5LWNA

Crystal structure of jak3 in complex with compound 5 (fm409)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
290
structure length
290
Chain Sequence
PTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRALAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGSERDVPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWSGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase JAK3
publication title Selective JAK3 Inhibitors with a Covalent Reversible Binding Mode Targeting a New Induced Fit Binding Pocket.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 290
sequence length 290
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5lwnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5lwnA01
2VX3A 3V5JA 4LRMA 3KL8A 3D83A 4AN3A 3KKVA 5AP7A 2BFYA 2X6DA 4DG2E 3BYUA 4Y85A 4WHZA 2JIIA 4NYEA 4JS8A 1FVVA 2F9GA 2ITPA 3LKMA 3H0ZA 5BVDA 5IEVA 2WQBA 3ZC6A 2RFEA 4EOMA 4I0RA 3KF7A 2ZYBA 4A9YA 5J5SA 4C34A 1ATPE 4FBXA 2UZNA 3QXPA 4H3BA 2VTNA 4AT4A 4F9AA 3V5TA 4E73A 4EC9A 2R9SA 2JDSA 2LGCA 3O17A 2V5QA 3MS9A 5F4NA 1H1SA 2C6OA 4H1MA 3RBWA 2PUUA 5IQGA 3R01A 3O8UA 3MJ2A 4MBIA 5H8EA 3ACJA 3EQPA 5HCYA 3I0QA 3MVMA 3UG2A 4YJQA 4QQCA 2PE2A 5CSVA 2FSOX 2YM4A 4GMYA 4MQ2A 4X2NA 3K5VA 3NW5A 5EYKA 3U9NA 4D9TA 3KFAA 5HICA 3W2PA 3HECA 4DGOA 2JBPA 3QF9A 1WBOA 3HNGA 3LM0A 1KV2A 1ZYDA 3BCEA 4FKUA 1NT2A 1UWJA 5IZFA 4TXCA 5AWMA 3D14A 4BCKA 3KXNA 2CMWA 4ALWA 4W9WA 2UVZA 3C4CA 5JEBA 3OG7A 4ZSEA 3R83A 2VRXA 2NNWB 3ZLYA 2YWVA 2IW8A 2CKPA 4XBUA 3L8VA 5ITAA 1W8CA 3T3UA 3K3JA 3UP2A 4H3PA 4BCPA 5CU0A 4LUEA 4WNOA 4M12A 4QMLA 3ZZEA 4DITA 4CQEA 4ZTSA 3ZYAA 4AT3A 5LVPA 3PY1A 4M66A 3PJ1A 4MYGA 5J95A 1URWA 5CU3A 2H96A 3QA0A 4BZDA 4B8LA 1O6KA 3RK7A 4G5JA 4J8MA 3SD0A 2BAJA 4WG5A 1WBVA 5AP2A 1ZMVA 4U5JA 3UZPA 3VJNA 2VTJA 3FPMA 5CALA 4CRSA 1OL2A 3PE1A 4A7CA 5ACKA 3VS7A 3ENHA 4EK5A 3ZO1A 3D5VA 3UPXA 2ZAZA 3R1QA 4RPVA 3UVQA 1GIHA 5KMKA 4O7RA 4ZMEA 1O9UA 4G3FA 3QC9A 1YKRA 3QTQA 1SZMA 3CE3A 3DAEA 3EN7A 3DV3A 3MDYA 4RJ4A 4F9BA 2A19B 2JAVA 3ZO4A 4UEUA 1XWSA 5AUYA 4TYHB 5EDRA 4ZY6A 5J5TA 3IS5A 2R3KA 3OXZA 3RAKA 4DTKA 4FIEA 3MFRA 5CNNA 3QX4A 3QWKA 3NAYA 3HEGA 4DTAA 3RK5A 3SDJA 2GTMA 4E6AA 5JRQA 2QOHA 1TQMA 3QRTA 4N6YA 5C03A 3U8WA 5HD4A 3CEKA 3NAXA 2WHBA 2XKDA 4X3FB 4BBFA 4D4RA 5IF1A 4UWBA 3BLRA 4W4YA 1KE6A 4FVQA 4BY9E 3H9FA 4F64A 5JFXA 1O6LA 3F2AA 2BIKB 3Q2JA 4IJPA 2WD1A 4FSNA 2ITNA 4RT7A 4I0TA 4EC8A 4QD6A 3FHRA 3LXNA 1J1CA 1IAJA 2OXDA 2I0HA 3HV6A 5FDXA 5E9EA 3V8TA 1OL6A 4F09A 4FNYA 3AC4A 4EK3A 2XK7A 3C5UA 2XA4A 4F70A 3C5IA 3R7GA 4RFZA 2RG6A 3HL7A 4F0IA 3IGOA 3BV3A 3CJGA 5DE2A 2C3LA 4RIXA 3WF8A 3WF9A 4ASZA 1Q4LA 5DR2A 4PNIA 5IUIA 4CFVA 4CLJA 5KMLA 5E8TA 3ODZX 5K5XA 2QOFA 3TNQB 4EQCA 5I0BA 1XBCA 4RWJA 4BCMA 3PA4A 2PVKA 5JFWA 2GFSA 2W17A 5DEYA 2XZSA 4NJDA 3K54A 3PIZA 2QO2A 3JYAA 3RZBA 4FSRA 4FV5A 4BDCA 4Y72A 5IISA 4Z3VA 1PRYA 4JOAA 4RX9A 1CTPE 1R78A 4KIKB 4LV5A 2CLXA 2ITOA 2HZNA 4EUUA 5BQ0A 3LQ5A 3EWHA 4TT7A 5HE1A 1Q24A 2ETRA 1JKKA 2X8IA 2BZJA 2J9MA 4HYHA 3BU5A 4YC8A 4YO4A 2PVNA 4XRJA 4H05A 3U54A 2I0YA 4TWOA 3KXXA 3R2YA 3RPOA 2VWIA 1XH9A 4RBLA 4FKPA 5HX8A 3EN5A 4EOJA 4WBOA 5AUXA 2AC5A 1NA7A 2ITUA 5KZIA 4AE9A 4BRXA 4IAFA 1GZOA 1UWHA 4FODA 1IR3A 2RSVA 3R9NA 4NU1A 2X8DA 2Z8CA 2W1FA 3CQUA 3F5UA 3L8SA 4ANOA 3VUDA 4P90A 4R5YA 3Q52A 2OKRA 5M51A 4FTJA 1XHAA 2ZVAA 3ACKA 3QLGA 3ZDIA 2I40A 5LOHA 4FEWA 1WMKA 4ENXA 4XYFA 2W1GA 2YABA 3QYZA 3TIZA 3ZFMA 1YWVA 2CGWA 3QD2B 4FX3A 3FWQA 4XV2A 2ZMDA 5C8KA 2ZV2A 3VN9A 2GNIA 4XG6A 2F49A 3QXOA 4YHFA 3RKBA 4BIDA 4PMPA 2XMYA 5A4LA 3GI3A 4YLJA 4Y83A 5E8WA 4IX4A 3RALA 4BTJA 3R73A 3NWWA 1ZRZA 4LUDA 2Z60A 1JOWB 2YM8A 5CT0A 5JZJA 2QCSA 5E8UA 4BWPA 2XIKA 4IB5A 1G8SA 3KMWA 4Q2AA 1M52A 3LM5A 1RJBA 4DG0E 2J5EA 2W5BA 3VUHA 4BCIA 5J7BA 4R1YA 4P7EA 1Q8YA 5GHVA 5AFVA 3WZEA 4ERWA 1UU8A 3R6XA 3EFJA 2B52A 4C2VA 3E3BX 3HV4A 4IZ5A 4QT1A 3I7BA 5HKMA 1O6YA 3FBVA 4ACHA 2PYWA 4EOKA 4B6LA 4QTDA 1Z5MA 4BN1A 3MY0A 3W10A 3FZPA 3RM7A 3VAPA 3SKCA 4IMYA 2VTQA 2XEYA 2UW3A 4LG4A 4IDVA 4B99A 4HW7A 2EXMA 4JAIA 4FSTA 1GJOA 5IH4A 5HVKA 5I9YA 3C4FA 1Q3DA 3C0HA 2X2LA 3P4KA 5KBRA 3ZU7A 5EYDA 5AP5A 2OXXA 4RQVA 3S3IA 5IH5A 2PPQA 3QRUA 5KKRB 4G3CA 3TM0A 1P2AA 2UW0A 1KE5A 4FT7A 3Q96A 4AS0A 3COIA 1URCA 2JIUA 4R7HA 4ZIMA 2BDWA 4XCUA 3DK6A 4FSQA 4GG5A 2WTKB 3CKWA 5I4NA 2WU7A 4YMJA 3QGYA 1W98A 2R0IA 2R3GA 3GQLA 4L53A 3FSFA 4J53A 2B1PA 2CGVA 4F0FA 4O83A 1IEPA 4O0RA 3O8TA 2VX0A 3QHWA 4OT5A 5M09A 2YM7A 3DTCA 4UZHA 3ZTXA 2YHVA 5E1EA 5T3QA 3RPVA 4LRJA 3LFEA 3NSZA 4GJ3A 5KE0A 1UVRA 4IW0A 4Z7HA 3TEIA 4O96A 3FXXA 4FICA 5J8IA 5JKGA 1SYKA 3BGZA 4C7TA 2GPHA 4AW0A 4D9UA 5CEOA 2JKQA 2PZ5A 3QKKA 1NVQA 4E6CA 4CNHA 4JNWA 2BHHA 5EH0A 3KRJA 4O7NA 3ZEPA 5A14A 5HE2A 4XLVA 4XV9A 3QRIA 3F2RA 4AE6A 1GAGA 4JQ8A 4YJRA 2WMBA 2VV9A 2C5YA 2W4KA 2BDJA 1ZYJA 4XRLA 1LPUA 2YLEA 2W1ZA 1BI8A 2OIBA 2XM8A 4MH7A 4NH1A 5HU9A 4O7WA 3KXMA 4QNYA 3PLSA 3C0GA 1H1RA 4IADA 4NKAA 3SQQA 4QTAA 3SOCA 3UO6A 3OCSA 5CAVA 4R1VA 4FYNA 4D4VA 2DWBA 3ZLXA 3DT1A 4I21A 4MNEB 5BUJA 2PVLA 1P5EA 5IQDA 3QAME 5FBNC 2B9IA 1BMKA 2VGOA 4D4YA 4EHEA 4O22A 5EM6A 5CS6A 4UB7A 3OXIA 4FTAA 3MESA 4PP9A 4FA2A 2Q0BA 2CDZA 2RG5A 4ZXTA 3G2FA 4G3DA 4YZCA 4EBVA 4ID7A 4BDGA 4DGLC 5EK7A 4OTHA 5FEEA 4E6DA 3P86A 2BRMA 4G6OA 5K5NA 4YZBA 4X2GA 4BKZA 4XG2A 3KREA 4L8MA 4RIYA 4ALVA 1HOWA 3LXKA 1W7HA 3EQBA 2YM5A 3NEWA 2CPKE 4CKRA 3OOGA 3PTGA 5HIBA 3IECA 4Y95A 4BIEA 1FQ1B 4KB8A 3VQHA 3O2MA 3UZTA 3CGFA 2XK6A 3KA0A 3BGPA 2R3PA 3DPKA 1UNGA 3KMUA 3KXHA 3OC1A 4GVJA 4LL0A 5EKOA 3R9DA 5JFSA 4X2JA 2OZAB 3F5PA 2F2UA 3DCVA 4I6QA 3TZMA 3BX5A 3T3VA 4P5ZA 4WRGA 4AZSA 4E3CA 3NLBA 3QCQA 2WMUA 3TNPC 1OIRA 2ITTA 5HZNA 4GJ2A 1SVGA 3WF5A 3FMEA 3NYVA 3QUEA 4AN9A 4ANSA 4E4LA 4JRVA 3F5GA 4M97A 3PP0A 4FL2A 4CV8A 3RTPA 3DJ5A 1Q8ZA 3C9WA 3MH2A 4IEBA 4EK6A 3OWLA 3GC0A 3PWYA 3KRXA 2H9VA 2OJJA 3FY2A 5BYZA 1REJA 5IQEA 3UQFA 4XHKB 2F7EE 5IH6A 4G6LA 4JLCA 2JDVA 4U80A 4HGLA 2X6EA 4AW5A 2V55A 4MXZA 2ETMA 5J1VA 3AD4A 3S95A 2ITZA 4YHTA 4MX9A 3PIYA 5EDQA 1WBSA 3NNUA 3CTQA 3GU4A 3TN8A 4ALUA 3EKNA 4YTFA 5C4LA 1ZYLA 4IVDA 4EONA 3NNVA 5DFPA 3F82A 2YAAA 1U54A 2FSTX 2WEIA 3BPRA 4X2FA 3E64A 4QYHA 1QPDA 4CVAA 4R8QA 2OFUA 1OPLA 3UNZA 1YHWA 3FKLA 4E8AA 1OMWA 2YDIA 3BHTA 3ORXA 3HRCA 3QALE 4C62A 1DI9A 1Q8WA 3H10A 5B2KA 2G01A 2ESMA 1TVOA 3FPQA 3SAYA 3W2SA 3FI2A 3QCXA 5CEPA 5GJFA 3VBXA 4O7SA 2OU7A 3DJ7A 4E5WA 5LWNA 3NZ0A 3OP5A 2JITA 3SXRA 4GFMA 5LWMA 3BBWA 4CZYB 2AC3A 3CY3A 3RGFA 4DGGA 5F1ZA 4J99A 3O96A 4PNKA 5E8YA 2W1DA 5EOLA 3VHKA 4DFLA 3KVXA 4YTCA 3OWPA 4QMVA 1KOAA 4XNEA 4I92A 4ZSJA 2WKMA 5JRSA 5LXMA 4MF1A 2BR1A 3TDWA 5AJQA 1OKVA 3QTWA 3RZFA 4F99A 4UV0A 3UBDA 3OOMA 4D4SA 1NW1A 5TT7A 2XKCA 5L2WA 5ETAA 2HOGA 3UYSA 4L42A 5DT4A 5IA4A 4IWDA 4CEGA 3F7WA 4F7SA 1ZARA 5K0KA 2B9HA 5FRIA 4KIPA 4QMTA 4DH7A 1NVSA 2JD5A 2YCRA 3OCGA 4DFBA 1H8FA 3W8QA 3EFLA 2BTSA 2YN8A 4MXYA 3TKIA 3UYTA 4YBKA 2YZLA 2Z7QA 5CEIA 4TPTA 4D55A 2G1TA 3EQFA 3ZSGA 4Y73A 2UW4A 4FV2A 4PTEA 3ZONA 3RK9A 4EK4A 2PZPA 4HYSA 2A0CX 2J0LA 4IB3A 3G6GA 2O63A 5EM5A 1UNLA 3FLYA 4EZ5A 4GT5A 3DZOA 3UO4A 5AR3A 3MY5A 4EYMA 5L6PA 2W96B 1SM2A 1YVJA 5FM3A 3V6RA 3IW8A 5HBJA 4UMRA 4E5BA 3TIYA 4YBJA 4OW8A 3GEQA 4EOSA 4K1BA 3DLZA 2VAGA 3BWFA 3ET7A 4BZNA 3QA8A 1Q99A 2RIOA 4BDKA 4DAWA 4EEVA 4DT8A 3KQ7A 4J7BA 2B55A 5J79A 1Y8YA 2J0KA 3LW0A 3V3VA 4CCUA 3NVKI 3QTSA 2Q83A 1Y6AA 1QPCA 2BAQA 4L45A 2BVAA 2JKOA 3CLYA 2XBAA 3A7IA 1PMNA 3VRYA 4HYIA 5ICPA 4C3PA 3G90X 4XG7A 4BCGA 4A9SA 2I0EA 4OGRA 1HCLA 4QMOA 3AC3A 4QNAA 4JBPA 4BKJA 2BDFA 5IQFA 3AMBA 4FYOA 3GC7A 4BTFA 4D0WA 1BYGA 2PZRA 1BX6A 2XRUA 3E8EA 3EN9A 3L9PA 3O51A 4MQ1A 2BFXA 2Y0AA 3DAKA 3DS6A 5AUWA 5M53A 1FMKA 3JPVA 3ERKA 3UVRA 3HX4A 2GHGA 5L2TA 3ZRLA 3DBEA 1OZ1A 3SA0A 2QOIA 2Y9QA 4R3RA 4BR3A 2GNGA 4HOKA 3Q9YA 4FTIA 2QKWB 1AD5A 3EN6A 2IZUA 4JBQA 2PVHA 2YM3A 4KS7A 3ZCLA 1SVHA 2J2IB 4GK2A 4JDIA 4LGGA 3QQGA 2HENA 4OBPA 4IJ9A 1H27A 3IKAA 4GUEA 2UZLA 4AZWA 5A54A 3NUPA 4KD1A 1F0QA 3OXTA 4I5PA 3QCYA 3G5DA 3IOPA 3T9IA 4FTCA 5FXSA 4EOPA 4IX5A 5I3RA 4IHPA 2XJ0A 2ITYA 3ORMA 4DEBA 3GU5A 4JX7A 2JAMA 2ZV8A 5HLPA 4BZOA 2X39A 3JY0A 4YTIA 3PVGA 2IVUA 3SOAA 4A9RA 1GZ8A 2A4LA 3MFTA 4X21A 3UVPA 5LVLA 5K3YA 4RC4A 3QTIA 4M68A 3QQUA 4P5QA 4AXAA 4AACA 4BCNA 2B54A 2YM6A 4RWKA 1Q97A 3UZRA 2QC6A 3DDQA 4XG8A 2VZ6A 4S34A 3AD6A 3D0EA 5CX9A 5FP6A 4A9TA 4APPA 1YWNA 2C4GA 2X9EA 4IAKA 1UKIA 3DA6A 4CFFA 3QQHA 2CJMA 2W1IA 3BEAA 3KULB 2C47A 5CLPA 5I9XA 4FK6A 5LJJA 5FP5A 5ACBC 3AQVA 3EJ1A 4RGJA 3AC2A 3VC4A 4QMZA 2PMIA 4D2VA 2PVMA 2VO3A 1R0EA 4BI2A 1YI4A 5IG1A 3UNKA 3PVUA 2VTSA 3BHUA 3Q4ZA 3FMMA 3U9CA 2RFSA 2W5HA 3AT2A 2QG7A 3E8CA 3UODA 3MH3A 4NEUA 3ZO3A 3HA8A 5AA9A 3BQRA 4B0GA 2H34A 4DC2A 4PTCA 5I9UA 2DQ7X 3VQUA 4D58A 2R7IA 3NUUA 2OIQA 2V7OA 4C4HA 1QPJA 3ZM9A 3QUPA 3LFFA 1H07A 3L1SA 5DLSA 4LFIA 2ZV9A 3MVJA 2YEXA 5HGIA 3FDNA 4ZK5A 3F7ZA 3BYSA 4FL3A 3PRIA 4Q9ZA 3P7BA 4IB0A 1U4DA 3SG8A 5FTGA 5EYCA 2XEZA 4IB1A 1F3MC 1W0XC 3OS3A 2YITA 3RHKA 3BU3A 4NSTA 1VYWA 2WZJA 4EH4A 4WBBB 4OBOA 3E8DA 4A4LA 4L46A 5JH6A 2OWBA 3L9NA 3NNWA 4TKSA 5EQPA 2WQOA 2ITXA 4I1ZA 4KIQA 4X3FA 2FO0A 4AOIA 3ZSIA 3H3CA 4XP0A 3FLQA 4CFUA 3LXPA 2BRBA 2C3JA 4I24A 1G3NA 3RAIA 1GZNA 2PZIA 1DS5A 3LAUA 5CENA 1ZYCA 1MRYA 4WRSA 1X8BA 3MJ1A 3NYNA 5HBEA 4GYIA 2BRHA 3MIAA 3W55A 2YIWA 2XK8A 1WVYA 4YHJA 4BFMA 4FEUA 1MQ4A 3HVCA 4PMSA 4RX8A 3BQCA 3UP7A 4II5A 3EMGA 3AMAA 4AFJA 3TI1A 4DEHA 1IA9A 1SNUA 5HVYA 5KMMA 2P4IA 3E93A 5BVKA 3F6XA 2KTYA 4F63A 3OF0A 4C4EA 3ZH8A 2WGJA 4QPAA 1NXKA 2GHLA 3FZSA 4JRNA 5AX9A 3H9OA 4FTLA 4FIJA 5AP6A 2ITWA 3HP2A 3DFAA 3EQCA 5EW8A 3PVBA 3PUPA 2Z7RA 2HZ4A 4ACCA 4EHVA 1K2PA 4H36A 3GOPA 4IX3A 3QD0A 3FQHA 2BZKB 4OTDA 4EOIA 2OH0E 2IPXA 4UYNA 4YJSA 5JGDA 2WPAA 3HMOA 2HCKA 3F66A 3Q9XA 2CN8A 3T8OA 4KIKA 2ZV7A 3TNWA 4QTEA 5LVOA 4NCTA 1GNGA 3ORKA 2RGPA 3O8PA 3R8ZA 4JG6A 2VO6A 3MA3A 2BTRA 1UU9A 1XH8A 3FC2A 3WF7A 2ZJWA 3R21A 3KXGA 4YU2A 4G17A 4UY9A 4Y5QA 2WOTA 4I93A 3VVHA 3SLSA 2JDRA 3PG3A 3A60A 1GIJA 5DGZA 4YZNA 2HIWA 3ZSHA 5HHWA 4C59A 2CNQA 1ERKA 3LCSA 5AR7A 2R5TA 4FV9A 4QYFA 4R6VA 4W8EA 5D11A 5JT2A 2EUFB 4FTTA 5BNJA 5J9YA 2X2KA 4FZ7A 3VUTA 4DYMA 5IQIA 5EDPA 4EORA 3DBCA 4ZTQA 3DBDA 4EWQA 3LE6A 3QHRA 4I0SA 1KV1A 3E92A 5D12A 2J0IA 5HTIA 4V0GA 3WZDA 4DH8A 4FV7A 2DYLA 3U6IA 3HGKA 4RJ6A 5KNJA 4CG8A 3G9NA 4ENYA 4XOZA 4TWPA 4FV6A 5DR6A 3HLLA 3KN6A 4DH3A 1UV5A 3ZOSA 3AT4A 4QMPA 3BELA 5K0XA 4O7YA 3OW4A 4BGHA 5FEDA 3TJDA 5D7AA 3LLTA 3GP0A 1M2QA 3E7VA 4TL0A 4HVHA 2XKEA 3FMHA 1DAYA 3FEGA 2FA2A 4ASXA 4FIFA 3P9JA 3MTFA 2CCHA 3VW8A 3RMFA 5LQFA 2GNLA 4NZWB 4RVMA 3W2CA 3P5KA 3GENA 4AX8A 1F5QA 2PE1A 1BL6A 3EQIA 2BALA 4FTOA 3TWJA 2OJFE 4U40A 5C4KA 1YI6A 5AEPA 4ZY5A 2BZIB 3PPKA 3EIDA 4FV4A 3GCSA 4AGUA 4FOCA 2W1HA 4FT5A 4FVPA 4QYEA 1OL1A 2BZHB 2VN9A 3MYGA 4YURA 3A8WA 4PL5A 2F4JA 3RCJA 1OKZA 5AM7A 4C37A 3PZEA 4W4XA 3LVPA 3RINA 3WZUA 4PUZA 3R28A 4FUYA 1A06A 3E62A 4X3FC 4XJ0A 3SRVA 3CCNA 4LGHA 4F6WA 4J71A 5CU4A 2OJIA 4JR3A 3ZXZA 4EHGA 4C4GA 1H08A 5EFQA 3W8LA 2XNGA 3RHXA 2P2HA 4CFWA 4PDSA 4DLIA 2X7GA 2EB2A 4EKLA 4RJ8A 2O8YA 4L44A 3VS0A 1H01A 2X2MA 3LFDA 4IWPA 4AA5A 5IUHA 2DUVA 5LVMA 4BCOA 1XQZA 2BRNA 5HO8A 4V01A 4ZS4A 2JDOA 4NM5A 2OJGA 2XNBA 3IGGA 5AV3A 1YDSE 3DU8A 5TR6A 3COHA 3MTLA 4BDIA 5M44A 3A2CA 3CJFA 3LJ2A 5IMEA 3P1AA 2PTKA 4YJTA 4YTHA 3TDVA 5AR8A 4BDHA 5CSHA 2W1CA 4HNIA 2G9XA 2ZM1A 1ZZLA 2W1EA 4HZRA 4IAAA 4U42A 2ITVA 4YJPA 3ZZWA 4BDDA 4C33A 4DCEA 3HAVA 4CXAA 5HU3A 3R8LA 3SV0A 2HWPA 2GS7A 4FIGA 3VBQA 3TKUA 5AADA 2XIRA 4U44A 2X8EA 4UZDA 4QPMA 1PJKA 5G6VA 4D2SA 2WEVA 4ZSLA 4L00A 2X9FA 4WSYA 2ZM4A 2F57A 2OW3A 1PMVA 1S9IA 5BVEA 4A06A 4AW2A 3ZLWA 4EUTA 1DAWA 5EI8A 3W2RA 3HP5A 4DG3E 4F6UA 2QHNA 3K3IA 4PPCA 2WMRA 4NW6A 2XNPA 4NCTC 4FSYA 5FWKK 3CGOA 2C69A 5T68A 3M11A 2ERKA 3UNJA 3PSDA 4G9CA 4BVUA 3PXZA 3ZM4A 4ITJA 2B9FA 3I6UA 2OI4X 3R63A 2YIRA 4GU9A 3R7VA 4C58A 5L2IA 4USDA 4IANA 5CF5A 4QMNA 5AAEA 5J9ZA 4JQ7A 5GZ9A 4K6ZA 2Z2WA 3WOWA 5K9IA 5D7VA 2G2FA 4C38A 2OZAA 1ZOGA 3L9LA 2PVFA 2QO7A 3QQFA 4MBJA 4M0YA 3D7ZA 5HCZA 1E1XA 2NP8A 3NCGA 2C3KA 1REKA 2I1MA 3KF4A 5CTPA 2XYUA 3TV7A 3QTXA 4GH2A 4IAZA 2X81A 4EOOA 5M4FA 4L67A 3V5QA 3QTUA 2XIXA 3KRRA 3PSBA 3LJ0A 5HNBA 3RCDA 4HVSA 5HTCA 5DHJA 1IASA 4AGCA 4XG9A 3N4VA 3ROCA 2IVSA 4FR4A 3HKOA 4FT0A 1B39A 4NT4A 4YGAA 2IVTA 2GNJA 4TY1A 4XG4A 4ZSGA 4D28A 5FQDC 3R7IA 2ZMCA 1FGIA 1YXSA 2BROA 2NO3A 1PKGA 1G5SA 2HXLA 4HPTE 3DNDA 5GINE 3WIGA 3E8NA 4Z55A 1KE8A 3RI1A 4AF3A 2J7TA 3QWJA 3UDBA 2VO0A 3PPZA 4JDJA 4ACMA 4D1SA 3I6WA 2IO6A 1H1QA 2G2IA 2QG5A 3PXYA 4H58A 4O0TA 3FY0A 5E1SA 3RPRA 3SXFA 4EOLA 5CEKA 3ZXTA 1ND4A 3IOKA 2QOCA 4RZWA 3BLHA 1VZOA 2XK4A 3QD3A 1K3AA 4EH9A 2EB3A 3MVHA 3DKCA 4FKTA 3OD6X 4UXLA 5IU2A 1WZYA 1MRUA 1XBBA 2YLFA 5IA0A 1PXKA 2XS0A 5E4HA 2VWUA 5KKRC 2PMLX 4FV1A 4ITHA 4R3PA 4FEQA 3G0FA 1K9AA 3R7UA 4G1WA 4IIRA 4XV1A 4G5PA 2C3IB 5B2MA 4ZOGA 3UIBA 5EHOA 3CD8A 3QGWA 5IKWA 4DLJA 4F4PA 2WTKC 4H1JA 2CNVA 2WU6A 3LLAA 1V0BA 4E1ZA 3E7OA 3KMMA 3EYHA 4N57A 4NL0A 3TL8A 3VBYA 3JXWA 4E7WA 4R77A 1PF8A 2CCIA 1WFCA 3GU7A 1J1BA 2C6IA 4NM0A 4W4VA 3FE3A 4CMUA 4QRCA 1B6CB 2OG8A 3R00A 4FKSA 1H1WA 4K8AA 2R3LA 4NIFB 4U7ZA 4X6QC 5TE0A 1M14A 4TYJA 3V5PA 3DQXA 4ZTLA 3ZMMA 5HE3A 3Q53A 4CFMA 3OT3A 3C4XA 2V0DA 3MBLA 4P2KA 4G34A 2HXQA 5HD7A 2GQSA 4M13A 4QP4A 1FBNA 5CT7A 1J7IA 4HZSA 4PV0A 1R0PA 3G0EA 4ERKA 3COMA 2Z7SA 2VWVA 5TO8A 2VTRA 3DFCB 4OTGA 3QYWA 4FSZA 2RFDA 1OL5A 3OBGA 4G9RA 4O0SA 3NW6A 5HIDA 2EXEA 4TYIA 2GSFA 5C8MA 3VHEA 3DKFA 3HMPA 2HY81 4EOQA 4X2KA 4FUXA 3PP1A 5E8XA 5KMOA 3PIXA 4QMWA 4XP2A 3NUXA 1CSNA 2PE0A 2XKFA 3FXZA 4RJ7A 3SW4A 2YCQA 3EFWA 2YZAA 3Q9WA 2C68A 4FTQA 4RIWB 3R7YA 1PKDA 3HRBA 4LOPA 5DWRA 4KAOA 2O5KA 3BV2A 2IW6A 4BDEA 4YLLA 4DEEA 1ZYSA 5A46A 1YOJA 1CKJA 2OXYA 4KS8A 4CT1A 4RVLA 4NFMA 4YC3A 3MVLA 2GU8A 2VTTA 4PY1A 3BEGA 3MFSA 4FTNA 4O27B 4LI5A 4M0ZA 3WARA 5BPYA 1Q8TA 4AQCA 5LMKA 2E9PA 1KE9A 4DGMA 3C7QA 1OKWA 1OKYA 4FIIA 4MXCA 2ZB1A 4QQ5A 5CWZA 1QCFA 3EHAA 5EM7A 1FVRA 3D5WA 4M69A 4MWIA 5B7VA 4O81A 4PDPA 2A27A 5L3AA 4EL9A 3IDBA 3NUYA 4E4NA 3KU2A 1MQBA 2WTIA 4FSUA 3PY0A 1M2PA 5ANJA 5KUPA 4WA9A 3ZRKA 2WTJA 2XIYA 4QQTA 4F9YA 5EM8A 3TNIA 4AOTA 1ZOEA 3NGAA 4BCHA 4GIHA 5KMIA 4I3ZA 4BCFA 3OUNB 4I22A 2JC6A 5HO6A 1Y6BA 2R7BA 4O1OA 3PXRA 4QP1A 3K5UA 4PTGA 3OW3A 3ENMA 5L8KA 3A8XA 3OUKA 4ZLOA 3BE9A 4IZAA 4MXOA 3EOCA 2F7XE 3MGYA 2WMVA 4PRJA 4XLIA 2UZDA 4ZZMA 4D0XA 4CG9A 3NVMB 4TRLA 4IZYA 2PMNX 2XUUA 3L8PA 3ORIA 5DBXA 3QZGA 5EKNA 4AZEA 4FOBA 3BKBA 4X3JA 3TXOA 1V1KA 2YACA 1UU3A 2GNHA 3C4ZA 3FYJX 4MD7E 2F7ZE 1UU7A 1S9JA 3OROA 4FZFB 5DYJA 3E87A 5CZIA 3MPAA 4AWIA 1VYZA 2YJRA 3A7GA 5GIPE 2OIDA 4TYEA 3AD5A 1JAMA 3MFUA 2X0GA 2R4BA 4WKQA 4DFUA 3LCTA 3D5UA 2J90A 3KCFA 1JBPE 2E9OA 4YZMA 1OPKA 2A1AB 4E5AX 3MH0A 2QOBA 1YDTE 4L3PA 3Q6UA 4NM3A 3IONA 2OO8X 3HDMA 4YC6A 3RAWA 2GFCA 4QTCA 3MIYA 3Q5IA 4MF0A 4O6EA 4O1PA 4RG0A 5GZAA 2PUPA 3OHTA 4O21A 4FKRA 3GUBA 3MSSA 5L6WL 2UW7A 3KULA 5DIAA 5AUTA 5CSXA 3PJ3A 1PXNA 4GSBA 1GY3A 4K77A 2JFLA 4PQNA 2E2BA 3QBNA 3KEXA 3R30A 2BRGA 2QR7A 4Z9LA 3VJOA 4BWKA 3CPBA 5GZ8A 4I5HA 2QONA 4R5SA 2PVJA 3EQGA 4IXPA 4F1MA 2HELA 2WMQA 1DI8A 4UN0C 5JGAA 2YIQA 1L8TA 2OZOA 3FKOA 5JZNA 5CF4A 3G15A 3PLAE 5K4JA 4E26A 4ZJVA 5E8SA 3V04A 2BKKA 2VTHA 2WB8A 3C50A 5BMSA 5HESA 3JY9A 4MTAA 3VBVA 2UZVA 3WI6A 1WBNA 4OAVB 3D15A 3R9HA 4J98A 4L01A 4PWNA 4DINA 1JSVA 3IDCA 3TV6A 3DXNA 1OPJA 1ZXEA 3DQWA 4PPAA 2OK1A 4O6LA 1BKXA 1H24A 2WELA 3D2IA 3FI3A 3GOKA 4GRBA 5CVFA 5TKDA 4EZ7A 5A4QA 1PY5A 4O7LA 2WTCA 1OIUA 5BX0A 3NIZA 1Y91A 2VNWA 4HVGA 3GQIA 3OFMA 4BHZA 2X7FA 4I6HA 3ODYX 4CGAA 2RF9A 1W82A 4NTSA 3V8SA 2NRUA 5EI2A 3G33A 5KHWA 3R9RA 4YJVA 4Q5HA 5CI6A 4JX3A 2C0OA 4UXQA 4HJOA 4ZY4A 1FPUA 1YXTA 3FUPA 4E93A 1XR1A 4KRCA 2VWWA 3E63A 5ANGA 5LMKC 2ZDTA 3P78A 5HCXA 5IQBA 4BDFA 3SX9A 1YHVA 4G31A 1PXLA 4EH8A 3VRZA 4CQGA 3WIKA 3V01A 2XNMA 4MBLA 4FG8A 3CQWA 4C35A 1ZZ2A 4CYJA 4EH3A 4G3GA 4QMMA 5ANIA 4EH2A 1GZKA 1ZAOA 3QC4A 1OUKA 4W8DA 4MD9E 4JR7A 4Q5EA 2IN6A 4MHAA 1WBPA 3TJCA 3RNYA 3TT0A 3W1FA 1PXJA 1JKSA 1SMHA 3TTJA 4FNZA 4N0SA 4J96A 4GVAA 4FKJA 5FM2A 3GC8A 2P2IA 2WQEA 2YAKA 2XM9A 3S4QA 3R1SA 4ACDA 2OFVA 4XMOA 3UOHA 4DA5A 4XP3A 3ORPA 3VUKA 4UALA 3EB0A 4F7LA 3EN4A 3KC3A 2X7OA 4PDOA 1TQIA 5LMAA 3Q2MA 4MAOA 3U87A 4JDHA 5ETCA 3JR1A 3WE8A 1UA2A 3LHJA 2UW9A 4OTRA 4FZAB 3AGMA 3LCDA 4FKVA 4IM2A 4KA3A 4X7QA 5DVRA 3LJ1A 1OVEA 2HZ0A 5L8JA 1TQPA 1W83A 2QNJA 3DGKA 5C26A 5HO7A 2CNUA 2IZRA 5ETIA 3LMIA 3D2KA 3D4QA 1JVPP 3BRBA 1CM8A 2VTPA 3PSCA 4GL9A 4PF4A 5KX8A 4ACGA 4RJ5A 2Y4PA 4GKHA 5DA3A 2WOUA 4GFGA 2C5OA 2HW7A 4ZMFA 2WXVA 1A9UA 3F3VA 3VULA 1GOLA 4FKLA 4HVIA 2QD9A 1WBTA 4FV0A 2GS6A 3MN3A 3P79A 4IACA 3DKOA 4KSPA 3BIZA 3RWPA 4FTKA 3F3WA 1J7UA 4J1RA 3RPYA 3B8QA 2FSMX 2Y4IB 3QD4A 4Y5HA 4F6SA 2NPQA 5IDNA 1ZLTA 3R04A 3TV4A 4JG7A 5BUEA 3THBA 4U6RA 2JKKA 2B0QA 4KRDA 2J50A 3C1XA 4CCBA 3LFNA 2ONLC 3G6HA 4DEGA 2CKEA 3E88A 4O86A 3PVWA 3S2PA 5D9HA 4QMQA 4CT2A 4L9IA 4OTWA 4CSVA 3NYOA 3AMYA 3SHEA 3PRFA 3DK7A 4C4FA 3NUSA 2IZSA 4AP7A 3TTIA 3MPMA 3QTZA 4TW9A 3A7HA 4L7SA 2UUEA 2QURA 2IWIA 3SG9A 1AGWA 1JSUA 3FMNA 4KBKA 1H25A 3NX8A 1PMUA 2C5NA 3LFQA 3MW1A 3AOXA 2JLDA 5H3QA 2PUIA 5C27A 3PDTA 2R3MA 4NWMA 3P23A 2I7QA 4O38A 3ROYA 2OICA 2QU5A 4BC6A 4G6NA 3IW5A 2J0MB 3BLQA 2PUNA 3MB6A 5AX3A 4EQMA 3PA3A 3ULIA 4I23A 4U41A 5AV4A 4AOJA 3IK3A 5ANOA 5AR5A 2ZOQA 2P3GX 2G2HA 2UV2A 3DY7A 2UZTA 5DT0A 3MWUA 4QMUA 5E92A 3GU6A 5EW3A 2H8HA 3UG1A 5AIKA 4AG8A 4EJNA 3RM6A 4C4IA 3Q4UA 2YDJA 4TYHA 3F3ZA 3CBLA 2R64A 4JQEA 3ANQA 4AUAA 1R3CA 3LFSA 4FZ6A 3FV8A 2F2CB 4L68A 1P14A 5EQEA 3I0OA 1H1PA 2BPMA 3A4OX 3D94A 3UJGA 1OITA 5HOAA 4DFXE 3LQ8A 3VUGA 3FLSA 3CKXA 1TKIA 4L7FA 3FZRA 3WZJA 4AA4A 3SW7A 4XEYA 3EH9A 5LARA 2EWAA 5FXRA 3KN5A 5CNOA 4UBAA 3UPZA 4CRLA 4YJOA 5HVJA 2UZWE 1PW2A 2OF4A 2VTIA 3BYOA 3V5LA 3P7AA 3Q3BA 4IBMA 5CSWA 3NR9A 4BDBA 3O71A 3NUNA 4PMTA 1E9HA 2XK9A 4YJUA 5CF8A 5KMNA 3F2NA 4M8TA 3TCPA 4F1TA 1XH5A 4IM0A 3R2BA 4WG3A 3Q32A 4J52A 3GNIB 4V05A 2WMWA 2QQ7A 4JT3A 3F61A 2HWOA 1YDRE 4CFNA 4RIOA 3D7TB 5CYIA 1OBDA 1FVTA 3DB6A 5DRDA 5M06A 4OTQA 5CEMA 3D9VA 4P4CA 3LCOA 3EZRA 5DEWA 2WNTA 4QP7A 4M84A 5AR4A 4GKIA 1ZMWA 1JKTA 3FLWA 4FT9A 4JI9A 1LP4A 1Q41A 3DJ6A 3FJQE 3UOKA 4Z7GA 4RWIA 4QO9A 1OI9A 2VTAA 5EHLA 1QPEA 4UMTA 2BAKA 4RVKA 5AAGA 1WVXA 3ZRMA 5IA1A 1BUHA 2B7AA 2JFMA 1NVRA 3R0TA 4ASEA 5CAUA 4BF2A 4I94A 4XBRA 5IQCA 4CTBA 5DI1A 2PU8A 2OBJA 4N6ZA 5LMBA 1QMZA 4MVFA 3H0YA 3TUCA 3QU0A 4WO5A 3PJ8A 3I79A 4QP6A 1G8AA 4RLLA 4KKGA 3VUMA 4O7VA 4BHNA 3HYHA 4BCQA 4DEIA 4JBOA 1BL7A 1ZY4A 2BHEA 4OUCA 4ANNA 3IO7A 4B7TA 5DN3A 1JQHA 2XK3A 3A62A 2PY3A 3DK3A 5I3OA 1XKKA 3N51A 4YPDA 3TACA 2WMAA 3VS5A 4DFNA 3R8UA 4GS6A 2XF0A 4F9CA 4YNEA 3LMGA 4ZTRA 3UMXA 2QKRA 5L2QA 5F95A 5DG5A 1BLXA 3FLZA 5FGKA 5B2LA 3FSKA 1Q5KA 5M4CA 2C6KA 4WUAA 5M55A 1T45A 4CV9A 4TWNA 4NKSA 4C2WA 3FHIA 4RSSA 3BBTB 3VBTA 5I9VA 5AV2A 3K2LA 2QR8A 4LYNA 3ETAA 3GT8A 2UVXA 3OMVA 3Q6WA 2R3HA 1YXXA 4PMMA 1OB3A 2BUJA 3WE4A 3POOA 3AC1A 5AM6A 4HGSA 4R3CA 4C57A 4KABA 5J9LA 4EI4A 3NRMA 3ZEWA 3EYGA 3V6SA 1LUFA 4S33A 5H8BA 3EFKA 4RLKA 4V04A 2YFXA 2OGVA 2XIZA 3S00A 3HA6A 5CI7A 5HORA 5GJGA 4U0IA 2GNFA 4LOOA 2C5VA 2W0JA 2YCSA 1U46A 3AC5A 5KMJA 3NNXA 4LQMA 4U97A 2P55A 1ZY5A 1XH6A 3LCKA 4QOXA 5KHXA 4E6QA 3MH1A 3JS2A 2XNNA 2P0CA 3F3TA 3R1NA 5CASA 3CR0A 3OZ6A 5LCJA 3UOJA 3CD3A 5M08A 4U3YA 5EG3A 2PVYA 3MY1A 4QMYA 5TF9A 3GB2A 2XYNA 4D2TA 4IVAA 5FTOA 4WG4A 4QQJA 3DXPA 3VS3A 4TTHB 3HV5A 2VWBA 4GIIA 3B2WA 4GT4A 3QX2A 4O7ZA 3WZKA 4RC2A 3NYXA 3NS9A 2W4JA 3EL8A 5HNGA 4EBWA 2R3OA 1M17A 4U3ZA 3I81A 5KZ0A 4H39A 4DH1A 3OVVA 4IWOA 4FI1A 3QCSA 4ZLZA 4X0MA 4K9YA 5KBQA 4C0TA 2QLQA 5A4TA 2ITQA 1RW8A 3QQKA 3CQEA 1CDKA 1CKPA 4QP9A 2V22A 4E20A 2QI8A 1OBGA 1Z57A 4BI1A 4KWPA 4AGWA 1I09A 4MK0A 2E9UA 4XG3A 4O84A 3DLSA 2QLUA 4FZDB 4WSQA 3TZ9A 3KK9A 3ORZA 1L3RE 3ANRA 3PE2A 4JL9A 4XUFA 2VD5A 4NIFA 3CC6A 1J91A 4HCTA 5KO1A 1Q62A 4BICA 1Z9XA 3OT8A 1PXIA 1JSTA 5DRBA 4A4OA 3LZBA 2XH5A 3RAHA 4F7JA 4ZZOA 4YZDA 5FUTA 5HG7A 3UGCA 3POZA 4AT5A 4DEAA 2OLCA 5CVHA 1FMOE 2VTMA 5EW9A 1YXUA 3SC1A 2YDKA 4YR8A 4ORKA 1YHSA 5CU2A 2CN5A 4CZTA 2HK5A 2Y6OA 5C9CA 5LVNA 4FC0A 3OY1A 3GFWA 5F94A 2R3IA 4FVRA 5AP4A 4D2PA 3S1HA 2YIYA 5C1QB 1PYXA 4FSMA 3Q04A 3ID6C 5FD2A 3G9LX 3NUAA 5DOSA 3TNHA 1EH4A 4IC8A 2UZEA 5AMNA 3QZIA 3ZUTA 4RIWA 2VO7A 4MNEA 5FDPA 5DR9A 5AV1A 5A6OA 4BYJA 3VS4A 1PXPA 2IJMA 2WAJA 2XCKA 3Q4TA 4GT3A 3ZFXA 3BI6A 4CMTA 1XH7A 2QHMA 4OAUC 4O2PA 1P4FA 2XJ1A 2X4FA 2ZDUA 2XNOA 4J97A 1KE7A 4MD8E 4DH5A 3AGLA 5HQ0A 4ZP5A 4KINA 3GXLA 3GFEA 3CTHA 3F9NA 4OT6A 3A61A 2W9FB 4O0XA 4RFMA 4R7IA 3UQGA 2O65A 1YOMA 4HGTA 3ZC5A 4TWCA 4NW5A 4EZ3A 2VTLA 2FB8A 4APCA 4K11A 5JMSA 4EQUA 2C0IA 3ZDUA 4E4XA 5A4EA 3ZUUA 4WOVA 3TKHA 4C8BA 1P4OA 4FEVA 1J3HA 4FEXA 1Y8GA 4FKIA 4JXFA 4TN6A 4BYIA 3GGFA 3R02A 2HW6A 4EJ7A 2FYSA 4DT9A 1PXOA 2WTDA 4BKYA 4BWXA 5BYLA 5H2UA 2DS1A 4UYAA 5D10A 3GCUA 3GC9A 3UTOA 4B8MA 4D1ZA 5FG8A 4F9WA 5AV0A 4XX9A 4I4EA 2PULA 4WNPA 4PDYA 3FXWA 3QKLA 5A4CA 3UQCA 3E3PA 3EKKA 4LMUA 3R9OA 4O7TA 4FTUA 4QMXA 1HCKA 2XJ2A 3PXFA 4DTBA 3ZBXA 3FYKX 3NPCA 3HV3A 4BBMA 3C51A 4YO6A 2Y6MA 2ACXA 3VF9A 2BKZA 2WQNA 3IW4A 3COKA 3RP9A 3VS2A 4ANLA 4ZS0A 5AUUA 4JBVA 3UIUA 2RL5A 2I6LA 1LEZA 3CY2A 5IEYA 4NTTA 4B4LA 4XH6A 2UZUE 5HX6A 4N70A 4ARKA 4CMOA 3FAAA 3BHHA 1YRPA 2FVDA 5BVOA 5F9EA 4V0GB 4USFA 1IA8A 4W4WA 4UWYA 4YZ9A 5EYMA 3MB7A 4F7NA 2ETKA 4FF8A 1OM1A 2VGPA 5GIOE 5JSMA 4RC3A 1RE8A 3LFAA 4IZ7A 4IE9A 3U4WA 2E9NA 3BGQA 3F69A 3R8VA 4AU8A 4E4MA 4GW8A 3JUHA 3IDPA 1STCE 4C36A 1UNHA 5FEQA 1A48A 4UWCA 3ORTA 4G3EA 1WCCA 4PL4A 3FQEA 4FG7A 5AA8A 4N4SA 4GFOA 2IZTA 2BMCA 1R1WA 4FMQA 3GCQA 1JNKA 3NCZA 3PY3A 4MCVA 5HBHA 1ZWSA 2QOOA 4KBAA 3F88A 4YJNA 3AC8A 3R7EA 3PJ2A 2QU6A 4FL1A 4EKKA 2Z02A 3FMDA 3C0IA 3OTVA 1VR2A 3HUCA 5CVGA 3O7LB 4GK3A 4DGNA 3GCVA 4AZVA 3JVRA 5HE0A 3M42A 3GCPA 3PXKA 3BYMA 4WIHA 5JQ5A 2CKOA 2FGIA 3QLFA 2YJSA 4GG7A 5JN2A 3DOGA 5T6KA 2JDTA 3D5XA 2EXCX 2XP2A 4Q9SA 4L3JA 4MWHA 1YW2A 2NRYA 4PPBA 2GHMA 3LIJA 3UE4A 2ZM3A 3P08A 4HVDA 3I1AA 1MP8A 2WMTA 3RVGA 3U55A 3LOKA 4U43A 5EQYA 4IAYA 4W9XA 1KOBA 3QKMA 2LAVA 5BVWA 4ZTMA 1SNXA 5FLFA 5IQHA 3SRVB 1UKHA 3U51A 3WBLA 5I5ZA 2V7AA 3RWQA 5HG9A 4AZFA 4CYIA 2ERZE 4JG8A 4HPUE 3FL4A 2JGZA 3O7LD 4M3QA 4O91A 1AQ1A 4EH5A 3S0OA 4KKEA 5CXHA 2C6LA 3TZ7A 4OR5A 4L3LA 4C02A 3B2TA 4YPSA 2IVVA 2V62A 3WYYA 5DNRA 4X6RA 4C3FA 3NDMA 1DM2A 1PMEA 1M7NA 2QOQA 3AG9A 4FV3A 4LM5A 2CHLA 1RQQA 3AT3A 3LFCA 2WTWA 5AR2A 3UOLA 4BL1A 1WBWA 4IDTA 1OL7A 4ASDA 2VNYA 4BI0A 5IEXA 4G16A 3BYVA 4IH8A 3V51A 4OLIA 2CSNA 5ANEA 4RIXB 4QP8A 4F65A 2OSCA 4S2ZA 4Y8DA 2E9VA 2YIXA 3BU6A 3RJCA 1Y57A 1PXMA 4YLKA 4XV3A 3W2OA 4CLIA 2J5FA 2YA9A 5IMXA 1CMKE 3LMHA 2OH4A 2SRCA 3EL7A 3PWDA 2P33A 4BDJA 5FTQA 3ZO2A 4K18A 1V0OA 4S30A 4YNOA 5DMZA 2PK9A 3PXQA 4RMZA 4UX9A 1U59A 2PVRA 4L6QA 4RA4A 4U9AA 3UC4A 1IG1A 3HUBA 4YP8A 3NMUF 2HAKA 1OUYA 2OJ9A 3L8XA 3ZLSA 3OCBA 5L4QA 4K33A 5AAFA 4IVCA 5LCKA 3HMNA 4XOYA 1YXVA 2YISA 4C61A 1JLUE 5AUVA 4JIKA 4TNBA 1MUOA 2J4ZA 2GDOA 3F3UA 4DFYA 2FSLX 1H00A 3FZ1A 1H28A 1JKLA 2BILB 4U45A 3R8MA 3MPTA 4G2FA 1H4LA 2FUMA 4DN5A 4RVTA 4FGBA 3O50A 1FOTA 2B53A 4ZJJA 4FSWA 3QRJA 3Q9ZA 4QYYA 5AUZA 2C0TA 5EI6A 4EH7A 1IRKA 5C8NA 5IA2A 1W84A 5IDPA 3C4WA 4AZTA 5E8VA 5A6NA 2X1NA 4WNMA 3QZHA 2W05A 3OBJA 3ATTA 1KWPA 2VWZA 2W4OA 4MEDA 4QP3A 5CEQA 2J51A 4WD5A 3VW6A 4OTIA 5HG5A 4KSQA 4KBCA 4CZUA 4C4JA 5HNIX 3W18A 3OTUA 1YI3A 2QOLA 3U6HA 5AP3A 5JK3A 4H3QA 2GMXA 5HG8A 4FTRA 5ANDA 5CAOA 1J7LA 4CFXA 3ZHPC 3FMJA 2W06A 3EZVA 4ZAUA 5I9ZA 2X4ZA 3FMLA 4L43A 4EK8A 1Q8UA 4CKJA 3OY3A 4FE2A 5K4IA 4FKQA 4U8ZA 3A7FA 4S32A 4ANMA 4D5KA 2EU9A 3W32A 4EHZA 5H8GA 4NFNA 4IAIA 4ANBA 4JVGA 2A2AA 4GU6A 3DTWA 1ZOHA 5BYYA 4QPSA 3OEFX 3PZHA 4GV1A 2ONLA 4IFGA 4HCVA 5M4UA 2XBJA 4OBQA 2WMXA 3VS1A 2W5AA 1ZMUA 5L2SA 3CSVA 3PYYA 4A07A 4O82A 4QMSA 3ATSA 3EQDA 4PL3A 3I4BA 3MV5A 2WIPA 2VX1A 3BE2A 2FH9A 5D41A 4YUQA 5M57A 4LRKA 4JDKA 2YERA 1MRVA 4F0GA 2RFNA 2WFYA 1XJDA 4KUJA 1YOLA 3DDPA 3DAJA 3G51A 3KB7A 3REPA 3UIXA 4CD0A 1Q61A 2C6MA 4I4FA 5BVNA 5CQWA 2GQRA 3I5NA 1H0VA 4MXAA 1KUTA 3ZS5A 4LV8A 2WIHA 2EVAA 3H9RA 2UW8A 4ITIA 3HMMA 2C30A 4IC7A 2GQGA 4GYGA 3RNIA 4EYJA 3DZQA 4NUSA 1IAHA 2YWPA 4YSJA 3OCTA 2GS2A 2R3JA 3QTRA 4TNDA 4BGGA 3Q4CA 4NM7A 3VO3A 5H9BA 1M7QA 2Q0NA 4FT3A 5HEZA 5CAQA 3TZ8A 4O2ZA 3PA5A 2AUHA 4JIAA 3OWJA 4IWQA 4ZJIA 3WYXA 4D5HA 2R0UA 2CLQA 2O3PA 5C01A 3TG1A 3BHVA 5A9UA 4FV8A 4QTBA 3VF8A 2VWYA 2R2PA 4IX6A 3HAMA 5CANA 1U5QA 2XB7A 3KCKA 3FKNA 4M7IA 5CQUA 1Q3WA 4L52A 5HTBA 2C6EA 5CU6A 4FGRA 3N4TA 3FMKA 3FZTA 3V8WA 5J7HA 2UW5A 3DBQA 3VNTA 5IPJA 3A7JA 4PX6A 5IA3A 2HY0A 3SGCA 1OIQA 2UZOA 3CPCA 4ZLYA 5BMMA 3N4UA 3QZFA 4BGQA 3E5AA 4LMNA 5AP1A 4CTCA 3QL8A 4JAJA 4ZTNA 4R7BA 1YQJA 3IQ7A 4LGDA 3P7CA 2O0UA 2WQMA 1APME 5ETFA 4KIOA 4ZEGA 3L9MA 3N9XA 3NIEA 1OECA 3D7TA 4EWHA 4F08A 4UMPA 3DXQA 2VWXA 5M56A 4O0YA 3QRKA 2O2UA 3C13A 1FINA 4RQKA 3UIMA 1VJYA 1LEWA 1YWRA 2I0VA 3DNEA 3UO5A 2Y8OA 2QO9A 4RIYB 3CS9A 4RJ3A 4DBXA 2RKUA 1V0PA 4BIBA 3VBWA 2W9ZB 5CAPA 3BWJA 2O64A 4M69B 5DPVA 3OWKA 1LR4A 3KRWA 3B8RA 3FQSA 3I7CA 5GJDA 4BTMA 3FI4A 2VTOA 4JJRA 4DHFA 3LXLA 4M15A 4A4XA 3HMIA 4I5MA 4A9UA 4U79A 3O23A 4XS2A 4I20A 4QP2A 2B9JA 3A4PA 4FKOA 3IPHA 3W2QA 4DEDA 3PG1A 4R78A 2HZIA 4I5CA 5E8ZA 2C6DA 5KCVA 5HLNA 4RFYA 3ULZA 3PJCA 4BBEA 3H4JA 4MNFA 2Y7JA 3FL5A 5E7RA 2CGXA 1NY3A 4DBNA 3H30A 4WT6A 3VWAA 3ORLA 4IQ6A 1SVEA 2Y4IC 5AIRA 5B0XA 4CKIA 5JFVA 1GIIA 4S31A 1B38A 3U6JA 3FC1X 3GU8A 3CTJA 5J87A 2R3QA 4IVBA 4AW1A 4BTKA 4RWLA 5AP0A 4BB4A 1KSWA 5FXQA 2PMOX 3II5A 3DB8A 1JWHA 1XBAA 5HI2A 4DCAA 1M2RA 4ZZNA 3ALOA 5CY3A 3CP9A 3QQJA 2JBOA 3I5ZA 3MA6A 2B4SB 3Q60A 3ZBFA 3M1SA 4EH6A 2R3NA 4B9DA 2H6DA 3Q5ZA 3MI9A 4NJ3A 4AGDA 3BZ3A 2KULA 4RA5A 3VUIA 3KVWA 4HGEA 1U54B 3QFVA 4FTMA 4GUBA 5HIEA 5FBOA 2CGUA 3VS6A 1PYEA 4D1XA 2JKMA 3QQLA 4U81A 4FK3A 2WO6A 2Z7LA 1T46A 2XCHA 3T9TA 3SVVA 4FNXA 4KKHA 3IW6A 3LFBA 3AXWA 2PHKA 4M67A 5G1XA 4NK9A 4QYGA 5CSPA 4TYGA 2WTVA 3FZOA 4ZTHA 3LQ3A 4HNFA 3BHYA 1R39A 3OEZA 1H26A 4LOQA 3R8PA 3VIDA 2OF2A 2J0JA 4ZSAA 4MXXA 4FIHA 4Z16A 2QOKA 3HZTA 4DF3A 5M07A 4K2RA 3F5XA 2QVSE 5JQ8A 2W99B 3CIKA 4K0YA 2REIA 3QUDA 3M2WA 5IUGA 4BDAA 3P0MA 3PFQA 4D2WA 2WMSA 5EHYA 2UW6A 5L8LA 2UZBA 4GEOA 3W33A 4ANQA 1FGKA 3R71A 1RDQE 3RPSA 4PP7A 2PWLA 2PZYA 2VUWA 4LL5A 3HRFA 4FG9A 2IW9A 3ITZA 2CKQA 5L6OA 4I41A 4AN2A 4HCUA 2J6MA 5CF6A 4I6BA 5F20A 5BUIA 1OIYA 2BCJA 2C1BA 4Y46A 2JIVA 2C6TA 4O0VA 2GCDA 3FLNC 5E91A 3KGAA 3FI8A 4YSMA 4ONAA 3ZUVA 4I6FA 4DE4A 2QODA 3IG7A 4HYUA 2GTNA 5DH3A 1XO2B 2AYPA 3UMWA 5ANKA 5E90A 1PHKA 2UVYA 4OTFA 3C4EA 3UC3A 2XRWA 4RX7A 4MKCA 5I9WA 3O0GA 4GCJA 3DBFA 4WUNA 1XH4A 5HLWA 4FNWA 4TZRA 5IA5A 3CXWA 3PPJA 5D1JA 3R1YA 4F1OA 1WAKA 4UMQA 3TUDA 4KNBA 5EOBA 4O0WA 4FKGA 4D2RA 2G15A 1VEBA 2XVDA 3DKGA 2XNEA 3EQRA 3HV7A 3W16A 5JGBA 4M14A 3EQHA 1E1VA 2ZB0A 1U5RA 5A3XA 3SXSA 4IM3A 5J1WA 3HDNA 4RRVA 2C1AA 3KXZA 2PSQA 3NW7A 3ALNA 2BIYA 2JEDA 4IFCA 1JPAA 3WF6A 3I60A 4O0UA 4AA0A 5CXZA 2HYYA 4WNKA 3U4UA 5DT3A 2C5XA 5BVFA 2R3FA 3ZFYA 1H0WA 3GVUA 1QL6A 4OTPA 2VU3A 4AAAA 1CKIA 4RX5A 2YCFA 2PL0A 3LPBA 3ORNA 4J8NA 3R7OA 4AFEA 3TUBA 3GBZA 1WVWA 3WILA 4USEA 4C3RA 5TOZA 4DFZE 5M4IA 3ELJA 3A99A 4BCJA 1BI7A 3KRLA 3R22A 3IW7A 1I44A 5GNKA 2W7XA 3KK8A 4J95A 3V5WA 2IG7A 3JVSA 1OGUA 5CZHA 4FKWA 4UMUA 4GK4A 5IQAA 3KY2A 4RZVA 2R3RA
chains in the Genus database with same CATH superfamily
2VX3A 3V5JA 4LRMA 3KL8A 3D83A 4AN3A 3KKVA 5AP7A 2BFYA 2X6DA 4DG2E 3BYUA 4Y85A 4WHZA 2JIIA 4NYEA 4JS8A 1FVVA 2F9GA 2ITPA 3LKMA 3H0ZA 5BVDA 5IEVA 2WQBA 3ZC6A 2RFEA 4EOMA 4I0RA 3KF7A 2ZYBA 4A9YA 5J5SA 4C34A 1ATPE 4FBXA 2UZNA 3QXPA 4H3BA 2VTNA 4AT4A 4F9AA 3V5TA 4E73A 4EC9A 2R9SA 2JDSA 2LGCA 3O17A 2V5QA 3MS9A 5F4NA 1H1SA 2C6OA 4H1MA 3RBWA 2PUUA 5IQGA 3R01A 3O8UA 3MJ2A 4MBIA 5H8EA 3ACJA 3EQPA 5HCYA 3I0QA 3MVMA 3UG2A 4YJQA 4QQCA 4QDEA 2PE2A 5CSVA 2FSOX 2YM4A 4GMYA 4MQ2A 4X2NA 3K5VA 3NW5A 5EYKA 3U9NA 4D9TA 3KFAA 5HICA 3W2PA 3HECA 4AQKA 4DGOA 2JBPA 3QF9A 1WBOA 3HNGA 3LM0A 1KV2A 1ZYDA 3BCEA 4FKUA 1NT2A 1UWJA 5IZFA 4TXCA 5AWMA 3D14A 4BCKA 3KXNA 2CMWA 4ALWA 4W9WA 2UVZA 3C4CA 5JEBA 4QEBA 3OG7A 4ZSEA 3R83A 2VRXA 2NNWB 3ZLYA 2YWVA 2IW8A 2CKPA 4XBUA 3L8VA 5ITAA 1W8CA 3T3UA 3K3JA 3UP2A 4H3PA 4BCPA 5CU0A 4LUEA 4WNOA 4M12A 4QMLA 3ZZEA 4DITA 4CQEA 4ZTSA 3ZYAA 4AT3A 5LVPA 3PY1A 4M66A 3PJ1A 4MYGA 5J95A 1URWA 5CU3A 2H96A 3QA0A 4BZDA 4B8LA 1O6KA 3RK7A 4G5JA 4J8MA 3SD0A 2BAJA 4WG5A 1WBVA 5AP2A 1ZMVA 4U5JA 3UZPA 3VJNA 2VTJA 3FPMA 5CALA 4CRSA 1OL2A 3PE1A 4A7CA 5ACKA 3VS7A 3ENHA 4EK5A 3ZO1A 3D5VA 3UPXA 2ZAZA 3R1QA 4RPVA 3UVQA 1GIHA 5KMKA 4O7RA 4ZMEA 1O9UA 4G3FA 3QC9A 1YKRA 3QTQA 1ST0A 4AXCA 1SZMA 3CE3A 3DAEA 3EN7A 3DV3A 3MDYA 4RJ4A 4F9BA 2A19B 2JAVA 3ZO4A 4UEUA 1XWSA 5AUYA 4TYHB 5EDRA 4ZY6A 5J5TA 3IS5A 2R3KA 3OXZA 3RAKA 4DTKA 4FIEA 3MFRA 5CNNA 3QX4A 3QWKA 3NAYA 3HEGA 4DTAA 3RK5A 3SDJA 2GTMA 4E6AA 5JRQA 2QOHA 1G8KA 1TQMA 3QRTA 4N6YA 5C03A 3U8WA 2ZFYA 5HD4A 3CEKA 3NAXA 2WHBA 2XKDA 4X3FB 4BBFA 4D4RA 5IF1A 4UWBA 3BLRA 4W4YA 1KE6A 4FVQA 4BY9E 3H9FA 4F64A 5JFXA 1O6LA 3F2AA 2BIKB 3Q2JA 4IJPA 2WD1A 4FSNA 2ITNA 1TFFA 4RT7A 4I0TA 4EC8A 4QD6A 3FHRA 3LXNA 1J1CA 1IAJA 2OXDA 2I0HA 3HV6A 5FDXA 5E9EA 3V8TA 1OL6A 4F09A 4FNYA 3AC4A 4MUQA 4EK3A 2XK7A 3C5UA 2XA4A 4F70A 3C5IA 3R7GA 4RFZA 2RG6A 3HL7A 4F0IA 3IGOA 3BV3A 3CJGA 5DE2A 2C3LA 4RIXA 3WF8A 3WF9A 4ASZA 1Q4LA 5DR2A 4PNIA 5IUIA 4CFVA 4CLJA 5KMLA 5E8TA 3ODZX 5K5XA 2QOFA 3TNQB 4EQCA 5I0BA 1XBCA 4RWJA 4BCMA 3PA4A 2PVKA 5JFWA 2GFSA 2W17A 5DEYA 2XZSA 4NJDA 3K54A 3PIZA 2QO2A 3JYAA 3RZBA 4FSRA 4FV5A 4BDCA 4Y72A 5IISA 4Z3VA 1PRYA 3BLAA 4JOAA 4RX9A 1CTPE 1R78A 4KIKB 4LV5A 2CLXA 2ITOA 2HZNA 4EUUA 5BQ0A 3LQ5A 3EWHA 4TT7A 5HE1A 1Q24A 2ETRA 1JKKA 2X8IA 2BZJA 2J9MA 4HYHA 3BU5A 4YC8A 4YO4A 2PVNA 4XRJA 4H05A 3U54A 2I0YA 4TWOA 3KXXA 3R2YA 3RPOA 2VWIA 1XH9A 4RBLA 4FKPA 5HX8A 3EN5A 4EOJA 4WBOA 5AUXA 2AC5A 1NA7A 2ITUA 5KZIA 4AE9A 4BRXA 4IAFA 1GZOA 1UWHA 4FODA 1IR3A 2RSVA 3R9NA 4NU1A 2X8DA 2Z8CA 2W1FA 3CQUA 3F5UA 3L8SA 4ANOA 3VUDA 4P90A 4R5YA 3Q52A 2OKRA 5M51A 4FTJA 1XHAA 2ZVAA 3ACKA 3QLGA 3ZDIA 2I40A 5LOHA 4FEWA 1WMKA 4ENXA 4XYFA 2W1GA 2YABA 3QYZA 3TIZA 3ZFMA 1YWVA 2CGWA 3QD2B 4FX3A 3FWQA 4XV2A 2ZMDA 5C8KA 2ZV2A 3VN9A 2GNIA 4XG6A 2F49A 3QXOA 4YHFA 3RKBA 4BIDA 4PMPA 2XMYA 5A4LA 3GI3A 4YLJA 4Y83A 5E8WA 4IX4A 3RALA 4BTJA 1XMLA 3R73A 3NWWA 1ZRZA 4LUDA 2Z60A 1JOWB 2YM8A 5CT0A 5JZJA 2QCSA 5E8UA 4BWPA 2XIKA 4IB5A 1G8SA 3KMWA 3BL7A 4Q2AA 1M52A 3LM5A 1RJBA 4DG0E 2J5EA 2W5BA 3VUHA 4BCIA 5J7BA 4R1YA 4P7EA 1Q8YA 5GHVA 5AFVA 3WZEA 4ERWA 1UU8A 3R6XA 3EFJA 2B52A 4C2VA 3E3BX 3HV4A 4IZ5A 4QT1A 3I7BA 5HKMA 1O6YA 3FBVA 4ACHA 2PYWA 4EOKA 4B6LA 4QTDA 1Z5MA 4BN1A 3MY0A 3W10A 3FZPA 3RM7A 3VAPA 3SKCA 4IMYA 2VTQA 2XEYA 2UW3A 4LG4A 4IDVA 4B99A 4HW7A 2EXMA 4JAIA 4FSTA 1GJOA 5IH4A 5HVKA 5I9YA 3C4FA 1Q3DA 3C0HA 2X2LA 3P4KA 5KBRA 3ZU7A 5EYDA 5AP5A 2OXXA 4RQVA 3S3IA 5IH5A 2PPQA 2IEWA 3QRUA 5KKRB 4G3CA 3TM0A 1P2AA 2UW0A 1KE5A 4FT7A 3Q96A 4AS0A 3W0RA 3COIA 1URCA 2JIUA 4R7HA 4ZIMA 2BDWA 3PUFC 4XCUA 3DK6A 4FSQA 4GG5A 2WTKB 3CKWA 5I4NA 2WU7A 4YMJA 3QGYA 1W98A 2R0IA 2R3GA 3GQLA 4L53A 3FSFA 4J53A 2B1PA 2CGVA 4F0FA 4O83A 1IEPA 4O0RA 3O8TA 2VX0A 3QHWA 4OT5A 5M09A 2YM7A 3DTCA 4UZHA 3ZTXA 2YHVA 5E1EA 5T3QA 3RPVA 4LRJA 3LFEA 3NSZA 4GJ3A 5KE0A 1UVRA 4IW0A 4Z7HA 3TEIA 4O96A 3FXXA 4FICA 5J8IA 5JKGA 1SYKA 3BGZA 4C7TA 2GPHA 4AW0A 4D9UA 5CEOA 2JKQA 2PZ5A 3QKKA 1NVQA 4E6CA 4CNHA 4JNWA 2BHHA 5EH0A 3KRJA 4O7NA 3ZEPA 5A14A 5HE2A 4XLVA 4XV9A 3QRIA 3F2RA 4AE6A 1GAGA 4JQ8A 4YJRA 2WMBA 2VV9A 2C5YA 2W4KA 2BDJA 1ZYJA 4XRLA 1LPUA 2YLEA 2W1ZA 1BI8A 2OIBA 2XM8A 4MH7A 4NH1A 5HU9A 4O7WA 3KXMA 4QNYA 3PLSA 3C0GA 1H1RA 4IADA 4NKAA 3SQQA 4QTAA 3SOCA 3UO6A 3OCSA 5CAVA 4R1VA 4FYNA 4D4VA 2DWBA 3ZLXA 3TYKA 3DT1A 4I21A 4MNEB 5BUJA 2PVLA 1P5EA 5IQDA 3QAME 5FBNC 2B9IA 1BMKA 2VGOA 4D4YA 4EHEA 4O22A 5EM6A 5CS6A 4UB7A 3OXIA 4FTAA 3MESA 4PP9A 4FA2A 2Q0BA 2CDZA 2RG5A 4ZXTA 3G2FA 4G3DA 4YZCA 4EBVA 4ID7A 4BDGA 4DGLC 5EK7A 4OTHA 5FEEA 4E6DA 3P86A 2BRMA 4G6OA 5K5NA 4YZBA 4X2GA 4BKZA 4XG2A 3KREA 4L8MA 4RIYA 4ALVA 1HOWA 3LXKA 1W7HA 3EQBA 2YM5A 3NEWA 2CPKE 4CKRA 3OOGA 3PTGA 5HIBA 3IECA 4Y95A 4BIEA 1FQ1B 4KB8A 3VQHA 3O2MA 3UZTA 3CGFA 2XK6A 3KA0A 3BGPA 2R3PA 3DPKA 1UNGA 3KMUA 3KXHA 3OC1A 4GVJA 4LL0A 5EKOA 3R9DA 5JFSA 4FJVA 4X2JA 2OZAB 3F5PA 2F2UA 3DCVA 4I6QA 3TZMA 3BX5A 3T3VA 4P5ZA 4WRGA 4AZSA 4E3CA 3NLBA 3QCQA 2WMUA 3TNPC 1OIRA 2ITTA 5HZNA 4GJ2A 1SVGA 3WF5A 3FMEA 3NYVA 3QUEA 4AN9A 4ANSA 4E4LA 4JRVA 3F5GA 4M97A 3PP0A 4FL2A 4CV8A 3RTPA 3DJ5A 1Q8ZA 3C9WA 3MH2A 4IEBA 4EK6A 3OWLA 3GC0A 3PWYA 3KRXA 2H9VA 2OJJA 3FY2A 5BYZA 1REJA 5IQEA 3UQFA 4XHKB 2F7EE 5IH6A 4G6LA 4JLCA 2JDVA 4U80A 4HGLA 2X6EA 4AW5A 2V55A 4MXZA 2ETMA 5J1VA 3AD4A 3S95A 2ITZA 4YHTA 4MX9A 3PIYA 5EDQA 1WBSA 3NNUA 3AKLA 3PFYA 3CTQA 3GU4A 3TN8A 4ALUA 3EKNA 4YTFA 5C4LA 1ZYLA 4IVDA 4EONA 3NNVA 5DFPA 3F82A 2YAAA 1U54A 2FSTX 2WEIA 3BPRA 4X2FA 3E64A 4QYHA 1QPDA 4CVAA 4R8QA 2OFUA 1OPLA 3UNZA 1YHWA 3FKLA 4O4BB 4E8AA 1OMWA 2YDIA 3BHTA 3ORXA 3HRCA 3QALE 4C62A 1DI9A 1Q8WA 3H10A 3W0MA 5B2KA 2G01A 2ESMA 1TVOA 3FPQA 3SAYA 3W2SA 3FI2A 3QCXA 5CEPA 5GJFA 3VBXA 2NYAA 4O7SA 2OU7A 3DJ7A 4E5WA 5LWNA 3NZ0A 3OP5A 2JITA 3SXRA 4GFMA 5LWMA 3BBWA 4CZYB 2AC3A 3CY3A 3RGFA 4DGGA 5F1ZA 4J99A 3O96A 4PNKA 5E8YA 2W1DA 5EOLA 3VHKA 4DFLA 3KVXA 4YTCA 3OWPA 4QMVA 1KOAA 4XNEA 4I92A 4ZSJA 2WKMA 5JRSA 5LXMA 4MF1A 2BR1A 3TDWA 5AJQA 1OKVA 3QTWA 3RZFA 4F99A 4UV0A 3UBDA 3OOMA 4D4SA 1NW1A 5TT7A 2XKCA 5L2WA 5ETAA 3W0PA 2HOGA 3UYSA 4L42A 5DT4A 5IA4A 4IWDA 4CEGA 3F7WA 4F7SA 1ZARA 5K0KA 2B9HA 5FRIA 4KIPA 4QMTA 4DH7A 1NVSA 2JD5A 2YCRA 3OCGA 4DFBA 1H8FA 3W8QA 3EFLA 2BTSA 2YN8A 4MXYA 3TKIA 3UYTA 4YBKA 2YZLA 2Z7QA 5CEIA 4TPTA 4D55A 2G1TA 3EQFA 3ZSGA 4Y73A 2UW4A 4FV2A 4PTEA 3ZONA 3RK9A 4EK4A 2PZPA 4HYSA 2A0CX 2J0LA 4IB3A 3G6GA 2O63A 5EM5A 1UNLA 3FLYA 4EZ5A 4GT5A 3DZOA 3UO4A 5AR3A 3MY5A 4EYMA 5L6PA 2W96B 1SM2A 1YVJA 5FM3A 3V6RA 3IW8A 5HBJA 4UMRA 4E5BA 3TIYA 4YBJA 4OW8A 3GEQA 4EOSA 4K1BA 3DLZA 2VAGA 3BWFA 3ET7A 4BZNA 3QA8A 1Q99A 2RIOA 4BDKA 4DAWA 4EEVA 4DT8A 3KQ7A 4J7BA 2B55A 5J79A 1Y8YA 2J0KA 3LW0A 3V3VA 4CCUA 3NVKI 3QTSA 2Q83A 1Y6AA 1QPCA 2BAQA 4L45A 2BVAA 2JKOA 3CLYA 2XBAA 3A7IA 1PMNA 3VRYA 4HYIA 5ICPA 4C3PA 3G90X 4XG7A 4BCGA 4A9SA 2I0EA 4OGRA 1HCLA 4QMOA 3AC3A 4QNAA 4JBPA 4BKJA 2BDFA 5IQFA 3AMBA 4FYOA 3GC7A 4BTFA 4D0WA 1BYGA 2PZRA 1BX6A 2XRUA 3E8EA 3EN9A 3L9PA 3O51A 4MQ1A 2BFXA 2Y0AA 3DAKA 3DS6A 5AUWA 5M53A 1FMKA 3JPVA 3ERKA 3UVRA 3HX4A 2GHGA 5L2TA 3ZRLA 3DBEA 1OZ1A 3SA0A 2QOIA 2Y9QA 4R3RA 4BR3A 2GNGA 4HOKA 3Q9YA 4FTIA 2QKWB 1AD5A 3EN6A 2IZUA 4JBQA 2PVHA 2YM3A 4KS7A 3ZCLA 1SVHA 2J2IB 4GK2A 4JDIA 4LGGA 3QQGA 2HENA 4OBPA 4IJ9A 1H27A 3IKAA 4GUEA 2UZLA 4AZWA 5A54A 3NUPA 4KD1A 1F0QA 3OXTA 4I5PA 3QCYA 3G5DA 3IOPA 3T9IA 4FTCA 5FXSA 4EOPA 4IX5A 5I3RA 4IHPA 2XJ0A 2ITYA 3ORMA 4DEBA 3GU5A 4JX7A 2JAMA 2ZV8A 5HLPA 4BZOA 2X39A 3JY0A 4YTIA 3PVGA 2IVUA 3SOAA 4A9RA 1GZ8A 2A4LA 3MFTA 4X21A 3UVPA 5LVLA 2X0PA 5K3YA 4RC4A 3QTIA 4M68A 3QQUA 4P5QA 4AXAA 4AACA 4BCNA 2B54A 2YM6A 4RWKA 1Q97A 3UZRA 2QC6A 3DDQA 4XG8A 2VZ6A 4S34A 3AD6A 3D0EA 5CX9A 5FP6A 4A9TA 4APPA 1YWNA 2C4GA 2X9EA 4IAKA 1UKIA 3DA6A 4CFFA 3QQHA 2CJMA 2W1IA 3BEAA 3KULB 2C47A 5CLPA 5I9XA 4FK6A 5LJJA 5FP5A 5ACBC 3AQVA 3EJ1A 4RGJA 3AC2A 3VC4A 4QMZA 2PMIA 4D2VA 2PVMA 2VO3A 1R0EA 4BI2A 1YI4A 5IG1A 3UNKA 3PVUA 2VTSA 3BHUA 3Q4ZA 3FMMA 3U9CA 2RFSA 2W5HA 3AT2A 2QG7A 3E8CA 3UODA 3MH3A 4NEUA 3ZO3A 3HA8A 5AA9A 3BQRA 4B0GA 2H34A 4DC2A 4AAYA 4PTCA 5I9UA 2DQ7X 3VQUA 4D58A 2R7IA 3NUUA 2OIQA 2V7OA 4C4HA 1QPJA 3ZM9A 3QUPA 3LFFA 1H07A 3L1SA 5DLSA 4LFIA 2ZV9A 3MVJA 4AXEA 2YEXA 5HGIA 3FDNA 4ZK5A 3F7ZA 3BYSA 4FL3A 3PRIA 4Q9ZA 3P7BA 4IB0A 1U4DA 3SG8A 5FTGA 5EYCA 2XEZA 4IB1A 1F3MC 1W0XC 3OS3A 2YITA 3RHKA 3BU3A 4NSTA 1VYWA 2WZJA 4EH4A 4AXFA 4WBBB 4OBOA 3E8DA 4A4LA 4L46A 5JH6A 2OWBA 3L9NA 3NNWA 4TKSA 5EQPA 2WQOA 2ITXA 4I1ZA 4KIQA 4X3FA 2FO0A 4AOIA 3ZSIA 3H3CA 4XP0A 3FLQA 4CFUA 3LXPA 2BRBA 2C3JA 4I24A 1G3NA 3RAIA 1GZNA 2PZIA 1DS5A 3LAUA 5CENA 1ZYCA 1MRYA 4WRSA 1X8BA 3MJ1A 3NYNA 5HBEA 4GYIA 2BRHA 3MIAA 3W55A 2YIWA 2XK8A 1WVYA 4YHJA 4BFMA 4FEUA 1MQ4A 3HVCA 4PMSA 4RX8A 3BQCA 3UP7A 4II5A 3EMGA 3AMAA 4AFJA 3TI1A 4DEHA 1IA9A 1SNUA 5HVYA 5KMMA 2P4IA 3E93A 5BVKA 3F6XA 2KTYA 4F63A 4BJJB 3OF0A 4C4EA 3ZH8A 2WGJA 4QPAA 1NXKA 2GHLA 3FZSA 4JRNA 5AX9A 3H9OA 3AKKA 4FTLA 4FIJA 5AP6A 2ITWA 3HP2A 3DFAA 3EQCA 5EW8A 3PVBA 3PUPA 2Z7RA 2HZ4A 4ACCA 4EHVA 1K2PA 4H36A 3GOPA 4IX3A 3QD0A 3FQHA 2BZKB 2X0QA 4OTDA 2OH0E 4EOIA 4UYNA 4YJSA 5JGDA 2IPXA 2WPAA 3HMOA 2HCKA 3F66A 3Q9XA 2CN8A 3T8OA 4KIKA 2ZV7A 3TNWA 4QTEA 5LVOA 4NCTA 1GNGA 3ORKA 2RGPA 3O8PA 3R8ZA 4JG6A 2VO6A 3MA3A 2BTRA 1UU9A 1XH8A 3FC2A 3WF7A 2ZJWA 3R21A 3KXGA 4YU2A 4G17A 4UY9A 4Y5QA 2WOTA 4I93A 4DHIB 3VVHA 3UDSA 3SLSA 2JDRA 3PG3A 3A60A 1GIJA 5DGZA 4YZNA 2HIWA 3ZSHA 5HHWA 4C59A 2CNQA 1ERKA 3LCSA 5AR7A 2R5TA 4FV9A 4QYFA 4R6VA 4W8EA 5D11A 5JT2A 2EUFB 4FTTA 5BNJA 5J9YA 2X2KA 4FZ7A 3VUTA 4DYMA 5IQIA 4O4FA 5EDPA 4EORA 3DBCA 4ZTQA 3DBDA 4EWQA 3LE6A 3QHRA 4I0SA 1KV1A 3E92A 5D12A 2J0IA 1ST4A 5HTIA 4V0GA 3WZDA 4DH8A 4FV7A 2DYLA 3U6IA 3HGKA 4RJ6A 5KNJA 4CG8A 3G9NA 4DHJA 4ENYA 4XOZA 2XANA 4TWPA 4FV6A 5DR6A 3HLLA 3KN6A 4DH3A 1UV5A 3ZOSA 3AT4A 4QMPA 3BELA 5K0XA 4O7YA 3OW4A 4BGHA 5FEDA 3TJDA 5D7AA 3LLTA 3GP0A 1M2QA 3E7VA 4TL0A 4HVHA 2XKEA 3FMHA 3O5AA 1DAYA 3FEGA 2FA2A 4ASXA 4FIFA 3P9JA 3MTFA 2CCHA 3VW8A 3RMFA 5LQFA 2GNLA 4NZWB 4RVMA 3W2CA 3P5KA 3GENA 4AX8A 1F5QA 2PE1A 1BL6A 3EQIA 2BALA 4FTOA 3TWJA 2OJFE 4U40A 5C4KA 1YI6A 5AEPA 4ZY5A 2BZIB 3PPKA 3EIDA 4FV4A 3GCSA 4AGUA 4FOCA 2W1HA 4FT5A 4FVPA 4QYEA 1OL1A 2BZHB 2VN9A 3MYGA 4YURA 3A8WA 4PL5A 2F4JA 3RCJA 1OKZA 5AM7A 4C37A 3PZEA 4W4XA 3LVPA 3RINA 3WZUA 4PUZA 3R28A 4FUYA 1A06A 3E62A 4X3FC 4XJ0A 3SRVA 3CCNA 4LGHA 4F6WA 4J71A 5CU4A 2OJIA 4JR3A 3ZXZA 4EHGA 4C4GA 1H08A 2XAOA 5EFQA 3W8LA 2XNGA 3RHXA 2P2HA 4CFWA 4PDSA 4DLIA 2X7GA 2EB2A 4EKLA 4RJ8A 2O8YA 4L44A 3VS0A 1H01A 2X2MA 3LFDA 4IWPA 4AA5A 5IUHA 2DUVA 5LVMA 4BCOA 1XQZA 2BRNA 5HO8A 4V01A 4ZS4A 1TZDA 2JDOA 4NM5A 2OJGA 2XNBA 3IGGA 5AV3A 1YDSE 3DU8A 5TR6A 3COHA 3MTLA 4BDIA 5M44A 3A2CA 3CJFA 3LJ2A 5IMEA 3P1AA 2PTKA 4YJTA 4YTHA 3TDVA 5AR8A 3UDZA 4BDHA 5CSHA 2W1CA 4HNIA 2G9XA 2ZM1A 1ZZLA 2W1EA 4HZRA 4IAAA 4U42A 2ITVA 4YJPA 3ZZWA 4BDDA 4C33A 4DCEA 3HAVA 4CXAA 5HU3A 3R8LA 3SV0A 2HWPA 2GS7A 4FIGA 3VBQA 3TKUA 5AADA 3BL9A 2XIRA 4U44A 2X8EA 4UZDA 4QPMA 1PJKA 5G6VA 4D2SA 2WEVA 4ZSLA 4L00A 2X9FA 4WSYA 2ZM4A 2F57A 2OW3A 1PMVA 1S9IA 5BVEA 4A06A 4AW2A 3ZLWA 4EUTA 1DAWA 5EI8A 3W2RA 3HP5A 4DG3E 4F6UA 2QHNA 3K3IA 4PPCA 2WMRA 4NW6A 2XNPA 4NCTC 4DHZA 4FSYA 5FWKK 3CGOA 2C69A 5T68A 3M11A 2ERKA 3UNJA 3PSDA 4G9CA 4BVUA 4DDGA 3PXZA 3ZM4A 4ITJA 2B9FA 3I6UA 2OI4X 3R63A 2YIRA 4GU9A 3R7VA 4C58A 5L2IA 4USDA 4IANA 5CF5A 4QMNA 5AAEA 5J9ZA 4JQ7A 5GZ9A 4K6ZA 2Z2WA 3WOWA 5K9IA 5D7VA 2G2FA 4C38A 2OZAA 1ZOGA 3L9LA 2PVFA 2QO7A 3QQFA 4MBJA 4M0YA 3D7ZA 5HCZA 1E1XA 2NP8A 3NCGA 2C3KA 1REKA 3ML1A 2I1MA 3KF4A 5CTPA 2XYUA 3TV7A 3QTXA 4GH2A 4IAZA 2X81A 4EOOA 5M4FA 4L67A 3V5QA 3QTUA 2XIXA 3KRRA 3PSBA 3LJ0A 5HNBA 3RCDA 4HVSA 5HTCA 5DHJA 1IASA 4AGCA 4XG9A 3N4VA 3ROCA 2IVSA 4FR4A 3HKOA 4FT0A 1B39A 4NT4A 4YGAA 2IVTA 2GNJA 4TY1A 4XG4A 4ZSGA 4D28A 5FQDC 3R7IA 2ZMCA 1FGIA 1YXSA 2BROA 2NO3A 1PKGA 1G5SA 2HXLA 4HPTE 3DNDA 5GINE 3WIGA 3E8NA 4Z55A 1KE8A 3RI1A 4AF3A 2J7TA 3QWJA 3UDBA 2VO0A 3PPZA 4JDJA 4ACMA 4D1SA 3I6WA 2IO6A 1H1QA 2G2IA 2QG5A 3PXYA 4H58A 4O0TA 3FY0A 5E1SA 3RPRA 3SXFA 4EOLA 5CEKA 3ZXTA 1ND4A 1XMMA 3IOKA 2QOCA 4RZWA 3BLHA 1VZOA 2XK4A 3QD3A 1K3AA 4EH9A 2EB3A 3MVHA 3DKCA 4FKTA 3OD6X 4UXLA 5IU2A 1WZYA 1MRUA 1XBBA 2YLFA 5IA0A 1PXKA 2XS0A 5E4HA 2VWUA 5KKRC 2PMLX 4FV1A 4ITHA 4R3PA 4FEQA 3G0FA 1K9AA 3R7UA 4G1WA 4IIRA 4XV1A 4G5PA 2C3IB 5B2MA 4ZOGA 3UIBA 5EHOA 3CD8A 3QGWA 5IKWA 4DLJA 4F4PA 2WTKC 4H1JA 2CNVA 2WU6A 3LLAA 1V0BA 4E1ZA 3E7OA 3KMMA 3EYHA 4N57A 4NL0A 3TL8A 3VBYA 3JXWA 4E7WA 4R77A 1PF8A 2CCIA 1WFCA 3GU7A 1J1BA 2C6IA 4NM0A 4W4VA 3FE3A 4CMUA 4QRCA 1B6CB 2A98A 2OG8A 3R00A 4FKSA 1H1WA 4K8AA 2R3LA 4NIFB 4U7ZA 4X6QC 5TE0A 1M14A 4TYJA 3V5PA 3DQXA 4ZTLA 3ZMMA 5HE3A 3Q53A 4CFMA 3OT3A 3C4XA 2V0DA 3MBLA 4P2KA 4G34A 2HXQA 5HD7A 2GQSA 4M13A 4QP4A 1FBNA 5CT7A 1J7IA 4HZSA 4PV0A 1R0PA 3G0EA 4ERKA 3COMA 2Z7SA 2VWVA 5TO8A 2VTRA 3DFCB 4OTGA 3QYWA 4FSZA 2RFDA 3TMOA 1OL5A 3OBGA 4G9RA 4O0SA 3NW6A 5HIDA 2EXEA 4TYIA 2GSFA 5C8MA 3VHEA 3DKFA 3HMPA 2HY81 4EOQA 4X2KA 4FUXA 3PP1A 5E8XA 5KMOA 3PIXA 4QMWA 4XP2A 3NUXA 1CSNA 2PE0A 2XKFA 3FXZA 4RJ7A 3SW4A 2YCQA 3EFWA 2YZAA 3Q9WA 2C68A 4FTQA 4RIWB 3R7YA 1PKDA 3HRBA 4LOPA 5DWRA 4KAOA 2O5KA 3BV2A 2IW6A 4BDEA 4YLLA 4DEEA 1ZYSA 5A46A 1YOJA 1CKJA 2OXYA 4KS8A 4CT1A 4RVLA 4NFMA 4YC3A 3MVLA 2GU8A 2VTTA 4O4CA 3BEGA 4PY1A 3MFSA 3W0QA 4FTNA 4O27B 4LI5A 4M0ZA 3WARA 5BPYA 1Q8TA 4AQCA 5LMKA 2E9PA 1G8JA 1KE9A 4DGMA 3C7QA 1OKWA 1OKYA 4FIIA 4MXCA 2ZB1A 4QQ5A 5CWZA 1QCFA 3EHAA 5EM7A 1FVRA 3D5WA 4M69A 4MWIA 5B7VA 4O81A 4PDPA 2A27A 5L3AA 4EL9A 3IDBA 3NUYA 4E4NA 3KU2A 1MQBA 2WTIA 4FSUA 3PY0A 1M2PA 5ANJA 5KUPA 4WA9A 3ZRKA 2WTJA 2XIYA 4QQTA 4F9YA 5EM8A 3TNIA 4AOTA 1ZOEA 3NGAA 4BCHA 4GIHA 5KMIA 4I3ZA 4BCFA 3OUNB 4I22A 2JC6A 5HO6A 1Y6BA 2R7BA 4O1OA 3PXRA 4QP1A 3K5UA 4PTGA 3OW3A 3ENMA 5L8KA 3A8XA 3OUKA 4ZLOA 3BE9A 4IZAA