSA 5FLFA 2WD1A 4GKHA 1YDSE 2YIRA 1YVJA 5TF9A 4C7TA 3ANQA 4FTNA 4RC2A 4CFUA 1HCKA 2CHLA 2X7GA 4MK0A 2XKFA 3BGZA 1KE9A 1M14A 3I60A 3FYJX 4LV5A 2YM5A 4I94A 2PULA 4UY9A 1PXKA 3KVXA 3R8ZA 4O7RA 2R0IA 4NW6A 3GEQA 2ITZA 4IWPA 5DRBA 4EQUA 2YITA 2RF9A 4G6OA 3QRJA 3C4CA 5JFVA 2YM6A 3FMNA 3RCJA 5HLPA 4MNEA 2UW9A 3ZCLA 3VBWA 4CD0A 2JKQA 3HRCA 4MD9E 2V55A 3UO6A 5AUTA 2PMOX 4MNFA 5FXQA 2I0EA 2PZYA 2NRUA 1SMHA 4CSVA 5J5SA 4EYJA 4F7SA 2C4GA 3LE6A 3PFQA 2R3FA 4OGRA 2UZLA 2H6DA 4PF4A 4LRMA 2B9IA 2XNGA 1MP8A 4WSYA 5EKOA 3V04A 3R7IA 4HYUA 3QCXA 2UZTA 4U43A 2ITUA 3R21A 4M14A 3RHKA 1YI3A 4RIXA 3VUIA 4B9DA 4F6UA 1PRYA 4RX7A 3NSZA 1P5EA 3WYXA 5E8VA 2HCKA 2VTQA 3LXLA 5HBEA 5CI6A 2UW4A 3GCPA 2W1CA 5CNNA 4BTFA 5TO8A 1KE7A 2R3JA 2R9SA 5L4QA 2WPAA 4U44A 5FD2A 4XP3A 5IH6A 4RFMA 4ASDA 4DTKA 1WVXA 3JS2A 5KMNA 4FEQA 4C38A 2BROA 2ITWA 3S1HA 1K2PA 3HVCA 2PZIA 4WSQA 3QA8A 4CT2A 4QP3A 5HEZA 4DTBA 3F7WA 2Y6MA 3C51A 2X81A 3I5NA 3LLTA 1Y8GA 1H28A 3LVPA 2YLEA 1YXSA 4FZ6A 4U81A 5AUVA 1ZARA 2VTSA 3E88A 5JZNA 4C2VA 4DF3A 4GUBA 4UMRA 4BIDA 4DHFA 3SVVA 2RFNA 4DEBA 2NPQA 4ZZNA 4FK3A 4F0IA 4KA3A 4C36A 4S30A 3COKA 3KXMA 4QMOA 1UVRA 2REIA 1NVRA 1OB3A 3QU0A 4EORA 3W2QA 2QKWB 4FT5A 4MXCA 4OTPA 3A7FA 3I4BA 4HNIA 4K1BA 4IB3A 5H8EA 5L6OA 4CXAA 3FZRA 3P1AA 5LJJA 4BWPA 2C6IA 3HV7A 5ACKA 2XH5A 2QO2A 4YJPA 2HWPA 3GCVA 4F7LA 4FVQA 2QOIA 4U7ZA 1E1XA 4WG5A 5CXZA 5C03A 4BCQA 4GJ2A 2OXYA 3ENHA 3FQEA 3NRMA 5AUWA 4K33A 4D1SA 4DFUA 3ZDIA 1CTPE 1R78A 2WTKC 2YDJA 2C6DA 3O2MA 4IADA 4YLLA 3OWKA 5F94A 4D58A 3NYNA 2OI4X 1J1BA 4R7HA 4EZ3A 5TR6A 1W98A 2WGJA 1XJDA 5EHYA 2QLQA 3PSBA 1CMKE 4ALWA 2OU7A 1AQ1A 3M42A 2XJ1A 4ZJIA 3C9WA 4ZTQA 4ZP5A 3FI4A 4RC4A 4C4HA 5IUHA 4QMLA 5IEXA 4PPBA 3TL8A 1BI8A 4NFMA 1H0WA 4GVJA 4IWQA 2CKQA 3RZFA 5A4TA 1G5SA 3F5XA 3QKMA 3QQKA 4QYYA 1BKXA 2B52A 3EJ1A 3GU6A 3SX9A 3TTJA 3OT3A 5AP6A 3L9LA 5DA3A 4IM3A 1K9AA 3FHRA 5EHOA 1GJOA 5BVEA 3R7YA 3FMEA 5FDXA 4AUAA 5T3QA 2HOGA 2CCHA 3TI1A 4I4EA 1APME 3CS9A 3GFEA 4UWBA 5JEBA 4PTEA 2XF0A 3ALOA 3BELA 3OS3A 5CF5A 5L2IA 3UIXA 3CGFA 4PTCA 5AR8A 1JSTA 3NNUA 5F4NA 1YOLA 2VTAA 4N0SA 2YWVA 4A07A 2WOTA 5DHJA 3ZSHA 3G6HA 4GVAA 4MVFA 4RWIA 2WXVA 3QFVA 4XOZA 1WCCA 4F7NA 4DG0E 2WMSA 4JL9A 5T6KA 2XK4A 1OI9A 2YWPA 4IX3A 2OJ9A 4CYIA 4BI2A 1LEZA 2GNHA 2PVLA 2QG5A 2ZDTA 4FYOA 5A4CA 3QD3A 3LOKA 1FVVA 3FLZA 4BC6A 3ZO3A 5J5TA 1FQ1B 3NDMA 4IJPA 2OJJA 2XM8A 5ICPA 4M12A 1URCA 2CGXA 3BHHA 1WVWA 3DBFA 3ROCA 3VBVA 3QTQA 2X9FA 4RX9A 4CFFA 2GHLA 4EOQA 2XNMA 2R3LA 3FUPA 4D1XA 1XH8A 3QTSA 4XRJA 4MXAA 5CSXA 5L6PA 2RFDA 4F1OA 3MB6A 4W4WA 5M4CA 3HDMA 4IM2A 3TKIA 2CLXA 2C5NA 3RHXA 4FGRA 5C8KA 2Y6OA 3IW6A 4L44A 4BTMA 5J7HA 5HTCA 2XMYA 2QOLA 4FTQA 3UG1A 5CSPA 2C0TA 3K5VA 3NUSA 3DV3A 2BRNA 4BZOA 4FG7A 4CV9A 3CP9A 4I6FA 4QP6A 4DEIA 2X6DA 4UB7A 2F7EE 5A3XA 2A4LA 4WIHA 4W8DA 4MNEB 4BFMA 1NVSA 1Q3WA 2VNWA 3MY0A 3WF9A 4AA0A 4BDJA 2Y4IB 2VWIA 1WBNA 4CTBA 4ONAA 5EQYA 1JBPE 1OVEA 4CZTA 4XEYA 4O0VA 4O7SA 2XA4A 2NRYA 3EYHA 3SHEA 3DBQA 3GI3A 4WT6A 1BL6A 4C4EA 2UW3A 2ITYA 3ETAA 4ITJA 4EOMA 1OIUA 3CTQA 3FXZA 2OZAA 3ZRMA 2XK8A 4TYEA 5CAQA 4IZAA 3L8PA 4RIXB 3WZKA 2OZOA 5HBHA 4G34A 4K8AA 3F2NA 3EN6A 3PXQA 1Q5KA 3G9LX 5HESA 5IQAA 4QP7A 2C6LA 4R5SA 3EQCA 4JI9A 2ZOQA 4YJNA 4UALA 4YJUA 2CGVA 3ZTXA 5HLNA 4I22A 3ZDUA 4DT8A 1XH5A 3GU8A 2VTRA 3A7IA 2OH0E 4YGAA 3DB8A 3N4UA 4KUJA 5AR7A 4KSPA 3NS9A 3ZRLA 4EYMA 2J0MB 3G6GA 3HMPA 2YDKA 4AGUA 5IH4A 2ZYBA 4KIPA 3GXLA 2V62A 4OTRA 1O6KA 5CNOA 5EOBA 3VS7A 3R9HA 3LFFA 4IVAA 3FE3A 4YURA 5AEPA 3KQ7A 4AGWA 4J96A 3AMBA 4W9XA 3MVLA 5KKRC 5BMMA 4YJVA 3BHUA 4UBAA 3SV0A 3Q2JA 4FKIA 4EK3A 2BHEA 3TM0A 3FPMA 3OVVA 4FSMA 4DEAA 5KHWA 1ZAOA 2CKEA 4CMUA 5C8MA 4CFMA 1REKA 3OFMA 3NUXA 5L8LA 4FT0A 1L8TA 3EWHA 4KRDA 4QTCA 4Y5HA 4YC8A 3HP5A 1YXTA 5IEVA 4QMYA 4UMPA 5IQHA 5CAOA 4PDPA 3VNTA 3EQHA 1GNGA 1GZNA 2YM4A 2EVAA 3E8DA 4N4SA 4QP8A 4C33A 4O7ZA 5GIPE 3MS9A 1G8AA 4XLIA 3ZLSA 3ODZX 4BWKA 2JDRA 4TWPA 4HVIA 3E62A 4M66A 3TNQB 3RJCA 5DNRA 4ASXA 4QTEA 4AFJA 4EOOA 3BU3A 4OT5A 1NA7A 4Y72A 2IW8A 5HD4A 2BFXA 3ACJA 4F70A 2QURA 4O6LA 1MQBA 4G3CA 4RMZA 2Q83A 4NTTA 3DJ7A 4C58A 3KN6A 3QL8A 3C7QA 3TTIA 3NNWA 1KV2A 2I6LA 4U5JA 1SVHA 2R7BA 2R0UA 5IPJA 4QD6A 1ZWSA 1XBBA 2YAKA 3II5A 5DR6A 4RA4A 1KE6A 4A9YA 5AV4A 5HHWA 3V5JA 2JDSA 3EQGA 1XQZA 3MH3A 5K3YA 1R39A 3VWAA 3ZBXA 4ZLYA 1ZY4A 5E8YA 2OIDA 4IMYA 5A14A 3E92A 2ITVA 4IB0A 5IH5A 2ZV2A 1OPKA 4O86A 5IA4A 1I44A 1MRUA 2GS6A 3C1XA 2R3KA 3QD2B 2J5FA 4K6ZA 3UOKA 4FNXA 2XCKA 3W2CA 4FOBA 2ONLC 5H3QA 3AMYA 2XNBA 3HMMA 2VO6A 3RI1A 3EKKA 4EC9A 4QMMA 4I5HA 4W4VA 5AAGA 5EYDA 3FQHA 5D7VA 1JKLA 1PXIA 5E91A 3FC1X 3BGQA 3JPVA 5B0XA 3S4QA 3TV4A 4ALVA 4I6HA 1URWA 4PWNA 2W9ZB 4KKEA 4PDOA 4BN1A 4E73A 4NKAA 2XIKA 3HX4A 4GJ3A 3PA4A 4C02A 3R7OA 4USEA 4JXFA 3L8SA 4FKTA 2OXXA 4C62A 3QF9A 3NYOA 3RPYA 1Z57A 3DKGA 5BYZA 3PSCA 1Q97A 2VX3A 3H4JA 4XG3A 2WTWA 4P5QA 4R77A 3PYYA 2GQGA 2HW6A 4Z55A 5M08A 4D28A 4FKUA 3KVWA 5EOLA 4D2RA 5JSMA 4GSBA 2B0QA 5CANA 4HGTA 5DEYA 3R6XA 1F3MC 3HNGA 2BZIB 1H0VA 3P5KA 4PL3A 1PHKA 2C1AA 3SXSA 3TKUA 4AA5A 4EL9A 4TWOA 4EUTA 3LKMA 4P7EA 3Q4TA 1R1WA 3QC9A 4NUSA 4QNYA 4S33A 2ZM1A 4XG7A 4FYNA 2PPQA 4L46A 4HVSA 5JGBA 5IQFA 3COHA 4AZTA 4FV7A 4AN3A 4ZEGA 4E5BA 2IO6A 4BDGA 2XRWA 3IG7A 5HG5A 4Q2AA 4XG8A 2C0OA 2PE2A 5HQ0A 2IZUA 3BV2A 4H1MA 3OXTA 3DBEA 4YBJA 3KRJA 3MY1A 4QMNA 2CNUA 2EXMA 2W1FA 2YLFA 3GQIA 4O0XA 2F2CB 1XH4A 4FIFA 4IEBA 4U80A 3HZTA 3OOMA 5EDQA 5L2WA 3PIYA 3U55A 2X2MA 4YC3A 4JG6A 4D0WA 4DGOA 1JKKA 4PY1A 3HV3A 3O7LD 4IM0A 4AX8A 4EWQA 2PVFA 5GINE 1Y6BA 4CKIA 4IACA 3QZGA 3VUGA 4FA2A 4YLKA 5AX9A 5BVFA 4MD7E 2VTMA 4XV9A 3SAYA 3EFLA 2C5YA 3MVMA 2J6MA 4FSRA 4I20A 5CVHA 1GZOA 2PUPA 2R3GA 3RWPA 1O6YA 4F99A 4C0TA 1G8SA 3PP0A 2OICA 4G9CA 4FEVA 2GTNA 1LPUA 2EB3A 2ZMDA 4TKSA 3GOPA 4HGEA 5EQEA 3GC0A 4AP7A 4Z7HA 1U59A 2VZ6A 4FT9A 3CBLA 4NCTA 5FEEA 2B4SB 3WE8A 4U79A 4DFBA 4BHZA 3A7JA 3EIDA 2BIYA 5KBQA 1XWSA 5M57A 3R7EA 3ZSGA 5I3RA 2PYWA 2VO3A 4C4JA 3RPVA 2WMAA 4UWCA 2WELA 3D5UA 2IJMA 3EHAA 3JVSA 3UZTA 3R9RA 3SLSA 2OZAB 3QWJA 2WKMA 5CT7A 1J7UA 2IZRA 4IH8A 4YNEA 4ZOGA 1JWHA 4M7IA 5FM3A 4CZYB 2C3IB 3OC1A 1Z5MA 3R30A 4I0TA 4IVBA 4NIFA 2V0DA 3QALE 3UTOA 2PU8A 1DI8A 3DCVA 4E4MA 2YM7A 3LPBA 3KMUA 2O8YA 4IJ9A 4BDKA 4EQCA 4ZSEA 4QYGA 3K5UA 2GSFA 2QI8A 2ZV9A 3EOCA 4XS2A 2BILB 4NM5A 5BUJA 3L9NA 4RLLA 1OL2A 2RG5A 4ZAUA 5HNBA 3QD0A 5E90A 4O82A 4C61A 4K2RA 3VHKA 3KULA 5C01A 1V0BA 4DC2A 2I1MA 1YDRE 2HZNA 2WQNA 5EM7A 5HO6A 1L3RE 4L68A 3DU8A 5CU3A 3CR0A 2F7XE 4M13A 1IASA 3NMUF 5HORA 1OKVA 5HU3A 4WRSA 3CTJA 3DK6A 3OG7A 4Y85A 1KSWA 5GJFA 4D9UA 3C50A 3PRIA 4RJ4A 3TJCA 3P4KA 4DE4A 5I9VA 5GZ9A 2O64A 4DCAA 1ZMVA 2F49A 2WQMA 3Q9ZA 3VS0A 2HELA 1IA8A 5AUZA 1VYWA 1FMOE 5FWKK 3W2OA 4BCFA 5EKNA 3AXWA 2BALA 2C3LA 3EZVA 4OLIA 4QMTA 3UMWA 1SYKA 4G31A 2IZSA 2EB2A 4XG4A 3VN9A 4Z3VA 3Q96A 2G2IA 1Q62A 3Q6WA 4QYFA 3F69A 2C6EA 5CYIA 5EK7A 3ULZA 3UQFA 1ZOGA 3IO7A 2W1HA 4EH3A 3FWQA 3N9XA 1YW2A 2YCFA 4I41A 4O2PA 1OL1A 3E87A 5L8JA 3V8SA 2UZVA 2ZM3A 1PW2A 4E6DA 1R0PA 4E20A 5E8TA 3V8TA 5BX0A 3B2WA 3PJ8A 3A60A 4HYSA 4LQMA 2UVXA 4CFXA 1LUFA 5IA0A 4YJRA 4ZTRA 2ITNA 3FJQE 5TT7A 3VIDA 4FTCA 4G5PA 1QPDA 5CQUA 3UMXA 2I40A 4BDCA 5HO8A 5C26A 5JH6A 4AG8A 2G2FA 4BCMA 4ACMA 3PPJA 4QMUA 4L67A 4IBMA 4MF1A 3R8UA 2IZTA 4GYGA 4ANNA 2ERKA 2XK6A 2YIQA 4TWNA 5HIEA 5IDNA 3ZFMA 4USFA 1KE5A 3EKNA 2A19B 3FMHA 4UXQA 2XEYA 2YABA 2H9VA 2R3OA 2W7XA 3D2IA 3UDBA 3DPKA 4BIBA 5JN2A 2PHKA 4L6QA 5FTQA 5K5NA 3LLAA 3F82A 4RFYA 4FV3A 1ZMUA 2CLQA 3NEWA 1OIRA 3PSDA 2PE1A 4JVGA 4ALUA 3O7LB 1EH4A 2YDIA 1PXJA 1Y91A 2VTJA 4DBNA 4EONA 3K2LA 3JYAA 1YOMA 1WVYA 3AC2A 4DFZE 3MI9A 4MWHA 2A0CX 4LI5A 2QU6A 1UU3A 4USDA 1PXPA 5E7RA 3VF9A 3OBGA 3BQRA 1M2RA 2PK9A 2QHNA 1DI9A 3JY9A 3ORIA 4NM7A 3WF5A 4EH7A 2JFMA 4HVDA 5F9EA 1H08A 4LL0A 3DLSA 3C0GA 2DWBA 5BMSA 2BVAA 4IC7A 3R9OA 5E4HA 5HTIA 4EEVA 2WNTA 4U6RA 3KRXA 2XBJA 5GHVA 3WOWA 2EUFB 3BIZA 3E63A 4KSQA 4FV8A 4OTIA 5FBNC 2R4BA 5J7BA 4M67A 1V0PA 2BIKB 4FICA 4OUCA 4BCNA 3NVKI 4GYIA 1KV1A 5HIDA 3FSFA 3PIXA 3IK3A 2GNGA 2JBPA 3WZUA 5FP6A 3VS3A 4APPA 2F2UA 3LCKA 2BMCA 4OTGA 3VBYA 1YHVA 4C4GA 3LQ5A 3R7GA 4CQEA 2Y4IC 3CC6A 4GMYA 3E3BX 4EZ5A 2OFUA 4H58A 5E8ZA 4U9AA 2YJSA 4RQVA 4FSYA 5CSHA 4BZDA 2OJIA 2JIIA 3N51A 4HZRA 3ZC6A 4QPMA 5HG9A 3JY0A 4KINA 3F61A 4XV2A 4R1YA 4D2VA 4J52A 5CT0A 3FLYA 4FSUA 1JQHA 1RDQE 1U4DA 4JBPA 4O0YA 3A4PA 5JQ5A 1YWVA 3H30A 1Q41A 2WMXA 3FKLA 5BNJA 4GH2A 1WBTA 4PDSA 4KABA 4DGLC 4JRVA 3KXZA 5FUTA 3V5WA 2J50A 4ANBA 3NPCA 2X8IA 1O6LA 3BU5A 4CT1A 4AGCA 3E3PA 4FV0A 4FV1A 3DGKA 3QC4A 4FGBA 4U3YA 4ZSJA 4HZSA 4FIGA 1JSVA 3HMOA 4WNPA 3LAUA 4G3GA 3BE9A 1XKKA 3JVRA 1JPAA 2VGOA 2XK3A 3E93A 4EKKA 3LQ3A 4BICA 3Q4UA 4HYIA 4G9RA 3UP2A 4G3EA 4HPUE 2V5QA 3OWLA 2YERA 4RVTA 5AAEA 5EDRA 3QYWA 5I4NA 3TNPC 3PWYA 3TDWA 2Z7SA 4AT3A 3R2YA 2ZAZA 2VD5A 5F95A 5AUYA 4NT4A 1IR3A 1DAYA 4XRLA 4EUUA 3QCYA 3OP5A 1BX6A 3GP0A 3GVUA 3NYVA 4GK2A 4YP8A 5CVFA 2Z02A 3DB6A 4N70A 1J1CA 2WFYA 3KB7A 3EZRA 5CVGA 2B1PA 4NM3A 5LVNA 5BQ0A 4WOVA 5DMZA 4FSNA 4NIFB 5IA5A 4EZ7A 3U9CA 1OPLA 5KCVA 2QOKA 5ETAA 5M4FA 4GT5A 2XNNA 2XM9A 3HV5A 3NWWA 5AA9A 2UW6A 5IA3A 1PXNA 4EK4A 5FXSA 2VX1A 5IQCA 3FMKA 4MXYA 2WTDA 4PMSA 3VS2A 4IX4A 4XBUA 4I1ZA 4IAYA 2A2AA 4I3ZA 2O0UA 3KULB 4FSQA 4D4RA 1W83A 4IFCA 4EJ7A 3POZA 4YZBA 2KULA 2XIXA 2WMUA 3KKVA 4IXPA 4JG8A 4BBEA 5TOZA 2XJ0A 4G3FA 3KXXA 3MFUA 4BI0A 4PRJA 2OWBA 4IB5A 4PQNA 4UMQA 1R3CA 4YTCA 2OSCA 3ORTA 2O5KA 4F9YA 3NCZA 4IIRA 1OZ1A 3MSSA 5EFQA 2PUUA 1PKDA 3R83A 3HUBA 2X7FA 1JKTA 5CU0A 1ZZ2A 3R22A 3R1NA 4EHZA 3DKOA 3AMAA 3QCQA 3QWKA 2JEDA 5LMBA 4FEUA 2BDWA 3QRUA 2PMNX 2ZM4A 3H9RA 4ZTSA 2FSMX 4M0ZA 4O91A 5DLSA 3RNIA 3LCOA 4DT9A 3RAHA 4BY9E 2PY3A 2YIXA 3SW4A 2EXCX 3UBDA 3UC3A 2LGCA 4ZZOA 5J9YA 3DXQA 5CWZA 2IW9A 3ALNA 3EL8A 5BVWA 2UV2A 4U45A 4QMZA 4I93A 4AA4A 2WAJA 5EDPA 3DBDA 4V0GA 3Q53A 4MWIA 4FTKA 4YSMA 3K3IA 3ZEPA 4Z16A 2WZJA 3V5PA 5L2TA 4X3FC 3FEGA 3BHVA 4AW5A 3LZBA 1Y6AA 2WTVA 4YC6A 4O7VA 4UZHA 4AS0A 3AD4A 3NUNA 2UZDA 3CJFA 3D9VA 4DEDA 3UNKA 2IVSA 5LCKA 5CS6A 3CSVA 5GIOE 4EK8A 4EH4A 2XKDA 3U9NA 5DR9A 5DG5A 3FL4A 4XX9A 3PY3A 1CDKA 3LFCA 2JDVA 2WMVA 3EFJA 3QTZA 3DAEA 4KB8A 4BDFA 4OAVB 2HYYA 1STCE 3FMDA 4HJOA 2ITPA 3SW7A 2W5BA 4I4FA 4ZXTA 5BYLA 4F0GA 3QTXA 4FODA 4FUYA 3AD5A 4DH7A 5KNJA 4J7BA 2FH9A 5CSVA 1OIYA 4UN0C 2WOUA 4BCOA 3DQWA 3CY2A 5EYKA 2NP8A 3QCSA 4KBAA 3GC8A 3CY3A 5DPVA 3UOLA 4ZSLA 5AM6A 3ZBFA 2W17A 5E1EA 3BQCA 4X6QC 3UIUA 3WBLA 3AC1A 4FVPA 5IKWA 5IUIA 4L01A 5TKDA 4D4VA 4YSJA 4BDIA 4QTDA 4XLVA 4O1PA 2FSLX 1A48A 5GZAA 4V05A 4OTDA 4AQCA 1QPJA 2CMWA 3ATSA 3ACKA 4M69A 3D94A 4FTLA 5EHLA 3NUPA 4EH6A 2QU5A 1XH7A 3P9JA 1CM8A 1H4LA 5CF4A 3HP2A 3MYGA 1FGKA 5BUIA 2YCRA 5AUXA 3NCGA 5HICA 4F63A 3MB7A 2W99B 4ENYA 3PDTA 1R0EA 3PZHA 4G3DA 2ERZE 4DA5A 4IAAA 3PWDA 2F4JA 4RWKA 4PP7A 4GFOA 4FI1A 3PLSA 1H26A 4RRVA 5IQBA 1FGIA 2OF2A 3VJNA 1GZKA 5EM6A 4V01A 3VS4A 3VW6A 3EMGA 4F9AA 3NW7A 5CENA 4HGSA 3E8NA 1GIJA 5AP2A 1SVEA 4LL5A 4A7CA 4C3FA 5IUGA 1P14A 3CJGA 3AD6A 3LFEA 2AYPA 4U97A 2BDJA 2CDZA 4FTIA 3UYTA 1F0QA 2E2BA 1TQIA 3KU2A 3LFNA 4TNBA 4IW0A 3ZLXA 4AZSA 4BDHA 3JR1A 2BUJA 3U51A 4O0RA 2YZAA 3WE4A 5D9HA 3A8XA 4DFLA 3BU6A 3NUAA 1YI4A 1OKYA 1YWNA 5AP5A 3TACA 4OTFA 5IQDA 2WQOA 4UZDA 3P08A 3RPOA 1M17A 1PYXA 4FE2A 3A99A 4TL0A 2ZB1A 1JSUA 1MRYA 3MY5A 3ZS5A 4CMOA 3IW5A 5J79A 5ANEA 2BPMA 2YIYA 3QYZA 3QZIA 2FUMA 2P2IA 3GOKA 1A9UA 4IZ7A 2BRGA 4J98A 4TN6A 5J87A 3VHEA 2PVNA 3VQUA 4ERKA 3ZZWA 3R7VA 1BMKA 4FL2A 4FG8A 4PUZA 1JVPP 4EOKA 5HNGA 3DDPA 2JDOA 4L43A 3LFQA 3WZEA 5KBRA 4A4LA 1JLUE 4QMPA 3QTUA 5I5ZA 5FTGA 4RIWA 3Q4CA 3S3IA 1M52A 4UEUA 2HZIA 3QQJA 4EOSA 3H10A 1Z9XA 3K3JA 4CKRA 4AOIA 3EL7A 3NYXA 3IW8A 4R3RA 4WNKA 5CTPA 4E6QA 5M44A 3HAMA 3I1AA 5EQPA 4DTAA 3E8CA 5C4KA 1OMWA 3W2RA 4ZLZA 3VQHA 4S31A 2QNJA 1A06A 3BCEA 3VS5A 2QKRA 5DR2A 3PE2A 2E9OA 3QZFA 4E5WA 4B99A 3ORLA 1ERKA 4JIKA 4AW1A 4B8MA 1GOLA 4JIAA 5IU2A 3TXOA 3UYSA 3E5AA 3EQRA 5J9LA 2QG7A 2YZLA 1Y57A 1IAHA 1JNKA 3CQEA 4LYNA 3BBWA 4CQGA 4AWIA 1CKIA 5CAVA 2IPXA 2PVRA 4LGGA 3ZM9A 4TZRA 4FG9A 3R1YA 2VGPA 4ZMEA 3RMFA 3ZXTA 4A4OA 3ZFYA 4NTSA 4YZMA 2BAQA 1CKJA 2BAKA 4C8BA 2VWBA 2JIUA 2RGPA 3P86A 4WBBB 1G3NA 3LW0A 2O65A 2PMIA 4FT3A 3O0GA 5ANGA 5LVMA 2X9EA 4O7NA 3L9MA 4UYAA 5FM2A 4YNOA 2XCHA 3DFCB 1JKSA 3KRWA 3RK9A 2CNVA 2WHBA 3UOJA 4DH8A 2QOBA 4WG3A 1SVGA 1PMVA 3FMJA 2VNYA 2R7IA 4OBQA 2ESMA 5KMKA 4MYGA 3U4WA 5LCJA 4O7YA 3FAAA 2WMBA 3OW4A 2BRMA 3UE4A 1UWJA 2F9GA 1YXUA 4HCTA 3FY0A 5GNKA 3REPA 5L3AA 2B7AA 4FKPA 5DEWA 3VBXA 1VYZA 3QX4A 2W1DA 3UZRA 5AV2A 3NNVA 4UMTA 3PY1A 4UYNA 4V0GB 4MD8E 3WF8A 5CU4A 2CGUA 4EHVA 4R8QA 4QMSA 5M55A 2XJ2A 3DK3A 4UWYA 2IVVA 4RIOA 1JOWB 3HLLA 3QX2A 4O27B 3ROYA 3OCSA 2C47A 4X2JA 3PVBA 2XYUA 2ETMA 4FKVA 2VWYA 3I6UA 1NY3A 3PA5A 2QCSA 3IPHA 1NVQA 3LXKA 1VZOA 1OECA 1CKPA 3RM7A 5K4JA 3CCNA 2J5EA 2X39A 4BGGA 3DZOA 5HD7A 3QRTA 2B53A 4YMJA 2Q0BA 4K18A 4Y95A 5HI2A 2C5OA 2GQSA 2VWWA 4BCKA 4PDYA 4GKIA 2OG8A 3VS1A 5J1WA 5HG8A 1UNGA 4BL1A 4H36A 4DFYA 3LMHA 5IQEA 5D11A 4ZMFA 4L00A 2C5VA 1DS5A 1H1WA 2JKMA 4FV4A 4YPSA 1LEWA 3UIBA 3NAXA 3D0EA 4JDKA 3U4UA 2P33A 4J1RA 3ORKA 2BTRA 5CZHA 5FDPA 3SDJA 4BVUA 4FIHA 4E6AA 5KHXA 3PXZA 5LARA 5M51A 2BR1A 3UGCA 4Q9SA 3QTRA 4IAIA 2E9NA 4FVRA 3RWQA 5J1VA 4HVGA 1SNXA 3I6WA 2BTSA 5H8GA 4AT4A 3HAVA 1ZMWA 5HTBA 1J3HA 3IGGA 5KZIA 1S9JA 5LMKA 4PV0A 2UW5A 1E9HA 3R04A 3I5ZA 4LOOA 1KOAA 3VRYA 2XBAA 2IWIA 5FRIA 3KK9A 4ZS0A 4DCEA 3OUNB 4M69B 4ANQA 2XP2A 3BEAA 3DQXA 4MCVA 4ANMA 3LMIA 2YACA 3HGKA 3VVHA 1YXVA 4ANLA 1U54A 2UW8A 2W06A 3CKXA 4II5A 3LHJA 4XMOA 3U87A 3WYYA 4F65A 5CAUA 5IISA 3P0MA 4OR5A 3G2FA 4D2PA 3UIMA 3N4VA 4XG6A 1GIIA 2W0JA 5A6OA 2DUVA 3BYSA 4TYHA 4OW8A 1TKIA 3O8UA 3QTIA 4RJ5A 4QP2A 3AG9A 4NZWB 1WZYA 4D2TA 3D5WA 1W7HA 3FXWA 4JAJA 4LV8A 4FNZA 4GS6A 4XH6A 2GFSA 3CD3A 4JOAA 4AZFA 3IDPA 2C0IA 3QKLA 4L7FA 4EH8A 2VTOA 5EI2A 1ZYCA 3SG9A 2GMXA 3R7UA 3DAKA 2R3PA 3RM6A 1VJYA 3ZONA 3IGOA 4F08A 3I79A 4Z7GA 3PG3A 3NLBA 4DGNA 3W2SA 4H3QA 4L3LA 3ZZEA 2J7TA 1FINA 4L9IA 1TQMA 4D9TA 3KFAA 2B54A 4HVHA 3E64A 3MH2A 4FV5A 3R00A 4AU8A 3JXWA 2IN6A 4L45A 4K0YA 4C4FA 4O96A 4PMPA 4RQKA 3C0IA 3BBTB 2FB8A 4JDJA 4R6VA 5AMNA 2XK7A 1OL7A 4NWMA 2H34A 3ODYX 4YZ9A 4NJ3A 4FMQA 4CGAA 4FTRA 4R78A 3EB0A 1BL7A 2Y7JA 1H00A 1Q3DA 3BWJA 3D2KA 4QQTA 2DS1A 3POOA 3HA6A 4ZY6A 3ULIA 5JKGA 2HW7A 5EW8A 5HVKA 2I0VA 5CLPA 2VRXA 1OGUA 3F7ZA 4A06A 2CKOA 4RIWB 3F2RA 2GHMA 4IFGA 3T9TA 3W18A 4BGHA 2GU8A 3V5TA 1ATPE 3WI6A 3RNYA
chains in the Genus database with same CATH superfamily
1IRKA 1GIHA 4NH1A 4EBWA 2WEVA 3OF0A 5EM8A 4EOLA 2WTKB 3R73A 5C27A 2QO9A 2UVYA 4GL9A 4O84A 3RPRA 2AC5A 2JKOA 4CCUA 3UODA 4K77A 3THBA 3FBVA 1H1PA 2CPKE 4IVDA 4N57A 4WO5A 4JR7A 2P55A 2Y8OA 5JZJA 1ND4A 3A4OX 1ZYLA 2QODA 2A1AB 3LFDA 3PVUA 3FMLA 4R3CA 3AC3A 2C6MA 4IE9A 4IANA 3I7BA 4F0FA 5CASA 1OBDA 2B9FA 4QOXA 2HK5A 2WIHA 3KXHA 4JX3A 4WHZA 3MFSA 1ZYJA 1WMKA 1RQQA 1IEPA 4FIEA 3KCKA 4JNWA 2W1GA 3NR9A 5AIRA 4A4XA 4B7TA 4UMUA 5JQ8A 4MXOA 2CGWA 4J53A 2J90A 3AT2A 1UKIA 2IW6A 2YAAA 4E1ZA 3UO5A 5CF6A 2GNJA 2WQBA 2X4FA 3OTUA 4W9WA 3NZ0A 2R3RA 3DKFA 2JC6A 3ZUTA 2R3IA 1QCFA 2QOOA 4GRBA 4ZLOA 3WZJA 3ZU7A 3OMVA 3CE3A 4X2NA 3EFWA 1FMKA 5AV1A 4F9WA 3MIYA 3Q5IA 4AXCA 3DLZA 3ZLWA 4BDAA 4KBCA 4ACDA 4AE9A 4BGQA 1FOTA 4KS8A 3U6JA 4TWCA 5HX6A 4QT1A 3TN8A 2J51A 4AF3A 4JDHA 3B8QA 4BF2A 1YHSA 3ZXZA 4CTCA 4DN5A 3IOKA 4RGJA 4MHAA 5C9CA 3WZDA 4X3JA 2O3PA 3KY2A 4FX3A 3LIJA 3Q9YA 5J95A 4JQ8A 4LRKA 3F3ZA 4NEUA 2JKKA 4PMMA 1PY5A 5LOHA 3UP7A 4YLJA 5AWMA 3Q9WA 3W8QA 2NO3A 4BI1A 4CRLA 4M0YA 4CLJA 4ITIA 2RSVA 2ZB0A 4FSZA 2CJMA 3VW8A 4ANOA 4APCA 4E6CA 3EH9A 4CMTA 2OK1A 1KE8A 3ORZA 2UZNA 2UZUE 4GG5A 4PP9A 5DBXA 2RKUA 4RLKA 4FL3A 1TVOA 3D15A 2X4ZA 2WMQA 4RPVA 1ZOHA 1PXMA 3PRFA 5CU6A 4BCGA 1GY3A 3QKKA 1PMNA 2XUUA 5AP4A 5JRQA 3TNIA 4MTAA 3P7AA 5AR5A 4OBOA 2IVTA 3DFAA 1YKRA 4FIJA 4JR3A 2W1EA 4PL4A 2UZEA 5DT0A 4FZAB 2OXDA 5K4IA 1SM2A 4F78A 3ANRA 5HZNA 4IC8A 2R3NA 2UVZA 2BHHA 3EYGA 2V22A 2XK9A 3P7BA 1S9IA 5A4LA 4CZUA 3HEGA 3A2CA 4FKLA 4G2FA 2DYLA 4AAAA 4QNAA 4UX9A 4YO4A 4X0MA 4WNMA 3EN9A 4ASEA 3HV6A 4I5PA 5F20A 3W8LA 1UU9A 4GK3A 4JBQA 3IQ7A 1Q61A 5CALA 1KOBA 4R1VA 3HRBA 4MF0A 4DG3E 3QUEA 3BZ3A 3ET7A 2AC3A 2BZHB 2F57A 4Y83A 4CFNA 2G1TA 2WTCA 2X0PA 1ST0A 4K11A 3ZO1A 3FXXA 4QDEA 4IZ5A 4RT7A 2PSQA 2QLUA 3FHIA 3UJGA 2R64A 4ZJJA 4R5YA 2CN5A 3FKOA 3QXPA 1U54B 3OCTA 4BKJA 4ZZMA 4TXCA 5IG1A 3R63A 4ACGA 3VUKA 4TYHB 4XG9A 1B6CB 3GT8A 4DEHA 3B2TA 4IHPA 4RVKA 4E5AX 4F9CA 2XEZA 5M09A 5DVRA 1FPUA 4R3PA 1MRVA 3RVGA 4B0GA 4M8TA 4RC3A 3LJ0A 3AT4A 4QP4A 3TZMA 4FEXA 4D5HA 3MVHA 5HBJA 4YBKA 5B7VA 3LM5A 1U46A 3MWUA 3TIZA 3BI6A 4F9BA 5IDPA 1QPEA 4I21A 2XIZA 5E92A 3QBNA 5EW3A 5KO1A 4FK6A 1H8FA 3EFKA 5KKRB 3TMOA 4O81A 4MBIA 3QQHA 3DXPA 3M1SA 2FO0A 1SZMA 3LMGA 3MJ1A 3PY0A 2VWZA 3FZPA 2VTPA 4FV9A 3MFRA 5DT4A 3V6SA 3W33A 3FSKA 3EN7A 4ZTNA 3MN3A 3GGFA 3PXKA 3PP1A 3R8PA 5LVOA 2PZRA 1PMEA 3CKWA 4AFEA 5FEQA 4RJ8A 5HVYA 3MA3A 4MXZA 3T3VA 2XNEA 4TT7A 4KBKA 1IG1A 5HE3A 3ZO4A 3O96A 5ETFA 3KXGA 3V3VA 5BUEA 4PTGA 2PVJA 4MX9A 3ID6C 5M07A 4G6LA 4TNDA 3DT1A 3TIYA 3U6IA 3AT3A 3QUDA 3PG1A 4LUEA 4ACCA 4CG9A 4U42A 4WUNA 1AGWA 4RX8A 5CQWA 3FDNA 4D55A 3K54A 2QR8A 2C6OA 2V7OA 5D1JA 5FTOA 3W55A 3CPCA 2JD5A 4DGGA 5JK3A 3PVWA 4CG8A 4QTAA 3M11A 3KRRA 4QMVA 4ACHA 3C4ZA 5L6WL 5T68A 5JGDA 2VTNA 3G90X 4W4XA 3IOPA 4G17A 3IDCA 4Q9ZA 5LQFA 1UNHA 3F3WA 4QYEA 4XP2A 4J97A 4J95A 4P4CA 5HOAA 5HE1A 3F5UA 4G6NA 4EJNA 4D5KA 5CEPA 2EU9A 3I0QA 2WB8A 4CNHA 4IAFA 1TQPA 1ZYSA 2GS2A 2OJFE 1NW1A 1PYEA 3HL7A 1P4FA 4C34A 3RALA 5JFSA 4U3ZA 4O4DA 4QQ5A 3EQFA 2HY0A 4BDEA 5AUUA 4HGLA 4BKZA 3O50A 3UVRA 4DH1A 4YJSA 5EH0A 5FBOA 4RZVA 3U8WA 5BPYA 3ZOSA 1LP4A 3MTLA 3O23A 3SOAA 4BCPA 3GCSA 5CEKA 4A9TA 5ITAA 2VTTA 3PZEA 4KRCA 4E93A 5D12A 3E8EA 2OO8X 5CSWA 3P5JC 4FTOA 2XIYA 4NFNA 2WQEA 5DH3A 3KEXA 3VBTA 4FOCA 2XZSA 3DTWA 3OCBA 4U41A 5AR3A 4D4SA 1WBSA 2J0KA 1ZYDA 2R3MA 5KMJA 1YHWA 4NSTA 2W1IA 3EQDA 3OXZA 4CEGA 1TFFA 1JAMA 3P7CA 4FNWA 2Q0NA 5B2LA 3HMIA 5DE2A 4YHFA 2HY81 2FA2A 3LJ1A 4TY1A 4MBLA 2RIOA 4O0UA 3CXWA 4BZNA 1OKWA 3C4XA 1NT2A 5KUPA 4O6EA 5JMSA 3Q3BA 5A46A 1IAJA 5ANIA 3LCSA 3NX8A 3F3UA 5IMEA 1WFCA 3TV7A 3H0YA 2GNLA 2HXLA 4AW0A 5BYYA 3W0SA 2CSNA 3RAWA 1K3AA 4RVMA 3PXYA 3ZUUA 3BYVA 4O4FA 2HXQA 4GU6A 4TYIA 4NJDA 4AXFA 1PKGA 5B2KA 4G5JA 2O2UA 4X7QA 4BBFA 3OY1A 3QRKA 2Z7QA 3E7VA 5EYCA 2ZFYA 3OEFX 2VO0A 3RTPA 3TCPA 3BGPA 2PZPA 2ETRA 5AV3A 3RINA 4UV0A 4ARKA 5EYMA 2QC6A 4DLJA 4RX5A 2GPHA 2XYNA 3OEZA 1XH9A 5LMAA 4B4LA 4D2SA 3F2AA 1ZOEA 3ITZA 3O8TA 3UOHA 3SG8A 3W0RA 4C35A 4AN2A 4R7BA 4TRLA 2C30A 4H3BA 2X6EA 2OIQA 4FEWA 3MJ2A 4FZDB 3ZLYA 4XOYA 4NL0A 4F6SA 4JJRA 3CIKA 3FKNA 2G9XA 2RG6A 3F5PA 3QTWA 4Y5QA 3SXRA 5FEDA 3V6RA 2G15A 4XV3A 3WF6A 3IW7A 3BKBA 2JLDA 3NW5A 2PZ5A 1P4OA 3ORMA 4I6BA 4KKHA 1OKZA 1XMMA 5HNIX 1ZRZA 2I0HA 1OUKA 4E4NA 3FZTA 3UVPA 3CEKA 3Q9XA 3MA6A 4FKOA 3V5LA 4J71A 2WO6A 4Y8DA 5FG8A 2Z8CA 5CEQA 3KRLA 5E8UA 1AD5A 4J8NA 4M84A 4IQ6A 3TEIA 3MV5A 3ZC5A 4C4IA 3G33A 3QHWA 5I3OA 5GZ8A 3OBJA 3MH1A 2UW0A 3ELJA 3FLWA 1H25A 3MBLA 3LXNA 3LFBA 5I9XA 4C57A 4GT4A 4BDBA 2PL0A 2V7AA 3MW1A 4WD5A 4MXXA 4GEOA 3FPQA 3DBCA 3GQLA 4DH3A 4EOJA 1XR1A 3R9DA 1Y8YA 2BZJA 5CZIA 4GFGA 5CEIA 2R3HA 5BVOA 3MDYA 3AGMA 3CGOA 3O51A 4FF8A 5I9UA 2AUHA 3RK7A 3GUBA 4RWLA 2GTMA 2VUWA 5E8WA 3WIGA 4BIEA 1OIQA 4LM5A 4KIKA 1REJA 3DZQA 3IS5A 5CXHA 4E4XA 3D7ZA 5AA8A 5HIBA 5JRSA 1GZ8A 4XHKB 4YJQA 3QD4A 5H8BA 4S32A 4BYJA 5GJGA 4H39A 4X21A 5HVJA 3UC4A 5C1QB 4F64A 3Q32A 1M2PA 3I81A 2EXEA 3QA0A 3RKBA 2LAVA 4ZSAA 4FKRA 3R8MA 3O5AA 2VTHA 2WU7A 2KTYA 3D7TA 3MESA 4YJTA 4IX6A 2A98A 2P0CA 1KUTA 4KWPA 3S00A 3D4QA 1M7QA 4EKLA 4MUQA 4TPTA 2JBOA 5K9IA 2W4JA 2BRHA 2J0LA 5B2MA 4TW9A 3BEGA 2VX0A 4RFZA 3NIZA 1HCLA 3VF8A 2GNIA 3F3TA 1G8KA 4DEGA 1YXXA 4X3FA 4FKWA 5HU9A 4FV2A 3FYKX 4ZJVA 5IQIA 4ZTMA 1YWRA 4DG2E 2ITQA 4I0RA 2OLCA 3TNHA 4EWHA 3BPRA 2PE0A 4FBXA 4XUFA 4JQEA 4O22A 3L8VA 2WMTA 4P2KA 1DAWA 4IX5A 2HWOA 4L3PA 1QL6A 4IB1A 4WRGA 2Z7RA 4EI4A 4O1OA 3NNXA 5AJQA 3PPKA 4A9UA 3PJ3A 3A62A 4RJ7A 2J4ZA 5I9WA 4Q5HA 4RJ3A 2Y0AA 2HZ4A 2VU3A 3OROA 3RK5A 2OH4A 3VAPA 4BTJA 2BKKA 2J9MA 2VTLA 1ZLTA 3VS6A 3FZSA 4WBOA 3V51A 2G2HA 1Q4LA 3DAJA 3MFTA 3W32A 5J9ZA 2WTJA 3UPZA 4JBOA 4L53A 2JAVA 2VV9A 3FZOA 4ZTLA 1WBOA 3AC8A 5IMXA 4OTWA 1W2FA 2QVSE 3UNZA 4GT3A 3DJ6A 5M4UA 4D2WA 5FP5A 4GV1A 4FV6A 4NYEA 4LOPA 3FZ1A 5HO7A 3DOGA 4LG4A 3AC5A 5M56A 2OFVA 4EK6A 3S95A 5TE0A 3WILA 2ACXA 3T9IA 2YCQA 4NKSA 3CQUA 4OBPA 4XYFA 4HCUA 5KZ0A 5A4EA 2BFYA 1WBWA 2OGVA 4ERWA 2X7OA 5AV0A 4GG7A 4MEDA 4AT5A 4E4LA 3UDZA 2I7QA 3SXFA 4BR3A 5C4LA 3ZMMA 2CKPA 3O71A 3VUDA 4FTUA 4FZFB 2GNFA 3SA0A 1BUHA 4BTKA 4PPCA 2X8DA 2CNQA 4BDDA 4KIQA 3EN5A 1UV5A 2XNPA 4GK4A 3VRZA 3VUHA 2VWVA 5GJDA 5HG7A 4XJ0A 2FVDA 4JT3A 5ETCA 4TYGA 4FNYA 2YEXA 4K9YA 5EI6A 4AZEA 3UPXA 3DNDA 5CY3A 5AAFA 4PPAA 2BCJA 3Q4ZA 1QMZA 1J91A 3L1SA 4XV1A 2XVDA 3FI3A 4MQ2A 4RZWA 4XP0A 4FKJA 4YTFA 5LMKC 1UWHA 1Q8UA 3EQBA 1XHAA 4OT6A 3NUYA 3C0HA 2YCSA 5ANJA 5KMIA 3QUPA 5M4IA 3NFGB 2ITOA 4U0IA 4O7LA 4L8MA 3LFSA 5LVPA 2UZOA 4PNKA 3G5DA 5HGIA 2H8HA 2YM3A 5IF1A 2OJGA 5CU2A 3BHTA 2GHGA 4O83A 4JS8A 4YZNA 4EBVA 3IW4A 4YUQA 3DNEA 4D0XA 3SC1A 5HLWA 3PE1A 3NIEA 1H27A 4CKJA 4FTAA 3SRVA 5AIKA 2WMWA 4PMTA 3KMWA 5H9BA 2X1NA 2WTIA 3R9NA 4AZVA 3C5UA 1ZZLA 3VC4A 3A61A 5DOSA 3D5VA 3G0FA 4QO9A 4CLIA 4F1TA 3H3CA 3CLYA 4FIIA 3RBWA 1ZXEA 4QRCA 3PJ2A 3Q2MA 4X2FA 4X6RA 1H07A 3MPTA 4RIYA 4F7JA 5M53A 4MH7A 1KWPA 2YISA 3MPAA 3EN4A 2YFXA 2C3KA 3R0TA 4UXLA 3TZ9A 5AFVA 3ZEWA 4F4PA 1T45A 4I92A 4M3QA 4FKGA 4J8MA 4DEEA 4IAZA 2WMRA 2RFEA 3Q52A 4G1WA 2R3QA 3HYHA 3ORXA 4FL1A 4IDTA 3ORPA 3A8WA 1XBAA 4QQJA 5DN3A 5LWMA 1W8CA 5DIAA 4BCJA 5DT3A 3W1FA 2BZKB 5KMMA 3CQWA 3ORNA 5CF8A 2XNOA 2C6KA 5L2QA 1YOJA 3RZBA 4C37A 2PUIA 4AQKA 2PUNA 4DHJA 3TZ7A 3Q04A 4GIHA 5IZFA 4ZS4A 3IDBA 4EOPA 3U6HA 4PL5A 3BLQA 5CAPA 2A27A 2XB7A 3SGCA 2GS7A 3F88A 3PXFA 3ZYAA 4EH9A 5M06A 2QOCA 4AOJA 3FI2A 1BI7A 4DGMA 3R2BA 1U5RA 5EM5A 1YRPA 3NGAA 4BCIA 4M68A 3I0OA 3KA0A 2HENA 2PVKA 5DRDA 5AP7A 2QO7A 3ENMA 2VN9A 3QXOA 1QPCA 4Y73A 4YTIA 3TWJA 3UNJA 1Q8TA 4YO6A 3RAKA 5I0BA 5A9UA 4KIKB 1XBCA 2Z7LA 1H1RA 1ZY5A 4NU1A 4IAKA 4ZY5A 1WAKA 3L9PA 3HV4A 2OW3A 2JIVA 3MVJA 5KX8A 4B6LA 1H24A 3UO4A 4MQ1A 4WNOA 2XRUA 4BJJA 1F5QA 4FC0A 3QAME 5HKMA 2QD9A 2YN8A 4CVAA 4ID7A 4NCTC 1NXKA 1XH6A 4LFIA 2C6TA 4X2KA 3RCDA 3TZ8A 4BWXA 3NVMB 4JG7A 1T46A 4H05A 2Z2WA 4EHGA 5DYJA 3D7TB 5F1ZA 4ZIMA 3DS6A 1OBGA 4M15A 5E8XA 1RW8A 2YHVA 5JFWA 3KREA 1OPJA 5K0KA 1WBVA 2X8EA 4I24A 3QQGA 3FLNC 2JDTA 4WKQA 5EG3A 3SKCA 2QONA 3CPBA 3OOGA 4WG4A 2BKZA 3GNIB 5DFPA 4V04A 4PNIA 3OHTA 3BWFA 2G01A 4F1MA 5LXMA 2ZVAA 5D10A 2VWXA 2X0GA 4X3FB 3P23A 4HPTE 3LCTA 3FLQA 4Q5EA 5BVKA 1BLXA 2C3JA 3UVQA 4C3PA 2P4IA 5K0XA 2F7ZE 4QPAA 3C5IA 2JFLA 3W16A 2VO7A 3BV3A 2RFSA 2P3GX 2XKCA 3BRBA 3PJCA 4PX6A 4GW8A 4J99A 3GU5A 4CRSA 2UUEA 3OXIA 3W10A 3QGWA 1WBPA 3HECA 1J7LA 1UU8A 3WIKA 1PF8A 2R2PA 2B9JA 3BYMA 4L7SA 4RWJA 5LVLA 4W4YA 3F66A 1OM1A 4O0SA 3EQPA 3IKAA 4W8EA 5J8IA 4B8LA 5BVDA 3H0ZA 4NK9A 3A7GA 3FMMA 4BBMA 4MAOA 3R1SA 3O17A 3VONA 4A9RA 4CYJA 2RL5A 3FY2A 4FZ7A 3BYOA 3HUCA 1H1QA 2J0JA 3G51A 1PXOA 4HCVA 4QP1A 2DQ7X 2HIWA 3VULA 2X0QA 4I23A 3HKOA 1O9UA 4AXAA 3GBZA 5JFXA 5L2SA 1OITA 3BHYA 3GB2A 4DH5A 5IA1A 3ZSIA 1I09A 4QMXA 4AE6A 4FKQA 1BYGA 4JX7A 1W84A 1DM2A 3LCDA 4P90A 3UQGA 1RJBA 2FSTX 4BKYA 1V0OA 2ITXA 2PVYA 2WU6A 2ZJWA 4CFWA 4EOIA 5JT2A 4E7WA 1H01A 3TUBA 5ANDA 1SNUA 1PJKA 2B55A 2X2LA 3Q5ZA 5AR4A 4ZK5A 3TT0A 2E9UA 2HAKA 3V8WA 4OAUC 3VJOA 2ONLA 4ZTHA 3LM0A 2PWLA 4BCHA 2IG7A 3KK8A 5AM7A 4U40A 2X2KA 4FTMA 4EH2A 5CEOA 3N4TA 3ZO2A 4YPDA 5KMLA 1J7IA 3ZM4A 5HCZA 4X2GA 3QZHA 4JLCA 5HCXA 5JGAA 3F5GA 3F6XA 3FV8A 4HOKA 4LOQA 4I0SA 2HZ0A 5EW9A 1PXLA 1W0XC 3RGFA 1FVRA 3DK7A 2GCDA 3HA8A 1E1VA 3E7OA 2XIRA 1CSNA 3OWPA 4C2WA 4YZDA 3GFWA 4QP9A 2PVMA 3JUHA 5G1XA 2UZBA 4Y46A 2ZV7A 2FSOX 3COMA 3PPZA 4U8ZA 4YTHA 4EK5A 4YHJA 5CI7A 2PMLX 4R7IA 3NUUA 3SOCA 3TG1A 4DYMA 4IDVA 4QPSA 2QR7A 3L8XA 3FC2A 3TUDA 3KL8A 3KN5A 3Q6UA 4MKCA 5E1SA 3V5QA 5KE0A 3WARA 4BB4A 4QMWA 5AP3A 4BRXA 3TUCA 5I9ZA 2ETKA 3T8OA 4CV8A 4YJOA 3TJDA 5ANKA 4FTTA 2JGZA 4IZYA 1YI6A 2Z60A 4JDIA 4RVLA 3M2WA 4QYHA 5IEYA 3OZ6A 2NNWB 5D41A 2YIWA 3OCGA 4XNEA 5AADA 2BDFA 3OD6X 5DWRA 3SD0A 1FBNA 2QHMA 1Q8WA 4ENXA 4LRJA 4IWDA 1H1SA 5HE0A 4C59A 4RJ6A 2BRBA 3SRVB 3HRFA 4JBVA 5I9YA 1P2AA 3A7HA 3C4FA 4ANSA 4ITHA 2QQ7A 1OL5A 4I6QA 1RE8A 4TYJA 3S0OA 2VTIA 5DGZA 3CTHA 4M97A 4E3CA 3UZPA 4DBXA 3TKHA 2UW7A 4D1ZA 3BLRA 4RIYB 5HE2A 5A54A 3UG2A 3P78A 4JQ7A 4DAWA 2GFCA 2GDOA 3QQLA 4H3PA 4CFVA 2W1ZA 4FKSA 3G0EA 5C8NA 4JRNA 5A6NA 3C13A 5IA2A 3TV6A 1Q8YA 3BX5A 3QLFA 2CN8A 3GCQA 4FSWA 4GCJA 4BHNA 4D4YA 2ZV8A 3BYUA 2C68A 3R71A 3R02A 1B39A 3GENA 4O7TA 5EI8A 4HW7A 3CD8A 1VR2A 3QQFA 1ST4A 3ERKA 4BYIA 4E26A 3MTFA 2C69A 3VBQA 4AOTA 3OTVA 3R8VA 2IVUA 4LMNA 3ZHPC 4DITA 3IECA 3AKKA 5BV3A 4KKGA 1M7NA 2W4OA 2PVHA 3KGAA 5DI1A 4ZSGA 3GC7A 4LGHA 2VWUA 3R8LA 4O21A 3DA6A 4RG0A 3SQQA 5FQDC 5H2UA 1YQJA 3NAYA 2QOQA 3I7CA 3LXPA 4ORKA 1GAGA 4RSSA 5G6VA 3UQCA 4OTHA 1X8BA 2QOHA 3FQSA 3AOXA 3F3VA 3BE2A 3OWJA 3MIAA 3QLGA 2Y4PA 3RP9A 3HDNA 3NW6A 3FL5A 3PUPA 4S2ZA 3R28A 1UKHA 2W4KA 3DTCA 2VAGA 2BAJA 2W9FB 3GU7A 5ANOA 3OT8A 3KXNA 3Q60A 5D7AA 5FGKA 4DHIB 4YZCA 4MBJA 4EH5A 4BJJB 3ZFXA 4DFXE 4DINA 4FTJA 3IONA 2P2HA 4JAIA 3HMNA 1MUOA 4S34A 2W5AA 3EQIA 4YR8A 3D83A 2E9VA 3PIZA 2OF4A 5AP1A 2ZMCA 3RAIA 2W5HA 4QQCA 3F9NA 5AP0A 4AW2A 3PJ1A 5IQGA 3QHRA 5HX8A 3T3UA 3FLSA 3PVGA 4GFMA 1UA2A 2UZWE 4QMQA 2QOFA 3H9FA 4HNFA 3ZRKA 3ATTA 3DJ5A 4F6WA 1YDTE 4FT7A 2JITA 3C4EA 4ASZA 4O0WA 4IWOA 5CEMA 3KF7A 3DKCA 3S2PA 3GC9A 4NM0A 4GUEA 4O0TA 1IA9A 2PTKA 3QQUA 4GU9A 4EHEA 2OBJA 1XO2B 2YM8A 2J2IB 2JAMA 3PLAE 4HYHA 3H9OA 3DXNA 2EWAA 2SRCA 1W82A 2ZDUA 3OW3A 3MGYA 4DHZA 3G9NA 5LWNA 3P79A 3AQVA 4IVCA 4RA5A 4C3RA 1Q99A 2B9HA 4ZY4A 5ETIA 2J0IA 4I5MA 2E9PA 3GCUA 5E8SA 5KMOA 3MH0A 2H96A 2X0OA 3B8RA 3LJ2A 3PA3A 4FSTA 3G15A 3TDVA 4O2ZA 4DFNA 2XALA 4TTHB 4Z9LA 4AACA 3QRIA 4AGDA 1FVTA 4F09A 3GU4A 3KC3A 3VO3A 3C4WA 2I0YA 1HOWA 2ITTA 4GIIA 4A9SA 4AZWA 5BVNA 3PXRA 1OL6A 2W96B 1B38A 4G16A 3ZH8A 3V01A 3BLHA 3KF4A 2Y9QA 4KD1A 4O38A 4WUAA 4QTBA 4XCUA 4KS7A 4KAOA 4L52A 3FI8A 3VUMA 4WA9A 3ZUVA 3LQ8A 1UNLA 4I5CA 4RBLA 2C5XA 3DY7A 5FXRA 3U54A 3ML1A 2YA9A 3AC4A 5K5XA 4N6YA 1LR4A 2WEIA 2YJRA 4OTQA 4YHTA 2XS0A 3QGYA 1Q24A 3RPSA 5E9EA 2GQRA 4EQMA 4KIOA 5AR2A 1M2QA 2CCIA 4E8AA 2R5TA 4L3JA 1PMUA 4FR4A 2O63A 4N6ZA 3MPMA 1U5QA 1UU7A 3PTGA 5CX9A 5AX3A 5HCYA 4XG2A 2XKEA 2OIBA 1Q8ZA 2W05A 3R01A 4FUXA 4KNBA 4NW5A 5L8KA 3D5XA 2OKRA 2FGIA 3D14A 1MQ4A 4LUDA 3WF7A 2C1BA 4L42A 3VUTA 4LMUA 3KCFA 3OUKA 4H1JA 3COIA 4O7WA 3TNWA 3KMMA 4CCBA 1V1KA 4YU2A 4DLIA 3R1QA 3OY3A 5A4QA 3W2PA 3AGLA 4LGDA 1VEBA 4XBRA 3DDQA 3LFAA 2WIPA 4P5ZA 5ACBC 4AN9A 4EC8A 1OUYA 3O8PA 2FYSA 5FLFA 2WD1A 4GKHA 1YDSE 2YIRA 1YVJA 5TF9A 4C7TA 3ANQA 4FTNA 4RC2A 4CFUA 1HCKA 2CHLA 2X7GA 4MK0A 2XKFA 3BGZA 1KE9A 1M14A 3I60A 3FYJX 4LV5A 2YM5A 4I94A 2PULA 4UY9A 1PXKA 3KVXA 3R8ZA 4O7RA 2R0IA 4NW6A 3GEQA 2ITZA 4IWPA 5DRBA 4EQUA 2YITA 2RF9A 4G6OA 3QRJA 3C4CA 5JFVA 1G8JA 2YM6A 3FMNA 3RCJA 5HLPA 4MNEA 2UW9A 3ZCLA 3VBWA 4CD0A 2JKQA 3HRCA 4MD9E 2V55A 3UO6A 5AUTA 2PMOX 4MNFA 5FXQA 2I0EA 2PZYA 2NRUA 1SMHA 4CSVA 5J5SA 4EYJA 4F7SA 2C4GA 3LE6A 3PFQA 2R3FA 4OGRA 2UZLA 2H6DA 4PF4A 4LRMA 2B9IA 2XNGA 1MP8A 4WSYA 5EKOA 3V04A 3R7IA 4HYUA 3QCXA 2UZTA 4U43A 2ITUA 3R21A 4M14A 3RHKA 1YI3A 4RIXA 3VUIA 4B9DA 4F6UA 1PRYA 4RX7A 3NSZA 1P5EA 3WYXA 5E8VA 2HCKA 2VTQA 3LXLA 5HBEA 5CI6A 2UW4A 3GCPA 2W1CA 5CNNA 4BTFA 5TO8A 1KE7A 2R3JA 2R9SA 5L4QA 2WPAA 4U44A 5FD2A 4XP3A 5IH6A 4RFMA 4ASDA 4DTKA 1WVXA 3JS2A 5KMNA 4FEQA 4C38A 2BROA 2ITWA 3S1HA 1K2PA 3HVCA 2PZIA 4WSQA 3QA8A 4CT2A 4QP3A 5HEZA 4DTBA 3F7WA 2Y6MA 3C51A 2X81A 3I5NA 3LLTA 1Y8GA 1H28A 3LVPA 2YLEA 1YXSA 4FZ6A 4U81A 5AUVA 1ZARA 2VTSA 3E88A 5JZNA 4C2VA 4DF3A 4GUBA 4UMRA 4BIDA 4DHFA 3SVVA 2RFNA 4DEBA 2NPQA 4ZZNA 4FK3A 4F0IA 4KA3A 4C36A 4S30A 3COKA 3KXMA 4QMOA 1UVRA 2REIA 1NVRA 1OB3A 3QU0A 4EORA 3W2QA 2QKWB 4FT5A 4MXCA 4OTPA 3A7FA 3I4BA 4HNIA 4K1BA 4IB3A 5H8EA 5L6OA 4CXAA 3FZRA 3P1AA 5LJJA 4BWPA 2C6IA 3HV7A 5ACKA 2XH5A 2QO2A 4YJPA 2HWPA 3GCVA 4F7LA 4FVQA 2QOIA 4U7ZA 1E1XA 4WG5A 5CXZA 5C03A 4BCQA 4GJ2A 2OXYA 3ENHA 3FQEA 3NRMA 5AUWA 4K33A 4D1SA 4DFUA 3ZDIA 1CTPE 1R78A 2WTKC 2YDJA 2C6DA 3O2MA 4IADA 4YLLA 3OWKA 5F94A 4D58A