5CAOA

Egfr kinase domain mutant "tmlr" with compound 29
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
323
structure length
300
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELTSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYREEDMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Noncovalent Mutant Selective Epidermal Growth Factor Receptor Inhibitors: A Lead Optimization Case Study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
total genus 83
structure length 300
sequence length 323
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5caoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5caoA01
4I23A 3V5QA 5E1SA 3KF4A 3L8PA 4WOVA 4IW0A 3EN6A 3FUPA 1H07A 3FMHA 2O3PA 4JNWA 4F0GA 3BIZA 4M8TA 4CV8A 3FSFA 3ET7A 3MESA 1H24A 4S30A 4EUTA 2ITXA 2O2UA 4EH3A 1OL2A 2HW7A 4ZSGA 4ZY6A 4MVFA 3BV3A 4FL2A 2UZWE 4CFNA 3NYNA 2GU8A 3DS6A 2YHVA 4JL9A 1OL5A 2W1DA 3FMMA 3UIUA 3ZO3A 5IPJA 2X8DA 1UU3A 5I9YA 3RCDA 4AP7A 4LRMA 5M57A 5JFVA 4EUUA 2OI4X 4Y5QA 4BKJA 3QTXA 4D2PA 5C8KA 5CQWA 2XIXA 2X7GA 3PVUA 3VUGA 1UA2A 3QTQA 2GNGA 5CEOA 4BRXA 5FUTA 5AR7A 4IACA 2C47A 4WNOA 4QT1A 4H39A 2NPQA 3DLSA 3LW0A 3ERKA 4AOTA 2QR8A 3V5TA 3VF8A 4UY9A 3G9LX 5DIAA 1NVQA 2WZJA 3OVVA 1YXUA 4IAFA 4EQUA 2GTMA 3O2MA 4X3JA 3PLSA 2C6KA 5IEXA 2W1FA 4K33A 1XBAA 2Z7QA 3B8QA 3DAKA 3ODZX 4YHJA 4WO5A 3OUKA 1TQMA 4PTCA 5T68A 4OT6A 5JMSA 4A9SA 3RCJA 2JFMA 3ORXA 2F9GA 4DFXE 1WBPA 2WQEA 4KIKB 5GHVA 1T46A 3Q4ZA 2GPHA 3EN7A 5DRBA 5F94A 3VBYA 3LXPA 4AA5A 3KN6A 3OOMA 2EXMA 3KA0A 1V1KA 4HYIA 5J9YA 1IA8A 3JVRA 2QHMA 2W4KA 3MPTA 1GIHA 4RC4A 2PVLA 4RIOA 4BC6A 4DEHA 2C6EA 4DTKA 4K9YA 4FTJA 2BKKA 4EHVA 2ZV7A 4EORA 3ORMA 3FYKX 2WU7A 2WU6A 3PPKA 3BE9A 4RT7A 4DA5A 4XX9A 3HMOA 1WVWA 5CVFA 4AT3A 4EWQA 4HW7A 2GNJA 2PHKA 3O23A 2W1HA 4K2RA 4O0VA 3WZDA 2E9UA 3RK7A 4A9TA 4BCMA 3MB7A 4ZZMA 4CMOA 3FZTA 3PIXA 5AAGA 3QRIA 4UBAA 4FVQA 5HD4A 3F5XA 1QPEA 3HUCA 4I1ZA 1ZMUA 2PTKA 3D4QA 4QMXA 1Q61A 5I9ZA 4LG4A 2CKQA 2JDSA 3IDBA 4KBAA 4WG3A 3G6HA 4MWIA 3O7LB 4KSQA 5CNOA 3QYWA 4L46A 5EM7A 5GNKA 1H25A 3HV4A 4HYHA 4FTTA 3P1AA 4DH8A 1ZOHA 3HYHA 2VTAA 4GT3A 3QTRA 4EK5A 4QMPA 3OP5A 3UG1A 1M17A 4R6VA 3PY3A 3R1YA 1WBVA 5E8UA 3M1SA 1MQBA 5AP0A 5LWNA 5KMIA 3OEZA 5A6NA 4C4JA 5EW8A 4CD0A 2P0CA 4HVHA 3OXZA 2REIA 1VZOA 4AE9A 4EHGA 5CXZA 3RK5A 4FSZA 5ANJA 4RWLA 5HLPA 4DH1A 5E8YA 5IUHA 4R8QA 2YA9A 4IAIA 2GNLA 4QMSA 4ZAUA 1GAGA 4H1MA 4O6EA 3AGLA 5BVWA 5D1JA 4O7LA 4GG7A 4M7IA 4I5PA 4RJ6A 3V6RA 3WE4A 5CX9A 5EHLA 4BI2A 2VTIA 4G3EA 3ZLWA 3U6JA 2QONA 3ORZA 5LMBA 1P4FA 2BTSA 1Y6AA 2A0CX 3VUTA 1H1PA 1J3HA 1PMEA 3RHXA 2UZDA 1JKTA 5EM6A 4S33A 4RX9A 5DA3A 5CEKA 2WFYA 1JNKA 3PXKA 4MNEA 4XBRA 4BVUA 2CCHA 4FEUA 3FV8A 3R6XA 4O21A 2YISA 2RFNA 3S2PA 1FQ1B 1R1WA 4FKRA 3DU8A 3L8XA 4NM3A 3BV2A 2IVTA 3OTUA 4QD6A 4WA9A 3EN5A 2BKZA 4E1ZA 2BAKA 3ORKA 1WCCA 2IO6A 4ZTQA 2WKMA 4FEXA 2CGUA 3U6IA 5CSPA 2ZJWA 3O7LD 4LUDA 2JAVA 2E9PA 5FGKA 4E7WA 4E93A 2A27A 4F7NA 4OBQA 3R7EA 4KINA 1ZYSA 5HZNA 5M07A 2UW5A 5CVGA 3U55A 3KRWA 1ZOGA 3AT3A 1Q5KA 2R3KA 4QP9A 4F6SA 3MJ2A 5HG9A 3W33A 4EOKA 2X2MA 1U54B 5AV0A 2PULA 3WZKA 4MH7A 2I7QA 4Z55A 3R00A 3KXZA 5LVOA 4O27B 1RW8A 1K9AA 2OIDA 4NH1A 3TZ7A 1PW2A 4FGRA 4WRSA 4QOXA 2B53A 3UIXA 4WT6A 4O7SA 2RFSA 5A4LA 3I60A 3MFTA 3UZRA 3WZEA 3DOGA 1GY3A 3WOWA 3BBTB 5IQGA 4O82A 4HCVA 5EHYA 4BDDA 5K4JA 5AIRA 4JDIA 1ZOEA 2IZTA 5IH5A 4UYAA 1JVPP 3C5IA 4DG3E 3LKMA 4F63A 2B0QA 4NFNA 4ZSJA 4RQKA 3DNEA 4L52A 2QG5A 1OIRA 1GNGA 1UKHA 4GFOA 3Q9WA 2PVJA 2ZDTA 2WIHA 3FQSA 3NCGA 2CCIA 3QZFA 3E3PA 5C8NA 2VTHA 3EQGA 5CSWA 4KA3A 3D15A 4KIPA 4BWKA 3KVWA 4ZJVA 3UQGA 4O7NA 4DFBA 1UV5A 3FZ1A 1FVTA 3GU8A 3G2FA 1KE7A 3SDJA 3BYVA 3FC2A 4XG6A 4Z16A 3HRBA 5BVNA 5KMOA 5M4CA 5L6WL 3FZPA 4QYEA 4IM3A 5DBXA 4QQTA 5HBJA 5IG1A 2VTLA 3HVCA 4FL1A 3NUNA 2X7OA 2XEYA 4HNFA 3HRCA 3ZDUA 4I93A 4XLVA 3O71A 2R9SA 4CZYB 5JRQA 5HNGA 3ZUUA 3B2WA 2JDOA 1PXKA 3GB2A 3W2SA 4E5AX 1Q99A 4BY9E 3NEWA 3MTFA 4IZYA 3VWAA 4YBJA 4KWPA 5ANDA 2HZ4A 2JDTA 4KS7A 4WG5A 3W2OA 4BIBA 4IX6A 5HICA 5BPYA 2WTWA 4A4OA 4RA4A 2Y9QA 4I6HA 3SRVA 1KV2A 4ZTLA 4LV8A 4MWHA 3CBLA 3RM6A 5JGDA 1XR1A 4XS2A 4BCGA 3SVVA 3MY0A 3BGZA 2DQ7X 4AUAA 1IASA 3K5VA 4N70A 4QP6A 3ZUTA 2CKPA 5EM8A 3D5UA 5F20A 3BU5A 4FEWA 5KKRB 2VWXA 3Q52A 3ZRLA 3CC6A 5J7HA 2QODA 4PV0A 3UVRA 3PXFA 5F9EA 2WTDA 4XG7A 3G9NA 2RFEA 4XCUA 3GU5A 2ZVAA 4HYUA 4DGLC 4XP0A 3FYJX 1JSVA 2UW8A 3EH9A 2W05A 3RPYA 4H3PA 3ZSHA 4U9AA 3E7OA 3D7ZA 4AZWA 2B1PA 4MXCA 5L8KA 1B6CB 3ANQA 1NVSA 2XK3A 3ZTXA 4OLIA 4JIKA 4G3CA 3UP7A 3EJ1A 4X2NA 1DAYA 4WSYA 3COIA 4YJUA 4C3FA 5DMZA 4X7QA 5J5SA 3PG1A 5JFSA 1KE9A 2QO9A 2RFDA 4OBPA 1FVVA 4FOBA 3VS4A 2XNPA 4IBMA 3KF7A 4R5YA 4GU9A 5CENA 1W7HA 2QOOA 3BHHA 3Q53A 4F1TA 4AWIA 2QQ7A 4NJDA 4DFZE 2QOIA 2OWBA 1Q8ZA 3QQKA 4PRJA 5DNRA 2PVMA 3BHVA 4JQ7A 5E90A 2O63A 4KKGA 4IWOA 4X6RA 3T3VA 5IQBA 4X0MA 4WNKA 2PUIA 3QQLA 4P90A 3L9PA 3ZM9A 1XH7A 3ZU7A 3MFUA 3PVGA 4YLJA 4QPAA 3OF0A 4PNKA 5E8VA 2HY0A 4FV7A 3VHEA 4XYFA 5L2WA 4OAVB 3BYOA 3KGAA 3MTLA 3P78A 2XS0A 2EB3A 2R3HA 3EB0A 3T3UA 4ZTMA 3DZQA 4QO9A 1JAMA 5DR9A 3FE3A 3IK3A 3K5UA 4TNBA 3LFFA 3NRMA 2VZ6A 4KAOA 3QUPA 3QZIA 2YM8A 2J0IA 4FMQA 2HY81 3A8XA 3Q04A 5AR2A 2X1NA 3QQUA 4JBOA 2UZOA 4YURA 3L9MA 4EOMA 4FV5A 4RA5A 5M4FA 3DAJA 4BCNA 3F7WA 3AMYA 3LXKA 2GNFA 4UB7A 1LUFA 1H4LA 3MSSA 1SVEA 3SGCA 3P79A 3NUXA 4AW2A 4EH7A 3C0GA 4MAOA 5AUTA 3A7GA 2JEDA 2ZMCA 3LQ8A 2WD1A 5CI7A 5CU2A 4O22A 4AZSA 4MNEB 2HXLA 3VS5A 4BCQA 3A8WA 2E9OA 3PFQA 3CY3A 4HCUA 4QP2A 4EC8A 3KC3A 2ITZA 3QQHA 5FEEA 4HOKA 4EK3A 5A14A 4IVAA 4F64A 4O1PA 3PVWA 3WZJA 1H0WA 3WYXA 1BL6A 5KBRA 3OW3A 3QC4A 3O96A 4FTAA 5DN3A 4ZTRA 5LMKC 4XLIA 4U7ZA 3UYSA 2QI8A 4CYJA 5JZJA 4RBLA 5HHWA 3KRJA 4CG8A 4BKZA 4Y85A 4C35A 5FTGA 5IQAA 1ZY4A 4BWXA 4Z7GA 1A48A 4WSQA 5FQDC 4BDJA 4Y72A 1PXOA 3BYSA 1V0OA 4KBKA 3H0ZA 3OFMA 5AADA 3PSDA 2ITVA 4DH7A 1IAJA 2CMWA 2HAKA 5DEYA 3Q2MA 3ZO1A 4BYJA 3MGYA 2Z02A 3IECA 4FOCA 3SAYA 3FI4A 4C38A 5HO6A 3NIZA 3FMEA 3R8PA 2AUHA 2WNTA 3MH3A 3GXLA 3OCBA 4XBUA 4GIIA 3KFAA 3F82A 3RZBA 3TNHA 4FNYA 4D2SA 4WIHA 4GU6A 3CY2A 3FKLA 4YZBA 4FVRA 4WUAA 4F9AA 1NT2A 3PA4A 4RZVA 4C61A 4AZTA 3H9RA 1PXNA 1ZMVA 4G6OA 1KOAA 3BRBA 3H4JA 1MQ4A 5KMKA 4QP7A 5LWMA 5LQFA 1XJDA 4FTKA 5FDPA 5C1QB 2GSFA 4YJRA 4O7VA 2ERKA 4OUCA 4YSMA 3VRZA 4G17A 3AOXA 3P9JA 3ZOSA 4BCIA 4H3BA 3WBLA 4QP3A 5CI6A 5CEIA 5FG8A 3DK3A 2UW9A 4G1WA 2WMRA 4O84A 3AD4A 3F5UA 4MD8E 3MB6A 4CT2A 4AS0A 5CXHA 5GJDA 4AE6A 3KQ7A 3NNWA 1XKKA 4CXAA 4GKHA 4FKUA 4I24A 4NU1A 4XMOA 4GH2A 5EG3A 4RJ8A 4R7HA 3M42A 4LRJA 2J5FA 3A61A 3ZC6A 2GQSA 4QMYA 3OZ6A 3VJNA 1JWHA 3R9DA 3D2IA 4U44A 2BILB 3IGOA 3VULA 1OKVA 3WF8A 3P7BA 2IPXA 5AX3A 2ZM4A 4GYGA 1UU9A 3N4TA 5DLSA 4E4XA 3LCTA 1WBWA 3QUDA 1PF8A 4O0XA 3HUBA 2XM9A 4G16A 3UO4A 3ZEPA 3QHRA 5GIPE 1GZOA 3EZRA 2Y4IC 1GZNA 3DJ5A 2W17A 3PRIA 3E5AA 4JG8A 1PKDA 4YZDA 3LJ2A 5HIBA 2VV9A 3P4KA 4CCBA 5HNIX 1ZYDA 1OKWA 4GT4A 1OGUA 1URWA 2YLFA 4FNXA 3W2CA 2B9HA 2YEXA 2J6MA 3QD0A 5EOBA 1WBSA 2C6OA 3I81A 1AD5A 3TL8A 3AXWA 3TV7A 4IB3A 1KSWA 4FEQA 5AP2A 5LVPA 1Q4LA 4A4LA 3OXTA 2VO7A 4F7LA 4O0RA 5BX0A 4O0UA 2HZIA 4UMUA 4BDFA 2WAJA 3DCVA 3SHEA 2X9FA 3U9CA 4ALUA 4RGJA 4JDHA 3C4ZA 2UW3A 4NM5A 4K77A 2WPAA 4GYIA 4C4EA 4FT0A 2B54A 2RG6A 3GFWA 1UKIA 1PRYA 5EH0A 4YZ9A 2WTIA 3C4CA 3EYGA 5B2KA 4I20A 4KUJA 4MXOA 4EONA 4V0GA 2X8EA 5CT0A 4AGUA 4DT9A 1PHKA 4FKQA 4D1ZA 1UU7A 4G3FA 4RJ4A 2XP2A 4FIEA 3BLHA 3H9FA 4PPBA 3CD8A 4DT8A 3LCDA 3GCSA 3QD2B 4XRJA 4U45A 5HOAA 4GEOA 1H0VA 2YJRA 3TDVA 3E7VA 4DHFA 1BI8A 3MS9A 4Q9SA 4M67A 3WIGA 2W1EA 3RKBA 5K5XA 3UZTA 3K54A 4BDHA 3UE4A 4XEYA 3DKFA 2HK5A 4BTMA 2VTJA 3O17A 3U8WA 5FRIA 4FTRA 2UUEA 1RJBA 2PZPA 4D58A 2E2BA 2RF9A 2XA4A 4D0XA 4EZ7A 4ACHA 3I4BA 2VTPA 3FXZA 5CS6A 4UZDA 2CDZA 3ORLA 4RC2A 4PWNA 5TOZA 4O86A 3PE2A 3LMIA 5IA4A 3ZLYA 4BL1A 4IX3A 4F4PA 4AF3A 3BELA 3AT4A 2G2IA 1E9HA 4AGCA 5AAFA 4GS6A 3LPBA 2EXEA 3EIDA 1H1WA 5DH3A 3VN9A 3ACJA 5E8TA 4FSYA 3RP9A 3ZBFA 4IZAA 3RZFA 2ITQA 4ZS0A 5ANGA 3R7UA 5CY3A 3COKA 1F3MC 3R01A 3KCKA 4FYNA 2Z7SA 3TUCA 3WZUA 5DOSA 2WXVA 2QU5A 5DR6A 1YHVA 5AA9A 3TDWA 3FPMA 3KREA 3HP2A 5IQFA 2PK9A 3MVLA 4BZDA 1DM2A 3BQRA 2C1BA 2XNBA 4YJNA 2B9IA 2OFUA 4IAYA 3FSKA 3DJ6A 4L43A 4DCAA 1KE8A 3UJGA 3BEAA 3PVBA 4U6RA 2J7TA 3KK9A 3NS9A 4W9WA 4H3QA 3ID6C 3NVKI 2FSOX 2IZRA 4ITHA 4ZTNA 4A06A 1ND4A 5LVMA 4PMMA 1XH5A 2OW3A 3MIAA 5HE3A 1BKXA 3O50A 2ZM3A 4C3RA 1H1QA 4QTCA 4BTFA 2WMBA 3DKGA 4FSTA 3C7QA 3CQUA 4GV1A 1QMZA 4IC7A 3V51A 4DCEA 3REPA 2R3JA 1CM8A 4FSQA 5E4HA 1UNHA 3PWYA 4ZIMA 4C3PA 5L6PA 3LM5A 5JFWA 4YNEA 2VD5A 1PXMA 3R28A 3F2AA 3U4UA 5M09A 4OBOA 3GOPA 3S95A 3LMGA 1UU8A 1KWPA 4II5A 1WBNA 2UW4A 3KB7A 3OWPA 3F2RA 5EQYA 5IA0A 1A06A 4QTAA 5JKGA 2WQOA 2X2KA 4HGSA 2G15A 2O5KA 3DDPA 4KSPA 3TT0A 3UVQA 4E6DA 3QCSA 4ZZOA 4AX8A 5GZ8A 2YM7A 2RKUA 3AC8A 3SLSA 2CGXA 3BEGA 3VO3A 4Y8DA 3F61A 3W18A 3SW7A 2G1TA 4JI9A 4F1MA 3LFCA 3DGKA 3FMKA 3TEIA 3FXWA 4IANA 3FI8A 3C1XA 4RFZA 1G8AA 2NO3A 4Y83A 4AA0A 2XK4A 4DITA 3IW4A 4JJRA 3CLYA 3FKOA 3H30A 4PPAA 1ATPE 4TWPA 1W98A 3FY2A 2VGPA 2XBAA 3UIBA 5E1EA 2ETKA 2ZAZA 5AAEA 4CVAA 5CEMA 3ZFXA 3LQ3A 1SNXA 3QUEA 4X2GA 2C6TA 1G8SA 1Q8TA 2P3GX 4IX4A 4FKSA 3ANRA 3UYTA 3ZLSA 1J91A 1TQIA 3DFCB 4JR7A 2C68A 2ETMA 3R1SA 4OTQA 4PDPA 3HX4A 4OTDA 3EYHA 5CSVA 4EH8A 4FIGA 4ONAA 3Q5IA 4D4YA 1P4OA 2YZLA 3QAME 3KXMA 4C58A 5HVKA 4TYJA 2XNMA 3LFBA 4K0YA 4PP9A 5CTPA 3KXGA 5C9CA 4GVJA 3R04A 3LHJA 4ASZA 3EKNA 1URCA 4FICA 3AC2A 3POOA 1LPUA 4FKGA 4DEIA 5EKOA 4C2VA 4RZWA 3TXOA 5DFPA 5BYZA 3U9NA 3GUBA 3UIMA 2C5YA 3DXNA 5CAQA 3OOGA 3QD3A 4J96A 1PXJA 4R1YA 3VS2A 1IEPA 4D2WA 4YPSA 5EDQA 5LVNA 1ZLTA 4DBXA 1JBPE 3QL8A 5EHOA 4LQMA 1SYKA 5IH4A 4IX5A 1YDSE 5HU3A 2O65A 4PNIA 3UC4A 2R3PA 3R7IA 4X2JA 1WFCA 4F0FA 3KRRA 4CQGA 3C4FA 4F6UA 1I09A 3CXWA 2BDFA 2C1AA 3CJFA 3FXXA 4O96A 2PU8A 4ASXA 4L3PA 3UMXA 4FUXA 3WIKA 3NPCA 4CCUA 3TZMA 5ANOA 4I4FA 4G3DA 4X3FA 4U43A 4BZNA 3BHTA 3FI3A 2BALA 2WEVA 4XRLA 4BHNA 3JR1A 3ZDIA 5A4EA 4W4YA 1R39A 3D5WA 2XK8A 2OH0E 2UZVA 2JIIA 2XEZA 4PPCA 4I0TA 4YTIA 4I94A 3UTOA 1OPJA 5TE0A 1F0QA 2IVSA 5D7AA 4JIAA 5FEDA 3R2BA 3UNJA 3ORNA 4RRVA 4CV9A 2YIQA 4FF8A 4BF2A 2JIVA 5EFQA 5A4CA 4FNWA 2V62A 3FL4A 5J95A 1DAWA 3PIYA 3S3IA 4C59A 5A4QA 2VO0A 4QPSA 4YJPA 2UW7A 3JXWA 4JLCA 4L9IA 4CKIA 1ZY5A 3AG9A 3FZOA 2YACA 4WUNA 4DC2A 4FV0A 2ZV9A 2BFXA 4YGAA 4F7JA 4D55A 2BTRA 2CN8A 1P5EA 4JDKA 5DT3A 3SV0A 2ZB0A 2WTVA 3LIJA 4YU2A 1YOMA 3QRKA 5EKNA 4EK6A 2VN9A 4MTAA 4F08A 5CNNA 3GU6A 4O0TA 2JKMA 4QQJA 4A4XA 2QO7A 4GVAA 5AM7A 1ZWSA 3C4EA 3RJCA 5I5ZA 5HI2A 3NUYA 5BVEA 4BGQA 1XQZA 5TF9A 2IVUA 3R63A 4B8MA 4E4LA 1JLUE 2QKWB 4X21A 1IA9A 5LJJA 4R77A 2PPQA 2AYPA 2QD9A 2QVSE 4ZK5A 4X2KA 2WIPA 4RC3A 4HGEA 5AR4A 5C26A 1PMNA 4GUEA 4TY1A 3P23A 4JRNA 2HWPA 4XOYA 2XJ1A 3DQXA 2PVHA 4AT4A 1P2AA 3GBZA 4I41A 2R7IA 2F4JA 1TQPA 5BUIA 4RVMA 3GCVA 2RSVA 4CNHA 4E6QA 5AJQA 5EW3A 2ZDUA 4CFWA 3EQDA 5F1ZA 4K1BA 4FSRA 3ZXZA 1ZYLA 4I22A 2W5AA 5FXSA 5L3AA 3W2PA 2YAKA 2FSLX 2P2HA 5DT4A 1YXXA 3GI3A 3GNIB 4CFUA 4CRLA 4E6CA 1SVGA 3ZZWA 2C3JA 2C0TA 1H08A 4EKLA 3O51A 5AP6A 3ALOA 3E87A 4O2ZA 1FINA 4TPTA 1YDRE 2BDWA 2W99B 2IN6A 3E8EA 2HIWA 5C03A 1CKJA 2PZRA 3KEXA 4APCA 4XP2A 4RIYB 4U5JA 2QOBA 3Q60A 4O0SA 2EXCX 3JY9A 2OZAA 4Z3VA 2C6LA 4QNYA 4LL0A 1W84A 4MBIA 3TI1A 4ZY5A 3FL5A 3NYOA 4A9RA 4C33A 2YABA 4EYMA 3THBA 3QC9A 5IMXA 4NYEA 1QPCA 2WTKC 3BYMA 3Q4TA 4MX9A 3G51A 4TW9A 4G3GA 5HEZA 4JAJA 4V05A 4XV9A 2B9JA 1XBCA 3OROA 3IS5A 4RVLA 4A7CA 4AACA 2YM6A 4D4SA 4AT5A 5IQDA 4XNEA 1EH4A 2JGZA 3BX5A 4ANSA 4TL0A 3F3VA 3RAKA 4M68A 3QTIA 1JSUA 2C5OA 2R2PA 4YTFA 3BBWA 3DBEA 2R3QA 3R7OA 5J1WA 1K3AA 4UMQA 2AC5A 5E91A 3MI9A 1IAHA 3CGOA 2Y0AA 3NR9A 4EEVA 2W1ZA 2XKEA 4FUYA 5JSMA 5HIDA 3HAMA 3TIYA 1LEZA 3V5LA 5J79A 3VUHA 4YUQA 3NNVA 1Q8YA 5BNJA 2V7OA 4BDEA 4E4MA 5ANKA 5IZFA 4V04A 1P14A 3VUDA 4HGLA 5B7VA 4M15A 2C3LA 4RWIA 3SG8A 1CMKE 5EYKA 4EOJA 4NK9A 3EQFA 3TKUA 5KMJA 2WMSA 4JT3A 5KZIA 3TZ9A 3ZBXA 4FV2A 1GZ8A 3NWWA 4O6LA 3UC3A 1J7UA 1XH9A 4NEUA 2HELA 2E9NA 4J8MA 3NVMB 3MH0A 5CVHA 3RBWA 2C6DA 3V3VA 4IADA 3D9VA 1Q97A 4H05A 4WNPA 2WQNA 2WELA 4M12A 3C4XA 5HCXA 3MWUA 4QYGA 3PWDA 2V22A 3PXQA 4N0SA 3NDMA 3W10A 1AGWA 3V5PA 5EYMA 1V0BA 2B55A 2ONLC 4CGAA 3VS3A 4DLJA 4RIXA 2Z8CA 3VS1A 4UV0A 4ZY4A 4FVPA 3MVJA 5AP3A 5JZNA 5I9XA 4HPTE 3PYYA 4F9BA 2V55A 4QQ5A 1OVEA 2VX0A 4WD5A 3WARA 2QU6A 1R0EA 2X81A 5IEYA 1OUKA 2QLUA 3FAAA 3FMNA 3E8CA 5JGBA 5EQPA 2IZSA 2NRYA 3G5DA 2Z7RA 2VTQA 4M84A 3QCQA 4OW8A 3F9NA 3TV4A 2WMXA 4ANNA 4BIDA 2OJJA 3GENA 2HZ0A 4Y95A 3BGQA 5E92A 3AC1A 1AQ1A 2XIRA 3ETAA 4QMZA 5KMNA 2OXXA 4ITIA 5E8SA 4AFJA 3PXZA 3M11A 3SD0A 3TTIA 5FXRA 3E64A 4BCPA 1B38A 2RL5A 1WVYA 4RLLA 5GIOE 2R3GA 5JQ5A 3FLYA 3OY3A 3KY2A 3EZVA 4FV9A 2C5NA 4RIWB 2FSMX 2I0EA 1YHSA 3DNDA 4FTNA 4D9TA 1O6KA 3UO5A 4FKVA 3PZEA 4BDAA 5LMKA 2HOGA 4EBWA 5B2MA 4EHEA 2WHBA 4MEDA 5D10A 5FTOA 3C51A 3D5XA 3FMJA 4MD9E 4L7SA 5D11A 4C37A 4TYHA 2VTMA 3ELJA 4TWCA 5M08A 3IPHA 2F57A 4X3FB 4F9CA 4XG3A 2Q0NA 2QNJA 4P2KA 3HGKA 4JG7A 4HGTA 4W4WA 3C13A 4DFLA 1CKIA 5H9BA 2JD5A 5HE1A 4MNFA 2WO6A 1R0PA 1MP8A 3TJDA 3DA6A 3DJ7A 2X6DA 3C9WA 4RIWA 4DTBA 3DV3A 3JY0A 1UVRA 3ZFMA 1DS5A 3QBNA 1JOWB 3I79A 5CAUA 3ATSA 4CG9A 4NL0A 1J7IA 5DI1A 3E63A 3B8RA 4AG8A 2PMNX 4TNDA 2VNWA 5CWZA 4HZRA 1CTPE 1M2QA 2W9FB 3NNUA 3QQJA 3WF7A 3G6GA 3VQHA 3VBXA 2ITNA 2PMOX 2W1CA 1H27A 4J95A 5I3RA 4F9YA 3V8TA 1RE8A 3DBFA 3WF6A 2J0JA 3PY0A 3NUAA 3DTCA 4RX8A 4FI1A 4RJ5A 3W2RA 3EFJA 3I0QA 4QPMA 4DEDA 4MF1A 2R64A 4FZDB 1PXLA 3E88A 3OCSA 4PP7A 1PMUA 3EN9A 3BI6A 3R30A 2PUUA 4DGOA 1NA7A 1PXIA 3GVUA 2W7XA 2Y8OA 1ZXEA 4GMYA 3A99A 5EI2A 1UNLA 2OF2A 5DHJA 3B2TA 3R21A 4DF3A 3QWJA 4IB0A 1OBDA 1YVJA 3O0GA 4KIOA 3VUIA 4RX7A 1BUHA 3DBCA 4WHZA 3AMBA 3HRFA 4N6YA 4YSJA 3CR0A 5AIKA 5CEPA 1U54A 3QX4A 4EOQA 3QGYA 4W4VA 1A9UA 3A2CA 4QYFA 5HG5A 1O6YA 1OKYA 2ITYA 3QKMA 3W32A 1DI8A 4ACMA 3SW4A 2UVYA 3OT8A 3O8PA 3L9LA 4U3ZA 4EL9A 1NXKA 4Y46A 3HLLA 2XKCA 3LXNA 4EOLA 4FIIA 4EQMA 1OL7A 3NYVA 4IWDA 2OJIA 5CU3A 5AP1A 4ZSLA 4XG8A 4XOZA 1W8CA 4ITJA 3KRLA 5AEPA 4R3PA 4MXYA 1OITA 1H26A 1WVXA 2VU3A 3R1QA 4NW5A 5JEBA 3CIKA 2QHNA 4RPVA 4TYEA 5FBNC 2OZAB 4AW0A 4FSWA 5H8GA 4DEEA 1NVRA 3QGWA 3HA6A 5EOLA 4ZTHA 5AR5A 4BDGA 3NZ0A 2GS2A 5KNJA 5H8BA 4LFIA 2AC3A 5B0XA 3LE6A 3HNGA 1Q41A 1VYWA 3Q4CA 4NCTC 5L2QA 5KBQA 5C4KA 3ZRKA 5L6OA 5AUXA 4ASDA 4JVGA 3AC3A 4ZSEA 2XZSA 2HWOA 2QC6A 4FR4A 4Q5HA 3W2QA 4ASEA 5HX8A 4Q2AA 1OPLA 3SC1A 4NM0A 2P33A 5H3QA 3I5ZA 4S32A 5HCYA 3LFEA 4IFCA 2BR1A 3DY7A 2W9ZB 4JS8A 4EZ5A 4UMRA 2O64A 2IZUA 4ENYA 1YKRA 4M14A 4QRCA 2PMLX 4CRSA 4XV2A 5TR6A 4L68A 3LZBA 3V01A 2BPMA 1G5SA 3K3JA 3MJ1A 5FEQA 4CFFA 3UGCA 4DAWA 3FKNA 1KUTA 1ZMWA 4IB5A 4MBLA 2VTTA 4GIHA 5CASA 5CEQA 3BGPA 2VWIA 4C8BA 4CYIA 2WTCA 4GRBA 4I0SA 5FDXA 1U46A 4YZNA 5LMAA 4LUEA 3W55A 3ZYAA 4MBJA 1LP4A 4DE4A 3CTHA 3N51A 2R5TA 3GFEA 3HP5A 5BYLA 4UWBA 4FKOA 3AT2A 2WQMA 4B6LA 5DRDA 3F6XA 1Q62A 5HU9A 4FKPA 3R8LA 3FZRA 4IFGA 4J97A 1M2RA 2FO0A 4U8ZA 3A7IA 3QTZA 3NW6A 3POZA 4QMUA 3R8MA 3IONA 5JGAA 4YPDA 5KHWA 1OM1A 4GFGA 2VWYA 5ICPA 3BZ3A 3PP0A 4RIXB 2QOQA 4FG7A 4D1XA 4CT1A 2GS7A 4MXXA 3JS2A 2ITTA 2JBPA 3OWJA 5ETFA 4XP3A 4FZFB 4E3CA 1GOLA 3BHYA 2XMYA 5HG8A 2XK7A 3R7YA 4NFMA 4QMMA 3RAIA 3T9IA 3KMUA 3BCEA 5K9IA 5KKRC 3NUPA 3HMMA 4IEBA 3ZZEA 1UWJA 3ORIA 3RAWA 3D2KA 4AN2A 3RAHA 2J0MB 2HXQA 4FV1A 4AZFA 2B9FA 4DEAA 4UMPA 2R3MA 3MFRA 3H10A 1ZAOA 2I0VA 2CGWA 2X7FA 3HV3A 5CYIA 5DR2A 3QTUA 4GG5A 5EK7A 2E9VA 3SX9A 5AV3A 4DG0E 4EOSA 3D0EA 4CLIA 4ZSAA 4H58A 4G2FA 4YZMA 3FQHA 3I0OA 4FTUA 4C4HA 3KL8A 4XV1A 2P55A 5D12A 4BTJA 3VHKA 4EKKA 3R0TA 3WI6A 5KO1A 4C4FA 1Q3WA 4FIFA 4O38A 3V8WA 4QTDA 2A4LA 5KX8A 3MFSA 1M2PA 3UPXA 3P0MA 4MXAA 4L3LA 2NP8A 2VTRA 4R5SA 2XRWA 3IKAA 4EH4A 4XG9A 5J8IA 4D0WA 4IVCA 5A46A 4M66A 3TG1A 3UOHA 5CAVA 1KV1A 3LXLA 3RPSA 3H9OA 2VWBA 1YQJA 3ROCA 4C34A 2XM8A 4I5CA 4DEBA 1BI7A 4XV3A 3HDNA 4UN0C 1PKGA 5CZHA 1XO2B 3VNTA 3NCZA 4YO6A 5CZIA 2I1MA 1SNUA 1R78A 2YJSA 5E8XA 3S00A 2ZYBA 1HOWA 4Z9LA 4CMUA 4D2TA 2JKQA 1PXPA 3P08A 3IW7A 1JSTA 2A2AA 2VNYA 4KNBA 4WRGA 4GL9A 4F7SA 1U59A 3QHWA 4XUFA 5ACBC 4G9RA 5FD2A 2J0KA 4RVTA 5AP5A 5IISA 4WKQA 3AQVA 1BL7A 3QYZA 4JG6A 3SQQA 2ONLA 3EFKA 4RWJA 3PUPA 5HIEA 5JT2A 2XKFA 3PA3A 1HCKA 2J50A 4MK0A 5EI6A 1W0XC 5I3OA 3LVPA 3LQ5A 5BVOA 4DFYA 2XCKA 2C69A 4N6ZA 5J5TA 5AV4A 4O0YA 2X8IA 2XIZA 2J9MA 4B99A 4GK3A 3QLFA 4U0IA 2EB2A 4LRKA 5J87A 4S34A 4K6ZA 3Q9XA 4IB1A 4DN5A 1YXSA 4XG4A 1VR2A 4NWMA 4JDJA 2YITA 4TKSA 4E20A 2YIRA 2XUUA 5CU4A 2F7XE 3TM0A 5FTQA 3DB6A 4Q9ZA 3SG9A 3IGGA 3R1NA 5IKWA 2WMQA 2GNIA 2UW0A 2W4OA 5IA3A 2ZB1A 5L8LA 3NX8A 4DEGA 2OJFE 3LCSA 1WMKA 4FODA 4QNAA 4WG4A 4AGDA 1WZYA 4JOAA 4DGGA 3EMGA 4BI1A 4FTOA 4O1OA 3OEFX 4TXCA 5BVKA 2J51A 4TT7A 4BHZA 4OGRA 2JIUA 4G6NA 4XH6A 1MRVA 4BB4A 2FUMA 2VWWA 2YM5A 4YTHA 3EFLA 2XVDA 4PL5A 3CPCA 5TT7A 2PMIA 3GC9A 2PVFA 5EM5A 5IQEA 4CMTA 5AUYA 1YW2A 1Y8GA 3OCGA 3HL7A 4LI5A 4FZ6A 1QL6A 3OBGA 3P5KA 5EYCA 1U4DA 4C7TA 1L8TA 2JKKA 2YM4A 4Y73A 4MQ1A 5I9VA 2G2FA 2WMUA 4NUSA 4LYNA 3OCTA 3W8LA 4YTCA 5CF8A 4AN9A 2OJGA 3KU2A 1Q8WA 3CP9A 4NJ3A 2QCSA 3GQLA 4I92A 2ZMDA 2R3IA 4DFNA 2YERA 4KRDA 3SRVB 2C4GA 2Q83A 1OPKA 3AC4A 4ZP5A 3MW1A 4FSUA 3MA3A 4O2PA 3QTWA 4FKTA 3OT3A 2XH5A 4L3JA 1OUYA 3ZO4A 3A7JA 1ZYJA 5FLFA 2FVDA 3KXXA 1FMOE 3WF9A 4YJTA 1BMKA 5HQ0A 1MRUA 3R71A 2PVRA 5IMEA 4HCTA 3IOPA 1IRKA 3CGFA 5CSXA 2UZUE 3DT1A 3ORPA 4AZVA 5HTBA 3RM7A 2P2IA 2W1GA 2FA2A 4USDA 3A7FA 3C50A 4B4LA 3GEQA 1CKPA 3Q32A 4FIHA 5HBEA 3VUMA 3ZMMA 4OTWA 4EQCA 4DH5A 5AV2A 4FA2A 1OI9A 2BIYA 4G34A 4KIKA 3CS9A 3W1FA 3ZHPC 2RG5A 5JK3A 4FG9A 4X2FA 4AW5A 4E26A 3WILA 1OIUA 4AU8A 4H1JA 3HMIA 2IVVA 3N4VA 4J7BA 2OSCA 1GIIA 4V0GB 3S4QA 4XG2A 5EDRA 3VBWA 4BDKA 4EK8A 2G01A 5F4NA 3RPVA 1Q24A 3BU6A 2BVAA 3NSZA 3QALE 1Z9XA 2XNNA 3C5UA 3R22A 2Y7JA 3ACKA 3COHA 5IQHA 4KS8A 5FBOA 4HJOA 2PVNA 2B4SB 2W0JA 3FLQA 3DAEA 1XH8A 4JAIA 4R7IA 2C3KA 3RWPA 4B0GA 3ZEWA 3BWFA 5FXQA 3FBVA 2WB8A 5DPVA 1FOTA 5KMMA 3I6WA 4C57A 4QMOA 1OBGA 3FLWA 5AFVA 4WBBB 4C2WA 3EQRA 1FVRA 2ZV2A 4YC3A 4PTEA 1J7LA 4ZZNA 4YJOA 2XYNA 3HKOA 5M4UA 2UV2A 2XRUA 3ITZA 4HVDA 4ZMFA 4BBMA 3EKKA 2YWVA 5HGIA 3GC0A 4X3FC 3E8NA 4HVGA 2SRCA 4YZCA 4L67A 3LFQA 5IF1A 2OBJA 3LOKA 3UQFA 4XHKB 4FT5A 3CQWA 3OMVA 4MF0A 3WYYA 3UNZA 5CF4A 3P7CA 3R8ZA 3D7TA 2QOCA 3F88A 5CT7A 5T6KA 3DQWA 3ROYA 3WF5A 4YMJA 2VTSA 2Z7LA 4FTMA 2UVZA 4C4IA 4U79A 4NIFB 5FM2A 4PL3A 4RSSA 4W9XA 5BVFA 5KUPA 2BHEA 2XCHA 4NKSA 4QP4A 5DWRA 4FT7A 4RVKA 4F65A 5E8WA 3RHKA 4BBEA 3HEGA 5DG5A 3UDBA 1STCE 2RGPA 1SM2A 1JKSA 3Q2JA 3MPMA 1OB3A 1YWRA 3EQPA 3QCXA 5AP4A 4FSNA 4L01A 4FK6A 3HAVA 4YC8A 4FV4A 3TNIA 1XBBA 2BAQA 4QTEA 2GDOA 2R7BA 4LL5A 2UZLA 2V0DA 3TNPC 4AQCA 1UWHA 5BQ0A 4F99A 1OL6A 2C6IA 3V6SA 1BYGA 4GK4A 2H6DA 3RK9A 4ANOA 3OWKA 1J1BA 4IIRA 2FB8A 4IDTA 3D7TB 3TN8A 3ZS5A 4EOPA 2VX3A 2LGCA 4J71A 5LARA 3N9XA 4IWPA 4LGDA 3FI2A 4UWYA 4NIFA 1Y57A 2I40A 4ARKA 1M7NA 3IQ7A 3MN3A 5J1VA 2WTJA 3NLBA 4J52A 4M0YA 4B8LA 5AUUA 1FMKA 4PL4A 4GKIA 1V0PA 3GU4A 3NW5A 3VJOA 3LMHA 5A3XA 2C0IA 3OXIA 3IDCA 4U41A 2ITOA 1ZYCA 5C01A 3MDYA 4GCJA 4C02A 1YHWA 3FEGA 4IJ9A 4MXZA 2W4JA 4FIJA 3VAPA 2Z2WA 4TZRA 4YLLA 4I5HA 5HLNA 2X4FA 4FTIA 4U97A 4M97A 4UMTA 5TKDA 2EU9A 4GT5A 4NTSA 3MVHA 5C27A 2HZNA 4FKLA 3ATTA 4O0WA 3U87A 4PY1A 4Y5HA 3KVXA 4ACGA 2FGIA 3ULZA 3V04A 2WMAA 5B2LA 1QPJA 4O91A 4H36A 4I6BA 5HO7A 3QFVA 4L6QA 3TKIA 2X2LA 4RMZA 3QA8A 4AZEA 5M4IA 3UPZA 4USFA 2EWAA 2PVYA 2PY3A 3K3IA 3KCFA 3LCKA 4J98A 2VWVA 4OTHA 3VQUA 3A60A 4FTCA 1KE5A 2VTNA 3QZGA 4L8MA 2JBOA 3TUBA 5HE0A 5EQEA 3F3TA 3EL8A 3GT8A 5AMNA 2OG8A 3PSBA 4C0TA 2WOTA 2P4IA 5L8JA 4YC6A 3GP0A 3UP2A 3ZUVA 5HD7A 3G0EA 4AA4A 2WMVA 3R02A 5GZAA 5L4QA 3NW7A 2F2UA 4GUBA 2JC6A 3R9RA 3UOJA 4I21A 2YLEA 4MCVA 4L53A 4RJ7A 5LCJA 4TN6A 1TVOA 3UODA 4AAAA 4D28A 5CQUA 3EQBA 4LMUA 2R0UA 3TNQB 3Q4UA 3EFWA 3DK6A 3OS3A 4EHZA 4FV3A 4J8NA 5T3QA 5E9EA 3C0IA 4TTHB 4K11A 5F95A 1Y91A 2R3NA 2OXYA 2CKOA 4ZS4A 1YOJA 2GFCA 4JQEA 3E62A 4IAKA 3PJCA 4FNZA 4QMLA 4D1SA 4S31A 3DBQA 5ETCA 3DPKA 3MY1A 3GCPA 3R7GA 3DB8A 3KN5A 5IDNA 4RWKA 4IVDA 3NNXA 3F3ZA 5K3YA 5D7VA 2XK9A 4KABA 4HYSA 4M13A 5HBHA 5K0XA 3OBJA 1J1CA 2IW6A 5LVLA 3RMFA 1RDQE 3SKCA 2UZBA 4QP8A 5JRSA 1YI4A 1XH4A 3GCUA 3W8QA 4QMVA 4AXAA 3BWJA 5IDPA 1WBOA 5I0BA 5IQCA 3MH1A 1Q3DA 2W96B 3R7VA 3U51A 4AN3A 4ANLA 4DTAA 2BMCA 4HNIA 5L2IA 1YDTE 3MBLA 3DKCA 4NTTA 4JQ8A 1YXVA 3F7ZA 5A54A 5J7BA 4U40A 4EI4A 5AUVA 1KOBA 2GS6A 3RWQA 2KULA 3KRXA 1O9UA 2PVKA 3S0OA 5E8ZA 4F70A 2YZAA 3CJGA 3Q5ZA 4EK4A 3MH2A 4OAUC 2X0GA 1YOLA 2V7AA 3FDNA 4RLKA 5GJGA 4BR3A 3G0FA 3P7AA 5HNBA 4TWOA 3AGMA 3TWJA 2Z60A 5IA2A 4FEVA 3CCNA 2GNHA 3DK7A 5HG7A 3E3BX 4WBOA 5C4LA 3EQHA 3Q9YA 3V5WA 3OC1A 3RTPA 3CSVA 2QG7A 3KKVA 4FE2A 2W06A 2QLQA 3JPVA 4CTCA 3PDTA 4QYYA 4D5HA 2PZYA 2XKDA 2YN8A 3PXRA 5BYYA 1JQHA 5AUZA 3UOKA 1QCFA 4FT9A 5CANA 5ITAA 2WMWA 3RGFA 4BYIA 2VAGA 4KB8A 4W4XA 4W8DA 3BLRA 1CSNA 3HDMA 3SXFA 2OJ9A 1OMWA 4PX6A 1SMHA 1REJA 2FYSA 2OFVA 2W1IA 3QZHA 4ANBA 4EH6A 3QRUA 4LV5A 4HVSA 4A9UA 4CTBA 2YCRA 1L3RE 3DLZA 2Y4PA 4P5ZA 4BDCA 4EH5A 2PE0A 3KULA 4PTGA 4MYGA 3K2LA 5HVJA 2IW9A 2V5QA 3QQGA 4G31A 4G5JA 1S9JA 4GJ2A 4ENXA 4CKJA 4EJ7A 2FSTX 2QOFA 2XIKA 2DS1A 3HMPA 4FV8A 2J5EA 3CQEA 3F66A 5A6OA 4XJ0A 3QLGA 5G6VA 5DYJA 5M56A 3QXPA 4LGHA 2EVAA 4JXFA 4PF4A 4BTKA 4ZLZA 2GQRA 1R3CA 3EQCA 3DXPA 5L2TA 4I6FA 2BAJA 1ZZLA 4YHTA 2BZKB 3G33A 3RINA 5TO8A 4NSTA 2YIXA 4BICA 2F7ZE 1M52A 1X8BA 2JKOA 3ULIA 3VF9A 2XNEA 2YCQA 3QRTA 3KULB 2UZTA 4YO4A 1KE6A 2ERZE 4LGGA 4CEGA 4FT3A 4KKEA 5CU0A 1ZRZA 3H3CA 4UALA 3FLZA 4UZHA 5HTCA 2CHLA 3IO7A 4FC0A 5EW9A 2VX1A 1FBNA 4S2ZA 2IWIA 2WGJA 2XF0A 2DWBA 1WAKA 3N4UA 4DYMA 2J0LA 2R3LA 4AOIA 4EH9A 4MHAA 1ERKA 4G5PA 4U80A 2BROA 4CQEA 3LJ1A 4QTBA 4LMNA 4IAAA 3OD6X 3UVPA 4UX9A 4FSMA 2X6EA 1OL1A 3KXNA 3ENMA 2I6LA 3KK8A 3WE8A 3ZSGA 5BUEA 3LFNA 3RPRA 4JR3A 3ZONA 2ZM1A 3II5A 5CAPA 4W8EA 3OY1A 2Q0BA 4FBXA 4OTFA 4UEUA 4AGWA 4ERKA 4BCJA 4OTGA 5AR3A 3EL7A 2YIYA 2F49A 3P86A 3TNWA 3ZH8A 3MA6A 2WOUA 3U4WA 4M69A 3A4OX 5EDPA 4DG2E 4X6QC 1H00A 3MV5A 4JBQA 4GK2A 2YCFA 4NZWB 3VBQA 4UXLA 2QKRA 5AR8A 4D5KA 4I0RA 2GHMA 3BKBA 4PDYA 3KXHA 2ITUA 1PY5A 4U81A 2X9EA 3FMDA 3Q6WA 3QTSA 4E73A 3GCQA 4F09A 5LOHA 5GINE 4F9WA 3M2WA 3HV5A 5HLWA 4BN1A 3TCPA 4BGGA 4D2VA 1YWVA 2VO3A 4YP8A 4D2RA 3VIDA 2G9XA 1YWNA 5BMSA 3COMA 3CTJA 3LAUA 5AV1A 4FV6A 1SZMA 1Y8YA 1WBTA 3IOKA 4L45A 4O7RA 2UZEA 4GW8A 3R9OA 1PJKA 4EH2A 2BHHA 4CSVA 3MIYA 2R4BA 4ZEGA 3GC8A 4FL3A 3JVSA 4JX3A 4DGMA 1LEWA 1SVHA 3FC1X 2PYWA 1O6LA 4IXPA 2WEIA 5M55A 3PSCA 4RFMA 3L1SA 3QU0A 2VWZA 2IJMA 4BI0A 2F7EE 4EZ3A 2CNQA 3BE2A 3D14A 1RQQA 2YM3A 3O8UA 3QKKA 2YIWA 4WNMA 1TKIA 4ZLOA 4L44A 3L8VA 1ZARA 3UOLA 4BZOA 4J53A 3H0YA 4IWQA 2H34A 2OXDA 2JDRA 3PG3A 4B9DA 3MY5A 4BCKA 3BU3A 4ZMEA 3LFDA 3VW6A 5AA8A 4U42A 4FTQA 4NW6A 4G6LA 4YR8A 4Q5EA 1NY3A 5HVYA 5CF6A 3R73A 2GCDA 1JKKA 1FGKA 4FK3A 4O7WA 4LOPA 5I9WA 2XB7A 1XWSA 3PA5A 5KMLA 2Y6OA 2HW6A 4MQ2A 5K5NA 2ZV8A 3HECA 2DYLA 4BCHA 4TYIA 4DFUA 3JUHA 3HZTA 1BX6A 2ESMA 2XNGA 4FKJA 1H8FA 1U5QA 4BWPA 2OIBA 5H8EA 2XJ0A 5GZ9A 4CLJA 1OIYA 4CZUA 3GQIA 2XYUA 5A4TA 3TACA 2OO8X 4TWNA 3UZPA 2YAAA 4FG8A 5HE2A 3ZXTA 3IDPA 1GIJA 5LCKA 5LXMA 2UW6A 2OF4A 5JQ8A 4FZAB 3SOCA 4A07A 2YFXA 4P4CA 4EBVA 2NNWB 4OR5A 4YJVA 5A9UA 4ANQA 2GHLA 5JN2A 5J9ZA 5HESA 5I4NA 2XK6A 4YLKA 4LOOA 4IJPA 3HV6A 3OTVA 4ID7A 4FYOA 4GFMA 2OK1A 3EN4A 3UQCA 2BRGA 2GQGA 2YDKA 3LLTA 2F2CB 2BRNA 1H1RA 2BCJA 2CN5A 3VRYA 3ZCLA 3CD3A 4F1OA 4KRCA 4E4NA 5HO8A 3I5NA 3G15A 4QQCA 4FKIA 5IUIA 2VUWA 5ETAA 2B52A 5IA1A 3HA8A 2XIYA 1OIQA 2QOKA 3D94A 4RJ3A 3FJQE 4V01A 2ITPA 2C5VA 2J90A 3R8VA 1VEBA 3I1AA 3DKOA 3TKHA 4KIQA 4D4VA 3NAXA 4USEA 1YI6A 2EUFB 3PJ1A 4E6AA 4JBPA 3LFSA 4IHPA 2O0UA 1I44A 1Z5MA 2H96A 5BMMA 4ACDA 3Q6UA 4NM7A 3FLNC 4EOIA 2WQBA 2OLCA 2CLQA 2RIOA 2FH9A 4FGBA 4BCFA 1U5RA 3LCOA 3R8UA 2BRBA 3Q3BA 2I0HA 5CU6A 2UZNA 3QWKA 3AC5A 5DT0A 4IM0A 5J9LA 3G90X 5CAOA 1XHAA 3QD4A 4U3YA 3VS7A 3PPZA 2DUVA 3RI1A 3AD5A 2C6MA 2VO6A 3PTGA 5M06A 5HTIA 1OKZA 4JBVA 4C36A 4NKAA 3F3UA 4ZJIA 3OG7A 4K18A 3LJ0A 3LFAA 3I6UA 2R0IA 4LOQA 4BDBA 1QPDA 2J4ZA 2Y4IB 4YJQA 2PE1A 5EI8A 3VBVA 5K0KA 4D9UA 4EYJA 5AP7A 4CKRA 3T9TA 4E5WA 3D5VA 2G2HA 3C4WA 1T45A 2X39A 4ORKA 5KHXA 3VC4A 4P5QA 3KMWA 2H8HA 3TV6A 1F5QA 3DXQA 2BFYA 4AFEA 3NUSA 3PRFA 3VUKA 5K4IA 4RQVA 2XBJA 2BIKB 4FKWA 4BKYA 4DINA 3QXOA 3S1HA 2HYYA 3VBTA 4DH3A 2CLXA 4IC8A 2C30A 5IH6A 3DFAA 4J99A 1VYZA 3I7BA 1H1SA 5CALA 3E8DA 5AWMA 3HV7A 4J1RA 4M0ZA 3PE1A 3IG7A 4Z7HA 3U54A 2R3OA 3PJ3A 3ALNA 4APPA 1H28A 5DE2A 3QCYA 4I4EA 3E92A 1CDKA 3GC7A 4RIYA 4BGHA 5M51A 1APME 3QX2A 2W5BA 4IZ7A 3FMLA 2QOHA 4MD7E 4DGNA 2HENA 4ZXTA 4C4GA 2XJ2A 2I0YA 2KTYA 4ERWA 4QMQA 2VTOA 2ITWA 5IU2A 3GU7A 3IW8A 4BFMA 4L7FA 4M69B 4YNOA 3TZ8A 4HZSA 2IW8A 5BUJA 3LLAA 4K8AA 4ACCA 4R7BA 3UO6A 4F6WA 3AMAA 5ANEA 3FHIA 1NW1A 4RFYA 1M7QA 2BRHA 3DTWA 1K2PA 3E93A 3VS0A 4D4RA 2O8YA 5M53A 4KBCA 3BYUA 3JYAA 5KE0A 2BZIB 3FY0A 4TYGA 5AX9A 4DBNA 3A7HA 3BQCA 5D41A 4LM5A 3UNKA 1FPUA 2J2IB 3ZM4A 2BDJA 1ZZ2A 4N57A 5JH6A 3T8OA 2OZOA 4RG0A 3DZOA 1PYXA 4OT5A 3EWHA 3Q9ZA 5HKMA 2LAVA 4CFMA 4DLIA 3OHTA 4G9CA 2JFLA 2YDJA 4JX7A 2A19B 3NAYA 3R9HA 1S9IA 3UG2A 4I3ZA 1JPAA 4PMTA 4ZTSA 4BIEA 2PZ5A 5FM3A 2OKRA 2OIQA 4I5MA 3RPOA 4EJNA 2X4ZA 2B7AA 4ANMA 3DDQA 3PXYA 3AD6A 1OECA 3UMWA 4CFVA 4KKHA 5FP6A 2YCSA 4FTLA 4IM2A 4PUZA 4BBFA 3CE3A 4QP1A 5EYDA 2A1AB 3SOAA 4IVBA 1VJYA 2VWUA 2VRXA 3L9NA 3VVHA 3Q96A 5ETIA 3CKWA 4N4SA 3GOKA 2CNVA 3NMUF 1XH6A 3V5JA 1BLXA 2PUNA 4YHFA 4A9YA 1MRYA 5IQIA 5DGZA 3RALA 2UVXA 3ENHA 1IG1A 5HORA 1YXTA 2PUPA 5IUGA 4QMTA 2ZOQA 3CPBA 3PY1A 3TTJA 3IW6A 1MUOA 2BRMA 2YDIA 1W83A 3RNYA 4EOOA 1M14A 4PDOA 1GZKA 4UXQA 2W5HA 4R3CA 4ALVA 1PYEA 3L8SA 4M3QA 2GMXA 3F69A 4IQ6A 4ZLYA 2CKEA 3IW5A 5CLPA 1FGIA 5IEVA 4C62A 3ZFYA 4O7ZA 3HMNA 4MKCA 4R3RA 3SXRA 2PZIA 3NGAA 3TIZA 3V8SA 3OWLA 3QQFA 3ODYX 3ZC5A 4AW1A 3F2NA 4F0IA 4QMNA 3PP1A 3F5PA 4GJ3A 4IAZA 4QMWA 4IE9A 4PMSA 1UNGA 2BZJA 4IH8A 3U6HA 1E1XA 4PQNA 4UYNA 3FPQA 3R83A 4O83A 1Z57A 4EWHA 2PE2A 5DEWA 4L42A 4ZJJA 4BDIA 1GJOA 5CF5A 3EHAA 4IDVA 2GFSA 3A4PA 2QO2A 3KMMA 2CSNA 5IA5A 3ZRMA 3QKLA 1Q8UA 2YWPA 4P7EA 5I9UA 3QRJA 4QYHA 2WTKB 3LM0A 3MPAA 4FX3A 5AM6A 4YJSA 2C5XA 2XNOA 2HCKA 2R3RA 3FWQA 5H2UA 4NT4A 4BCOA 3PLAE 3PZHA 5C8MA 3SXSA 4CZTA 5HCZA 4ALWA 3BLQA 5BVDA 2BUJA 3CTQA 1YI3A 3ZSIA 2WMTA 5HX6A 3VS6A 3FZSA 2CNUA 5DVRA 2JDVA 5JFXA 2Y6MA 2GTNA 3OW4A 3QF9A 4YBKA 5E7RA 3FQEA 3OUNB 4JRVA 2QR7A 4PDSA 4IZ5A 1HCLA 2JITA 2OGVA 1DI9A 1YRPA 3NUUA 3UBDA 4TYHB 5KZ0A 4B7TA 4O81A 3W16A 2CPKE 3PJ8A 5G1XA 3CEKA 2H9VA 4UWCA 2JAMA 2OH4A 2QURA 2PSQA 3R2YA 4OTIA 2NRUA 5FWKK 3SA0A 3RNIA 2C3IB 1G3NA 4R78A 3D83A 3EOCA 1LR4A 3A62A 4I6QA 5FP5A 4L00A 5ACKA 4E5BA 4E8AA 3BHUA 4HVIA 5GJFA 2R3FA 5D9HA 5ANIA 1IR3A 3F5GA 3MYGA 3PIZA 3VW8A 1PMVA 2PWLA 2OICA 3R9NA 3CKXA 4CFXA 1E1VA 1B39A 4O7YA 2PL0A 5CSHA 3ORTA 1JKLA 3I7CA 2ETRA 4EC9A 4HPUE 3ZO2A 3GGFA 5M44A 4NCTA 1OZ1A 2C0OA 4OTPA 2QOLA 4R1VA 5KCVA 3TUDA 1W82A 2ACXA 4ZOGA 3FLSA 3TJCA 4KD1A 3O8TA 3PPJA 2JLDA 5L2SA 3ZLXA 3DBDA 2CJMA 4OTRA 1Y6BA 2VGOA 3QA0A 4AOJA 3EQIA 4RX5A 2OU7A 2BZHB 1REKA 3C0HA 3FHRA 3NIEA 3NYXA 3PJ2A 5AUWA 3BPRA 4FZ7A 4PMPA 3MVMA 3RVGA 4TRLA 4IMYA 4GSBA 2CGVA 2IG7A 2GHGA 1H01A 3F3WA 4O7TA
chains in the Genus database with same CATH superfamily
4I23A 3V5QA 5E1SA 3KF4A 3L8PA 4WOVA 4IW0A 3EN6A 3FUPA 1H07A 3FMHA 2O3PA 4JNWA 4F0GA 4DHIB 3BIZA 4M8TA 4CV8A 3FSFA 3ET7A 3MESA 1H24A 4S30A 4EUTA 2ITXA 2O2UA 4EH3A 1OL2A 2HW7A 4ZSGA 4ZY6A 4MVFA 3BV3A 4FL2A 2UZWE 4CFNA 3NYNA 2GU8A 3DS6A 2YHVA 4JL9A 1OL5A 2W1DA 3FMMA 3UIUA 3ZO3A 5IPJA 2X8DA 1UU3A 5I9YA 3RCDA 4AP7A 4LRMA 5M57A 5JFVA 4EUUA 2OI4X 4Y5QA 4BKJA 3QTXA 4D2PA 5C8KA 5CQWA 2XIXA 2X7GA 3PVUA 3VUGA 1UA2A 3QTQA 2GNGA 5CEOA 4BRXA 1ST4A 5AR7A 4IACA 5FUTA 3W0PA 2C47A 4WNOA 4QT1A 4H39A 2NPQA 3DLSA 3LW0A 3ERKA 4AOTA 2QR8A 3V5TA 3VF8A 4UY9A 3G9LX 5DIAA 1NVQA 2WZJA 2NYAA 3OVVA 1YXUA 4IAFA 4EQUA 2GTMA 3O2MA 4X3JA 3PLSA 2C6KA 5IEXA 2W1FA 4MUQA 4K33A 1XBAA 2Z7QA 3B8QA 3DAKA 3ODZX 4YHJA 4WO5A 3OUKA 1TQMA 4PTCA 5T68A 4OT6A 5JMSA 4A9SA 3W0OA 3RCJA 2JFMA 3ORXA 2F9GA 4DFXE 1WBPA 2WQEA 4KIKB 5GHVA 1T46A 3Q4ZA 2GPHA 3EN7A 5DRBA 5F94A 3VBYA 3LXPA 4AA5A 3KN6A 3OOMA 2EXMA 3KA0A 1V1KA 4HYIA 5J9YA 1IA8A 3JVRA 2QHMA 2W4KA 3MPTA 1GIHA 4RC4A 2PVLA 4RIOA 4BC6A 4DEHA 2C6EA 4DTKA 4K9YA 4FTJA 2BKKA 4EHVA 2ZV7A 4EORA 3ORMA 3FYKX 2WU7A 2WU6A 3PPKA 3BE9A 4RT7A 4DA5A 4XX9A 3HMOA 1WVWA 5CVFA 4AT3A 4EWQA 4HW7A 2GNJA 2PHKA 3O23A 2W1HA 4K2RA 4O0VA 3WZDA 2E9UA 3RK7A 4A9TA 4BCMA 3MB7A 4ZZMA 4CMOA 2AEGA 3FZTA 3PIXA 5AAGA 3QRIA 4UBAA 4FVQA 5HD4A 3F5XA 1QPEA 3HUCA 4I1ZA 1ZMUA 2PTKA 3D4QA 4QMXA 1Q61A 5I9ZA 4LG4A 2CKQA 2JDSA 3IDBA 4KBAA 4WG3A 3G6HA 4MWIA 3O7LB 3KIOC 4KSQA 5CNOA 3QYWA 4L46A 5EM7A 5GNKA 1H25A 3HV4A 4HYHA 4FTTA 3P1AA 4DH8A 1ZOHA 3HYHA 2VTAA 4GT3A 3QTRA 4EK5A 4QMPA 3OP5A 3UG1A 1M17A 4R6VA 3PY3A 3R1YA 1WBVA 5E8UA 3M1SA 1MQBA 5AP0A 5LWNA 5KMIA 3OEZA 5A6NA 4C4JA 5EW8A 4CD0A 2P0CA 4HVHA 3OXZA 2REIA 1VZOA 4AE9A 4EHGA 5CXZA 3RK5A 4FSZA 5ANJA 4RWLA 5HLPA 4DH1A 5E8YA 5IUHA 4R8QA 4FJVA 2YA9A 4IAIA 2GNLA 4QMSA 4ZAUA 1GAGA 4H1MA 4O6EA 3AGLA 5BVWA 5D1JA 4O7LA 4GG7A 4M7IA 4I5PA 4RJ6A 3V6RA 3WE4A 5CX9A 5EHLA 4BI2A 2VTIA 4G3EA 3ZLWA 3U6JA 2IEWA 2QONA 3ORZA 1P4FA 5LMBA 2BTSA 1Y6AA 2A0CX 3VUTA 1H1PA 1J3HA 1PMEA 3RHXA 2UZDA 1JKTA 5EM6A 4S33A 4RX9A 5DA3A 5CEKA 2WFYA 1JNKA 3PXKA 4MNEA 4XBRA 4BVUA 2CCHA 4FEUA 3FV8A 3R6XA 4O21A 2YISA 2RFNA 3S2PA 1FQ1B 1R1WA 4FKRA 3DU8A 3L8XA 4NM3A 3BV2A 2IVTA 3OTUA 4QD6A 4WA9A 3EN5A 2BKZA 4E1ZA 2BAKA 3ORKA 1WCCA 2IO6A 4ZTQA 2WKMA 4FEXA 2CGUA 3U6IA 5CSPA 2ZJWA 3O7LD 4LUDA 2JAVA 2E9PA 5FGKA 4E7WA 4E93A 2A27A 4F7NA 4OBQA 3R7EA 4KINA 1ZYSA 5HZNA 5M07A 2UW5A 5CVGA 3U55A 3KRWA 1ZOGA 3AT3A 1Q5KA 2R3KA 4QP9A 4F6SA 3MJ2A 5HG9A 3W33A 4EOKA 2X2MA 1U54B 5AV0A 2PULA 3WZKA 4MH7A 2I7QA 4Z55A 3R00A 3KXZA 5LVOA 4O27B 1RW8A 1K9AA 2OIDA 4NH1A 3TZ7A 1PW2A 4FGRA 4WRSA 4QOXA 2B53A 3UIXA 4WT6A 4O7SA 2RFSA 5A4LA 3I60A 3MFTA 3UZRA 3WZEA 3DOGA 1GY3A 3WOWA 3BBTB 5IQGA 4O82A 4HCVA 5EHYA 4BDDA 5K4JA 5AIRA 4JDIA 1ZOEA 2IZTA 5IH5A 4UYAA 1JVPP 3C5IA 4AXFA 4DG3E 3LKMA 4F63A 2B0QA 4JMQA 4NFNA 4ZSJA 4RQKA 3DNEA 4L52A 2QG5A 1OIRA 1GNGA 1UKHA 4GFOA 3Q9WA 2PVJA 2ZDTA 2WIHA 3FQSA 3NCGA 2CCIA 3QZFA 3E3PA 5C8NA 2VTHA 3EQGA 5CSWA 4KA3A 3D15A 4KIPA 4BWKA 3KVWA 4ZJVA 3UQGA 4O7NA 4DFBA 1UV5A 3FZ1A 1FVTA 3GU8A 3G2FA 1KE7A 3SDJA 3BYVA 3FC2A 4XG6A 4Z16A 3HRBA 5BVNA 5KMOA 5M4CA 5L6WL 3W0MA 3FZPA 4QYEA 4IM3A 5DBXA 4QQTA 5HBJA 5IG1A 2VTLA 3HVCA 4FL1A 3NUNA 2X7OA 2XEYA 4HNFA 3HRCA 3ZDUA 4I93A 4XLVA 3O71A 2R9SA 4CZYB 5JRQA 5HNGA 3ZUUA 3B2WA 2JDOA 1PXKA 3GB2A 3W2SA 4E5AX 1Q99A 4BY9E 3NEWA 3MTFA 4IZYA 3VWAA 4YBJA 4KWPA 5ANDA 2HZ4A 2JDTA 4KS7A 4WG5A 3W2OA 4BIBA 4IX6A 5HICA 5BPYA 2WTWA 4A4OA 4RA4A 2Y9QA 4I6HA 3SRVA 1KV2A 4ZTLA 4LV8A 4MWHA 3CBLA 3RM6A 5JGDA 1XR1A 4XS2A 4BCGA 3SVVA 3MY0A 3BGZA 2DQ7X 4AUAA 1IASA 3K5VA 4N70A 4QP6A 3ZUTA 2CKPA 5EM8A 3D5UA 5F20A 3BU5A 4FEWA 5KKRB 2VWXA 3Q52A 3ZRLA 3CC6A 5J7HA 2QODA 4PV0A 3UVRA 3PXFA 5F9EA 2WTDA 4XG7A 3G9NA 2RFEA 4XCUA 3GU5A 2ZVAA 4HYUA 4DGLC 4XP0A 3FYJX 1JSVA 2UW8A 3EH9A 2W05A 3RPYA 4H3PA 3ZSHA 4U9AA 3E7OA 4I6LA 3D7ZA 4AZWA 2B1PA 4MXCA 5L8KA 1XMMA 1B6CB 3ANQA 1NVSA 2XK3A 3ZTXA 4OLIA 4JIKA 4G3CA 3UP7A 3EJ1A 4X2NA 1DAYA 4WSYA 3COIA 4YJUA 4C3FA 5DMZA 4X7QA 5J5SA 3PG1A 5JFSA 1KE9A 2QO9A 2RFDA 4OBPA 1FVVA 4FOBA 3VS4A 2XNPA 4IBMA 3KF7A 4R5YA 4GU9A 5CENA 1W7HA 2QOOA 3BHHA 3Q53A 4F1TA 4AWIA 2QQ7A 4NJDA 4DFZE 2QOIA 2OWBA 1Q8ZA 3QQKA 4PRJA 5DNRA 2PVMA 3BHVA 4JQ7A 5E90A 2O63A 4KKGA 4IWOA 4X6RA 3T3VA 5IQBA 4X0MA 4WNKA 2PUIA 3QQLA 4P90A 3L9PA 3ZM9A 1XH7A 3ZU7A 3MFUA 3PVGA 4YLJA 4QPAA 3OF0A 4PNKA 5E8VA 2HY0A 4FV7A 3VHEA 4XYFA 5L2WA 4OAVB 3BYOA 3KGAA 2XARA 3MTLA 3P78A 2XS0A 2EB3A 2R3HA 3EB0A 3T3UA 4ZTMA 3DZQA 4QO9A 1JAMA 5DR9A 3FE3A 3IK3A 3K5UA 4TNBA 3LFFA 3NRMA 2VZ6A 4KAOA 3QUPA 3QZIA 2YM8A 2J0IA 4FMQA 2HY81 3A8XA 3Q04A 5AR2A 2X1NA 3QQUA 4JBOA 2UZOA 4YURA 3L9MA 4EOMA 4FV5A 4RA5A 5M4FA 3DAJA 4BCNA 4AXCA 3F7WA 3AMYA 3LXKA 2GNFA 4UB7A 1LUFA 1H4LA 3MSSA 1SVEA 3SGCA 3P79A 3NUXA 4AW2A 4EH7A 3C0GA 4MAOA 5AUTA 3A7GA 2JEDA 2ZMCA 3LQ8A 2WD1A 5CI7A 5CU2A 1XMLA 4O22A 3W0NA 4AZSA 4MNEB 2HXLA 3VS5A 4BCQA 3A8WA 2E9OA 3PFQA 3CY3A 4HCUA 4QP2A 4EC8A 3KC3A 2ITZA 3QQHA 5FEEA 4HOKA 4EK3A 5A14A 4IVAA 4F64A 4O1PA 3PVWA 3WZJA 1H0WA 3WYXA 1BL6A 5KBRA 3OW3A 3QC4A 3O96A 4FTAA 5DN3A 4ZTRA 5LMKC 4XLIA 4U7ZA 3UYSA 2QI8A 4CYJA 5JZJA 4RBLA 5HHWA 3KRJA 4CG8A 4BKZA 4Y85A 4C35A 5FTGA 5IQAA 1ZY4A 4BWXA 4Z7GA 1A48A 4WSQA 5FQDC 4BDJA 4Y72A 1PXOA 3BYSA 1V0OA 4KBKA 3H0ZA 3OFMA 5AADA 3PSDA 2ITVA 4DH7A 1IAJA 2CMWA 2HAKA 5DEYA 3Q2MA 3ZO1A 4BYJA 3MGYA 2Z02A 3IECA 4FOCA 3SAYA 3FI4A 4C38A 5HO6A 3NIZA 3FMEA 3R8PA 2AUHA 2WNTA 3MH3A 3GXLA 3OCBA 4XBUA 4GIIA 3KFAA 3F82A 3RZBA 3TNHA 4FNYA 4D2SA 4FRFA 4WIHA 4GU6A 3CY2A 3FKLA 4YZBA 4FVRA 4WUAA 4F9AA 1NT2A 3PA4A 4RZVA 4C61A 4AZTA 3H9RA 1PXNA 1ZMVA 4G6OA 1KOAA 3BRBA 3H4JA 1MQ4A 5KMKA 4QP7A 5LWMA 5LQFA 1XJDA 4FTKA 5FDPA 5C1QB 2GSFA 4YJRA 4O7VA 2ERKA 4OUCA 4YSMA 3VRZA 4G17A 3AOXA 3P9JA 3ZOSA 4BCIA 4H3BA 3WBLA 4QP3A 5CI6A 5CEIA 5FG8A 3DK3A 2UW9A 4G1WA 2WMRA 4O84A 3AD4A 3F5UA 4MD8E 3UDZA 3MB6A 4CT2A 4AS0A 5CXHA 5GJDA 4AE6A 3KQ7A 3NNWA 1XKKA 4CXAA 4GKHA 4FKUA 4I24A 4NU1A 4XMOA 4GH2A 5EG3A 4RJ8A 4R7HA 3M42A 4LRJA 2J5FA 3A61A 3ZC6A 2GQSA 4QMYA 3OZ6A 3VJNA 1JWHA 3R9DA 3D2IA 4U44A 2BILB 3IGOA 3VULA 1OKVA 3WF8A 3P7BA 2IPXA 5AX3A 2ZM4A 4GYGA 1UU9A 3N4TA 5DLSA 4E4XA 3LCTA 1WBWA 3QUDA 1PF8A 4O0XA 3HUBA 2XM9A 4G16A 3UO4A 3ZEPA 3QHRA 5GIPE 1GZOA 3EZRA 2Y4IC 1GZNA 3DJ5A 2W17A 3PRIA 3E5AA 4JG8A 1PKDA 4YZDA 3LJ2A 5HIBA 2VV9A 3P4KA 4CCBA 5HNIX 1ZYDA 1OKWA 4GT4A 1OGUA 1URWA 2YLFA 4FNXA 3W2CA 2B9HA 2YEXA 2J6MA 3QD0A 5EOBA 1WBSA 2C6OA 3I81A 1AD5A 3TL8A 3AXWA 3TV7A 4IB3A 1KSWA 4FEQA 5AP2A 5LVPA 1Q4LA 4A4LA 3OXTA 2VO7A 4F7LA 4O0RA 5BX0A 4O0UA 2HZIA 4UMUA 4BDFA 2WAJA 3DCVA 3SHEA 2X9FA 3U9CA 4ALUA 4RGJA 4JDHA 3C4ZA 2UW3A 4NM5A 4K77A 2WPAA 4GYIA 4C4EA 4FT0A 2B54A 2RG6A 3GFWA 1UKIA 1PRYA 5EH0A 4YZ9A 2WTIA 3C4CA 3EYGA 5B2KA 4I20A 4KUJA 4MXOA 4O4CA 4EONA 4V0GA 2X8EA 5CT0A 4AGUA 4DT9A 1PHKA 4FKQA 4D1ZA 1UU7A 4G3FA 4RJ4A 2XP2A 4FIEA 3BLHA 3H9FA 4PPBA 3CD8A 4DT8A 3LCDA 3GCSA 3QD2B 4XRJA 4U45A 5HOAA 4GEOA 1H0VA 2YJRA 3TDVA 3E7VA 4DHFA 1BI8A 3MS9A 4Q9SA 4M67A 3WIGA 2W1EA 3RKBA 5K5XA 3UZTA 3K54A 4BDHA 3UE4A 4XEYA 3DKFA 2HK5A 4BTMA 2VTJA 3O17A 3U8WA 1VLRA 5FRIA 4FTRA 2UUEA 1RJBA 2PZPA 4D58A 2E2BA 2RF9A 2XA4A 4D0XA 4EZ7A 4ACHA 3I4BA 2VTPA 3FXZA 5CS6A 4UZDA 2CDZA 3ORLA 4RC2A 4PWNA 5TOZA 4O86A 3PE2A 3LMIA 5IA4A 3ZLYA 4BL1A 4IX3A 4F4PA 4AF3A 3BELA 3AT4A 2G2IA 1E9HA 4AGCA 5AAFA 4GS6A 3LPBA 2EXEA 3EIDA 1H1WA 5DH3A 3VN9A 3ACJA 5E8TA 4FSYA 3RP9A 3ZBFA 4IZAA 3RZFA 2ITQA 4ZS0A 5ANGA 3R7UA 5CY3A 3COKA 1F3MC 3R01A 3KCKA 4FYNA 2Z7SA 3TUCA 3WZUA 5DOSA 2WXVA 2QU5A 5DR6A 1YHVA 5AA9A 3TDWA 3FPMA 3KREA 3HP2A 5IQFA 2PK9A 3MVLA 4BZDA 1DM2A 3BQRA 2C1BA 2XNBA 4YJNA 2B9IA 2OFUA 4IAYA 3FSKA 3DJ6A 4L43A 4DCAA 1KE8A 3UJGA 3BEAA 3PVBA 4U6RA 2J7TA 3KK9A 3NS9A 4W9WA 4H3QA 3ID6C 3NVKI 2FSOX 2IZRA 4ITHA 4ZTNA 4A06A 1ND4A 5LVMA 4PMMA 1XH5A 2OW3A 3MIAA 5HE3A 1BKXA 3O50A 2ZM3A 4C3RA 1H1QA 4QTCA 4BTFA 2WMBA 3DKGA 4FSTA 3C7QA 3CQUA 4GV1A 1QMZA 4IC7A 3V51A 4DCEA 4AAYA 3REPA 2R3JA 1CM8A 4FSQA 5E4HA 1UNHA 3PWYA 4ZIMA 4C3PA 5L6PA 3LM5A 5JFWA 4YNEA 2VD5A 1PXMA 3R28A 3F2AA 3U4UA 5M09A 4OBOA 3GOPA 3AKJA 3S95A 3LMGA 1UU8A 1KWPA 4II5A 1WBNA 2UW4A 3KB7A 3OWPA 3F2RA 5EQYA 5IA0A 1A06A 4QTAA 5JKGA 2WQOA 2X2KA 4HGSA 2G15A 2O5KA 3DDPA 4KSPA 3TT0A 3UVQA 4E6DA 3QCSA 4ZZOA 4AX8A 5GZ8A 2YM7A 2IF8A 2RKUA 3AC8A 3AKKA 3SLSA 2CGXA 3BEGA 3VO3A 4Y8DA 3F61A 3W18A 3SW7A 2G1TA 4JI9A 4F1MA 3LFCA 3DGKA 3FMKA 3TEIA 3FXWA 4IANA 3FI8A 3C1XA 4RFZA 1G8AA 2NO3A 4Y83A 4AA0A 2XK4A 4DITA 3IW4A 4JJRA 3CLYA 3FKOA 3H30A 4PPAA 1ATPE 4TWPA 1W98A 3FY2A 2VGPA 2XBAA 3UIBA 5E1EA 2ETKA 2ZAZA 5AAEA 4CVAA 5CEMA 3ZFXA 3LQ3A 1SNXA 3QUEA 4X2GA 2C6TA 1G8SA 1Q8TA 2P3GX 4IX4A 4FKSA 3ANRA 3UYTA 3ZLSA 1J91A 1TQIA 3DFCB 4JR7A 2C68A 2ETMA 3R1SA 4OTQA 4PDPA 3HX4A 4OTDA 3EYHA 5CSVA 4EH8A 4FIGA 4ONAA 3Q5IA 4D4YA 1P4OA 2YZLA 3QAME 2AQXA 3KXMA 4C58A 5HVKA 4TYJA 2XNMA 3LFBA 4K0YA 1G8JA 4PP9A 5CTPA 3KXGA 5C9CA 4GVJA 3R04A 3LHJA 4ASZA 3EKNA 1URCA 4FICA 3AC2A 3POOA 1LPUA 4FKGA 4DEIA 5EKOA 4C2VA 4RZWA 3TXOA 5DFPA 5BYZA 3U9NA 3GUBA 3UIMA 2C5YA 3DXNA 5CAQA 3OOGA 3QD3A 4J96A 1PXJA 4R1YA 3VS2A 1IEPA 4D2WA 4YPSA 5EDQA 5LVNA 1ZLTA 4DBXA 1JBPE 3QL8A 5EHOA 4LQMA 1SYKA 5IH4A 4IX5A 1YDSE 5HU3A 2O65A 4PNIA 3UC4A 2R3PA 3R7IA 4X2JA 1WFCA 4F0FA 3KRRA 4CQGA 3C4FA 4F6UA 1I09A 3CXWA 2BDFA 2C1AA 3CJFA 3FXXA 4O96A 2PU8A 4ASXA 4L3PA 3UMXA 4FUXA 3WIKA 3NPCA 4CCUA 3TZMA 5ANOA 4I4FA 4G3DA 4X3FA 4U43A 4BZNA 3BHTA 3FI3A 2BALA 2WEVA 4XRLA 4BHNA 3JR1A 3ZDIA 5A4EA 4W4YA 1R39A 3D5WA 2XK8A 2OH0E 2UZVA 2JIIA 2XEZA 4PPCA 4I0TA 4YTIA 4I94A 3UTOA 1OPJA 5TE0A 1F0QA 2IVSA 5D7AA 4JIAA 5FEDA 3R2BA 3UNJA 3ORNA 4RRVA 4CV9A 2YIQA 4FF8A 4BF2A 2JIVA 5EFQA 5A4CA 4FNWA 2V62A 3FL4A 5J95A 1DAWA 3PIYA 3S3IA 4C59A 5A4QA 2VO0A 4QPSA 4YJPA 2UW7A 3JXWA 4JLCA 4L9IA 4CKIA 1ZY5A 3AG9A 3FZOA 2YACA 4WUNA 4DC2A 4FV0A 2ZV9A 2BFXA 4YGAA 4F7JA 4D55A 2BTRA 2CN8A 1P5EA 4JDKA 5DT3A 3SV0A 2ZB0A 2WTVA 3LIJA 4YU2A 1YOMA 3QRKA 5EKNA 4EK6A 2VN9A 4MTAA 4F08A 5CNNA 3GU6A 4O0TA 2JKMA 4QQJA 4A4XA 2QO7A 4GVAA 5AM7A 1ZWSA 3C4EA 3RJCA 5I5ZA 5HI2A 3NUYA 5BVEA 4BGQA 1XQZA 5TF9A 2IVUA 3R63A 4B8MA 4E4LA 1JLUE 2QKWB 4X21A 1IA9A 5LJJA 4R77A 2PPQA 2AYPA 2QD9A 2QVSE 4ZK5A 4X2KA 2WIPA 4RC3A 4HGEA 5AR4A 5C26A 1PMNA 4GUEA 4TY1A 3P23A 4JRNA 2HWPA 4XOYA 2XJ1A 3DQXA 2PVHA 4AT4A 1P2AA 3GBZA 4I41A 2R7IA 2F4JA 1TQPA 5BUIA 4RVMA 3GCVA 2RSVA 4CNHA 4E6QA 5AJQA 5EW3A 2ZDUA 4CFWA 3EQDA 5F1ZA 4K1BA 4FSRA 3ZXZA 1ZYLA 4I22A 2W5AA 5FXSA 5L3AA 3W2PA 2YAKA 2FSLX 2P2HA 5DT4A 1YXXA 3GI3A 3GNIB 4CFUA 2X0PA 4CRLA 4E6CA 1SVGA 3ZZWA 2C3JA 2C0TA 1H08A 4EKLA 3O51A 5AP6A 3ALOA 3E87A 4O2ZA 1FINA 4TPTA 1YDRE 2BDWA 2W99B 3E8EA 2IN6A 2HIWA 5C03A 1CKJA 2PZRA 3KEXA 4APCA 4XP2A 4RIYB 4U5JA 2QOBA 3Q60A 4O0SA 2EXCX 3JY9A 2OZAA 4Z3VA 2C6LA 4QNYA 4LL0A 1W84A 4MBIA 3TI1A 4ZY5A 4DHJA 3FL5A 3NYOA 4A9RA 4C33A 2YABA 4EYMA 3THBA 3QC9A 5IMXA 4NYEA 1QPCA 2WTKC 3BYMA 3Q4TA 4MX9A 3G51A 4TW9A 1W2CA 4G3GA 5HEZA 4JAJA 4V05A 4XV9A 2B9JA 1XBCA 3O5AA 3OROA 3IS5A 4RVLA 4A7CA 4AACA 2YM6A 4O4BB 4AT5A 4D4SA 5IQDA 4XNEA 1EH4A 2JGZA 3BX5A 4ANSA 4TL0A 3F3VA 3RAKA 4M68A 3QTIA 1JSUA 2C5OA 2R2PA 4YTFA 3BBWA 3DBEA 2R3QA 3R7OA 5J1WA 1K3AA 4UMQA 2AC5A 5E91A 3MI9A 1IAHA 3CGOA 2Y0AA 3NR9A 4EEVA 2W1ZA 2XKEA 4FUYA 5JSMA 5HIDA 3HAMA 3TIYA 1LEZA 3V5LA 5J79A 3VUHA 4YUQA 3NNVA 1Q8YA 5BNJA 2V7OA 4BDEA 4E4MA 5ANKA 5IZFA 4V04A 1P14A 3VUDA 4HGLA 5B7VA 4M15A 2C3LA 4RWIA 3SG8A 1CMKE 5EYKA 4EOJA 4NK9A 3EQFA 3TKUA 5KMJA 2WMSA 4JT3A 5KZIA 3TZ9A 3ZBXA 4FV2A 1GZ8A 3NWWA 4O6LA 3UC3A 1J7UA 1XH9A 4NEUA 2HELA 2E9NA 4J8MA 3NVMB 3MH0A 5CVHA 3RBWA 2C6DA 3V3VA 4IADA 3D9VA 1Q97A 4H05A 4WNPA 2WQNA 2WELA 4M12A 3C4XA 5HCXA 3MWUA 4QYGA 3PWDA 2V22A 3PXQA 4N0SA 3NDMA 3W10A 1AGWA 3V5PA 5EYMA 1V0BA 2B55A 2ONLC 4CGAA 3VS3A 4DLJA 4RIXA 2Z8CA 3VS1A 4UV0A 4ZY4A 4FVPA 3MVJA 5AP3A 5JZNA 5I9XA 4HPTE 3PYYA 4F9BA 2V55A 4QQ5A 1OVEA 2VX0A 4WD5A 3WARA 2QU6A 1R0EA 2X81A 5IEYA 1OUKA 2QLUA 3FAAA 3FMNA 3E8CA 5JGBA 5EQPA 2IZSA 2NRYA 3G5DA 2Z7RA 2VTQA 4M84A 3QCQA 4OW8A 3F9NA 3TV4A 2WMXA 4ANNA 4BIDA 2OJJA 3GENA 2HZ0A 4Y95A 3BGQA 5E92A 3AC1A 1AQ1A 2XIRA 3ETAA 4QMZA 5KMNA 2OXXA 4ITIA 5E8SA 4AFJA 3PXZA 3M11A 3SD0A 3TTIA 5FXRA 3E64A 4BCPA 1B38A 2RL5A 1WVYA 4RLLA 5GIOE 2R3GA 5JQ5A 3FLYA 3OY3A 3KY2A 3EZVA 4FV9A 2C5NA 4RIWB 2FSMX 2I0EA 1YHSA 3DNDA 4FTNA 4D9TA 1O6KA 3UO5A 4FKVA 3PZEA 4BDAA 5LMKA 2HOGA 4EBWA 5B2MA 4EHEA 2WHBA 4MEDA 5D10A 5FTOA 3C51A 3D5XA 3FMJA 4MD9E 4L7SA 5D11A 4C37A 4TYHA 2VTMA 3ELJA 4TWCA 5M08A 3IPHA 2F57A 4X3FB 4F9CA 4XG3A 2Q0NA 2QNJA 4P2KA 3HGKA 4JG7A 4HGTA 4W4WA 3C13A 4DFLA 1CKIA 3PUFC 5H9BA 2JD5A 5HE1A 4MNFA 2WO6A 1R0PA 1MP8A 3TJDA 3DA6A 3DJ7A 2X6DA 3C9WA 4RIWA 4DTBA 3DV3A 2XAOA 3JY0A 1UVRA 3ZFMA 1DS5A 3QBNA 1JOWB 3I79A 5CAUA 3ATSA 4CG9A 4NL0A 1J7IA 5DI1A 3E63A 3B8RA 4AG8A 2PMNX 4TNDA 2VNWA 5CWZA 4HZRA 1CTPE 1M2QA 2W9FB 3NNUA 3QQJA 3WF7A 3G6GA 3VQHA 3VBXA 2ITNA 2PMOX 2W1CA 1H27A 4J95A 5I3RA 4F9YA 3V8TA 1RE8A 3DBFA 3WF6A 2J0JA 3PY0A 3NUAA 3DTCA 4RX8A 4FI1A 4RJ5A 3W2RA 3EFJA 3I0QA 4QPMA 4DEDA 4MF1A 2R64A 4FZDB 1PXLA 3E88A 3OCSA 4PP7A 1PMUA 3EN9A 3BI6A 3R30A 2PUUA 4DGOA 1NA7A 1PXIA 3GVUA 2W7XA 2Y8OA 1ZXEA 4GMYA 3A99A 5EI2A 1UNLA 2OF2A 5DHJA 3B2TA 3R21A 4DF3A 3QWJA 4IB0A 1OBDA 1YVJA 3O0GA 4KIOA 3VUIA 4RX7A 1BUHA 3DBCA 4WHZA 3AMBA 3HRFA 4N6YA 4YSJA 3CR0A 5AIKA 5CEPA 1U54A 3QX4A 4EOQA 3QGYA 4W4VA 1A9UA 3A2CA 4QYFA 5HG5A 1O6YA 3TYKA 1OKYA 2ITYA 3QKMA 3W32A 1DI8A 4ACMA 3SW4A 2UVYA 3OT8A 3O8PA 3L9LA 4U3ZA 4EL9A 1NXKA 4Y46A 3HLLA 2XKCA 3LXNA 4EOLA 4FIIA 1TZDA 4EQMA 1OL7A 3NYVA 4IWDA 2OJIA 5CU3A 5AP1A 4ZSLA 4XG8A 4XOZA 1W8CA 4ITJA 3KRLA 5AEPA 4R3PA 4MXYA 1OITA 1H26A 1WVXA 2VU3A 3R1QA 4NW5A 5JEBA 3CIKA 2QHNA 4RPVA 4TYEA 5FBNC 2OZAB 4AW0A 4FSWA 5H8GA 4DEEA 1NVRA 3QGWA 3HA6A 5EOLA 4ZTHA 5AR5A 4BDGA 3NZ0A 2GS2A 5KNJA 5H8BA 4LFIA 2AC3A 5B0XA 3LE6A 3HNGA 1Q41A 1VYWA 3Q4CA 4NCTC 5L2QA