4FV5A

Crystal structure of the erk2 complexed with ek9
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
349
structure length
330
Chain Sequence
AGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVAATRWYRAPEIMLNTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with EK9
rcsb
source organism Homo sapiens
total genus 98
structure length 330
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fv5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fv5A01
3EN9A 2WTCA 2J0JA 2J7TA 2CKQA 1XH5A 3AGLA 2VTIA 3WF7A 5LMBA 2V7OA 3TUBA 4BCJA 3O50A 4EHVA 4EH5A 2CN5A 4QPMA 1I44A 3K3JA 4QP1A 3FXWA 5I9XA 2IZTA 3OROA 5HO7A 5LVMA 3EZRA 5K0KA 1JNKA 4RG0A 4H1JA 2ZV2A 4GJ3A 5DNRA 3ETAA 3H0ZA 4U6RA 3D2IA 4W9WA 3O7LB 5DR2A 4D2VA 3MB6A 4E5WA 3T3VA 3VUHA 2W4JA 3WIGA 4DHFA 4RX9A 4CG9A 3D7TA 2C6OA 4Y5QA 5GIOE 3IW6A 4XNEA 2PUPA 2CHLA 2B53A 3LLAA 3MA6A 3RCDA 4XX9A 2ZB1A 3QQKA 4KKGA 1WAKA 4ALUA 4BB4A 3EKKA 1UU8A 3UJGA 4R7HA 2YCRA 1ZZLA 2OXDA 5DH3A 2BUJA 3L8XA 4IB1A 3ZBFA 5B7VA 1H00A 3EQGA 1SMHA 3DKFA 2B7AA 3H30A 3OW4A 4FIEA 4OR5A 3FEGA 2R0IA 1JKTA 4RJ4A 5ANEA 5AR5A 2C5OA 3SA0A 1KE8A 4AGCA 3HV4A 1S9JA 4W4WA 3JR1A 2H9VA 5AUZA 1YI3A 3C50A 2OIQA 4JXFA 5DN3A 3UP2A 4ANNA 1H01A 4D4SA 1YWNA 4DGGA 5E8WA 4PL4A 4UN0C 5JFWA 5IQGA 3M1SA 3NNWA 1Q8ZA 5H8BA 3FBVA 3VS7A 4O0RA 3UO6A 4DTBA 2XF0A 2F7ZE 2XK4A 5EYMA 4BDFA 1NVQA 3ZO2A 5CF4A 5AP2A 1PXLA 4PPCA 3MFRA 4O38A 5BNJA 4AOTA 4WT6A 3V5WA 2J2IB 4RIYB 3K3IA 5IA1A 2PE0A 3QAME 4NZWB 4EBWA 4BCKA 5L8JA 4JDIA 5KMIA 1CDKA 3D83A 3PIYA 1WVWA 4DH8A 1S9IA 3F5PA 4YTIA 5TE0A 1YQJA 3MVHA 2H34A 4O82A 4IMYA 5E8UA 2R3HA 3F61A 2XEZA 2IZRA 4IAZA 2OW3A 3KQ7A 3G9NA 4ERKA 3VBVA 4QTAA 2QHNA 2VTNA 4IAYA 4M0ZA 4MCVA 3NDMA 4O0WA 1W82A 1WCCA 4QMVA 4QTDA 2Y6MA 4WBBB 4AA0A 4DFZE 4F6UA 3ZZEA 3F82A 3FZTA 1JKLA 4L68A 4BKZA 5E8XA 2R9SA 4LI5A 4U5JA 3RPVA 4I0TA 5L4QA 4U41A 5EDQA 2G9XA 4CV9A 3MFTA 1OIRA 2UW6A 4FKOA 4KIKB 4FV5A 3ZC6A 3NLBA 4E6CA 1WVXA 4CZUA 1FGIA 4O91A 1KOBA 4LGDA 1MRUA 4NWMA 3FQSA 5I4NA 4BDCA 3DDQA 5FTOA 2A0CX 2H8HA 2JBPA 1MUOA 3W18A 3HX4A 4FV3A 4MNFA 4KSQA 3FI3A 5FQDC 4GUEA 2FSOX 3PXQA 5HGIA 4DH7A 1Y8GA 2WKMA 4U80A 4CRLA 4NW5A 3GCUA 3GT8A 3LFCA 4KINA 4E8AA 4FKIA 4KB8A 4BCFA 5CU3A 4GUBA 3ZBXA 2O3PA 4FODA 3PRFA 3QC4A 3L9PA 3I4BA 4NU1A 4AX8A 4HNFA 2DYLA 3E62A 4AGUA 4C02A 3HLLA 5J9YA 4FV8A 2VGOA 1KV1A 3PXRA 2EB2A 1OUKA 2QOLA 4CFMA 5AP0A 3F88A 3FI2A 2OH4A 3AC3A 4JG7A 2YM5A 4C3PA 4FV2A 5A54A 4H36A 2OZAA 5CENA 1ND4A 4GT3A 4IVBA 3LMGA 1OL2A 5HNGA 1J1CA 4TYIA 2BAKA 3E8DA 3V5TA 3SRVB 3TZ8A 3F6XA 2UW4A 3OOMA 1XH9A 4MXYA 3HP2A 3QQUA 3HUBA 3FSKA 3UNZA 3WZEA 3GU6A 3LOKA 2OJ9A 4J97A 3JPVA 3WYYA 1PYXA 3TKHA 3RCJA 3SXFA 3W8QA 5CT0A 4BIBA 1FQ1B 3F2NA 5HE0A 3EQFA 3MW1A 4PNKA 4NL0A 4HOKA 3RNYA 1H4LA 2OI4X 2PUNA 1R0EA 5CVHA 2XCHA 4IZYA 2YJSA 1XH7A 1NW1A 3FLYA 3D5UA 5I0BA 3HMNA 3T8OA 4AQCA 4TYJA 4F7NA 3W2CA 2HYYA 3WARA 4MKCA 2GS2A 3WZUA 4F9WA 2VTOA 2IW9A 3EQDA 4K11A 5DYJA 4Y46A 4X3FA 1ZYDA 5K9IA 2HWOA 4KIPA 2E9NA 2BKKA 2CSNA 1KE5A 4P90A 3MDYA 4Q9SA 3ODYX 3LFBA 4C57A 2IW6A 2PVLA 5KHXA 1SYKA 3HUCA 5IUIA 3PWYA 4JX7A 1OPLA 4J99A 3UVQA 1FVRA 4FG7A 4I5MA 2YIXA 4IE9A 1O6YA 2FO0A 3PSCA 3W16A 1WMKA 2Y7JA 3GU5A 3KRWA 3OT8A 3BCEA 4MH7A 3OG7A 2GDOA 1BMKA 2VTHA 3R71A 5AP1A 4RVKA 3OXIA 4IAAA 2ITTA 4EH2A 1J1BA 5GJDA 3H9RA 3KXHA 3NYOA 4YP8A 4X3FC 5IA2A 4L8MA 2QOCA 4P5QA 4JT3A 2VWIA 2GQGA 5L3AA 3VBQA 4FUYA 4TL0A 2WGJA 4NKAA 1GOLA 2JDOA 5AP4A 3UOJA 3W2OA 3MH1A 3MY0A 4N4SA 2PUIA 3HA8A 3U9NA 4FEUA 3PTGA 5K4IA 3A61A 4AE6A 4DGLC 4IACA 5CVFA 4R6VA 4BR3A 1ATPE 2R3KA 4FR4A 2W96B 1NY3A 2Z7QA 3F3UA 2PVHA 1U5RA 4FTKA 5CU6A 5AUUA 2QO9A 3DXQA 3FZ1A 1GZKA 5ETAA 3NMUF 1ZYJA 2OFVA 1TKIA 4DGMA 2Y6OA 2QOOA 3CJGA 4R5SA 3RHXA 3KFAA 4OAUC 5C4LA 1Y6BA 3BV2A 3TNPC 5EM6A 3AC2A 4L3LA 4J52A 2YISA 4IADA 5A14A 4FSUA 4HYUA 5D11A 5DG5A 2QOFA 2BHEA 1JKKA 4UMTA 4BYIA 2C4GA 5CNNA 4I5HA 2X6DA 3UPXA 4IC7A 5HVKA 5CSHA 3MIYA 3S2PA 1WFCA 3OEFX 5J87A 3U51A 3WIKA 5HX6A 4KIOA 3K54A 4EH7A 4QP4A 1XH6A 3EN7A 1MRYA 5AA8A 4UZHA 2VV9A 3LXKA 4GU9A 3A7GA 4IDVA 5AV0A 4CZTA 2WEIA 1XR1A 2WOTA 3F69A 5AR4A 4CRSA 2C5VA 4CQGA 3ROYA 4J71A 4LRJA 3M11A 5AR7A 3V5PA 4CMTA 5FBOA 1YRPA 4BGGA 2QOKA 4ACHA 4FZFB 4YR8A 4ZOGA 4K6ZA 4I23A 5HTCA 1NVRA 4J1RA 4FZAB 1PJKA 3RWPA 4EORA 2GNIA 4D1SA 4G2FA 3A7IA 3O8UA 1CSNA 1GIHA 1M17A 3DNEA 3D9VA 3ERKA 4QT1A 4UZDA 3VRYA 2YHVA 3JY0A 3WZDA 4C4JA 4DG3E 5KMOA 5JZJA 2YM4A 2C5XA 3VBWA 4QQCA 2X7OA 3QWKA 5HBJA 5AWMA 4BVUA 3PE1A 1LUFA 2OJGA 1Z57A 1XJDA 5ETIA 3LFNA 4PTCA 3DKOA 3LFEA 4F0FA 2XNMA 3V51A 4FF8A 2W1GA 5IQEA 4ASEA 3HMOA 1R0PA 1IAJA 4PDYA 4EQMA 1LP4A 1MP8A 4FX3A 2JLDA 1X8BA 2NRYA 2X2LA 4A07A 2VNYA 4C59A 1MQBA 5EQPA 2W4OA 2YERA 3K5VA 2C3IB 1YDRE 5HIDA 3ZDIA 2IO6A 3SC1A 3TM0A 4I4EA 3ORKA 2WD1A 4M84A 4YZBA 3MV5A 3NIZA 1Y57A 2OJFE 1HCLA 4YJVA 3EL8A 5EFQA 3UYSA 3PJ8A 4XP2A 2G2HA 4EK6A 3QRIA 4M97A 2IVVA 2ITXA 2ZM4A 3HEGA 4H1MA 4I22A 5CZIA 4P4CA 5E8VA 4ACCA 5KX8A 3HMIA 4QOXA 3MVMA 4HPTE 5EKOA 4J95A 2XRUA 4D58A 4WKQA 2J9MA 2O2UA 1G8AA 4J96A 3KCFA 4MBIA 3R9DA 5EHYA 3FLZA 3DBCA 1JAMA 4YJOA 2BPMA 4FICA 3BLRA 2X8IA 3FKLA 4MHAA 4QMWA 3I60A 4GRBA 3VS0A 4EZ3A 2JFMA 2ERZE 2GSFA 3CD3A 5BVFA 3R04A 5DA3A 4USDA 5KCVA 3G6HA 3WZJA 4H58A 1HOWA 4IANA 4DFNA 4E3CA 2BRGA 4B99A 3EJ1A 4CFWA 3QGYA 2FH9A 3TCPA 4FEXA 4Y72A 3D5WA 5DRDA 3RP9A 5L6PA 4B9DA 3TNQB 4RVLA 4AE9A 1U4DA 2E2BA 3ORPA 4DGNA 2OICA 1QCFA 5BUIA 1Q41A 5M57A 3CP9A 2G2FA 4UMUA 5CU0A 2FSTX 4E4XA 3HRCA 3BWFA 3SX9A 1TQPA 2PVFA 2QCSA 2VTSA 2GS7A 3QTSA 4U43A 4DEBA 1URWA 2WMAA 3O96A 4GU6A 3FZSA 3IGGA 3PJCA 2HOGA 3D14A 3PJ3A 3S4QA 4O7LA 1OB3A 1VYZA 1H8FA 3EQBA 3L9MA 4BI0A 5HNIX 3WYXA 4L45A 4XG3A 2XJ1A 3WI6A 4EOQA 3RKBA 4FT0A 3TV4A 3CPCA 4AN9A 4LUEA 4IH8A 4CD0A 3GU8A 1P4OA 2YM8A 3MIAA 4BC6A 3GC0A 4ANBA 4FEVA 3PG1A 5E8TA 1JWHA 3E3BX 3Q6UA 1ZWSA 2UZWE 4FNWA 4U3ZA 4K18A 3BX5A 4X21A 3WBLA 3D15A 3UZTA 4V04A 2JFLA 3NW7A 3R8UA 3UGCA 4BCMA 4KRDA 4CFXA 2ITNA 4MK0A 3N4TA 5FDPA 4EC9A 3C4CA 1YOJA 3REPA 2Q83A 1GIJA 4C0TA 3FY2A 2JDTA 2V22A 3L9NA 1H1WA 4IB3A 5BMMA 3RAWA 2QR7A 3ZSIA 2QOHA 1UNLA 4PF4A 4DN5A 4F4PA 3D7ZA 3UIXA 1Q24A 3ZHPC 3LCOA 3DFAA 4EL9A 2PVRA 3CLYA 3WOWA 4BIEA 4MBJA 4X3FB 4MBLA 2Z8CA 3VNTA 3CEKA 3CY3A 5CEOA 3DBQA 3RI1A 5CAUA 3EYGA 1GNGA 3ULIA 4ASXA 5CXZA 5HIEA 3NYVA 3HVCA 3I6UA 3OT3A 4WHZA 5DI1A 4CTBA 3CKXA 5IF1A 2QOBA 4YZNA 2W5BA 4FNYA 2ZDTA 4D2PA 1I09A 4MX9A 4OTQA 2OU7A 3MA3A 3HGKA 5KZIA 3PZEA 4AZWA 1NT2A 3E93A 4J8NA 4C34A 2YJRA 2XIKA 3N4UA 2NP8A 4U79A 2X8DA 4UY9A 1OUYA 5BYZA 1DAWA 4I94A 3ROCA 2RSVA 3PSBA 4FTMA 3BEAA 2GCDA 3PXYA 4BDJA 2WPAA 4F6SA 4GSBA 4O84A 4KWPA 3PE2A 2C5NA 3SXSA 1PKDA 3IK3A 5GZ8A 2DS1A 4X2FA 2OJJA 5CF5A 3OMVA 2UZDA 3NX8A 2ITZA 3V8SA 4E20A 4ITHA 3WZKA 4C62A 4I6QA 4I92A 4WNOA 5K0XA 3MPAA 5FEQA 3RZFA 3KF7A 3QD0A 4M68A 4YJTA 3GUBA 4YZCA 4APPA 2YWVA 4UWYA 4Q9ZA 2VGPA 3DXPA 2ZM3A 5CAOA 2YLEA 3AOXA 3MY5A 3MSSA 3PRIA 5DR6A 5ACBC 3VO3A 3I7CA 4CTCA 2CKOA 4HVDA 5HVJA 5IPJA 3A7JA 3DJ6A 3TJDA 4BIDA 5IH6A 3LM0A 4X6RA 3ZO3A 3KGAA 3POOA 4JAJA 4E6DA 3LQ3A 2QR8A 3GCVA 4JIKA 4CV8A 2XNEA 3IW4A 3Q4CA 2O5KA 3BV3A 2BZKB 2HXQA 2W99B 4ARKA 3MVJA 4KIKA 4OTHA 2C0TA 2W1ZA 3CC6A 4ZJJA 4FSWA 1WVYA 3AQVA 3C4ZA 5HCXA 2NNWB 3G0FA 4BDHA 5LMKA 5DFPA 1APME 1KUTA 1CKPA 2XRWA 4FK6A 3TN8A 2EB3A 3KREA 2WQMA 4WG4A 4ZTLA 4EYJA 4Z3VA 3PLAE 4V01A 4UMRA 4U44A 2SRCA 5HE2A 4EHEA 1EH4A 4L52A 5J9LA 1V0PA 2PTKA 2WMTA 3FL5A 3ORXA 3O51A 5TO8A 3EMGA 3QC9A 2VWYA 3B2TA 3PJ1A 1YI6A 3MTLA 1H1PA 2VD5A 2XYUA 3IS5A 4N57A 3DKGA 5I9WA 4O83A 4U3YA 4FUXA 2A1AB 4M15A 4C2VA 5JFVA 3FQEA 2UVXA 5CI6A 4JIAA 5AEPA 3QHRA 2G01A 2QO7A 2P55A 4IX6A 2BRNA 4LG4A 2GHGA 3HRFA 3MYGA 4FC0A 3KVWA 3TZ9A 3SRVA 3BE2A 4DFYA 2PYWA 3L9LA 5EG3A 1O6LA 3ELJA 2W9FB 4FG8A 4S30A 2RKUA 2ITQA 4KABA 2J0MB 2FA2A 5F9EA 4C36A 3EWHA 4AU8A 3E63A 4EUUA 3G5DA 1H24A 1JVPP 2J4ZA 5AV2A 2X7GA 5HO8A 4ANOA 5HNBA 2YZLA 3BBTB 2XJ2A 2PSQA 2A2AA 3PG3A 4XUFA 3DGKA 5J8IA 1J7UA 4B8LA 4G3CA 5IU2A 5KMNA 3SW7A 4QQJA 5CEQA 5FGKA 4QQTA 3Q3BA 3RPOA 4D2SA 3CKWA 2OZOA 1TQMA 2UVYA 3MS9A 3R8LA 3KK8A 3ORMA 3VHKA 4U9AA 5LQFA 1MRVA 4GYIA 4BCHA 1MQ4A 1R3CA 4PL3A 2BVAA 5L2QA 2PMIA 5FG8A 2WOUA 2OFUA 2EVAA 5BVDA 4EK3A 4ANMA 4M8TA 5AP6A 5FEEA 5EW9A 3PPJA 3QHWA 2EXMA 4FTNA 4FV6A 4J8MA 4JR3A 5BPYA 3PXFA 3QUEA 2J0IA 3F5UA 4EUTA 3UQFA 4FIJA 2BFXA 4JDKA 3GU4A 4LOQA 5AUXA 2UZNA 2I1MA 5M44A 1K3AA 1PF8A 2OWBA 3Q4ZA 4TWNA 2ZV7A 1FVTA 4Z55A 2XZSA 2WTWA 1JQHA 5JQ8A 1XH4A 4RA4A 3RWQA 3VUIA 1HCKA 3NNUA 2PK9A 3FYJX 5FXSA 2EXCX 2VTMA 4X3JA 3FMHA 3QUPA 5TR6A 4F63A 3CSVA 5BUJA 2C3LA 5JGBA 5C8MA 4LL5A 2H96A 2R2PA 2V55A 2BIYA 4E4NA 4EBVA 2XJ0A 4F7SA 3TNIA 4BBFA 1H1RA 5JMSA 4EQCA 2ZB0A 3DQWA 2VWBA 4JBQA 3I5NA 4L53A 4TWOA 2PWLA 4FTQA 4RJ8A 5J5TA 2AC5A 5M4CA 3IQ7A 1SVEA 4G5JA 4ZY6A 3IW8A 2XP2A 1ZXEA 3EN6A 1NA7A 5E7RA 2W1EA 3TKUA 3UNKA 1SM2A 2B9IA 2BDFA 3QTZA 3Q9ZA 3ZEWA 3BELA 2VO3A 5AUWA 3VHEA 4FVRA 4L6QA 3JYAA 4DITA 2CPKE 5KO1A 4W4XA 5DHJA 3R7IA 2W1FA 3L8PA 3QBNA 2YABA 4GFOA 2X4ZA 3TIYA 4OTDA 5J5SA 3OW3A 2XM9A 5E1SA 3F7ZA 1Q61A 3IDCA 3QUDA 4IM3A 4XYFA 2VRXA 1V1KA 2Z7RA 2WTJA 3LCKA 4ID7A 2VWWA 3TDWA 3FSFA 3VS6A 5CEPA 3KXXA 3R7GA 4JDHA 4O7RA 2QKWB 4D4VA 5EQYA 3R8VA 1W83A 4L3JA 2Y8OA 1PMVA 2C6LA 2I0HA 2R3RA 3R2BA 1OIQA 3OCSA 2OXYA 2O64A 1XWSA 4N6ZA 5DE2A 3FLWA 3R7EA 4BGQA 3EHAA 4ZLZA 2R3QA 3UZRA 5DT4A 2OSCA 2HY81 2BMCA 3JY9A 3UIUA 1OVEA 1YOMA 2F2UA 4CT1A 1YOLA 5GINE 4G3FA 3RAHA 4BZNA 4Z9LA 4JDJA 4FV0A 2I7QA 3QRKA 4A9RA 1H26A 4UWBA 1OI9A 4AT4A 3D5VA 4XV9A 3FZRA 2R3OA 2IN6A 4FZ7A 4LV8A 4RQKA 1UWHA 4DG2E 4G16A 4GG5A 3PYYA 3F2RA 1XO2B 4FT5A 1L8TA 2JDVA 3SHEA 4EYMA 2ESMA 3LPBA 4E5BA 2PZ5A 1OIUA 2WHBA 4ENYA 5C4KA 2JDSA 3KVXA 5M09A 5KBQA 2IZSA 3V5LA 5HBEA 4U45A 4GFMA 3UQCA 3R1QA 4EOPA 5EKNA 1DM2A 1LEWA 3MFSA 1BI8A 4C38A 4GL9A 2WELA 2Y9QA 4HCUA 4RJ5A 5CSWA 3Q53A 5BVEA 2ZMCA 4R78A 3V6RA 2RGPA 4ZSEA 1CTPE 2C30A 2BFYA 2RG6A 3D94A 4XV3A 1A06A 5D10A 2VUWA 4O21A 3EN4A 5EDPA 5AR3A 3H4JA 4ZLOA 2OF2A 1ZY5A 3R63A 4GIHA 2ITWA 3EQHA 4GIIA 4E6QA 2P4IA 3OTVA 3BQCA 4HYIA 3VWAA 4ZXTA 4S2ZA 4DEAA 3LMIA 1BUHA 2C1AA 3LM5A 4NJDA 4BKYA 4YJPA 2Z7LA 3GOPA 4FE2A 2WMQA 3R83A 4DAWA 4PMPA 5HESA 3QRUA 2EWAA 2GPHA 4QD6A 4YSMA 5IG1A 4BWKA 5HX8A 5CI7A 3FI8A 1F5QA 4EHZA 3CPBA 5GHVA 2XIXA 4AFJA 5A4TA 4RWJA 5EM8A 5AR8A 1GIIA 2XIRA 4NKSA 5HIBA 5J79A 4BCNA 5LWNA 1VYWA 4FOCA 5FRIA 2YIWA 5LVPA 2C1BA 3IOPA 4FNZA 4IEBA 4KSPA 4EC8A 3I7BA 2WMWA 4QQ5A 4R7BA 2WQOA 3VUGA 3UE4A 4G6OA 4TZRA 2PVKA 4PQNA 4FKPA 3P0MA 4QYFA 1SNXA 3PA4A 3ZLWA 5CEMA 3NSZA 1ZYCA 2G15A 1OL6A 2JGZA 4GVAA 5FXQA 3HDMA 2GFSA 4R3RA 3GI3A 3QQLA 5JZNA 1GJOA 1YKRA 5IA0A 3IW5A 5C8NA 4IJ9A 4NSTA 3JUHA 4WRGA 3P23A 4FKQA 4H3PA 2XK8A 3I0OA 4RPVA 5TF9A 4CFFA 4E7WA 2F57A 3PP1A 4GV1A 4GKIA 3VQHA 2O0UA 3P7AA 5GZ9A 3C4FA 3DV3A 4WO5A 4O1PA 4IC8A 4QYHA 4TT7A 4QP6A 2GTMA 4FKWA 3F3ZA 1YXSA 2CGXA 4NM3A 3CR0A 1QPCA 3PUPA 4HVSA 5KKRB 1BL7A 4DFUA 3S3IA 3T3UA 5EHLA 4FTRA 4W9XA 3VJNA 2QKRA 3VS5A 3CGFA 1WZYA 1DI8A 4JVGA 3G51A 3DBFA 4KIQA 3E8CA 2HXLA 4W4VA 3TJCA 4II5A 3GENA 1VR2A 1GY3A 3LE6A 5D7AA 5I9ZA 4MQ2A 1OBDA 3C0HA 4XEYA 1L3RE 1YDSE 1JSVA 1Q5KA 3VUMA 4TKSA 3DAJA 2HENA 4NUSA 5J7BA 3CTHA 4LYNA 4NM5A 5EYCA 5A6NA 4YJSA 2W9ZB 5FUTA 3QZGA 4ALWA 1UU3A 5JQ5A 3F66A 2CDZA 1IA9A 5FBNC 2JIVA 2P2IA 4E6AA 2UW9A 4QO9A 1A48A 3OFMA 1R78A 5DEWA 3IKAA 4NK9A 1Q3DA 5L8KA 4FT7A 1W7HA 3TDVA 4FTIA 3C9WA 4B8MA 3MY1A 4FA2A 4WG5A 5EOBA 4WOVA 3P7BA 3GP0A 4EWQA 3FDNA 3Q60A 3ZFMA 4A9SA 4R3CA 3GC8A 4ASZA 3NUSA 3MJ2A 3W1FA 4BDEA 2HZNA 1PXOA 4G34A 4AACA 4DBNA 5BMSA 4USEA 4OAVB 5I3RA 4GS6A 4IVCA 2XVDA 4AT5A 5IQIA 3T9IA 4D5KA 3TZ7A 4RJ6A 5IQHA 3KN5A 3L8VA 1CKJA 2C0IA 2W4KA 4FMQA 3UG2A 2HW7A 3COMA 5EI6A 3UBDA 4FGBA 3THBA 4MXOA 5EYKA 4F64A 4OBQA 3O8TA 2R3JA 2JKKA 3IONA 4YZ9A 3SOCA 4Q5EA 4USFA 2QG5A 3P5KA 4R3PA 5IKWA 4HZSA 3ZUUA 3MJ1A 3OBGA 4D2WA 3UYTA 1BYGA 4O7SA 2R64A 3FLQA 3NYXA 5HTIA 1FOTA 3DBEA 3NIEA 4QP3A 3UOKA 2WNTA 4D2RA 3PDTA 3DAEA 4NTSA 5HVYA 1M2PA 2GNGA 4FV9A 2XEYA 2CKPA 2W7XA 4GJ2A 4M66A 4MWIA 4RMZA 4O1OA 4JG8A 5CF6A 3KK9A 4I21A 3BEGA 4IFCA 2PMNX 1B6CB 1Y8YA 4PV0A 1M2RA 3R9HA 4YPDA 4UXLA 2UZOA 4XHKB 1O9UA 1REJA 1P14A 3ZXZA 5A4CA 3C51A 3R1NA 3FXZA 3M2WA 5HU9A 2J0LA 2IVSA 4XG6A 3KRLA 3WE4A 2ITYA 4I24A 4DA5A 4U97A 4IQ6A 4AZFA 4JL9A 4D1ZA 1BI7A 4BCPA 3PPKA 4RC3A 5BQ0A 4A9TA 5FXRA 3A8XA 2F7EE 3QZIA 2QNJA 4QP7A 5J1WA 3QTIA 4O2ZA 5H9BA 2WQNA 5LMAA 2YFXA 1BL6A 3BPRA 4K9YA 4CMUA 5HKMA 4CLJA 5HG9A 2GQRA 1CM8A 1GZNA 4YNEA 4BDDA 2OIBA 4W8DA 4ZTRA 3R8PA 1JSUA 2YA9A 4H39A 2B52A 3QRJA 4EZ7A 2VO0A 4YC6A 3R22A 3W2PA 5HTBA 4AFEA 1J3HA 4F9AA 3HDNA 3RPYA 3FI4A 4JAIA 2X1NA 2VU3A 3K2LA 5EK7A 3RPSA 4DFBA 4MVFA 5DGZA 1H08A 4OUCA 4CZYB 4L46A 2BR1A 3FZPA 2OJIA 4KD1A 5HZNA 5IA4A 3EQRA 5G6VA 2ERKA 3VBTA 4DEEA 3RALA 4YHJA 3QALE 3Q52A 3A2CA 5LVNA 3ANQA 4WSYA 5BX0A 2WMUA 2J90A 3SW4A 4L7SA 2UZBA 3TEIA 1YHSA 3UIMA 4HVGA 5IZFA 4A4OA 3AD6A 3EZVA 4A4LA 2XKCA 5CX9A 2JIIA 4PTEA 4QRCA 4OTRA 5CTPA 4DTKA 5D9HA 4FT3A 3O23A 4ENXA 3BHUA 4EH4A 5L8LA 2GQSA 5F94A 4I20A 2GMXA 4FTTA 4AN3A 2OKRA 4QMTA 3TXOA 2YACA 2BROA 3MH2A 1PXJA 4TXCA 4ASDA 3LFAA 4HVIA 1YVJA 2QLUA 4HGSA 3C5IA 2QLQA 3VS1A 2CGWA 3P08A 2PVYA 4NFNA 2X0GA 3AC5A 4RLLA 5AUYA 2IZUA 3Q04A 4QMZA 5HEZA 3W32A 4MEDA 3H10A 4D0XA 3FMJA 3GQLA 3BWJA 1ZZ2A 3S1HA 3ZTXA 3Q4TA 4ONAA 3MFUA 5HO6A 5K3YA 4EK5A 3Q5ZA 3MTFA 2IWIA 5E1EA 2EUFB 2WIHA 2X2KA 5CQUA 4FL3A 4FTAA 2PU8A 3PWDA 5IA3A 5AUVA 2WTVA 3QZFA 2HCKA 3DDPA 4PMMA 4NT4A 2IJMA 4GT4A 4JR7A 4TWCA 4ZZMA 5FLFA 5KE0A 4AOIA 4E4MA 3S00A 4PNIA 3F3WA 3DK6A 3KRRA 4BN1A 2ZAZA 4EK8A 5IQFA 4EHGA 4RT7A 5M55A 4M12A 4WNMA 3FV8A 3SV0A 5L2WA 4G1WA 1XH8A 3TTJA 4HGLA 3UVRA 3RTPA 3FLNC 3KCKA 3S95A 4UYAA 5T3QA 2WIPA 3Q9XA 3BHVA 3PSDA 1ZYLA 2BHHA 4I1ZA 5AV3A 5LJJA 4FSZA 4DINA 2VWZA 2Y4IC 3LFFA 5ANIA 5LVOA 3SVVA 3CJFA 2JIUA 3ZYAA 3BGQA 4O2PA 3W10A 3DLZA 3ZOSA 3LQ8A 3OZ6A 2PVJA 3E64A 4LM5A 3ZSHA 3DBDA 4EOSA 1AQ1A 4FSRA 4RFYA 4C4EA 4P7EA 4DCAA 2GNHA 2X9FA 5JK3A 1W98A 2HAKA 3FPQA 2LGCA 5TKDA 3QGWA 4O7VA 3BRBA 3PIXA 1LEZA 4YBJA 5F95A 3VIDA 2OBJA 4MWHA 5HD4A 3JVSA 5BVKA 3DNDA 4EOKA 2YM3A 4RIWA 4BHNA 1RQQA 2HELA 3ID6C 2I0YA 2W05A 3QX2A 5F20A 5AAEA 3IW7A 3RINA 5DT0A 4YNOA 2QURA 4WRSA 5DRBA 1VJYA 2BTSA 3LIJA 5B2LA 4YSJA 4AT3A 2CN8A 2W17A 3R9NA 3DPKA 1QPDA 3KXNA 4OT6A 3LXPA 4BYJA 1KE7A 4LL0A 5M56A 3CS9A 4KBAA 2YAKA 3MH0A 4AA4A 2FYSA 3HMPA 2C6DA 3NGAA 2WTDA 5I9UA 3SLSA 4NYEA 5CQWA 1V0OA 4IX3A 4O96A 2J51A 4M13A 2BCJA 2GNLA 4BBMA 4K2RA 4W4YA 5M4FA 1H07A 5JRSA 5AADA 4AXAA 3BU3A 3LXNA 5IQAA 4IXPA 4L00A 5BVWA 5JEBA 4O7ZA 5ACKA 2X39A 2VTAA 5JRQA 5CEIA 4R7IA 2C6MA 3ZUTA 4U81A 2EU9A 2YZAA 4KNBA 5CWZA 1XBAA 4MD8E 4XG2A 5LARA 3V8WA 4RIXA 3NUUA 2QONA 4O7NA 3FUPA 2QOIA 4I93A 1PXNA 3I6WA 3UOHA 5AP5A 2RL5A 3OD6X 5AP3A 3L1SA 2IW8A 2QODA 1PKGA 4O86A 3DLSA 3R00A 4CCUA 4M14A 5C1QB 3ET7A 4NCTC 4TN6A 3MWUA 5EW3A 3LCTA 1YXTA 2F7XE 2RG5A 4GFGA 4IM2A 5HG7A 2CGUA 5EM7A 3NPCA 1DAYA 3SAYA 1QPEA 4G5PA 4AZSA 5FEDA 1RW8A 2XK6A 4UMQA 3DS6A 5ANOA 3AGMA 3GQIA 2GHLA 3PY3A 4LV5A 5HD7A 4DC2A 4F09A 4CMOA 1PXKA 2X4FA 3F7WA 4OTFA 5FP5A 4AW1A 2IPXA 3ITZA 2PHKA 3PIZA 2P3GX 4K77A 2VTLA 4FKJA 4MXCA 3Q2MA 4PDOA 4H3BA 5EM5A 4HYHA 4ZS4A 2HY0A 1H28A 3NRMA 3TTIA 4RGJA 4JJRA 4TY1A 4B6LA 1XBBA 1IRKA 2CNVA 5AX9A 1T46A 3C0GA 3D4QA 4FTOA 4PDSA 5CAQA 3NYNA 5DPVA 4IAKA 3ZXTA 5M06A 2CMWA 5CLPA 4RC2A 5B0XA 1J7IA 2WQEA 2JD5A 3ZRMA 3FC2A 4GCJA 4I0SA 4AN2A 4GT5A 4A9YA 4ZY4A 5C8KA 1U5QA 2UZTA 3EYHA 4RQVA 5HBHA 3PVUA 3OXZA 3ATSA 3ORNA 3KY2A 5IDPA 4D5HA 2JKQA 3F3TA 4QMYA 1PYEA 3AMAA 5FP6A 2CCHA 4IX5A 2EXEA 2WMVA 4RX5A 3GGFA 4HCTA 4C58A 3GOKA 5EW8A 3P7CA 4GEOA 3MPTA 4R1VA 1KSWA 1PMNA 4K33A 4OTIA 4QPAA 4ZTQA 1ZMVA 3CBLA 2Q0BA 3PP0A 4I0RA 3R73A 4MXZA 3OCGA 2XA4A 3R8ZA 2QHMA 4BDAA 5D41A 4WUAA 5AM7A 2NRUA 4CFVA 2WFYA 4TW9A 5M4IA 3WF9A 5JKGA 3P86A 4FSNA 1RDQE 1XBCA 2W1IA 2I0VA 3C5UA 2BAQA 4IW0A 3ZM4A 4DH3A 5M4UA 4FSQA 1OL1A 3R9RA 3ACJA 4S33A 2VTRA 2G2IA 4XV2A 4HJOA 3IG7A 3CTJA 4QTBA 1ZAOA 2CGVA 4OTPA 1STCE 4CSVA 3QCXA 4FV4A 3V01A 2E9PA 4DE4A 3UC3A 5J95A 4NM0A 4FL2A 4XRLA 2OF4A 5DT3A 3FHIA 4YGAA 4WNPA 3Q2JA 5AAFA 3A8WA 1E1XA 4MYGA 4MAOA 4LUDA 4D55A 2JC6A 4IM0A 4YZMA 5HORA 4I3ZA 2B9HA 2ZJWA 2XS0A 4IZ7A 4I6HA 4G6LA 2X7FA 3QXPA 2YDJA 1YI4A 2FVDA 4HPUE 5FTGA 5CU4A 5HICA 3V5JA 3WF6A 3ZRLA 1Z5MA 2QU5A 4AZEA 5CSPA 3DJ7A 3C4XA 4CKIA 4BWXA 1F3MC 3SDJA 2X81A 4IB5A 2BRBA 3ZC5A 3R7OA 4CT2A 4XCUA 4ZSAA 3TV6A 3MH3A 3VS4A 2HWPA 3TUDA 3RZBA 3G15A 5H2UA 2WXVA 3AT3A 5DIAA 2JBOA 2F2CB 3C7QA 3E88A 3GFWA 4PWNA 4IB0A 3RGFA 4C4GA 2R7IA 5CEKA 4Z7GA 3BBWA 1ZRZA 4LOOA 3BGPA 5M07A 3U54A 4MNEB 3AC8A 4UV0A 4EJ7A 3RBWA 2YCFA 4FOBA 4O6EA 4QMOA 1IAHA 4WD5A 1UU7A 1YWVA 3PFQA 4GVJA 1ZY4A 4ACGA 4EOJA 4PMSA 1FGKA 3AC1A 4BRXA 2AUHA 3A60A 3E7VA 3ZH8A 3EFKA 4IWDA 4FZDB 3QXOA 4TPTA 5JGDA 4XS2A 4DFLA 3CE3A 5JH6A 4O0SA 4BTFA 2Y4PA 2XB7A 4O6LA 4PY1A 3TACA 3Q9WA 3P1AA 3OCTA 3COIA 4BZDA 4CCBA 3OUNB 2W5HA 3MPMA 1URCA 3E92A 3I79A 3ZM9A 4PPBA 1WBVA 4BGHA 3DY7A 2O63A 3VUDA 4X6QC 3C0IA 1ZMWA 2Y4IB 4FTCA 4IWOA 2YDIA 4AGWA 4FKTA 4YPSA 3U9CA 2GNJA 4TWPA 3L8SA 4U40A 4C35A 2ONLC 4XP3A 3VS3A 2CKEA 2PY3A 4QMNA 1IA8A 4ZS0A 4A7CA 1P2AA 4O7WA 4L44A 3JVRA 4WA9A 1CMKE 4LRMA 4PTGA 2UZEA 2ITUA 3FJQE 4KAOA 4ZTMA 5A4QA 5L2SA 3GXLA 1O6KA 3ZONA 3FHRA 3UDBA 3HKOA 3O8PA 5GJGA 4UX9A 3LFDA 5HCYA 4O0TA 4F1MA 1OIYA 3LJ2A 3HV5A 4FSTA 3TNHA 1REKA 4S31A 1W84A 3QCYA 5FDXA 3KMWA 4I41A 4QMSA 4BCGA 3LMHA 2ZOQA 3COKA 4FI1A 4FV7A 3BYSA 3TIZA 4HCVA 4FYNA 4RA5A 4UB7A 5GNKA 5KMMA 3LCSA 3RAIA 3W2SA 5AFVA 1YHWA 2HZIA 3AT2A 1XHAA 3WILA 3HL7A 3LHJA 2FB8A 2UUEA 2IVTA 3CCNA 3F3VA 3I1AA 4FYOA 3RK5A 4BCQA 4CYJA 3NVMB 4F1OA 2E9VA 4IBMA 4CXAA 4E5AX 1OL7A 3NUNA 3MGYA 4G3EA 2BRHA 2ZYBA 4FIGA 4TTHB 1IASA 3RJCA 4BI2A 4QMXA 1U46A 5KNJA 5DEYA 3ULZA 3VULA 4PRJA 4RIWB 2CJMA 5BUEA 2VX3A 2A19B 3G2FA 5FTQA 2XKDA 4G3GA 3HV7A 3VW6A 2WU7A 4XJ0A 3HAMA 3WF5A 2UV2A 4OGRA 4AG8A 4C37A 3QQFA 2AC3A 3FKNA 4YBKA 3VBYA 2HZ0A 1UKIA 4NEUA 1RJBA 4YMJA 4EH3A 4H05A 1M14A 5M08A 4LFIA 4RZVA 4FZ6A 5ANDA 5LCKA 2VWVA 2CNQA 4YLLA 3RK7A 1OBGA 2F49A 4U7ZA 1Q62A 3E5AA 2ETKA 4YHTA 2XMYA 2ZM1A 4FSYA 3OY3A 3LJ0A 3R6XA 3DJ5A 2GFCA 3MBLA 4YJNA 4YZDA 4E26A 1Q8YA 4ZSJA 5FM2A 3B2WA 2WMXA 4EOIA 3ZLXA 5LCJA 3S0OA 4RIXB 4RVTA 2WO6A 2B54A 4D0WA 2V0DA 3FC1X 2LAVA 3FMLA 1OKYA 1YXVA 4WSQA 1OPJA 3VJOA 2PZIA 2QU6A 4CFNA 3U6IA 3OS3A 1YDTE 2QVSE 5GZAA 3G0EA 4EZ5A 5CY3A 4XG7A 3CIKA 4APCA 2WMRA 3KA0A 4FT9A 3BKBA 3UODA 2RFEA 1LR4A 5HLPA 5BVOA 4O0YA 5LVLA 4D4RA 5IISA 4F7JA 3IGOA 1U54B 4BCIA 2ZVAA 3U55A 1JLUE 1ZOEA 3G9LX 2YIYA 4BFMA 2R3MA 2J5EA 4KBCA 3QL8A 3R7YA 4GK2A 3Q5IA 5B2KA 3ODZX 4NIFB 3GC9A 4UALA 2VAGA 2W1HA 2W0JA 1FMOE 3DOGA 3C13A 4FL1A 4HW7A 4C3RA 3FMMA 5GIPE 4FGRA 5C9CA 3NCZA 4IVDA 5HQ0A 3Q4UA 1G8SA 3P78A 2F9GA 4EQUA 3BYOA 4CG8A 3KULB 2CCIA 5I5ZA 5ICPA 2I6LA 3ENMA 4I6BA 5IH5A 3GCQA 3M42A 4X2NA 3UO4A 3QRTA 3H9OA 1CKIA 3QLGA 3DB6A 3E3PA 2XNOA 3N9XA 4U0IA 4IZ5A 4JG6A 4N0SA 2BTRA 4UMPA 4M3QA 4XOZA 4NW6A 3UPZA 2C69A 4D9TA 2XH5A 2QC6A 2WB8A 2XYNA 2BAJA 3GFEA 3CGOA 4WBOA 3WE8A 2XK7A 3IECA 4G9RA 4MD7E 4ZEGA 2OIDA 2R3NA 5CANA 5HU3A 3NWWA 3SGCA 4X2GA 2UZLA 3VW8A 3BYMA 3IDPA 4ZSGA 3QFVA 3ZDUA 5E90A 4ITIA 3IOKA 4F0IA 1PXPA 3N51A 4ANQA 3CQUA 4F9BA 4A06A 5AR2A 2RF9A 4QMMA 4HGEA 5E91A 5HG5A 4O7TA 2VTTA 3R21A 4QNAA 5IQCA 3ZS5A 2GTNA 2DUVA 4FTLA 4F65A 4CVAA 4UXQA 3QD4A 3QLFA 4Y73A 4AA5A 4ZSLA 2W06A 5IEYA 3R7VA 2CLXA 2JAVA 4IFGA 4Z16A 2C6TA 2VN9A 2J5FA 3LVPA 3LZBA 4CNHA 4ZMFA 3CXWA 2QQ7A 2UW8A 4G3DA 2OG8A 5JSMA 5BVNA 3R1YA 5AV4A 4FVPA 2XBAA 5A4LA 4BY9E 1Q8WA 4DFXE 4B0GA 3O0GA 5HE1A 5LWMA 5AP7A 3QF9A 1WBWA 2YITA 2YCSA 3EIDA 4X0MA 2QD9A 1OKWA 5EH0A 3PVGA 4DH5A 3NZ0A 4C4FA 3FLSA 1J7LA 4IAIA 3FL4A 3OTUA 1VEBA 2OO8X 3P79A 5AV1A 3V6SA 3W2RA 4D4YA 4RFZA 2ETMA 3FKOA 3U6HA 4DF3A 4G31A 3TWJA 1Q99A 3A4OX 1KV2A 1XQZA 3Q9YA 4C2WA 1KOAA 3A7FA 3BQRA 4FG9A 3OEZA 4EOMA 3D2KA 3G33A 2BILB 3KL8A 4XG9A 5DLSA 3QZHA 4OBOA 4YC3A 3HA6A 3PZHA 5AMNA 2PE2A 5KZ0A 3OF0A 2QOQA 1YXUA 2WTKC 2UZUE 1AGWA 4CLIA 5F4NA 1OZ1A 3B8RA 4OLIA 1ERKA 4OT5A 2X9EA 3GBZA 1G3NA 2DQ7X 2P0CA 4XV1A 3EOCA 4AF3A 4DEGA 3RM6A 3CQWA 4Y83A 1NVSA 4LOPA 4MF0A 3ZLSA 4QMPA 4EWHA 4O81A 4Y95A 4WNKA 3LQ5A 3QTWA 1IG1A 3OWKA 1FVVA 3U6JA 5E8YA 4DLJA 3KC3A 4QMUA 3SXRA 2BRMA 1BX6A 4QYEA 3OWPA 5AIKA 2AYPA 4Y85A 2F4JA 4XLIA 3OVVA 1NXKA 2XBJA 3DB8A 4FV1A 5TT7A 2YDKA 2RFNA 3WF8A 5DR9A 3V3VA 4PX6A 2O8YA 3ZFXA 4PP7A 4ZIMA 2CNUA 1UU9A 3QKKA 3F9NA 5CT7A 4KS8A 4F08A 1T45A 1FPUA 3R2YA 3VBXA 2PZRA 4BHZA 4ZY5A 4GMYA 3QA0A 2WMBA 2QG7A 1LPUA 2BKZA 4OTWA 3AC4A 3PA3A 1B39A 3KXGA 3O2MA 3TL8A 4AAAA 4L9IA 2ZDUA 3SOAA 4GG7A 4JX3A 2WZJA 4JQ7A 4AW2A 1PMEA 4O0XA 3FMKA 4MQ1A 4KKEA 4ACMA 4CFUA 1ZOGA 4V0GB 3V8TA 4P2KA 3UNJA 1OITA 2YWPA 4L42A 2XIYA 2YAAA 5G1XA 3UMXA 4JOAA 4BTJA 3HAVA 1OKZA 4YO6A 4AWIA 5CALA 4IX4A 1RE8A 3GC7A 5AA9A 1H25A 1ZLTA 4BZOA 2PMLX 5M53A 3R8MA 1K2PA 1UNHA 1U59A 1ZYSA 3EQPA 5ETFA 2YIRA 3FYKX 5A4EA 4EH6A 4G9CA 1QPJA 2WMSA 3A99A 4EOLA 2GNFA 2Q0NA 2PPQA 4ORKA 2VTPA 5IH4A 3Q96A 2REIA 1Q97A 4KKHA 1H27A 4AOJA 3NNXA 4GK3A 1UKHA 4XBRA 4XP0A 1PMUA 1SVGA 4N70A 2Y0AA 4RRVA 3EFLA 3RNIA 1ZOHA 2UVZA 3NAXA 3G6GA 3QX4A 4XH6A 3OXTA 2NO3A 3QYWA 5HE3A 3ZCLA 3Q6WA 2RIOA 2B55A 4RX7A 3PA5A 3ZMMA 4NFMA 2OXXA 5GJFA 1H0VA 1JBPE 5HLWA 4P5ZA 2B4SB 3U87A 3KRJA 4BTMA 4O0UA 4BF2A 3E7OA 4QNYA 1G5SA 2C0OA 4FVQA 4DBXA 1UNGA 4TRLA 5KBRA 1WBSA 4RIOA 4ANLA 5LOHA 3LXLA 4QP8A 3NUYA 5EDRA 4ANSA 3DT1A 3ZEPA 3BLHA 4KA3A 4O7YA 4CKJA 4C8BA 4ALVA 4C61A 3QQGA 3P9JA 5CNOA 4F70A 5IA5A 5IDNA 4DEHA 2A27A 1JOWB 4K8AA 4G6NA 5IEVA 4AW0A 4V05A 3QKMA 4DGOA 4YTFA 3HECA 2J0KA 3LFQA 4O22A 2RFDA 3DKCA 3C4EA 4KS7A 3COHA 4B7TA 2WAJA 2YM6A 4F1TA 3LFSA 4RWLA 5C01A 4XG8A 3UMWA 1H0WA 2FUMA 4J53A 3OP5A 3CQEA 3UQGA 3ZO4A 4AUAA 1BKXA 1ZMUA 4BDBA 3AD4A 4XG4A 3D5XA 4RFMA 4U8ZA 5CXHA 4TYHA 2J50A 2R7BA 3I5ZA 2OLCA 4ITJA 3TT0A 1P5EA 2VTJA 5AM6A 5EHOA 4IHPA 2VTQA 4ZMEA 3ORTA 4O27B 2V7AA 4CQEA 5JGAA 4C33A 4F9YA 2HW6A 3RHKA 1H1QA 3I0QA 3ORZA 2PMOX 3TKIA 5KMKA 2R3IA 2FSMX 2XNGA 5CF8A 3NUPA 2ITVA 4FKSA 4PUZA 4ZP5A 1GAGA 4XMOA 3BIZA 3TI1A 3RK9A 4F9CA 3QD2B 5A9UA 5LXMA 3A4PA 4IVAA 4QYYA 3IO7A 4MNEA 4M0YA 2XK3A 2BIKB 3R30A 4JQEA 5C27A 1M2QA 4DYMA 2XNBA 5DOSA 1V0BA 3QYZA 2QI8A 4NJ3A 3NW6A 3ZFYA 3ZLYA 5KUPA 2R5TA 5I9VA 3D7TB 4BKJA 5IUGA 5FM3A 3ZZWA 2GHMA 4Z7HA 1Y6AA 3FMEA 3VF8A 5ETCA 2R3GA 2C47A 3KKVA 2JKOA 3POZA 4BL1A 4ZZNA 3A7HA 4R8QA 1Z9XA 4RJ7A 3FAAA 1UVRA 3P4KA 3FXXA 5D1JA 5DWRA 4ZAUA 4BBEA 4I5PA 4J98A 4EJNA 2VNWA 2ZMDA 3SG9A 3G90X 3B8QA 4PMTA 5IQDA 2ZV9A 2CLQA 3HP5A 4CKRA 4GH2A 1OMWA 3UC4A 3HMMA 1UV5A 4XRJA 4ACDA 3PJ2A 4FIHA 4ZTHA 2E9OA 4CYIA 5J9ZA 5L6OA 1GZOA 5CU2A 5AX3A 4X2KA 4KBKA 3ZSGA 5CS6A 3BYUA 3EN5A 3AD5A 4E93A 1PRYA 2P33A 4QMLA 2C5YA 3OHTA 4Q5HA 3ZRKA 5E8SA 5JT2A 3UO5A 2VX1A 1FINA 3AMYA 4RSSA 1Q4LA 3EFWA 3FWQA 4AP7A 4HGTA 3A62A 3RM7A 2HK5A 4QP9A 4RWIA 4GK4A 2JDRA 3DAKA 4FBXA 4YTHA 2C6EA 3DTCA 3W8LA 3MB7A 3UOLA 3VAPA 3KB7A 5CSXA 4FEWA 2UW0A 1BLXA 5CAPA 4QP2A 4I4FA 2IVUA 4M69A 1SNUA 4L3PA 1Y91A 3AMBA 4FIIA 5ANKA 2GS6A 5HOAA 3VRZA 4D1XA 2WTKB 3MESA 3NUAA 3NR9A 4FKVA 2XUUA 4XLVA 3HNGA 2Z60A 3U4UA 4JBVA 4PDPA 3MN3A 4L7FA 1PHKA 3E87A 3QKLA 3DQXA 4XOYA 1IEPA 3JXWA 3TG1A 3F2AA 4MTAA 1JSTA 2B1PA 3QTRA 3MI9A 2JKMA 4BI1A 2C68A 5D7VA 4WG3A 2C3KA 3I81A 4BDKA 4TNDA 2JAMA 4I5CA 4QTCA 2UW3A 5CASA 3VUKA 3NCGA 1AD5A 2UW5A 5KHWA 4MXAA 2IG7A 1H1SA 4ZLYA 3UG1A 1FMKA 1OM1A 3DFCB 4JRVA 4AGDA 3OOGA 4M7IA 2XK9A 4L67A 5CYIA 4EKLA 4NM7A 3NW5A 3EL7A 4NCTA 4JI9A 3LW0A 2I0EA 3OWLA 3QQHA 4OW8A 1UA2A 5ANJA 3NS9A 4OTGA 1SVHA 3BYVA 3DU8A 4RWKA 4ERWA 2Z02A 4IDTA 3OC1A 4L01A 4X7QA 1GZ8A 4E4LA 4D28A 2UZVA 4JRNA 1R1WA 1B38A 2VX0A 3KXZA 3R9OA 5J7HA 1PXIA 2NPQA 4C7TA 3QCQA 5AJQA 4JBOA 1Q3WA 2PE1A 1TVOA 2XIZA 3CTQA 1XKKA 3ALOA 2WQBA 2A4LA 4JQ8A 2WU6A 4BDIA 5KMJA 4A9UA 2B9FA 5DBXA 2JEDA 3PY0A 4PPAA 3HV3A 5J1VA 4BCOA 2BALA 3QCSA 2PL0A 2VWUA 2XNNA 3DK7A 2PVNA 4YJQA 4ZK5A 3TNWA 2OZAB 3UTOA 2QO2A 2HIWA 2R4BA 4G17A 3PVWA 5I3OA 3SQQA 3C1XA 3EKNA 4Q2AA 1VZOA 4FTJA 3VUTA 4FKGA 3OUKA 2WEVA 2ZV8A 4F6WA 1M52A 5H8GA 1DI9A 1U54A 4J7BA 4AS0A 2ETRA 3NAYA 4AW5A 2YEXA 2BZJA 4EOOA 1FBNA 1P4FA 4BWPA 5BYLA 4NIFA 3QU0A 3NUXA 5C26A 3PXKA 5AAGA 5L2IA 3QQJA 2YN8A 3H9FA 4ZTNA 4NH1A 3E8EA 4LRKA 5IEXA 2KULA 3ENHA 3KULA 2XKEA 4DEDA 3KEXA 5KMLA 1PY5A 4S34A 3LJ1A 4H3QA 1KE9A 1OPKA 4TYGA 5AIRA 5HHWA 5HLNA 2R0UA 2OGVA 4N6YA 4HYSA 1ZARA 3BU6A 2PVMA 4ZJIA 2G1TA 4MF1A 1M7NA 5K5XA 3PXZA 2VO6A 3QWJA 2C3JA 3F5XA 2J6MA 3PPZA 1Q8UA 3GB2A 3GCSA 3ZO1A 4IJPA 4S32A 3JS2A 3W2QA 3RMFA 2B0QA 3U8WA 3LKMA 3R7UA 3EH9A 4FIFA 2V5QA 3ZU7A 3HYHA 1WBTA 4ZJVA 3FZOA 3GEQA 1K9AA 4K1BA 2OK1A 4HZRA 4LQMA 1W8CA 4R1YA 2BZHB 4YURA 3N4VA 2ACXA 3BLQA 4WIHA 4K0YA 4BDGA 3MVLA 4IWPA 1OL5A 3II5A 3VQUA 4JLCA 5DMZA 3R1SA 3V04A 3VF9A 1QL6A 3KRXA 3O71A 3OBJA 4RIYA 4ZTSA 4DG0E 5JFSA 5EQEA 3HV6A 4EI4A 4E1ZA 4C4IA 4GKHA 3EB0A 4Y5HA 3DA6A 3PY1A 3IDBA 4RX8A 4D2TA 1TQIA 2BDJA 3K5UA 4PP9A 5IQBA 3NNVA 3R02A 4O0VA 3H3CA 4YHFA 2ITPA 5HG8A 4XBUA 4DT8A 5E4HA 4DTAA 4A4XA 4D9UA 1R39A 3W33A 1E1VA 4X2JA 4DH1A 4RVMA 4YU2A 4MD9E 3BU5A 2JITA 4DEIA 4E73A 5EI2A 3UP7A 1F0QA 3TZMA 1YXXA 4TYHB 4AZVA 1M7QA 3GVUA 4Y8DA 5M51A 3EQIA 4HNIA 1IR3A 3ALNA 2W5AA 2RFSA 5IUHA 2YIQA 5ANGA 5E8ZA 5A3XA 3V5QA 4RJ3A 4FKLA 1QMZA 3SD0A 2P2HA 2XCKA 3AG9A 2XM8A 4QPSA 4RC4A 5TOZA 3LLTA 1WBPA 5E92A 3VS2A 4U42A 1KWPA 3BZ3A 2UW7A 4EEVA 5AUTA 1OECA 1WBOA 1YWRA 2XKFA 2Z2WA 4HVHA 4IAFA 2FGIA 3OY1A 2ONLA 2W1DA 4JNWA 3BI6A 3ZUVA 4DLIA 4CGAA 4BICA 3FMDA 4YJRA 3R28A 4GW8A 5IMEA 3FQHA 3ANRA 2E9UA 3FY0A 3NVKI 3HRBA 3LCDA 1OKVA 2KTYA 3VN9A 2X8EA 5IMXA 3AXWA 5CZHA 3O17A 4EKKA 4YC8A 3KMUA 4PL5A 3BHHA 3RAKA 3ATTA 5K4JA 4LGHA 5BYYA 1A9UA 3ORIA 3GCPA 2VZ6A 5LMKC 3KMMA 3QTXA 1KE6A 4RLKA 2PZYA 3VVHA 5B2MA 3ACKA 5A6OA 2ITOA 4YO4A 1Q8TA 2W1CA 2YM7A 5FD2A 2B9JA 2C6IA 3O7LD 5C03A 4FKUA 4WUNA 4IZAA 2BDWA 2Z7SA 1E9HA 3E8NA 4DCEA 2VWXA 4QTEA 4LMNA 5T6KA 3EQCA 5F1ZA 5L6WL 2FSLX 3KU2A 4UYNA 2PZPA 3IPHA 3PLSA 2R3LA 2GU8A 3TUCA 5H8EA 3T9TA 2H6DA 4R5YA 3CD8A 3NEWA 3H0YA 4V0GA 5HI2A 5KKRC 5L2TA 2HZ4A 3FE3A 5FWKK 4B4LA 4LMUA 3DXNA 3SG8A 4W8EA 3GU7A 4M69B 4YJUA 3RVGA 4FEQA 3KXMA 4I6FA 4UEUA 2R3FA 3GNIB 1JKSA 1DS5A 4R77A 3OCBA 3QA8A 4FKRA 3AT4A 2DWBA 5ITAA 3UIBA 2XNPA 1SZMA 2V62A 4FSMA 3DCVA 4IWQA 4TYEA 5DVRA 3UVPA 3VC4A 5E9EA 4EK4A 3KF4A 3HZTA 3QTQA 3TV7A 4AZTA 4NTTA 4JS8A 3BE9A 2X6EA 1YHVA 4F7LA 4FNXA 5JFXA 2OH0E 4DT9A 2VO7A 3BHTA 2R3PA 4LGGA 2I40A 3CY2A 4RZWA 5JN2A 1PXMA 3RPRA 3F5GA 4IIRA 2C6KA 3LAUA 5CVGA 5EOLA 1OGUA 3U4WA 5CAVA 3FPMA 3FMNA 5K5NA 1WBNA 4BTKA 3BHYA 1W0XC 3R0TA 5T68A 3OWJA 4GYGA 2YCQA 4OBPA 2PUUA 3ORLA 4QYGA 3R01A 2WTIA 2YLFA 4EH9A 4F0GA 3UZPA 4M67A 3BGZA 5EI8A 4C3FA 4FTUA 4JBPA 4YLJA 5A46A 1PW2A 4MXXA 3QD3A 4ZZOA 3Q32A 4YLKA 4YUQA 2PULA 5D12A 4EONA 3DTWA 5HCZA 5EYDA 1JPAA 3DZOA 2X2MA 1J91A 4C4HA 3QTUA 3D0EA 5I9YA 4KRCA 2BZIB 3DK3A 1YW2A 4UBAA 3C4WA 5CSVA 4QMQA 4L43A 3SKCA 1UWJA 4F99A 4YTCA 4KUJA 3KN6A 4FK3A 3W55A 3PVBA 2O65A 3EFJA 4UWCA 4EH8A 4CEGA 4TNBA 5H3QA 3DZQA 4RBLA
chains in the Genus database with same CATH superfamily
1W2FA 3EN9A 2WTCA 2J0JA 2J7TA 2CKQA 1XH5A 3AGLA 2VTIA 3WF7A 3UDSA 5LMBA 2V7OA 3TUBA 4BCJA 3O50A 4EHVA 4EH5A 2CN5A 4QPMA 1I44A 3K3JA 4QP1A 3FXWA 5I9XA 2IZTA 3OROA 5HO7A 5LVMA 3EZRA 5K0KA 1JNKA 4RG0A 4H1JA 2ZV2A 4GJ3A 5DNRA 3ETAA 3H0ZA 4U6RA 3D2IA 4W9WA 3O7LB 5DR2A 4D2VA 3MB6A 4E5WA 3T3VA 3VUHA 2W4JA 3WIGA 4DHFA 4BJJA 4RX9A 4CG9A 3D7TA 2C6OA 4Y5QA 5GIOE 3IW6A 4XNEA 2PUPA 2CHLA 2B53A 3LLAA 3MA6A 3RCDA 4XX9A 2ZB1A 3QQKA 4KKGA 1WAKA 4ALUA 4BB4A 3EKKA 1UU8A 3UJGA 4R7HA 2YCRA 1ZZLA 2OXDA 5DH3A 2BUJA 3L8XA 4IB1A 3ZBFA 5B7VA 1H00A 2NYAA 3EQGA 1SMHA 3DKFA 2B7AA 3H30A 3OW4A 4FIEA 4OR5A 3FEGA 2R0IA 1JKTA 3W0PA 4RJ4A 5ANEA 5AR5A 2C5OA 4O4DA 3SA0A 1KE8A 4AGCA 3HV4A 1S9JA 4W4WA 3JR1A 2H9VA 5AUZA 1YI3A 3C50A 2OIQA 4JXFA 5DN3A 3UP2A 4ANNA 1H01A 4D4SA 1YWNA 4DGGA 5E8WA 4PL4A 4UN0C 5JFWA 5IQGA 3M1SA 3NNWA 1Q8ZA 5H8BA 3FBVA 3VS7A 4O0RA 3UO6A 4DTBA 2XF0A 2F7ZE 2XK4A 5EYMA 4BDFA 1NVQA 3ZO2A 5CF4A 5AP2A 1PXLA 4PPCA 3MFRA 4O38A 5BNJA 4AOTA 4WT6A 3V5WA 2J2IB 4RIYB 3K3IA 5IA1A 2PE0A 3QAME 4NZWB 4EBWA 4BCKA 5L8JA 4JDIA 5KMIA 1CDKA 3D83A 3PIYA 1WVWA 4DH8A 1S9IA 3F5PA 4YTIA 5TE0A 1YQJA 3MVHA 2H34A 4O82A 4IMYA 5E8UA 2R3HA 3F61A 2XEZA 2IZRA 4IAZA 2OW3A 3KQ7A 3G9NA 4ERKA 3VBVA 4QTAA 2QHNA 2VTNA 4IAYA 4M0ZA 4MCVA 3NDMA 4O0WA 1W82A 1WCCA 4QMVA 4QTDA 2Y6MA 4WBBB 4AA0A 4DFZE 4F6UA 3ZZEA 3F82A 3FZTA 1JKLA 4L68A 4BKZA 5E8XA 2R9SA 4LI5A 4U5JA 3RPVA 4I0TA 5L4QA 4U41A 5EDQA 2G9XA 4CV9A 3MFTA 1OIRA 2UW6A 4FKOA 4KIKB 4FV5A 3ZC6A 3NLBA 4E6CA 1WVXA 4CZUA 1FGIA 4O91A 1KOBA 4LGDA 1MRUA 4NWMA 3FQSA 5I4NA 4BDCA 3DDQA 5FTOA 2A0CX 2H8HA 2JBPA 1MUOA 3W18A 3HX4A 4FV3A 4MNFA 4KSQA 3FI3A 5FQDC 4GUEA 2FSOX 3PXQA 5HGIA 4DH7A 1Y8GA 2WKMA 4U80A 4CRLA 4NW5A 3GCUA 3GT8A 3LFCA 4KINA 4E8AA 4FKIA 3NFFB 4KB8A 4BCFA 5CU3A 4GUBA 3ZBXA 2O3PA 4FODA 3PRFA 3QC4A 3L9PA 3I4BA 4NU1A 4AX8A 4HNFA 2DYLA 3E62A 4AGUA 4C02A 3HLLA 5J9YA 4FV8A 2VGOA 1KV1A 2XAMA 3PXRA 2EB2A 1OUKA 2QOLA 4CFMA 5AP0A 3F88A 3FI2A 2OH4A 3AC3A 4JG7A 2YM5A 4C3PA 4FV2A 5A54A 4H36A 2OZAA 5CENA 1ND4A 4QEBA 4GT3A 4IVBA 3LMGA 1OL2A 5HNGA 1J1CA 4TYIA 2BAKA 3E8DA 3V5TA 3SRVB 3TZ8A 3F6XA 2UW4A 3OOMA 1XH9A 4MXYA 3HP2A 3QQUA 3HUBA 3FSKA 3UNZA 3WZEA 3GU6A 3LOKA 2OJ9A 4J97A 3JPVA 3WYYA 1PYXA 3TKHA 3RCJA 3SXFA 3W8QA 5CT0A 4BIBA 1FQ1B 3F2NA 5HE0A 3EQFA 3MW1A 4PNKA 4NL0A 4HOKA 3RNYA 4FRFA 1H4LA 2OI4X 2PUNA 1R0EA 5CVHA 2XCHA 4IZYA 2YJSA 1XH7A 1NW1A 3FLYA 3D5UA 5I0BA 3HMNA 3T8OA 4AQCA 4TYJA 4F7NA 3W2CA 2HYYA 3WARA 4MKCA 2GS2A 3WZUA 4F9WA 2VTOA 2IW9A 3EQDA 4K11A 5DYJA 4Y46A 4X3FA 1ZYDA 5K9IA 2HWOA 4KIPA 2E9NA 2BKKA 2CSNA 1KE5A 4P90A 3MDYA 4Q9SA 3ODYX 3LFBA 4C57A 2IW6A 2PVLA 2IEWA 5KHXA 1SYKA 3HUCA 5IUIA 3PWYA 4JX7A 1OPLA 4J99A 3UVQA 1FVRA 4FG7A 4I5MA 2YIXA 4IE9A 1O6YA 2FO0A 3PSCA 3W16A 1WMKA 2Y7JA 3GU5A 3KRWA 3OT8A 3BCEA 4MH7A 3OG7A 2GDOA 1BMKA 2VTHA 3R71A 5AP1A 4RVKA 3OXIA 4IAAA 2ITTA 4EH2A 1J1BA 5GJDA 3H9RA 3KXHA 3NYOA 4YP8A 4X3FC 5IA2A 4L8MA 2QOCA 4P5QA 4JT3A 2VWIA 2GQGA 5L3AA 3VBQA 4FUYA 4TL0A 2WGJA 4NKAA 1GOLA 2JDOA 5AP4A 3UOJA 3W2OA 3MH1A 3MY0A 4N4SA 2PUIA 3HA8A 3U9NA 4FEUA 3PTGA 5K4IA 3A61A 4AE6A 4DGLC 4IACA 5CVFA 4R6VA 4BR3A 1ATPE 2R3KA 4FR4A 2W96B 1NY3A 2Z7QA 3F3UA 2PVHA 1U5RA 4FTKA 5CU6A 5AUUA 2QO9A 3DXQA 3FZ1A 1GZKA 5ETAA 3NMUF 1ZYJA 2OFVA 1TKIA 4DGMA 2Y6OA 2QOOA 3CJGA 3TMOA 2A98A 4R5SA 3RHXA 3KFAA 4OAUC 5C4LA 1Y6BA 3BV2A 3TNPC 5EM6A 3AC2A 4L3LA 4J52A 3BL9A 2YISA 4IADA 5A14A 4FSUA 4HYUA 5D11A 5DG5A 3W0SA 2QOFA 2BHEA 1JKKA 4UMTA 4BYIA 2C4GA 5CNNA 4I5HA 2X6DA 3UPXA 4IC7A 5HVKA 5CSHA 3MIYA 3S2PA 1WFCA 3OEFX 5J87A 3U51A 3WIKA 5HX6A 4KIOA 3K54A 4EH7A 4QP4A 1XH6A 3EN7A 1MRYA 5AA8A 4UZHA 2VV9A 3LXKA 4GU9A 3A7GA 4IDVA 5AV0A 4CZTA 2WEIA 1XR1A 2WOTA 3F69A 5AR4A 4CRSA 2C5VA 4CQGA 3ROYA 4J71A 4LRJA 3M11A 5AR7A 3V5PA 4CMTA 5FBOA 1YRPA 4BGGA 2QOKA 4ACHA 4FZFB 4YR8A 4ZOGA 4K6ZA 4I23A 5HTCA 1NVRA 4J1RA 4FZAB 1PJKA 3RWPA 4EORA 2GNIA 4D1SA 4G2FA 3A7IA 3O8UA 3W0NA 1CSNA 1GIHA 1M17A 3DNEA 3D9VA 3ERKA 4QT1A 4UZDA 3VRYA 2YHVA 3JY0A 3WZDA 4C4JA 4DG3E 5KMOA 5JZJA 2YM4A 2C5XA 3VBWA 4QQCA 2X7OA 3QWKA 5HBJA 5AWMA 4BVUA 3PE1A 1LUFA 2OJGA 1Z57A 1XJDA 5ETIA 3LFNA 4PTCA 3DKOA 3LFEA 4F0FA 2XNMA 3V51A 4FF8A 2W1GA 5IQEA 4ASEA 3HMOA 1R0PA 1IAJA 4PDYA 4EQMA 1LP4A 1MP8A 4FX3A 2JLDA 1X8BA 2NRYA 2X2LA 4A07A 2VNYA 4C59A 1MQBA 5EQPA 2W4OA 2YERA 3K5VA 2C3IB 1YDRE 5HIDA 3ZDIA 2IO6A 3SC1A 3TM0A 4I4EA 3ORKA 2WD1A 4M84A 4YZBA 4LV7A 3MV5A 3NIZA 1Y57A 2OJFE 1HCLA 4YJVA 3EL8A 5EFQA 3UYSA 3PJ8A 4XP2A 2G2HA 4EK6A 3QRIA 4JMQA 4M97A 2IVVA 2ITXA 2ZM4A 3HEGA 4H1MA 4I22A 5CZIA 4P4CA 5E8VA 4ACCA 5KX8A 3HMIA 4QOXA 3MVMA 4HPTE 5EKOA 4J95A 2XRUA 4D58A 4WKQA 2J9MA 2O2UA 1G8AA 4J96A 3KCFA 4MBIA 3R9DA 5EHYA 3FLZA 3DBCA 1JAMA 4YJOA 2BPMA 4FICA 3BLRA 2X8IA 3FKLA 4MHAA 4QMWA 3I60A 4GRBA 3VS0A 4EZ3A 2JFMA 2ERZE 2GSFA 3CD3A 5BVFA 3R04A 5DA3A 4USDA 5KCVA 3G6HA 3WZJA 4H58A 1HOWA 4IANA 4DFNA 4E3CA 2BRGA 4B99A 3EJ1A 4CFWA 3QGYA 2FH9A 3TCPA 4FEXA 4Y72A 3D5WA 5DRDA 3RP9A 5L6PA 4B9DA 3TNQB 4RVLA 4AE9A 1U4DA 2E2BA 3ORPA 4DGNA 2OICA 1QCFA 5BUIA 1Q41A 5M57A 3CP9A 2G2FA 4UMUA 5CU0A 2FSTX 4E4XA 3HRCA 3BWFA 3SX9A 1TQPA 2PVFA 2QCSA 2VTSA 2GS7A 3QTSA 4U43A 4DEBA 1URWA 2WMAA 3O96A 4GU6A 3FZSA 3IGGA 3PJCA 2HOGA 3D14A 3PJ3A 3S4QA 4O7LA 1OB3A 1VYZA 1H8FA 3EQBA 3L9MA 4BI0A 5HNIX 4DHJA 3WYXA 4L45A 4XG3A 2XJ1A 3WI6A 4EOQA 3RKBA 4FT0A 2XAOA 3TV4A 3CPCA 4AN9A 4LUEA 4IH8A 4CD0A 3GU8A 1P4OA 2YM8A 3MIAA 4BC6A 4DHZA 3W0MA 3GC0A 4ANBA 4FEVA 3PG1A 5E8TA 1JWHA 3E3BX 3Q6UA 1ZWSA 2UZWE 4FNWA 4U3ZA 4K18A 3BX5A 4X21A 3WBLA 3D15A 3UZTA 4V04A 2JFLA 3NW7A 3R8UA 3UGCA 4BCMA 4KRDA 4CFXA 2ITNA 4MK0A 3N4TA 5FDPA 4EC9A 3C4CA 1YOJA 3REPA 2Q83A 1GIJA 4C0TA 3FY2A 2JDTA 2V22A 3L9NA 1H1WA 4IB3A 5BMMA 3RAWA 2QR7A 3ZSIA 2QOHA 1UNLA 4PF4A 4DN5A 4F4PA 3D7ZA 3UIXA 1Q24A 3ZHPC 3LCOA 3DFAA 4EL9A 2PVRA 3CLYA 3WOWA 4BIEA 4MBJA 4X3FB 4MBLA 2Z8CA 3VNTA 3CEKA 3CY3A 5CEOA 3DBQA 3RI1A 5CAUA 4DDGA 3EYGA 1GNGA 3ULIA 4ASXA 5CXZA 5HIEA 3NYVA 3HVCA 3I6UA 3OT3A 4WHZA 5DI1A 4CTBA 3CKXA 5IF1A 2QOBA 4YZNA 2W5BA 4FNYA 2ZDTA 4D2PA 1I09A 4MX9A 4OTQA 2OU7A 3MA3A 3HGKA 5KZIA 3PZEA 4AZWA 1NT2A 3E93A 4J8NA 4C34A 2YJRA 2XIKA 3N4UA 2NP8A 4U79A 2X8DA 4UY9A 1OUYA 5BYZA 1DAWA 4I94A 3ROCA 2RSVA 3PSBA 4FTMA 3BEAA 2GCDA 3PXYA 4BDJA 2WPAA 4F6SA 4GSBA 4O84A 4KWPA 3PE2A 2C5NA 3SXSA 1PKDA 3IK3A 5GZ8A 2DS1A 4X2FA 2OJJA 5CF5A 3OMVA 2UZDA 3NX8A 2ITZA 3V8SA 4E20A 4ITHA 3WZKA 4C62A 4I6QA 4I92A 4WNOA 5K0XA 3MPAA 5FEQA 3RZFA 3KF7A 3QD0A 4M68A 4YJTA 3GUBA 4YZCA 4APPA 2YWVA 4UWYA 4Q9ZA 2VGPA 3DXPA 2ZM3A 5CAOA 2YLEA 3AOXA 3MY5A 3MSSA 3PRIA 5DR6A 5ACBC 3VO3A 3I7CA 4CTCA 2CKOA 4HVDA 5HVJA 5IPJA 3A7JA 3DJ6A 3TJDA 4BIDA 5IH6A 4MUQA 3LM0A 4X6RA 3ZO3A 3KGAA 3POOA 4JAJA 4E6DA 3LQ3A 2QR8A 3GCVA 4JIKA 4CV8A 2XNEA 3IW4A 3Q4CA 2O5KA 3BV3A 2BZKB 2HXQA 2W99B 4ARKA 3KIOC 3MVJA 4KIKA 4OTHA 2C0TA 2W1ZA 3CC6A 4ZJJA 4FSWA 1WVYA 3AQVA 3C4ZA 5HCXA 2NNWB 3G0FA 4BDHA 5LMKA 5DFPA 1APME 1KUTA 1CKPA 2XRWA 4FK6A 3TN8A 2EB3A 3KREA 2WQMA 4WG4A 4ZTLA 4EYJA 4Z3VA 3PLAE 4V01A 4UMRA 4U44A 2SRCA 5HE2A 4EHEA 1EH4A 4L52A 5J9LA 1V0PA 2PTKA 2WMTA 3FL5A 3ORXA 3O51A 5TO8A 3EMGA 3QC9A 2VWYA 3B2TA 3PJ1A 1YI6A 3MTLA 1H1PA 2VD5A 2XYUA 3IS5A 4N57A 3DKGA 5I9WA 4O83A 4U3YA 4FUXA 2A1AB 4M15A 4C2VA 5JFVA 3FQEA 2UVXA 5CI6A 4JIAA 5AEPA 3QHRA 2G01A 2QO7A 2P55A 1W2DA 4IX6A 3P5JC 2BRNA 4LG4A 2GHGA 3HRFA 3MYGA 4FC0A 3KVWA 3TZ9A 3SRVA 3BE2A 4DFYA 2PYWA 3L9LA 3PFYA 5EG3A 1O6LA 3ELJA 2W9FB 4FG8A 4S30A 2RKUA 2ITQA 4KABA 2J0MB 2FA2A 5F9EA 4C36A 3EWHA 4AU8A 3E63A 4EUUA 3G5DA 1H24A 1JVPP 2J4ZA 5AV2A 2X7GA 5HO8A 4ANOA 5HNBA 2YZLA 3BBTB 2XJ2A 3ML1A 2PSQA 2A2AA 3PG3A 4XUFA 3DGKA 5J8IA 1J7UA 4B8LA 4G3CA 5IU2A 5KMNA 3SW7A 4QQJA 5CEQA 5FGKA 4QQTA 3Q3BA 3RPOA 4D2SA 3CKWA 2OZOA 1TQMA 2UVYA 3MS9A 3R8LA 3KK8A 3ORMA 3VHKA 4U9AA 5LQFA 1MRVA 4GYIA 4BCHA 1MQ4A 1R3CA 4PL3A 2BVAA 5L2QA 2PMIA 5FG8A 2WOUA 2OFUA 2EVAA 5BVDA 4EK3A 4ANMA 4M8TA 5AP6A 5FEEA 5EW9A 3PPJA 3QHWA 2EXMA 4FTNA 4FV6A 4J8MA 4JR3A 5BPYA 3PXFA 3QUEA 2J0IA 3F5UA 4EUTA 3UQFA 4FIJA 2BFXA 4JDKA 3GU4A 4LOQA 5AUXA 2UZNA 2I1MA 5M44A 1K3AA 1PF8A 2OWBA 3Q4ZA 4TWNA 2ZV7A 1FVTA 4Z55A 2XZSA 2WTWA 1JQHA 5JQ8A 1XH4A 4RA4A 3RWQA 3VUIA 1HCKA 3NNUA 2PK9A 3FYJX 5FXSA 2EXCX 2VTMA 4X3JA 3FMHA 3QUPA 5TR6A 4F63A 3CSVA 5BUJA 2C3LA 5JGBA 5C8MA 4LL5A 2H96A 2R2PA 2V55A 2BIYA 4E4NA 4EBVA 2XJ0A 4F7SA 3TNIA 4BBFA 1H1RA 5JMSA 4EQCA 2ZB0A 3DQWA 2VWBA 4JBQA 3I5NA 4L53A 4TWOA 2XALA 2PWLA 4FTQA 4RJ8A 5J5TA 2AC5A 5M4CA 3IQ7A 1SVEA 4G5JA 4ZY6A 3IW8A 2XP2A 1ZXEA 3EN6A 1NA7A 5E7RA 2W1EA 3TKUA 3UNKA 1SM2A 2B9IA 2BDFA 3QTZA 3Q9ZA 3ZEWA 3BELA 2VO3A 5AUWA 3VHEA 4FVRA 4L6QA 3JYAA 4DITA 2CPKE 5KO1A 4W4XA 5DHJA 3R7IA 2W1FA 3L8PA 3QBNA 2YABA 4GFOA 2X4ZA 3TIYA 4OTDA 5J5SA 3OW3A 2XM9A 5E1SA 3F7ZA 1Q61A 3IDCA 3QUDA 4IM3A 4XYFA 2VRXA 1V1KA 2Z7RA 2WTJA 3LCKA 4ID7A 2VWWA 3TDWA 3FSFA 3VS6A 5CEPA 3KXXA 3R7GA 4JDHA 4O7RA 2QKWB 4D4VA 5EQYA 3R8VA 1W83A 4L3JA 2Y8OA 1PMVA 2C6LA 2I0HA 2R3RA 3R2BA 1OIQA 3OCSA 2OXYA 2O64A 1XWSA 4N6ZA 5DE2A 3FLWA 3R7EA 4BGQA 3EHAA 4ZLZA 2R3QA 3UZRA 5DT4A 2OSCA 2HY81 2BMCA 3JY9A 3UIUA 1OVEA 1YOMA 2F2UA 4CT1A 1YOLA 5GINE 4G3FA 3RAHA 4BZNA 4Z9LA 4JDJA 4FV0A 2I7QA 3QRKA 4A9RA 1H26A 4UWBA 1OI9A 4AT4A 3D5VA 4XV9A 1ST4A 3FZRA 2R3OA 2IN6A 4FZ7A 4LV8A 4RQKA 1UWHA 4DG2E 4G16A 4GG5A 3PYYA 3F2RA 1XO2B 4FT5A 1L8TA 2JDVA 3SHEA 4EYMA 2ESMA 3LPBA 4E5BA 2PZ5A 1OIUA 2WHBA 4ENYA 5C4KA 2JDSA 3KVXA 5M09A 5KBQA 2IZSA 3V5LA 5HBEA 4U45A 4GFMA 3UQCA 3R1QA 4EOPA 5EKNA 1DM2A 1LEWA 3MFSA 1BI8A 4C38A 4GL9A 2WELA 2Y9QA 4HCUA 4RJ5A 5CSWA 3Q53A 5BVEA 2ZMCA 4R78A 3V6RA 2RGPA 4ZSEA 1CTPE 2C30A 2BFYA 2RG6A 3D94A 4XV3A 1A06A 5D10A 2VUWA 4O21A 3EN4A 5EDPA 5AR3A 3H4JA 4ZLOA 2OF2A 1ZY5A 3R63A 4GIHA 2ITWA 3EQHA 4GIIA 4E6QA 2P4IA 3OTVA 3BQCA 4HYIA 3VWAA 4ZXTA 4S2ZA 4DEAA 3LMIA 1BUHA 2C1AA 3LM5A 4NJDA 4BKYA 4YJPA 2Z7LA 3GOPA 4FE2A 2WMQA 3R83A 4DAWA 4PMPA 5HESA 3QRUA 2EWAA 2GPHA 4QD6A 4YSMA 5IG1A 4BWKA 5HX8A 5CI7A 3FI8A 1F5QA 4EHZA 3CPBA 5GHVA 2XIXA 4AFJA 5A4TA 4RWJA 5EM8A 5AR8A 1GIIA 2XIRA 4NKSA 5HIBA 5J79A 4BCNA 5LWNA 1VYWA 4FOCA 5FRIA 2YIWA 5LVPA 2C1BA 3IOPA 4FNZA 4IEBA 4KSPA 4EC8A 3I7BA 2WMWA 4QQ5A 4FJVA 4R7BA 2WQOA 3VUGA 3UE4A 4G6OA 4TZRA 2PVKA 4PQNA 4FKPA 3P0MA 4QYFA 1SNXA 3PA4A 3ZLWA 5CEMA 3NSZA 1ZYCA 2G15A 1OL6A 2JGZA 4GVAA 5FXQA 3HDMA 2GFSA 4R3RA 3GI3A 3QQLA 5JZNA 1GJOA 1YKRA 5IA0A 3IW5A 5C8NA 4IJ9A 4NSTA 3JUHA 4WRGA 3P23A 4FKQA 4H3PA 2XK8A 3I0OA 4RPVA 5TF9A 4CFFA 4E7WA 2F57A 3PP1A 4GV1A 4GKIA 3VQHA 2O0UA 3P7AA 5GZ9A 3C4FA 3DV3A 4WO5A 4O1PA 4IC8A 4QYHA 4TT7A 4QP6A 2GTMA 4FKWA 3F3ZA 1YXSA 2CGXA 4NM3A 3CR0A 1QPCA 3PUPA 4HVSA 5KKRB 1BL7A 4DFUA 3S3IA 3T3UA 5EHLA 4FTRA 4W9XA 3VJNA 2QKRA 3VS5A 3CGFA 1WZYA 1DI8A 4JVGA 3G51A 3DBFA 4KIQA 3E8CA 2HXLA 4W4VA 3TJCA 4II5A 3GENA 1VR2A 1GY3A 3LE6A 5D7AA 5I9ZA 4MQ2A 1OBDA 3C0HA 4XEYA 1L3RE 1YDSE 1JSVA 1Q5KA 3VUMA 4TKSA 3DAJA 2HENA 4NUSA 5J7BA 3CTHA 4LYNA 4NM5A 5EYCA 5A6NA 4YJSA 2W9ZB 5FUTA 3QZGA 4ALWA 1UU3A 5JQ5A 3F66A 2CDZA 1IA9A 5FBNC 2JIVA 2P2IA 4E6AA 2UW9A 4QO9A 1A48A 3OFMA 1R78A 5DEWA 3IKAA 4NK9A 1Q3DA 5L8KA 4FT7A 1W7HA 3TDVA 4FTIA 3C9WA 4B8MA 3MY1A 4FA2A 4WG5A 5EOBA 4WOVA 3P7BA 3GP0A 4EWQA 3FDNA 3Q60A 3ZFMA 4A9SA 4R3CA 3GC8A 4ASZA 3NUSA 3MJ2A 3W1FA 4BDEA 2HZNA 1PXOA 4G34A 4AACA 4DBNA 5BMSA 4USEA 4OAVB 5I3RA 4GS6A 4IVCA 2XVDA 4AT5A 3BLAA 3T9IA 4D5KA 5IQIA 3TZ7A 4RJ6A 5IQHA 3KN5A 3L8VA 1CKJA 2C0IA 2IF8A 2W4KA 4FMQA 3UG2A 2HW7A 3COMA 5EI6A 3UBDA 4FGBA 3THBA 4MXOA 5EYKA 4F64A 4OBQA 3O8TA 2R3JA 2JKKA 3IONA 4YZ9A 3SOCA 4Q5EA 4USFA 2QG5A 3P5KA 4R3PA 5IKWA 4HZSA 3ZUUA 3MJ1A 3OBGA 4D2WA 3UYTA 1BYGA 4O7SA 2R64A 3FLQA 3NYXA 5HTIA 1FOTA 3DBEA 3NIEA 4QP3A 3UOKA 2WNTA 4D2RA 3PDTA 3DAEA 4NTSA 5HVYA 1M2PA 2GNGA 4FV9A 2XEYA 2CKPA 2W7XA 4GJ2A 4M66A 4MWIA 4RMZA 4O1OA 1VLRA 4JG8A 5CF6A 3KK9A 4I21A 3BEGA 4IFCA 2PMNX 1B6CB 1Y8YA 4PV0A 1M2RA 3R9HA 4YPDA 4UXLA 2UZOA 4XHKB 1O9UA 1REJA 1P14A 3ZXZA 5A4CA 3C51A 3R1NA 3FXZA 3M2WA 5HU9A 2J0LA 2IVSA 4XG6A 3KRLA 3WE4A 2ITYA 4I24A 4DA5A 4U97A 4IQ6A 4AZFA 4JL9A 4D1ZA 1BI7A 4BCPA 3PPKA 4RC3A 5BQ0A 3AKLA 4A9TA 5FXRA 3A8XA 2F7EE 3QZIA 2QNJA 4QP7A 5J1WA 3QTIA 4O2ZA 5H9BA 2WQNA 5LMAA 2YFXA 1BL6A 3BPRA 4K9YA 4CMUA 5HKMA 4CLJA 5HG9A 2GQRA 1CM8A 1GZNA 4YNEA 4BDDA 2OIBA 4W8DA 4ZTRA 3R8PA 1JSUA 2YA9A 4H39A 2B52A 3QRJA 4EZ7A 2VO0A 4YC6A 3R22A 3W2PA 5HTBA 4AFEA 1J3HA 4F9AA 3HDNA 3RPYA 3W0RA 3FI4A 4JAIA 2X1NA 2VU3A 3K2LA 5EK7A 3RPSA 4DFBA 4MVFA 5DGZA 1H08A 4OUCA 4CZYB 4L46A 2BR1A 3FZPA 2OJIA 4KD1A 5HZNA 5IA4A 3EQRA 5G6VA 2ERKA 3VBTA 4DEEA 3RALA 4YHJA 3QALE 3Q52A 3A2CA 5LVNA 3ANQA 4WSYA 5BX0A 2WMUA 2J90A 3SW4A 4L7SA 2UZBA 3TEIA 1YHSA 3UIMA 4HVGA 5IZFA 4A4OA 3AD6A 3EZVA 4A4LA 2XKCA 5CX9A 2JIIA 4PTEA 4QRCA 4OTRA 5CTPA 4DTKA 5D9HA 4FT3A 3O23A 4ENXA 3BHUA 4EH4A 5L8LA 2GQSA 5F94A 4I20A 2GMXA 4FTTA 4AN3A 2OKRA 4QMTA 3TXOA 2YACA 2BROA 3MH2A 1PXJA 4TXCA 4ASDA 3LFAA 4HVIA 1YVJA 2QLUA 4HGSA 3C5IA 2QLQA 1TZDA 2CGWA 3P08A 3VS1A 2PVYA 4NFNA 2X0GA 3AC5A 4RLLA 5AUYA 2IZUA 3Q04A 4QMZA 5HEZA 3W32A 4MEDA 3H10A 4D0XA 3FMJA 3GQLA 3BWJA 1ZZ2A 3S1HA 3ZTXA 3Q4TA 4QDVA 4ONAA 3MFUA 5HO6A 5K3YA 4EK5A 3Q5ZA 3MTFA 2IWIA 5E1EA 2EUFB 2WIHA 2X2KA 5CQUA 4FL3A 4FTAA 2PU8A 3PWDA 5IA3A 5AUVA 2WTVA 3QZFA 2HCKA 3DDPA 4PMMA 4NT4A 2IJMA 4GT4A 4JR7A 4TWCA 4ZZMA 5FLFA 5KE0A 4AOIA 4E4MA 3S00A 4PNIA 3F3WA 3DK6A 3KRRA 4BN1A 2ZAZA 4EK8A 5IQFA 4EHGA 4RT7A 5M55A 4M12A 4WNMA 3FV8A 3SV0A 5L2WA 4G1WA 1XH8A 3TTJA 4HGLA 3UVRA 3RTPA 3FLNC 3KCKA 3S95A 4UYAA 4DHIB 5T3QA 2WIPA 3Q9XA 3BHVA 3PSDA 1ZYLA 2BHHA 4I1ZA 5AV3A 5LJJA 4FSZA 4DINA 2VWZA 2Y4IC 3LFFA 5ANIA 5LVOA 3SVVA 3CJFA 2JIUA 3ZYAA 3BGQA 4O2PA 3W10A 3DLZA 3ZOSA 3LQ8A 3OZ6A 2PVJA 3E64A 4LM5A 3ZSHA 3DBDA 4EOSA 1AQ1A 4FSRA 4RFYA 4C4EA 4P7EA 4DCAA 2GNHA 2X9FA 5JK3A 1W98A 2HAKA 3FPQA 2LGCA 5TKDA 3QGWA 4O7VA 3BRBA 3PIXA 1LEZA 4YBJA