4FV5A

Crystal structure of the erk2 complexed with ek9
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
349
structure length
330
Chain Sequence
AGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVAATRWYRAPEIMLNTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with EK9
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 330
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fv5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fv5A01
4OBQA 4UZDA 1PW2A 2G9XA 2VZ6A 4YJOA 3Q5IA 5F4NA 3PRFA 3ZLYA 5E8XA 4CT1A 1PXNA 5LMKA 5M09A 5KE0A 1IR3A 2UVZA 2PSQA 4QMVA 2X1NA 1XKKA 3BZ3A 3L9MA 4A4OA 5HLNA 2YIYA 3I1AA 4TKSA 2BDFA 4PDYA 4I5HA 3ALOA 4LM5A 4G31A 4JX3A 4O27B 5C27A 3BBTB 4EH9A 3FZOA 3H4JA 2WEIA 4D4RA 3GNIB 4R5SA 4HOKA 4DFYA 3N4TA 2FGIA 3MPMA 3FXWA 4FV5A 1CMKE 1YI3A 2JFMA 2PVYA 4GVAA 4QNYA 3WZUA 4AW1A 4QQ5A 3ZOSA 5B2MA 4H36A 3KRLA 4MF0A 2BTRA 2VWBA 1PXKA 3B8RA 4FZDB 4JBVA 1MRYA 4FUYA 4UALA 3VS4A 4YJUA 3GGFA 4NJDA 5CU4A 3FLSA 3FZTA 2C0TA 3FMMA 3LFNA 4M13A 5AM6A 1S9IA 1SNXA 2WQBA 3PIXA 4EZ3A 4GS6A 3NMUF 2Y9QA 4E6AA 2QC6A 5AEPA 3R00A 4RC4A 1BUHA 3VBVA 4GV1A 1UNHA 3UYSA 2DUVA 3ODYX 1WVYA 3H0ZA 3R73A 3VHKA 4DGLC 3FMNA 4MQ1A 2B9HA 4UB7A 3PJ2A 4PRJA 2FA2A 4M3QA 2WTKC 4UMUA 3BGPA 1I09A 2GSFA 5CYIA 5BVOA 4F9BA 4BCJA 4F1MA 3C13A 3FMJA 3P79A 1MQ4A 3O7LB 4FKLA 4ANLA 3OCGA 4H39A 2OFVA 3IDCA 5KUPA 3E63A 2BAKA 5ANGA 4FSTA 2I0EA 2CSNA 2VTPA 3EIDA 4K33A 4FKQA 4QPMA 4TNBA 4KBCA 4X7QA 4DGNA 4CFMA 5LWNA 1R0EA 3G0FA 4EZ7A 2Z60A 4BZOA 3W2RA 4FEQA 3IPHA 3C0HA 3ET7A 3WF9A 3GB2A 3TM0A 1Q99A 3F5XA 3IK3A 3JYAA 2R3PA 4IAKA 3RAWA 4CG8A 5DPVA 4KD1A 4AE9A 2HELA 2R3QA 4QTAA 3ZU7A 4BCPA 3LFDA 5DWRA 3VC4A 1RE8A 3F3UA 2OO8X 1Q8TA 4U3YA 4BCQA 2OXDA 4EBWA 4NYEA 4R1VA 1WBOA 4B0GA 4PF4A 1ATPE 5H2UA 4RG0A 4XLIA 5K3YA 3LFBA 4ACCA 4EH5A 2QOKA 3KC3A 4C8BA 5FEEA 3IGOA 3UIXA 2PUNA 1Q8ZA 4JJRA 2WEVA 3LVPA 4CQGA 3LJ0A 3BEAA 3OWLA 1REKA 5K4JA 2OBJA 2W1HA 5E8VA 3CQWA 2XJ2A 4BDDA 4KRCA 5HD4A 5HBHA 4OTWA 2EVAA 3CGOA 3IGGA 3K2LA 4FKIA 4E5BA 5LMAA 4LUDA 4F70A 3M42A 5AP0A 4BTKA 2J0KA 3PVWA 2ZM4A 3QWJA 5BVNA 1ZOGA 4RVLA 4FEXA 2J50A 2A2AA 3RPSA 4F6UA 3O51A 4O6EA 4RX8A 4K77A 3QYZA 1G5SA 3EN6A 4RWJA 1WVWA 4ANQA 4ACDA 1M7NA 4DYMA 4CFFA 3F82A 4CSVA 4O81A 1V0BA 3LMIA 4NM3A 3D0EA 5HX8A 2NO3A 4OTGA 3REPA 2C69A 3P7BA 5H8EA 5E8SA 4C34A 4RMZA 3MJ2A 4LRMA 4QP4A 4Y83A 5C01A 2O8YA 2WOUA 4AZVA 1FGKA 3V6SA 1OBDA 4MH7A 1JNKA 1O6KA 2F57A 4DEIA 1JWHA 4BR3A 4ENXA 3VUHA 2RF9A 3R1QA 3AGLA 4RJ5A 3RAKA 3LQ5A 3ZYAA 3R8ZA 4OTIA 3PY0A 2J4ZA 3TZ9A 4QMUA 5IDNA 5EG3A 4DEHA 3WF8A 2PZRA 4XUFA 3AC3A 4GCJA 1ZMVA 2YERA 1Y6AA 4IX5A 3KA0A 2JDSA 5LWMA 3DNDA 4UWBA 2PVJA 3VF9A 4D2PA 1Y8YA 3VNTA 3FKOA 4PWNA 2CLXA 2J5FA 3UJGA 4DCAA 1OECA 5EM6A 1FINA 4FGBA 3NYOA 2R3RA 3GBZA 3KREA 3RM7A 2GU8A 2PVMA 3TNQB 5JT2A 4QQCA 4DFNA 3FBVA 4CTCA 3PIZA 4UN0C 5DT4A 3OC1A 1UU8A 2F49A 3QD2B 3R7UA 3IKAA 3PRIA 4RC2A 4XBUA 4BTJA 4FR4A 2BMCA 1OGUA 3ODZX 2VGPA 5AFVA 4IBMA 4V04A 4EOOA 4WNMA 4ALUA 2ITOA 2PUPA 5JEBA 2WTWA 2YWPA 3H3CA 4BF2A 1UKIA 2WQOA 4MWHA 2OKRA 3R9OA 4E6QA 4X2JA 5L6PA 2XIKA 3RCJA 5GIOE 3FMDA 1ZYJA 3FMHA 5HE1A 5TKDA 2XIRA 3CKWA 2R9SA 3BLQA 4BGHA 3MY1A 1WBNA 2WO6A 3EQCA 1SZMA 4OUCA 4AOIA 4FL3A 3MTLA 2A1AB 3HLLA 4FSWA 4I6BA 1Q8UA 3BV2A 5TT7A 4QPSA 1DM2A 2QODA 2YITA 3PY1A 4FV1A 4FV2A 5HNBA 3W1FA 3NW5A 4U5JA 3U6IA 4QP1A 5CX9A 1Q97A 4K11A 1IRKA 4JG7A 1IAJA 4WSYA 3K54A 3NGAA 4KKGA 2YEXA 4QMNA 4DH8A 3TDWA 3ZBFA 4DFUA 5L2SA 2ZAZA 2YZAA 4ZLZA 3TL8A 4B9DA 3DFAA 3QZIA 1H26A 1NVQA 5HHWA 3R7YA 3HMPA 4MKCA 5EW8A 1U5RA 4DEAA 4O83A 2VO3A 5M44A 3R9DA 3IQ7A 4L7SA 4MQ2A 2H34A 2CLQA 3TKIA 2CKPA 2IVTA 4O0UA 2ZB1A 5J9YA 1BKXA 2PVHA 3G15A 1XH9A 4ANSA 5JN2A 4H58A 3DKGA 5L8JA 4BZDA 3I5NA 3BWJA 2R3IA 4IZYA 3BYVA 5A9UA 1M14A 4IIRA 1OIUA 4DAWA 2C3JA 5K0XA 5J9LA 4U40A 3AT2A 4ZTNA 5AAEA 2X6DA 3WYXA 4DH7A 5IZFA 2I7QA 4FL2A 3UVRA 3M2WA 4IC8A 4NH1A 2GS6A 5JZNA 4O0XA 5FM3A 5EQPA 5HO8A 5FDPA 5J5TA 1XH5A 2UVYA 4GK2A 2IZUA 2YM6A 3U4UA 2AC5A 3MDYA 3ZXTA 4LOPA 3DT1A 1KV1A 3W10A 3VW8A 3GU5A 2X4ZA 1NVRA 2J0MB 4X3FB 1A48A 2BKZA 3D5WA 5LXMA 2ZMCA 3TT0A 5JQ5A 3I7BA 3OW4A 3RCDA 3A7IA 2XKDA 3ZBXA 3ZFMA 4F6WA 3QYWA 2Z7SA 1JQHA 4CFUA 3QCXA 3MVLA 4A9UA 4DCEA 4WO5A 3LFEA 3UO6A 3UPZA 4E6DA 2BDWA 4LOOA 2FVDA 4C4GA 4S31A 3C0IA 5CSXA 3RPRA 2QU6A 4OTPA 1UV5A 2OIQA 4N6ZA 4RT7A 3DKFA 2YM8A 2J2IB 4BKYA 3W33A 4I1ZA 2WZJA 3CJGA 4U3ZA 5CENA 5EHLA 5AX3A 2V22A 5TOZA 4CV9A 4ZAUA 4NKSA 2VV9A 4LI5A 4E5AX 5A4EA 4OLIA 3G9NA 1OIRA 4QPAA 4XP0A 2I1MA 2PHKA 4NCTA 1CSNA 4AU8A 2CNUA 2C6LA 2PU8A 2GQSA 3R7VA 4ACMA 4QYFA 3HMMA 4CNHA 2XZSA 2ITZA 4NEUA 3EB0A 3TKHA 4LUEA 4ZY5A 5I9UA 5HTIA 4AGUA 4D2SA 4U80A 4N0SA 2B52A 3F5UA 4QP9A 3O8UA 5HEZA 4DGOA 4RQVA 4XH6A 3HECA 2Z2WA 3QTUA 3FXXA 3LIJA 3UNZA 3EQGA 2P33A 2DYLA 3D15A 4G3FA 4ANNA 3EZVA 3GT8A 5E8UA 2WU6A 1JKSA 2QO2A 3BBWA 4M0ZA 4EKLA 5DMZA 3U6HA 3N4UA 2JAVA 5H9BA 2CGWA 4K6ZA 4JR3A 1H24A 5J87A 3FXZA 5EM8A 3L1SA 3F88A 3R8LA 2C6MA 5KBQA 3TKUA 5AAGA 4XOZA 1OUKA 2Q0BA 4IB5A 2ZDUA 5HGIA 5CU6A 4RFYA 5JMSA 3O23A 3ZRMA 5A46A 3S95A 3ERKA 3FI4A 2WQEA 3B2WA 4GU9A 3V8WA 2LAVA 4BBFA 5CU0A 3P1AA 3LHJA 5AADA 2JIVA 4P7EA 5JKGA 2OU7A 4CV8A 2P0CA 5KO1A 5DE2A 2J90A 2VGOA 2C6IA 4C59A 3C0GA 4F6SA 4FZFB 1JAMA 2C0OA 2VTNA 4LV8A 1FBNA 3AT3A 2A0CX 4L3PA 3KK8A 1YHSA 5K9IA 4BDIA 2ITTA 2X2MA 4F7JA 5GZAA 5KCVA 3G2FA 1OITA 4YO4A 3R2BA 3FLNC 5CSVA 1T46A 3SXSA 1CM8A 4C33A 1LP4A 1SVEA 2J0JA 4J52A 2PMOX 5LARA 3PA5A 4BI2A 1K3AA 3UZPA 3LXNA 5AV0A 4DEGA 3PLAE 4FKPA 4PMMA 4GU6A 1ZY5A 2OG8A 4WIHA 4C3PA 4Y5HA 5A4QA 4GT3A 5EOLA 2ZM3A 4L6QA 1P14A 3H9FA 5IA1A 3D5VA 1LEZA 2F9GA 3VQUA 3DBDA 3O8TA 2WTIA 4L43A 3UOJA 4NK9A 3BHVA 2EB2A 5ANDA 4CMUA 3IW7A 2G15A 1U59A 5EKOA 4NTSA 1BL7A 2YM3A 4FC0A 1EH4A 2QOCA 4ANMA 4O1OA 4PDSA 3UZRA 3K3IA 2WTKB 4MNEB 3E64A 2IG7A 3VJNA 4RLLA 4AW5A 4F1TA 4E93A 5AV3A 3HGKA 3QCSA 4QMOA 4XNEA 2OLCA 3EQPA 4OAUC 4YJQA 4FGRA 1YHVA 2XYUA 1JVPP 3RKBA 1V1KA 4IZAA 4CKJA 5HIBA 3CPCA 5CANA 4F09A 4R6VA 5EFQA 1OL7A 2KTYA 3H9OA 4FT0A 3KGAA 4BIDA 4YJPA 2XNPA 3FI3A 3O0GA 5HG5A 4ZXTA 3ORMA 3TTJA 5IH5A 4I21A 5KZIA 4E8AA 4R7BA 4PTCA 4I5CA 3VO3A 1NXKA 2PE0A 3A61A 3F6XA 2XP2A 2OH0E 4Y8DA 3FQEA 5LMBA 3PA3A 4HJOA 4KNBA 4FF8A 3NW6A 2OWBA 5B0XA 3FZ1A 3RMFA 2VNYA 1KE8A 1XJDA 4X3FA 4LGGA 4TWNA 4YR8A 3AMYA 1L8TA 4Y72A 3PTGA 1BYGA 3BV3A 3F3ZA 3LFFA 3CTHA 1E1VA 3OWKA 3NYNA 4MVFA 3BI6A 2ZMDA 5A4CA 4XX9A 4IVBA 4LMNA 5CT7A 4FSYA 4FKRA 4DE4A 3EQFA 4AN3A 4ASXA 2WHBA 3ZCLA 2PMIA 3B8QA 1PXPA 3H9RA 5FGKA 5KMJA 4ZTLA 2R0UA 4YJVA 5DG5A 3ELJA 2CGXA 3R8MA 3FC1X 4KIKA 4Q9SA 1PMUA 3R8PA 3BX5A 3MA3A 4KIOA 3P78A 5JQ8A 4HVGA 3WYYA 3DFCB 3Q04A 2C6TA 4UWYA 1RQQA 3G33A 5C1QB 1A06A 3DLSA 3DLZA 5D10A 5E4HA 1O9UA 3QXPA 4C3RA 1Q24A 2Z7RA 3GU8A 4UBAA 3R0TA 5DR2A 4BDEA 4FTCA 4X3JA 1YWRA 3ORPA 1URCA 2UW8A 4JI9A 3Q6UA 4RIOA 5DRDA 3T3VA 5CEPA 2XCKA 2P3GX 4QMPA 4F4PA 3BGQA 5BVEA 1OL2A 4HVSA 2YCRA 2A27A 2W9FB 3QHWA 1E9HA 1H1SA 3GQIA 2B54A 5F94A 4ERKA 1Q4LA 3RK5A 3A62A 5DT3A 4FG7A 3EFJA 2PZYA 2VWUA 3PFQA 4FSNA 4BGGA 3G0EA 4G34A 2YAKA 5I0BA 4YHJA 2ZV8A 4IACA 4BCMA 5BMSA 4M97A 4GH2A 2W99B 3AD6A 4KKEA 2EB3A 1PMEA 3PZEA 5E8WA 3ZS5A 4BBMA 1NVSA 4YMJA 3R9HA 3GU7A 3ZM9A 3FY0A 2UZTA 2XKEA 4HYIA 4ZZMA 3W32A 2YDKA 4IM3A 3FI2A 4GVJA 3P5KA 3CS9A 4FSMA 1OPJA 2HAKA 5AUYA 5CF8A 2XMYA 2HZ0A 3QQFA 5AP2A 3FPQA 5KMNA 5KMIA 2UW6A 4IXPA 5FM2A 5BX0A 4PL5A 5DRBA 5JGDA 4EC8A 2ZV9A 2W05A 4FIFA 2B9IA 1JSUA 4G3EA 4IZ5A 2BKKA 3I6UA 2WTDA 1ZAOA 3KXNA 3NYVA 4FT7A 5TE0A 4YZBA 3NUPA 4OTDA 4W4YA 1H4LA 4NM7A 5HNIX 4AZSA 5IA4A 4GYIA 3IDBA 5AP6A 3ULIA 2FUMA 3QTSA 4L53A 1K2PA 4B6LA 3P7CA 1PXOA 5A14A 5EQEA 4WG5A 4XV2A 4EC9A 4CGAA 2QOIA 2XNNA 3AMBA 3VBYA 4E7WA 5I9VA 4EOLA 2PK9A 2GFCA 2QOQA 3F2AA 4AOJA 3UP7A 3UVPA 4UYNA 3BU6A 3E8EA 2XIXA 4QYGA 4XG8A 4CG9A 2W5HA 3VUGA 5M55A 2QHNA 2B7AA 2WFYA 4O0VA 5ETIA 4BTMA 4HCVA 4RX7A 4E6CA 2R0IA 3ENHA 4QRCA 3U87A 3OBJA 1XO2B 4F0FA 1WBVA 2CKQA 4EEVA 5IUHA 3BQCA 2XM9A 2IZSA 5L6OA 1LEWA 1Q8WA 5BUJA 5IA0A 2WXVA 2G01A 2VTMA 2W17A 3FMKA 5GZ9A 3ZUVA 1GAGA 3PJ1A 4EH3A 1VYWA 2WIPA 4TT7A 4TWOA 3QTWA 4X2KA 5C03A 3DXQA 3CKXA 1Q41A 2CNQA 2VN9A 3SAYA 2CGUA 5DR9A 3RJCA 2VWZA 3U9CA 5CSPA 2QG7A 2IJMA 4D28A 3TV4A 5BPYA 3HYHA 4MNEA 3DB6A 3ORNA 4JDIA 4UXQA 4DN5A 3ORXA 3HP5A 4G6NA 4LGHA 3ZO3A 1H1WA 3FWQA 4HGSA 1P2AA 4BHZA 5EQYA 3VWAA 2WMWA 3U8WA 2ITYA 2H6DA 4PPAA 4QP3A 5HICA 3F2RA 5CU3A 4WNPA 5AAFA 2XK7A 3KCKA 5L8LA 1VR2A 5AIKA 3BHYA 3UG1A 4GUEA 4L45A 2YDJA 3QRUA 4IQ6A 3UNKA 3UTOA 3C50A 4EONA 2O63A 2X2KA 2QG5A 3MY5A 2B1PA 4CT2A 2FH9A 4BCFA 4ARKA 3ALNA 4YSJA 1Q61A 5CXHA 4FZ7A 4XG3A 1XH8A 2QLQA 4XEYA 2REIA 4WRSA 3LFCA 4CLIA 3MH1A 3T9TA 4O86A 4IE9A 2OXXA 2X39A 3UC4A 3SG8A 2PULA 4CD0A 3FQHA 4WRGA 3RVGA 5J1WA 4USEA 2G2FA 2Q0NA 3Q2JA 3BELA 3MV5A 1XBCA 4CLJA 3A99A 2HOGA 5CU2A 3TNWA 3NUNA 4AA0A 1B39A 4L7FA 5F9EA 4O96A 5C4KA 3FY2A 1GIJA 2QOHA 4FYOA 4FIEA 4O91A 5DN3A 3R21A 3ORIA 2UZVA 2OIBA 5JSMA 4OR5A 2Y4PA 3QUDA 4I4EA 5CEIA 3VN9A 4EOSA 4C36A 4F63A 5IEVA 5IQAA 5IQCA 5HO7A 5CSHA 3LXLA 3F69A 2JGZA 5ETAA 3OT3A 4I5MA 4XV9A 2BALA 5DOSA 5D7AA 4IWPA 1IA8A 3GOKA 3C4XA 4AW0A 1ZARA 2GHGA 1O6YA 2Z7LA 3I0OA 3POOA 4FVPA 4KIPA 4C58A 3LFAA 2B9JA 4EQCA 4GG5A 4FOCA 4G9RA 2FSLX 4MYGA 3ZTXA 4AXAA 4CCBA 5KNJA 1ND4A 4FKUA 3ZFYA 2BIKB 3E8NA 5LVLA 2W1IA 1FVVA 1Q8YA 3MIYA 3P7AA 4FNZA 4M0YA 4TY1A 4YGAA 4O7VA 5GJFA 4ZJVA 1UWHA 3DTCA 4JIAA 1OKVA 4IAYA 3LCTA 5L2TA 1APME 5DNRA 3RHXA 2VWYA 5AA8A 3IOKA 3AC1A 3CLYA 1ZZ2A 2QOLA 3MPTA 3KN5A 5FP6A 4IWQA 4IAZA 1KUTA 4CVAA 1YWNA 3F2NA 2BZKB 3Q96A 4YSMA 3SA0A 1KE6A 3VVHA 5KKRC 1M7QA 3OCBA 1IAHA 4LRJA 1MQBA 4V05A 2BR1A 2CCIA 2YIWA 3R8VA 4E4MA 4ZZNA 4KSPA 2GCDA 3SXRA 4M67A 5DH3A 4YUQA 1J1BA 4GEOA 3RK9A 2YAAA 4QT1A 3QD3A 4G3GA 5J7HA 2ZV2A 2ITUA 3EQBA 2P2IA 4YC6A 4APPA 2WQNA 5EI8A 4GK3A 4HZRA 3MVMA 4PMPA 4I0RA 2YM4A 1LPUA 4FTRA 4MEDA 3KB7A 3QX2A 3O8PA 3QAME 5HTCA 4QYYA 4QP8A 4TYJA 4GFMA 3NCZA 4IWDA 3UDBA 4IH8A 3ZUUA 3DK7A 1OL5A 4PP7A 2X9EA 5FBNC 2X4FA 2YM5A 5ACBC 3DJ5A 5I4NA 3EQRA 5D12A 1XQZA 1UU3A 3QTRA 4XRLA 5AUZA 3I7CA 4ZJIA 3VIDA 3LMHA 3KRXA 3NNVA 3KVWA 4LMUA 4RJ8A 5AX9A 3E92A 4E3CA 5DIAA 3LXPA 3TI1A 3OY1A 3UODA 5E8ZA 2ESMA 4C38A 4I0TA 1KWPA 5CI7A 3K3JA 1QPCA 1YRPA 2RKUA 4RIYB 2EU9A 5CEKA 3QGYA 3K5VA 3NRMA 5HESA 2RFSA 4WHZA 4QTEA 5KHXA 4XP3A 1LR4A 4M12A 4FTIA 5JGAA 2UW4A 1U4DA 3DDPA 1GZ8A 3Q4TA 2BRNA 3QKKA 4HYSA 4QMSA 3UMWA 3OTUA 2CMWA 2ETRA 3F61A 5IQGA 4LOQA 1G3NA 3V5JA 3WZKA 3D2IA 4NWMA 5H8BA 3ZUTA 3VS1A 2BRHA 4DBNA 5AUTA 2BHEA 3SX9A 2O2UA 2FSMX 4I41A 2HW7A 5BNJA 2E9PA 3NNXA 4PV0A 3AT4A 3AC2A 2W4OA 3NW7A 3S4QA 2E2BA 3C5UA 1YQJA 3KRWA 4IVDA 3OHTA 2GDOA 4B99A 4DEBA 2Z8CA 4M7IA 4FTKA 4MNFA 5J8IA 3R7EA 2XH5A 3WBLA 2C47A 3UMXA 5JFXA 2ETMA 2XA4A 3DS6A 3LM5A 1YXSA 2GMXA 2IPXA 1FVTA 2BPMA 4OTRA 1SMHA 1AGWA 4GMYA 3UPXA 3GOPA 4BWPA 3POZA 5FUTA 4U81A 4DG2E 3F7ZA 4YU2A 1OI9A 3FE3A 4E1ZA 2C5XA 2EUFB 3GCQA 4A7CA 2VTTA 2WELA 3Q4UA 4BGQA 1OL6A 3MFSA 4EQMA 4BY9E 2UZDA 4IVAA 4WG3A 3G6HA 3HMIA 4NKAA 3WZDA 5HVKA 2GNLA 3SD0A 4MF1A 3ATTA 2CPKE 5I9ZA 3N9XA 2KULA 2E9NA 4E26A 2XYNA 4GSBA 5L4QA 1H8FA 1W7HA 1J7UA 2C6KA 4PDOA 2QD9A 5CAQA 1TVOA 4RWLA 4U42A 2Q83A 1TQPA 2I0YA 5EYCA 2PVKA 4ONAA 4QD6A 3RM6A 3W2PA 2VO7A 5IEXA 3BU5A 3O17A 1OMWA 1PMNA 3EL8A 3NDMA 1JPAA 4O0SA 3ROCA 5ANKA 2UW5A 4JRNA 5KX8A 5AR2A 4KBKA 2BRGA 3HVCA 3H30A 4FTLA 5JGBA 1OKYA 4F99A 4NL0A 4FKGA 4B8MA 1B6CB 2V7AA 4C7TA 1Z57A 4APCA 3TNHA 3COIA 3EFLA 3L9LA 2VTIA 4R7IA 5CS6A 5HIEA 4BDAA 3ATSA 5DHJA 4FTMA 2JDVA 2R3FA 4EH8A 3JS2A 5L2IA 5JH6A 3E7VA 4DTBA 3UP2A 1MP8A 3VUDA 2C5NA 4YPSA 4YNEA 3BE9A 4JDHA 4DFLA 4QMTA 4QOXA 3ZEPA 1YI4A 3VS5A 2CN5A 3ZO1A 2R7BA 3KFAA 1UNGA 5EOBA 3SDJA 2J0IA 3FJQE 4JS8A 1PXIA 4Q5EA 3R30A 3VBWA 1CTPE 5EDPA 2C6DA 3ETAA 3MY0A 3SHEA 5IQIA 1PXMA 2NRYA 4N57A 2XB7A 4Q5HA 3PXYA 3V8SA 2WGJA 1KE9A 2VTJA 4ZSJA 5IKWA 1J1CA 5C26A 3F5PA 3QQUA 2E9VA 1NY3A 2OZAB 3QQKA 5HU3A 4EWQA 3GC9A 4FV8A 5JZJA 2QR7A 2W96B 3C4ZA 4Y95A 3TACA 4MXCA 2ITVA 3HAVA 3CEKA 4O7YA 2BAQA 3UIBA 3C4EA 3KXZA 3TJDA 3QD0A 4WBOA 3PUPA 1OBGA 2YIQA 4RIXB 4U8ZA 4D0XA 3ULZA 4NTTA 3FLQA 3AD4A 3D4QA 4YO6A 1GZKA 2XCHA 3EFWA 5DLSA 4BDKA 3QD4A 3HAMA 3DKCA 3NWWA 3N51A 2XK6A 4D9TA 4I0SA 4EHZA 5LCJA 4I22A 2AYPA 2W4JA 4WD5A 5J79A 4WNKA 2QU5A 5CZHA 4AG8A 2QHMA 1Y8GA 2DS1A 3FKNA 3OUNB 4DTKA 4FTQA 3W16A 3FI8A 2HWPA 4ZTMA 3PPJA 3EKKA 4G5PA 3IDPA 4R7HA 3AQVA 2J51A 2YDIA 2FB8A 2B9FA 2O0UA 1SVHA 5LVMA 3QALE 4ANBA 2JBOA 4FYNA 3TEIA 3QZGA 2QNJA 4A06A 1F0QA 4WNOA 4QTCA 5T3QA 2YHVA 4R3RA 3KXHA 4JDKA 4MBLA 4ACHA 3IW5A 1Q5KA 2O3PA 3OXIA 4ZK5A 1QPDA 5D11A 3HV4A 3I0QA 4UMPA 3OP5A 4GW8A 3GCPA 1DI9A 4CXAA 4QP2A 1Y6BA 2YA9A 1CKJA 1Q62A 2OK1A 3ANQA 3DCVA 3R2YA 4W4VA 2WTJA 4XMOA 5M4FA 5C8NA 2YCFA 3MW1A 5G6VA 4U6RA 2XNOA 4USDA 4DFXE 5HLWA 4OGRA 1Y91A 2F2CB 3EQHA 5K0KA 2X81A 1GZNA 4C62A 3CD3A 3OWJA 3E88A 3C4WA 3P0MA 2E9UA 4YC3A 3DBQA 3ORTA 3TIYA 3UOLA 2X9FA 4TYIA 3ANRA 1FGIA 4QTBA 4O7RA 1BX6A 4YTFA 2Y4IC 4BDCA 1O6LA 2V55A 4IVCA 4BC6A 4EQUA 4ALWA 5CVGA 2FSTX 3DOGA 1YOLA 2X7GA 4F9CA 3PPKA 4RFZA 4ZP5A 4PQNA 4QNAA 2FSOX 2HY0A 4E5WA 3GCUA 5K5NA 3RPYA 2JITA 2UZOA 2VAGA 3MVJA 3IW6A 1ZWSA 3PG3A 1KSWA 3C7QA 4FUXA 3ZRKA 2XNGA 4F0GA 4CFWA 4X2GA 4NZWB 3MH2A 4E4LA 5BVFA 4ZSLA 2BVAA 4J8NA 5IDPA 4O7LA 4QMYA 4AWIA 3HUCA 4DFBA 4EYMA 4AN2A 2JKQA 2WMXA 1XR1A 3SG9A 4BCOA 2XJ1A 2BZJA 3A4OX 3RAHA 4YTHA 3OOGA 2EXEA 2A19B 3V6RA 2BFXA 4M68A 1DI8A 5M06A 2PY3A 3MTFA 3AOXA 4FTAA 4IHPA 2PVRA 3TUDA 3PJCA 1AQ1A 4O2ZA 2WB8A 4II5A 5DT0A 5GHVA 3TNPC 4BKJA 3LAUA 3CQUA 4MXAA 4TYEA 4EBVA 5AV4A 5IH6A 3HDNA 5L2WA 1BI8A 4FKTA 5GJDA 5DBXA 3BIZA 4BDHA 2CGVA 3SOAA 4DGGA 1IA9A 2Z02A 3HV5A 4OT5A 4FVRA 3V5LA 4QMXA 1NT2A 5ITAA 4R77A 4G6LA 1ZRZA 5J95A 4EJ7A 4PL3A 3R1NA 1IASA 1KOAA 4FSUA 2WMQA 1GNGA 2RGPA 5AJQA 4AS0A 3O2MA 5CF5A 3RPOA 3JR1A 3EYGA 5HQ0A 4JIKA 2VO6A 4LG4A 4IB3A 2YWVA 4ZSAA 5CZIA 3PE1A 4I6FA 2J7TA 3QC4A 4R3PA 4S34A 4U97A 5M4UA 3UC3A 3FYJX 5C8MA 5LVOA 2PZPA 3ZC6A 3QL8A 3GQLA 5K4IA 4C4HA 3JY0A 3ZM4A 4JQ7A 4EOMA 1BL6A 3VF8A 4BN1A 3S00A 5HNGA 3ORKA 3TDVA 4Y5QA 1WFCA 2GNJA 2PVNA 1BI7A 4RWIA 4EHGA 4FTJA 3BYOA 3P4KA 3DGKA 3PDTA 1KE7A 2QCSA 3IW4A 4MXYA 2OZAA 2UZUE 5AM7A 4D2RA 2QURA 3JVSA 4F65A 2HXLA 3MN3A 2G2IA 2PE2A 3H10A 1PXJA 4HGLA 4AZFA 5E8YA 4BI0A 1LUFA 4RIXA 2UZBA 4AOTA 4ZSEA 5D41A 4FEUA 4JQEA 4D1XA 1WZYA 4HGTA 3TV6A 5CF6A 3OCSA 5I9WA 2GNHA 5KKRB 3WIKA 4MK0A 5FQDC 1G8AA 2A4LA 2I40A 2B53A 2Y8OA 2AUHA 3OCTA 4AF3A 3IONA 2PVLA 2I0HA 2JKOA 4HVHA 1IG1A 4AT4A 3F7WA 2UV2A 4JT3A 4O84A 4O7NA 2G2HA 3CR0A 1PYEA 2B4SB 3DQWA 3OVVA 4EKKA 2C3KA 2YJRA 4BDJA 3S1HA 1FMOE 1U54B 5CNNA 1JSVA 2OJJA 2YISA 3EH9A 3DV3A 4IJPA 3HX4A 5AUUA 4L44A 2YIRA 2ZV7A 3C4FA 4UWCA 3RHKA 5IQEA 5AUVA 3E8CA 5CTPA 2W5AA 3DU8A 4FI1A 3HZTA 4CQEA 4C4JA 4AA5A 3OS3A 3RZBA 2XK8A 2LGCA 5FTOA 3VBTA 4FKSA 4DHFA 3R83A 3EFKA 3CY2A 2C4GA 3CTQA 3KRJA 4O7TA 3QRTA 4GFOA 4RGJA 3FLWA 3BHUA 3FMLA 5EYDA 2VX3A 4CKIA 3RTPA 5CEMA 4PTEA 4LGDA 5FTQA 4PY1A 1VYZA 3ACJA 4BL1A 3TG1A 3BRBA 3CBLA 3ENMA 3F66A 2VUWA 5I3OA 4DC2A 3GXLA 2BRMA 1OUYA 3E3PA 2O5KA 3MYGA 4I93A 4RX9A 3ZFXA 4F64A 3TZMA 4NM5A 4AGWA 4C37A 3RINA 4A9SA 4DF3A 1OB3A 3LXKA 4IB1A 2C0IA 3CD8A 3QRIA 4WT6A 3RWQA 3PSCA 3R6XA 5CEQA 1YW2A 3GEQA 3HV3A 3THBA 1W98A 2GQGA 3LCOA 4FK3A 4KSQA 2B55A 4EH2A 2IW6A 4NFNA 4IMYA 1FQ1B 4P5QA 2QO7A 3GCVA 3NNUA 5T68A 4BDBA 2XEZA 4FTOA 4QMWA 4YTCA 4J98A 4RA4A 5AV2A 3T8OA 4TRLA 3L8PA 3OT8A 3UBDA 3UIMA 2VTQA 4A07A 3MESA 2C5OA 4RLKA 2IW8A 5D1JA 3A60A 4ITIA 4NJ3A 2XVDA 5CVHA 1UU7A 3BLHA 3DTWA 3VUMA 4BICA 4D1ZA 2JEDA 4FT5A 3ZSIA 4EUUA 4U45A 5E9EA 4B4LA 4EWHA 4K8AA 4CFVA 2FYSA 3UO5A 3CPBA 4ASZA 2W5BA 5LQFA 3E7OA 3MS9A 4TNDA 5DFPA 3TUCA 2PPQA 4U41A 4IFCA 3PXKA 4O21A 5TR6A 4AGCA 4D5HA 4DA5A 1H1RA 4I5PA 2VX0A 4X0MA 4GKIA 4ZTSA 5EK7A 5AMNA 4L00A 1R3CA 4GK4A 5CY3A 4AFJA 1UVRA 2YACA 5HIDA 5H3QA 1HCLA 3DAEA 4ZS4A 5J7BA 3NVMB 5ANEA 3BEGA 1B38A 3QLFA 4EHEA 4GKHA 3D5UA 3RAIA 1KOBA 3OXTA 2CHLA 2C5YA 3MJ1A 4XV3A 3W55A 3LJ2A 2UZWE 3NS9A 2HK5A 2WU7A 3FMEA 4YLLA 3VQHA 2HIWA 3PXFA 3E62A 3AGMA 3HA8A 3ZMMA 2O64A 2XRWA 1YXXA 1UNLA 1OPKA 3D5XA 4EOJA 4G1WA 3ZSGA 3P86A 4PMTA 4YZ9A 5ANJA 3SGCA 3MBLA 3LW0A 2W1DA 3QXOA 1DAWA 1YDTE 2ETKA 3A7JA 1GIIA 3C4CA 3QTZA 3PXRA 1ZYCA 2WQMA 3VS7A 3D14A 4DFZE 3D7ZA 2QOFA 4DH1A 2BTSA 5CVFA 4O7ZA 4FICA 3MH3A 3QU0A 4NIFB 4PL4A 5DR6A 4MHAA 2R3KA 4QTDA 5DGZA 4C4EA 4E4XA 2P2HA 4DINA 1ZY4A 5CSWA 1JBPE 3FHRA 2PZ5A 4FTUA 4X21A 4ZLYA 5B2LA 5G1XA 5EHYA 4F7LA 4V0GB 4DH3A 5DEWA 3R9RA 4TPTA 5HG8A 3WARA 5AA9A 4ANOA 5HI2A 2C1BA 3HV7A 4EH6A 4EOPA 3FLZA 1ZMUA 4UMTA 3AC8A 3LCDA 4BDGA 2NPQA 3LFQA 1GZOA 4FL1A 5HG9A 2R3NA 1RJBA 2ZVAA 5EDRA 3FUPA 3MB7A 5M4IA 1PKDA 2NP8A 4AE6A 4JBOA 5CNOA 5M51A 3Q9ZA 1SVGA 2OZOA 4YZMA 4V01A 5CQUA 3SXFA 4GT4A 3NCGA 1P4OA 4GIHA 4TWPA 4ZEGA 2JKMA 2IW9A 3EKNA 2UW7A 3G90X 5AUXA 2YZLA 5EYKA 2RG5A 4FIJA 5D9HA 4I4FA 4X6QC 3UQGA 2HZNA 3VULA 1U54A 4P4CA 3OXZA 3A4PA 3NUSA 2JIUA 4JG8A 3NX8A 1MRUA 2Y0AA 3I79A 3HEGA 4G5JA 4JR7A 3BCEA 4IDVA 4DH5A 4L42A 2C5VA 1FVRA 2VTLA 4PNIA 3UO4A 4KUJA 4DT9A 4IZ7A 5LVPA 2VTRA 5T6KA 2IWIA 3NUUA 4H3QA 3PSDA 5C9CA 2CCHA 3D2KA 5I3RA 3AC5A 2BDJA 3QZHA 2WMBA 4CYIA 2XNBA 1W8CA 2JC6A 2VWVA 3HKOA 4KABA 4KIQA 4M8TA 3QA0A 2Y7JA 2VTOA 4XG9A 4B7TA 5JRQA 3CQEA 4O22A 4GYGA 5CLPA 2JIIA 2OF2A 2QI8A 3KKVA 5AV1A 4K18A 3EJ1A 3GCSA 3KL8A 2R3JA 2ZJWA 1Z9XA 4RJ7A 2IVVA 5IA2A 3S0OA 3GP0A 5IQDA 4CZYB 5L3AA 3IO7A 4O0TA 4EK5A 4WG4A 2GHLA 5AP4A 4NW6A 4FIGA 1OZ1A 4WUAA 5HVYA 4F9YA 4XLVA 3W18A 3U9NA 3W2QA 5FWKK 4QO9A 3WILA 2UW0A 3CXWA 3QHRA 4EZ5A 3DXNA 4JBPA 2IN6A 4RRVA 4FG9A 4EK3A 2PL0A 3FPMA 3QCYA 3FDNA 5DYJA 3OF0A 5IQHA 2OF4A 4FIHA 1RW8A 2V5QA 1M2RA 4M14A 2WTCA 4JX7A 4AZEA 4JXFA 2QOBA 5CF4A 2OXYA 4G3CA 3TUBA 2Y4IB 4ITHA 4D1SA 4BFMA 4AACA 3FYKX 4KKHA 4U0IA 3EWHA 4DLJA 3G6GA 1PHKA 4D5KA 4IANA 3F3VA 3D94A 3A8WA 4FTTA 4NW5A 2C6EA 2YIXA 1YXVA 2WOTA 3U54A 3MWUA 2WTVA 3QLGA 3DJ6A 5E91A 5E7RA 3SLSA 4W4WA 4M66A 4BB4A 3FSFA 3DK6A 5F1ZA 4U79A 2RSVA 3OEFX 2ITWA 3EOCA 2WMSA 2XKCA 4PNKA 3JPVA 4ZS0A 4FA2A 5A4LA 3KF7A 4XBRA 4OBPA 4M84A 3C5IA 2C68A 3WOWA 3VUKA 1H25A 5KMLA 3JY9A 3PYYA 3F3WA 4ZTQA 2JKKA 4KB8A 4UXLA 4AAAA 1P5EA 2IVSA 3QFVA 3I81A 4IWOA 4QMLA 5DVRA 3PVGA 3WE8A 3GFEA 2GHMA 3FZSA 2HWOA 4CRLA 3HMNA 3L9PA 4I24A 3GUBA 4RZVA 1HCKA 4FEWA 4EJNA 5CAPA 3QKLA 4Q2AA 2CKOA 5AP1A 3KCFA 3KY2A 2HENA 5AIRA 4J96A 3ZO2A 3ZONA 4L68A 3W2OA 5FP5A 1WBSA 4GG7A 4HYHA 3TCPA 3PG1A 4HYUA 4TL0A 3FAAA 1ZZLA 3MI9A 3F9NA 4Y46A 4H1JA 5ICPA 3OY3A 4TTHB 1YXUA 4KS8A 4OTFA 4HW7A 4NIFA 3PP1A 4XS2A 3C9WA 3Q4CA 4AT3A 4ZMEA 3PVBA 3MH0A 3R71A 3CC6A 4LV5A 4EI4A 2CKEA 5DI1A 2R3MA 2WIHA 4V0GA 3GI3A 2PUUA 4IC7A 4L9IA 1JLUE 2R7IA 1UKHA 5F95A 4YTIA 2B0QA 2XBAA 2XIYA 2V0DA 3H0YA 3L8VA 2XUUA 4DEEA 5BYLA 4J95A 1U5QA 3FC2A 4BCHA 5E8TA 2UZNA 2RFEA 2XM8A 3COKA 3JUHA 5M57A 2XKFA 2XNEA 1I44A 4W8DA 3A7GA 1K9AA 1GJOA 3PWDA 4WKQA 5FLFA 2GTNA 1CKPA 1H27A 5CI6A 3WZJA 4FV0A 3KVXA 4PP9A 3NUAA 5CQWA 4EL9A 4FSZA 1E1XA 1OKWA 4P2KA 5BYYA 4OT6A 5HLPA 2XRUA 4C2VA 2ZYBA 4QP7A 5J9ZA 3JVRA 3K5UA 3KEXA 3PPZA 5FEDA 5IG1A 4MD9E 4EOQA 5FD2A 5IH4A 4JVGA 2HZ4A 4MWIA 3W8LA 3D7TB 4XG2A 2JAMA 3TZ7A 3GU4A 1DS5A 2OGVA 4YNOA 4O0YA 2VTHA 3R1SA 5TO8A 2XK3A 3VBQA 2YLFA 3HRBA 4FV6A 4IX4A 1VZOA 3QRJA 4RJ3A 3ZDIA 5LVNA 3G9LX 3D83A 3QTIA 4FKWA 4O6LA 3FEGA 2C6OA 3Q60A 3NUXA 1PY5A 2ONLC 4CTBA 2VD5A 4N4SA 3NUYA 4YLKA 4AW2A 2OH4A 4C4IA 2CN8A 3PA4A 4Q9ZA 4WUNA 4O38A 4RC3A 3BWFA 2FO0A 2PE1A 1YDSE 4L01A 3TTIA 5M4CA 1OVEA 4MX9A 2P55A 4QQTA 3TV7A 3UGCA 4D58A 4ZOGA 4G17A 5C4LA 4C0TA 1J3HA 4QYEA 3EQDA 3SRVB 1M17A 4HGEA 3DKOA 4NU1A 4UEUA 4Y85A 3EL7A 4EUTA 4FZ6A 4BYJA 1H00A 2ZM1A 4K1BA 5BMMA 4IX3A 3UIUA 3VUIA 2F2UA 4AX8A 2DQ7X 3HA6A 3RI1A 5I9XA 2YJSA 4FOBA 3A7HA 4PX6A 1YXTA 4FSQA 1QCFA 4TZRA 3OTVA 3E93A 4EYJA 1QPJA 4AT5A 2GNFA 4LL0A 4FKJA 4UYAA 1H07A 4ZTRA 4Z16A 3DA6A 4G9CA 3W2SA 1XBBA 4H3PA 4LYNA 2HZIA 5HE0A 2OJGA 2XIZA 1R1WA 2EWAA 3NLBA 2ERZE 2W9ZB 2XF0A 4I23A 5LMKC 4K2RA 4DBXA 4WA9A 4IADA 4DG3E 5CALA 3SV0A 1RDQE 4MXZA 3SW4A 3U51A 3Q53A 2JDRA 3MB6A 3OBGA 5EH0A 4ORKA 4J99A 4JAJA 5IQFA 5L2QA 3ZO4A 5IA5A 4L67A 4AA4A 4QMQA 4BCIA 2F7ZE 2XJ0A 4G3DA 4X2FA 4BIBA 4D0WA 1GY3A 3DB8A 3PY3A 5E1EA 3RALA 3VAPA 3OMVA 4JBQA 5M07A 4E20A 3NAYA 3ZZEA 1URWA 4XP2A 4U43A 4G2FA 1Y57A 3ROYA 2CNVA 2F7XE 4FVQA 4BTFA 5D7VA 3BE2A 4QMMA 2VTAA 4YPDA 2QOOA 4N6YA 3R02A 3TIZA 3NPCA 3NYXA 1NW1A 1HOWA 5AP7A 2UZLA 4J1RA 3SKCA 3AMAA 4F7SA 3ZH8A 3AG9A 4KS7A 2V7OA 3JXWA 4WOVA 4XG6A 4YLJA 5JRSA 4ZLOA 3PSBA 4H3BA 2WPAA 2IZTA 1L3RE 3R01A 3DY7A 1PF8A 3V04A 4R5YA 4FX3A 4YBKA 4CEGA 1XBAA 1SNUA 1H28A 3FV8A 3M1SA 3CCNA 4L46A 3ORLA 5FG8A 4D2WA 4XG7A 2BILB 5M08A 1QMZA 3HRCA 1OM1A 1XH7A 3EQIA 4GL9A 1T45A 4JOAA 3QBNA 3UE4A 5GJGA 3KF4A 4FT9A 4FKVA 2ITPA 3R9NA 4BIEA 4W9XA 4C35A 1FPUA 2VU3A 3UNJA 2ZOQA 4HVIA 1A9UA 3V5WA 5B2KA 3VS2A 2R3LA 1KV2A 3CIKA 4AZWA 4GRBA 3DPKA 3TWJA 3ZRLA 2W0JA 3VBXA 3VS6A 4FNXA 2R3GA 3PE2A 5EYMA 3C51A 3OG7A 5ETFA 3SQQA 1WMKA 1TKIA 2X0GA 5KBRA 4C3FA 3HP2A 5AP3A 3NVKI 1WBWA 4EORA 2GPHA 3OW3A 2RIOA 4D4VA 3NAXA 1YVJA 2YFXA 2UUEA 4J53A 2QKWB 5TF9A 2PZIA 1M2PA 4J7BA 5A4TA 4F1OA 4KAOA 4OW8A 4RSSA 3RNYA 4FODA 2BUJA 3KMMA 4IEBA 4LFIA 2DWBA 5FRIA 1R78A 2ZB0A 5GNKA 4BDFA 1JKTA 3U4WA 2W06A 2UZEA 4RVKA 3WZEA 4BZNA 3KXGA 4RIYA 3EN9A 4YZCA 2CDZA 3PWYA 3UYTA 5EDQA 4PTGA 5CWZA 4XYFA 3FZPA 1STCE 4W8EA 5AWMA 3QZFA 4E4NA 4AFEA 4FV3A 2PMNX 4X2NA 3BYSA 4O7WA 2BRBA 5FTGA 3QUEA 4PMSA 2VO0A 2W1GA 3DBEA 3V5TA 4IAAA 4YBJA 1YOMA 1QPEA 1JOWB 4YZNA 3ZXZA 4C02A 1SYKA 3Q2MA 4ZSGA 3Q52A 3T3UA 3WIGA 3D7TA 4KRDA 3ZDUA 2VTSA 3S2PA 2O65A 2YCSA 1JKKA 3W8QA 3LQ3A 4I6QA 3LFSA 4UMQA 3BU3A 4BHNA 1ZYLA 4L3JA 4B8LA 3QTQA 4DEDA 3G51A 5HKMA 4M69B 1OKZA 1YOJA 1UWJA 3FLYA 4QQJA 1W82A 3DAJA 3II5A 3V51A 4RWKA 4TYHB 1G8SA 1CDKA 3CTJA 3RWPA 3GU6A 5BQ0A 3UZTA 2AC3A 3GFWA 4OBOA 4GJ2A 4BWXA 1H1PA 3O7LD 5IMXA 5HE2A 2BAJA 2JLDA 1XHAA 4BCGA 5A6OA 5AP5A 1PRYA 1UU9A 4A9TA 2R5TA 2BHHA 3FKLA 1M52A 4MXXA 3OUKA 5AR4A 3R28A 1KE5A 3FQSA 3SRVA 3EN4A 2X6EA 3QUPA 3A2CA 3VHEA 3FL5A 2H8HA 3LLTA 2RL5A 5EKNA 1ZYDA 2OIDA 3PXZA 3TJCA 5JFWA 3Q6WA 2XK4A 3ZLWA 4F9AA 3M11A 3OROA 4BRXA 5IPJA 4KIKB 3FHIA 5EM5A 4L52A 3V3VA 3AC4A 3WF5A 3L9NA 5K5XA 3IW8A 5GINE 1W83A 5KZ0A 3PLSA 5IUIA 3V5QA 3GENA 2J9MA 3C1XA 3MFUA 5BVWA 4S2ZA 4HVDA 4DITA 4N70A 4EH4A 3VRZA 1J7IA 3UG2A 2HW6A 4FT3A 3R8UA 2UVXA 3DK3A 5E90A 4GIIA 3I5ZA 2ACXA 3KMUA 3QCQA 4A4LA 4C4FA 5AR8A 3MFRA 2WNTA 5HO6A 3NIEA 5FBOA 3G5DA 4ZIMA 4S32A 4FNYA 4IW0A 1PXLA 2RG6A 4PPCA 4IB0A 1W84A 5I9YA 1AD5A 2OI4X 2SRCA 3E5AA 2BIYA 3ZC5A 3UVQA 5HZNA 4QP6A 4MBIA 1UA2A 5GIPE 4Z55A 3VJOA 4BVUA 3O50A 5E1SA 4L8MA 2X8DA 4I20A 1YKRA 4FV4A 3LCSA 1P4FA 3NR9A 4IFGA 2QVSE 1XWSA 1Q3WA 2P4IA 1DAYA 1WCCA 4K0YA 4YZDA 1WVXA 3GVUA 5EHOA 2UW9A 4FKOA 4H1MA 3RNIA 5IA3A 1NA7A 2OJIA 4HNIA 2R3OA 4TWCA 3HUBA 3BHHA 3ORZA 4RZWA 3V8TA 4O7SA 3SW7A 3O96A 4RX5A 4S33A 4EK6A 3DXPA 2X7OA 1W0XC 3CGFA 3DBFA 4JNWA 5HOAA 5CT0A 4BKZA 3SOCA 4I3ZA 4XV1A 4R1YA 1YDRE 2GFSA 5HX6A 3ZZWA 4HZSA 5L6WL 3QTXA 2R64A 4TW9A 4Z9LA 4A9RA 4DTAA 2I6LA 3WI6A 3R63A 5A6NA 2W4KA 3Q5ZA 4U7ZA 3RGFA 4EK8A 2OJ9A 2ITNA 3DZQA 2QONA 5IQBA 5H8GA 4XRJA 3Q9WA 4HCTA 3RK7A 4FIIA 4D2TA 4ASDA 4EOIA 4OTQA 4DG0E 3IS5A 4JAIA 3VS3A 2IO6A 3P9JA 4RBLA 4P5ZA 1CKIA 4TN6A 4FNWA 4NM0A 4YJNA 2YLEA 4UMRA 2H9VA 4ZTHA 4HPTE 3QRKA 4MD8E 1BMKA 2J6MA 2XK9A 1YWVA 1PJKA 1FOTA 3BYMA 3VW6A 4ACGA 4GUBA 3CJFA 4LQMA 4TXCA 2HXQA 3I4BA 5A3XA 3VS0A 3LZBA 2IZRA 2WMAA 3NNWA 4GFGA 3RZFA 2QQ7A 3EN7A 3PJ8A 3QKMA 5AR5A 4R8QA 4QYHA 3I6WA 2ITQA 3LQ8A 4AZTA 3PP0A 2GS2A 3KRRA 4UV0A 4L3LA 1REJA 2BZIB 2I0VA 4I92A 3MIAA 4X6RA 1H0VA 4XJ0A 5CEOA 4PUZA 4XOYA 1OPLA 3E87A 3NEWA 3COHA 4GJ3A 4RJ4A 3NIZA 2C30A 1J91A 1R0PA 3DBCA 4LL5A 1XH6A 5BYZA 2H96A 4AUAA 3I60A 5HU9A 4JDJA 2JD5A 4TYGA 4ZJJA 4I94A 5EI6A 4A9YA 3MSSA 1ZXEA 2W1FA 1GIHA 5KHWA 3WF7A 1F3MC 1H1QA 3EHAA 5EM7A 3F5GA 3PZHA 2OSCA 2W1CA 3MPAA 4JQ8A 3MFTA 2GNIA 3EMGA 3O71A 4M69A 3BPRA 4MTAA 4MD7E 3A7FA 3MA6A 4J97A 4TYHA 3IG7A 4W4XA 4NCTC 4IAFA 4NUSA 4R3CA 5KMOA 3U55A 3F3TA 3FL4A 2YCQA 4YJSA 4ASEA 4RA5A 4KA3A 4ZY6A 2PUIA 2R3HA 2WKMA 5IISA 5CXZA 2YN8A 5HBJA 3CP9A 5LJJA 3V5PA 4J71A 5L8KA 3BYUA 4AP7A 1YI6A 5AR7A 4K9YA 3BKBA 3RPVA 3R04A 3HNGA 2NRUA 1MRVA 4P90A 2XEYA 2HYYA 3P08A 1WBTA 2UW3A 4MAOA 4BCKA 3GC8A 3LE6A 3CSVA 4CKRA 2QKRA 2Y6OA 4AN9A 5KMKA 3HDMA 3KN6A 4EOKA 2ZDTA 4RVMA 3QQLA 4IM0A 3TZ8A 4F08A 3KULB 3OEZA 4H05A 2JDTA 4DGMA 5IEYA 3LLAA 4GT5A 4U44A 4NSTA 3R7OA 3R7IA 5IU2A 1WAKA 2YM7A 4FEVA 4KINA 4IX6A 2E9OA 2WMRA 2XBJA 2W1EA 1GOLA 3UOHA 4W9WA 5CAVA 4M15A 3E3BX 2HCKA 3D9VA 3ZEWA 1ERKA 2WMUA 4BYIA 3ACKA 5HCXA 4F0IA 4RIWB 3TNIA 1VJYA 1BLXA 3ID6C 1V0PA 2V62A 3UQCA 4AGDA 2HY81 2C3IB 1V0OA 5C8KA 3QQGA 3KQ7A 4FTNA 3SC1A 3BQRA 4XCUA 4UY9A 4DT8A 2BFYA 1ZLTA 1PMVA 4YURA 5BUIA 2WMTA 5JFVA 3BLRA 2BCJA 4D4YA 4ZY4A 2PMLX 4WSQA 4JLCA 4ZZOA 3DJ7A 4CZTA 2R4BA 1PYXA 3MGYA 3QQJA 4FBXA 1M2QA 2ERKA 4O0RA 4CFNA 4EH7A 3FZRA 2JFLA 1S9JA 3Q3BA 3DZOA 5J1VA 4CZUA 2IVUA 3LCKA 4BI1A 5AUWA 3IECA 3DNEA 1U46A 4RQKA 4RVTA 4ZMFA 2G1TA 3CE3A 3HV6A 5FDXA 4XG4A 3KU2A 2GTMA 4S30A 4U9AA 3ZLSA 2PTKA 5I5ZA 5HORA 1TQIA 3QGWA 4G16A 4UX9A 3LPBA 3VRYA 4BWKA 4CRSA 3EYHA 5HE3A 3ZLXA 2PVFA 5J5SA 3U6JA 5JFSA 4YJRA 3HMOA 3OOMA 4IM2A 2X2LA 1JKLA 4JG6A 5A54A 3WE4A 3P23A 5F20A 3CY3A 4USFA 1OL1A 3EN5A 4FSRA 3QC9A 2GS7A 1OIYA 5EW9A 2J5EA 2X8IA 4YHFA 2W7XA 3BHTA 3GC0A 5HBEA 5B7VA 2X8EA 2F4JA 4CYJA 4XHKB 1XH4A 3ZHPC 4BCNA 4CFXA 4BBEA 2VRXA 2XS0A 2OW3A 5GZ8A 1IEPA 1Z5MA 2QLUA 3LM0A 5BVKA 2OJFE 2WD1A 3NSZA 3KXMA 4R78A 4E73A 2R2PA 4JRVA 4Y73A 4WBBB 3S3IA 1ZOEA 4FK6A 2BROA 3L8XA 3DDQA 2QO9A 4I6HA 5FXSA 4OAVB 2ITXA 5E92A 3RP9A 4C57A 1J7LA 2VNWA 3GC7A 2VWXA 2WMVA 2VX1A 4IAIA 4QMZA 2X7FA 5DEYA 1JSTA 2GQRA 3KXXA 3Q4ZA 3T9IA 4F7NA 1ZOHA 1MUOA 2OFUA 4Z3VA 1OIQA 1QL6A 3LJ1A 4FV7A 4LRKA 2VWWA 3PXQA 5AR3A 4X3FC 5ACKA 3LKMA 4PDPA 5LOHA 4HCUA 3R7GA 4YHTA 4ALVA 4YC8A 2J0LA 4RJ6A 5HD7A 3W2CA 1VEBA 4YJTA 1WBPA 3DQXA 3WF6A 2NNWB 3QF9A 3PVUA 4EHVA 4UZHA 2QR8A 3OWPA 4MCVA 3QA8A 4IDTA 3AD5A 2RFDA 5EI2A 4NT4A 2Z7QA 4IJ9A 3PIYA 3B2TA 1PKGA 3QX4A 4CCUA 2VWIA 5ANIA 4O82A 3R22A 2RFNA 4JL9A 3V01A 4D55A 4RPVA 3TN8A 5FXRA 2Y6MA 3OZ6A 1X8BA 2EXMA 3UQFA 3A8XA 4Z7GA 3EZRA 4HNFA 4CMTA 4PPBA 3ZSHA 1ZMWA 1TQMA 3LOKA 5CAOA 1R39A 2JBPA 3HRFA 3Q9XA 2WAJA 4FZAB 3QWKA 4OTHA 4ENYA 5HTBA 2PYWA 4YP8A 2XNMA 5FXQA 1ZYSA 5CASA 4Z7HA 3MVHA 5LCKA 3RBWA 4HPUE 2CJMA 2PWLA 5CAUA 2C3LA 3Q9YA 2W1ZA 4C61A 2JDOA 4ITJA 3KK9A 5HVJA 3AXWA 4G6OA 3Q32A 2EXCX 4ERWA 5FEQA 5HCZA 5KMMA 3R1YA 1SM2A 4J8MA 2ONLA 3IOPA 3KMWA 4KBAA 4MXOA 5DA3A 5M56A 2YABA 4FMQA 3SVVA 2OICA 3DAKA 4ID7A 5HG7A 3PJ3A 5BUEA 4FG8A 3ITZA 4MBJA 4C2WA 1H08A 3OFMA 2GNGA 3HL7A 3KULA 4KWPA 3BGZA 3UOKA 4O1PA 3VUTA 5M53A 3N4VA 4O0WA 4F9WA 5BVDA 4A4XA 1Q3DA 4D2VA 3QQHA 5ANOA 3COMA 4DLIA 3NZ0A 4EK4A 3OD6X 1YHWA 3FSKA 4FV9A 1F5QA 3L8SA 4CMOA 5IF1A 4NFMA 4D9UA 3LMGA 1H0WA 4O2PA 2F7EE 1H01A 4RIWA 5JK3A 3E8DA 5ETCA 4AQCA 5IUGA 1FMKA 3TXOA 5IMEA 5HCYA 4RFMA 2BZHB 5EW3A 4D4SA 2C1AA 4FE2A
chains in the Genus database with same CATH superfamily
4OBQA 4UZDA 1PW2A 2G9XA 2VZ6A 4YJOA 3Q5IA 5F4NA 3PRFA 3ZLYA 5E8XA 4CT1A 1PXNA 5LMKA 3BL9A 5M09A 5KE0A 1IR3A 2UVZA 2PSQA 4QMVA 2X1NA 1XKKA 3BZ3A 3L9MA 4A4OA 5HLNA 2YIYA 3I1AA 4TKSA 2BDFA 4PDYA 4I5HA 3ALOA 4LM5A 4G31A 4JX3A 4O27B 5C27A 3BBTB 4EH9A 3FZOA 3H4JA 2WEIA 4D4RA 3GNIB 4R5SA 4HOKA 4DFYA 3N4TA 2FGIA 3MPMA 3FXWA 4FV5A 1CMKE 1YI3A 2JFMA 2PVYA 4GVAA 4QNYA 3WZUA 4AW1A 4QQ5A 3ZOSA 5B2MA 4H36A 3KRLA 4MF0A 2BTRA 2VWBA 1PXKA 3B8RA 4FZDB 4JBVA 1MRYA 4FUYA 4UALA 3VS4A 4YJUA 3GGFA 4NJDA 5CU4A 3FLSA 3FZTA 2C0TA 3FMMA 3LFNA 4M13A 5AM6A 1S9IA 1SNXA 2WQBA 3PIXA 4EZ3A 4GS6A 3NMUF 2Y9QA 4E6AA 2QC6A 5AEPA 3R00A 4RC4A 1BUHA 3VBVA 4GV1A 1UNHA 3UYSA 2DUVA 3ODYX 1WVYA 3H0ZA 3R73A 3VHKA 4DGLC 3FMNA 4MQ1A 2B9HA 4UB7A 3PJ2A 4PRJA 2FA2A 4M3QA 2WTKC 4UMUA 3BGPA 1I09A 2GSFA 5CYIA 5BVOA 4F9BA 4BCJA 4F1MA 3C13A 3FMJA 3P79A 1MQ4A 3O7LB 4FKLA 4ANLA 3OCGA 4H39A 2OFVA 3IDCA 5KUPA 3E63A 2BAKA 5ANGA 4FSTA 2I0EA 2CSNA 2VTPA 3EIDA 4K33A 4FKQA 4QPMA 4TNBA 4KBCA 4X7QA 4AXEA 4DGNA 4CFMA 5LWNA 1R0EA 3G0FA 4EZ7A 2Z60A 4BZOA 3W2RA 4FEQA 3IPHA 3C0HA 3ET7A 3WF9A 3W0SA 3GB2A 3TM0A 1Q99A 3F5XA 3IK3A 3JYAA 2R3PA 4IAKA 3RAWA 4CG8A 5DPVA 4KD1A 4AE9A 2HELA 2R3QA 4QTAA 3ZU7A 4BCPA 3LFDA 5DWRA 3VC4A 1RE8A 3F3UA 2OO8X 1Q8TA 4U3YA 4BCQA 2OXDA 4EBWA 4NYEA 4R1VA 1WBOA 4B0GA 4PF4A 1ATPE 5H2UA 4RG0A 4XLIA 5K3YA 3LFBA 4ACCA 4EH5A 2QOKA 3KC3A 4C8BA 5FEEA 3IGOA 3UIXA 2PUNA 1Q8ZA 4JJRA 2WEVA 3LVPA 4CQGA 3LJ0A 3BEAA 3OWLA 1REKA 5K4JA 2OBJA 2W1HA 5E8VA 3CQWA 2XJ2A 4BDDA 4KRCA 5HD4A 5HBHA 4OTWA 2EVAA 3CGOA 3IGGA 3K2LA 4FKIA 4E5BA 5LMAA 4LUDA 4F70A 3M42A 5AP0A 4BTKA 2J0KA 3PVWA 4QDVA 2ZM4A 3QWJA 5BVNA 1ZOGA 4RVLA 4FEXA 2J50A 2A2AA 3RPSA 4F6UA 3O51A 4O6EA 4RX8A 4K77A 3QYZA 1G5SA 3EN6A 4RWJA 1WVWA 4ANQA 4ACDA 1M7NA 4DYMA 4CFFA 3F82A 4CSVA 4O81A 1V0BA 3LMIA 4NM3A 3D0EA 5HX8A 2NO3A 4OTGA 3REPA 2C69A 3P7BA 5H8EA 5E8SA 4C34A 4RMZA 3MJ2A 4LRMA 4QP4A 4Y83A 5C01A 2O8YA 2WOUA 4AZVA 1FGKA 3V6SA 1OBDA 4MH7A 1JNKA 1O6KA 2F57A 4DEIA 1JWHA 4BR3A 4ENXA 3VUHA 2RF9A 3R1QA 3AGLA 4RJ5A 3RAKA 3LQ5A 3ZYAA 3R8ZA 4OTIA 3PY0A 2J4ZA 3TZ9A 4QMUA 5IDNA 5EG3A 4DEHA 3WF8A 2PZRA 4XUFA 3AC3A 4GCJA 1ZMVA 2YERA 1Y6AA 4IX5A 3KA0A 2JDSA 5LWMA 3DNDA 4UWBA 2PVJA 3VF9A 4D2PA 1Y8YA 3VNTA 3FKOA 4PWNA 2CLXA 2J5FA 3UJGA 4DCAA 1OECA 5EM6A 1FINA 4FGBA 3NYOA 2R3RA 3GBZA 3KREA 3RM7A 2GU8A 2PVMA 3TNQB 5JT2A 4QQCA 4DFNA 3FBVA 4CTCA 3PIZA 4UN0C 5DT4A 3OC1A 3KIOC 1UU8A 2F49A 3QD2B 3R7UA 3IKAA 3PRIA 4RC2A 4XBUA 4BTJA 4FR4A 2BMCA 1OGUA 3ODZX 2VGPA 5AFVA 4IBMA 4V04A 4EOOA 4WNMA 4ALUA 2ITOA 2PUPA 4AXFA 5JEBA 2WTWA 2YWPA 3H3CA 4BF2A 1UKIA 2WQOA 4MWHA 2OKRA 3R9OA 4E6QA 4X2JA 5L6PA 2XIKA 3RCJA 5GIOE 3FMDA 1ZYJA 3FMHA 5HE1A 5TKDA 3UDSA 2XIRA 3CKWA 2R9SA 3BLQA 4BGHA 3MY1A 1WBNA 2WO6A 3EQCA 4JMQA 1SZMA 4OUCA 4AOIA 4FL3A 3MTLA 2A1AB 3HLLA 4FSWA 4I6BA 1Q8UA 3BV2A 5TT7A 4QPSA 1DM2A 2QODA 2YITA 3PY1A 4FV1A 4FV2A 5HNBA 3W1FA 3NW5A 4U5JA 3U6IA 4QP1A 5CX9A 1Q97A 4K11A 1IRKA 4JG7A 1IAJA 4WSYA 3K54A 3NGAA 4KKGA 2YEXA 4QMNA 4DH8A 3TDWA 3ZBFA 4DFUA 5L2SA 2ZAZA 2YZAA 4ZLZA 3TL8A 4B9DA 3DFAA 3QZIA 3W0PA 1H26A 1NVQA 5HHWA 3R7YA 3HMPA 4MKCA 5EW8A 1U5RA 4DEAA 4O83A 2VO3A 5M44A 3R9DA 3IQ7A 4L7SA 4MQ2A 2H34A 2CLQA 3TKIA 2CKPA 2IVTA 4O0UA 2ZB1A 5J9YA 1BKXA 2PVHA 3G15A 1XH9A 4ANSA 5JN2A 4H58A 3DKGA 5L8JA 4BZDA 3I5NA 3BWJA 2R3IA 4LV7A 4IZYA 3BYVA 5A9UA 1M14A 4IIRA 1OIUA 4DAWA 2C3JA 5K0XA 2XAOA 5J9LA 4U40A 3AT2A 4ZTNA 5AAEA 2X6DA 3WYXA 4DH7A 5IZFA 2I7QA 4FL2A 3UVRA 3M2WA 4IC8A 4NH1A 2GS6A 5JZNA 4O0XA 5FM3A 5EQPA 5HO8A 5FDPA 5J5TA 1XH5A 2UVYA 4GK2A 2IZUA 2YM6A 3U4UA 2AC5A 3MDYA 3ZXTA 4LOPA 3DT1A 1KV1A 3W10A 3VW8A 3GU5A 2X4ZA 1NVRA 2J0MB 4X3FB 1A48A 2BKZA 3D5WA 5LXMA 2ZMCA 3TT0A 5JQ5A 3I7BA 3OW4A 3RCDA 3A7IA 2XKDA 3ZBXA 3ZFMA 4F6WA 3QYWA 2Z7SA 1JQHA 4CFUA 3QCXA 3MVLA 4A9UA 4DCEA 4WO5A 3LFEA 3UO6A 3UPZA 4E6DA 2BDWA 4LOOA 2FVDA 4C4GA 4S31A 3C0IA 5CSXA 3RPRA 2QU6A 4OTPA 1UV5A 2OIQA 4N6ZA 4RT7A 3DKFA 2YM8A 2J2IB 4BKYA 3W33A 4I1ZA 2WZJA 3CJGA 4U3ZA 5CENA 5EHLA 5AX3A 2V22A 5TOZA 4CV9A 4ZAUA 4NKSA 2VV9A 4LI5A 4E5AX 5A4EA 4OLIA 3G9NA 1OIRA 4QPAA 4XP0A 2I1MA 2PHKA 4NCTA 1CSNA 4AU8A 2CNUA 2C6LA 2PU8A 2GQSA 3R7VA 4ACMA 2IEWA 4QYFA 3HMMA 4CNHA 2XZSA 2ITZA 4NEUA 3EB0A 3TKHA 4LUEA 4ZY5A 5I9UA 5HTIA 4AGUA 4D2SA 4U80A 4N0SA 2B52A 3F5UA 4QP9A 3O8UA 5HEZA 4DGOA 4RQVA 4XH6A 3HECA 2Z2WA 3QTUA 3FXXA 3LIJA 3UNZA 3EQGA 2P33A 2DYLA 3D15A 4G3FA 4ANNA 3EZVA 3GT8A 5E8UA 2WU6A 1JKSA 2QO2A 3BBWA 4M0ZA 4EKLA 5DMZA 3U6HA 3N4UA 2JAVA 5H9BA 2CGWA 4K6ZA 4JR3A 1H24A 5J87A 3FXZA 5EM8A 3L1SA 3F88A 3R8LA 2C6MA 5KBQA 3TKUA 5AAGA 4XOZA 1OUKA 2Q0BA 4IB5A 2ZDUA 5HGIA 5CU6A 4RFYA 5JMSA 3O23A 3ZRMA 5A46A 3S95A 3ERKA 3FI4A 2WQEA 3B2WA 4GU9A 3V8WA 2LAVA 4BBFA 5CU0A 3P1AA 3LHJA 5AADA 2JIVA 4P7EA 5JKGA 2OU7A 4CV8A 2P0CA 5KO1A 4DHJA 5DE2A 2J90A 2VGOA 2C6IA 4C59A 3C0GA 4F6SA 4FZFB 1JAMA 2C0OA 2VTNA 4LV8A 1FBNA 3AT3A 2A0CX 4L3PA 3KK8A 1YHSA 5K9IA 4BDIA 2ITTA 2X2MA 4F7JA 5GZAA 5KCVA 3G2FA 1OITA 4YO4A 3R2BA 3FLNC 5CSVA 1T46A 3SXSA 1CM8A 4C33A 1LP4A 1SVEA 2J0JA 4J52A 2PMOX 5LARA 4FRFA 3PA5A 4BI2A 1K3AA 3UZPA 3LXNA 5AV0A 4DEGA 3PLAE 4FKPA 4PMMA 4GU6A 1ZY5A 2OG8A 4WIHA 4C3PA 4Y5HA 5A4QA 4GT3A 5EOLA 2ZM3A 4L6QA 1P14A 3H9FA 5IA1A 3D5VA 1LEZA 2F9GA 3VQUA 3DBDA 4MUQA 3O8TA 2WTIA 4L43A 3UOJA 4NK9A 3BHVA 2EB2A 5ANDA 4CMUA 3IW7A 2G15A 1U59A 5EKOA 4NTSA 1BL7A 2YM3A 4FC0A 1EH4A 2QOCA 4ANMA 4O1OA 4PDSA 3UZRA 3K3IA 2WTKB 4MNEB 3E64A 2IG7A 3VJNA 4RLLA 4AW5A 4F1TA 4E93A 5AV3A 3HGKA 3QCSA 4QMOA 4XNEA 2OLCA 3EQPA 4OAUC 4YJQA 4FGRA 1YHVA 2XYUA 1JVPP 3RKBA 1V1KA 4IZAA 4CKJA 5HIBA 3CPCA 5CANA 4F09A 4R6VA 5EFQA 1OL7A 2KTYA 3H9OA 4FT0A 3KGAA 4BIDA 4YJPA 2XNPA 3FI3A 3O0GA 5HG5A 4ZXTA 3ORMA 3TTJA 5IH5A 4I21A 5KZIA 4E8AA 4R7BA 4PTCA 4I5CA 3VO3A 1NXKA 2PE0A 3A61A 3F6XA 2XP2A 2OH0E 4Y8DA 3FQEA 5LMBA 3PA3A 4HJOA 4KNBA 4FF8A 3NW6A 2OWBA 5B0XA 3FZ1A 3RMFA 2VNYA 1KE8A 1XJDA 4X3FA 4LGGA 4TWNA 4YR8A 3AMYA 1L8TA 4Y72A 3PTGA 1BYGA 3BV3A 3F3ZA 3LFFA 3CTHA 1E1VA 3AKKA 3OWKA 3NYNA 4MVFA 3BI6A 2ZMDA 5A4CA 4XX9A 4IVBA 4LMNA 5CT7A 4FSYA 4FKRA 4DE4A 3EQFA 4AN3A 4ASXA 2WHBA 3ZCLA 2PMIA 3B8QA 1PXPA 3H9RA 5FGKA 5KMJA 4ZTLA 2R0UA 4YJVA 5DG5A 3ELJA 2CGXA 3R8MA 3FC1X 4KIKA 4Q9SA 1PMUA 3R8PA 3BX5A 4O4CA 3MA3A 4KIOA 3P78A 5JQ8A 4HVGA 3WYYA 3DFCB 3Q04A 2C6TA 4UWYA 1RQQA 3G33A 5C1QB 1A06A 3DLSA 3DLZA 5D10A 5E4HA 1O9UA 3QXPA 4C3RA 1Q24A 2Z7RA 3GU8A 4UBAA 3R0TA 5DR2A 4BDEA 4FTCA 4X3JA 1YWRA 3ORPA 1URCA 2UW8A 4JI9A 3Q6UA 4RIOA 5DRDA 3T3VA 5CEPA 2XCKA 2P3GX 4QMPA 4F4PA 3BGQA 5BVEA 1OL2A 4HVSA 2YCRA 2A27A 2W9FB 3QHWA 1E9HA 1H1SA 3GQIA 2B54A 5F94A 4ERKA 1Q4LA 3RK5A 3A62A 5DT3A 4FG7A 3EFJA 2PZYA 2VWUA 3PFQA 4FSNA 4BGGA 3G0EA 4G34A 2YAKA 3W0NA 5I0BA 4YHJA 2ZV8A 4IACA 4BCMA 5BMSA 4M97A 4GH2A 2W99B 3AD6A 4KKEA 2EB3A 1PMEA 3PZEA 5E8WA 3ZS5A 4BBMA 1NVSA 4YMJA 3R9HA 3GU7A 3ZM9A 3FY0A 2UZTA 2XKEA 4HYIA 4ZZMA 3W32A 1VLRA 2YDKA 4IM3A 3FI2A 4GVJA 3P5JC 3P5KA 3CS9A 4FSMA 1OPJA 2HAKA 5AUYA 5CF8A 2XMYA 2HZ0A 3QQFA 5AP2A 3FPQA 5KMNA 5KMIA 2UW6A 4IXPA 5FM2A 5BX0A 4PL5A 5DRBA 5JGDA 4EC8A 2ZV9A 2W05A 4FIFA 2B9IA 4O4EA 1JSUA 4G3EA 4IZ5A 2BKKA 3I6UA 2WTDA 1ZAOA 3KXNA 3NYVA 4FT7A 5TE0A 4YZBA 3NUPA 4OTDA 4W4YA 1H4LA 4NM7A 5HNIX 4AZSA 5IA4A 4GYIA 3IDBA 5AP6A 3ULIA 2FUMA 3QTSA 4L53A 1K2PA 4B6LA 3P7CA 1PXOA 5A14A 5EQEA 4WG5A 4XV2A 4EC9A 1XMLA 2QOIA 4CGAA 2XNNA 3AMBA 3VBYA 4E7WA 5I9VA 4EOLA 2PK9A 2GFCA 2QOQA 3F2AA 4AOJA 3UP7A 3UVPA 4UYNA 3BU6A 3E8EA 2XIXA 4QYGA 4XG8A 4CG9A 2W5HA 3VUGA 5M55A 2QHNA 2B7AA 2WFYA 4O0VA 5ETIA 4BTMA 4HCVA 4RX7A 4E6CA 2R0IA 3ENHA 4QRCA 3U87A 3OBJA 1XO2B 4F0FA 1WBVA 2CKQA 4EEVA 5IUHA 3BQCA 2XM9A 2IZSA 5L6OA 1LEWA 1Q8WA 5BUJA 5IA0A 2WXVA 2G01A 2VTMA 2W17A 3FMKA 5GZ9A 3ZUVA 1GAGA 3PJ1A 4EH3A 1VYWA 2WIPA 4TT7A 4TWOA 3QTWA 4X2KA 5C03A 3DXQA 3CKXA 3TYKA 1Q41A 2CNQA 2VN9A 3SAYA 2CGUA 5DR9A 3RJCA 2VWZA 3U9CA 5CSPA 2QG7A 2IJMA 4D28A 3TV4A 5BPYA 3HYHA 4MNEA 3DB6A 3ORNA 4JDIA 4UXQA 4DN5A 3ORXA 3HP5A 4G6NA 4LGHA 3ZO3A 1H1WA 3FWQA 4HGSA 1P2AA 4BHZA 5EQYA 3VWAA 2WMWA 3U8WA 2ITYA 2H6DA 4PPAA 4QP3A 5HICA 3F2RA 5CU3A 4WNPA 5AAFA 2XK7A 3KCKA 5L8LA 1VR2A 5AIKA 3BHYA 3UG1A 3W0OA 4GUEA 4L45A 2YDJA 3QRUA 4IQ6A 3UNKA 3UTOA 2AQXA 3C50A 4EONA 2O63A 2X2KA 2QG5A 3MY5A 2B1PA 4CT2A 2FH9A 4BCFA 4ARKA 3ALNA 4YSJA 1Q61A 5CXHA 4FZ7A 4XG3A 1XH8A 2QLQA 4XEYA 2REIA 4WRSA 3LFCA 4CLIA 3MH1A 3T9TA 4O86A 4IE9A 2OXXA 2X39A 3UC4A 3SG8A 2PULA 4CD0A 3FQHA 4WRGA 3RVGA 5J1WA 4USEA 2G2FA 2Q0NA 3Q2JA 3BELA 4AXCA 3MV5A 1XBCA 4CLJA 3A99A 2HOGA 5CU2A 3TNWA 3NUNA 4AA0A 1B39A 4L7FA 5F9EA 4O96A 5C4KA 3FY2A 1GIJA 2QOHA 4FYOA 4FIEA 4O91A 5DN3A 1ST4A 3R21A 3ORIA 2UZVA 2OIBA 5JSMA 4OR5A 2Y4PA 3QUDA 4I4EA 5CEIA 3VN9A 4EOSA 4C36A 4F63A 5IEVA 5IQAA 5IQCA 5HO7A 5CSHA 3LXLA 3F69A 2JGZA 5ETAA 3OT3A 4I5MA 4XV9A 2BALA 5DOSA 5D7AA 4IWPA 1IA8A 3GOKA 3C4XA 4AW0A 1ZARA 2GHGA 1O6YA 2Z7LA 3I0OA 3POOA 4FVPA 4KIPA 4C58A 3LFAA 2B9JA 4EQCA 4GG5A 4FOCA 4G9RA 2FSLX 4MYGA 3ZTXA 4AXAA 4CCBA 5KNJA 1ND4A 4FKUA 3ZFYA 2BIKB 3E8NA 5LVLA 2W1IA 1FVVA 1Q8YA 3MIYA 3P7AA 4FNZA 4M0YA 4TY1A 4YGAA 4O7VA 5GJFA 4ZJVA 1UWHA 3DTCA 4JIAA 1OKVA 4IAYA 3LCTA 5L2TA 1APME 5DNRA 3RHXA 2VWYA 5AA8A 2XARA 3IOKA 3AC1A 3CLYA 1ZZ2A 2QOLA 3MPTA 3KN5A 5FP6A 4IWQA 4IAZA 1KUTA 4CVAA 1YWNA 3F2NA 2BZKB 3Q96A 3O5AA 4YSMA 3SA0A 1KE6A 3VVHA 5KKRC 1M7QA 3OCBA 1IAHA 4LRJA 1MQBA 4V05A 2BR1A 2CCIA 2YIWA 3R8VA 4E4MA 4ZZNA 4KSPA 2GCDA 4O4DA 4M67A 3SXRA 5DH3A 4YUQA 1J1BA 4GEOA 3RK9A 2YAAA 4QT1A 3QD3A 4G3GA 5J7HA 2ZV2A 2ITUA 3EQBA 2P2IA 4YC6A 4APPA 2WQNA 5EI8A 4GK3A 4HZRA 3MVMA 4PMPA 4I0RA 2YM4A 1LPUA 4FTRA 4MEDA 3KB7A 3QX2A 3O8PA 3QAME 5HTCA 4QYYA 4QP8A 4TYJA 4GFMA 3NCZA 4IWDA 3UDBA 4IH8A 3ZUUA 3DK7A 1OL5A 4PP7A 2X9EA 5FBNC 2X4FA 2YM5A 5ACBC 3DJ5A 5I4NA 3EQRA 5D12A 1XQZA 1UU3A 3QTRA 4XRLA 5AUZA 3I7CA 4ZJIA 3VIDA 3LMHA 3KRXA 3NNVA 3KVWA 4LMUA 4RJ8A 5AX9A 3E92A 4E3CA 5DIAA 3LXPA 3TI1A 3OY1A 3UODA 5E8ZA 2ESMA 4C38A 4I0TA 1KWPA 5CI7A 3K3JA 1QPCA 1YRPA 2RKUA 4RIYB 2EU9A 5CEKA 3QGYA 3K5VA 3NRMA 5HESA 2RFSA 4WHZA 4QTEA 5KHXA 4XP3A 1LR4A 4M12A 4FTIA 5JGAA 2UW4A 1U4DA 3DDPA 1GZ8A 3Q4TA 2BRNA 3QKKA 4HYSA 4QMSA 3UMWA 3OTUA 2CMWA 2ETRA 3F61A 5IQGA 4LOQA 1G3NA 3V5JA 3WZKA 3D2IA 4NWMA 5H8BA 3ZUTA 3VS1A 2BRHA 4DBNA 5AUTA 2BHEA 3SX9A 2O2UA 2FSMX 4I41A 2HW7A 5BNJA 2E9PA 3NNXA 4PV0A 3AT4A 1TZDA 3AC2A 2W4OA 3NW7A 3S4QA 2E2BA 3C5UA 1YQJA 3KRWA 4IVDA 3OHTA 2GDOA 4B99A 4DEBA 2Z8CA 4M7IA 4FTKA 4MNFA 5J8IA 3R7EA 2XH5A 3WBLA 2C47A 3UMXA 5JFXA 2ETMA 2XA4A 3DS6A 3LM5A 1YXSA 2GMXA 2IPXA 1FVTA 2BPMA 4OTRA 1SMHA 1AGWA 4GMYA 3UPXA 3GOPA 4BWPA 3POZA 5FUTA 4U81A 4DG2E 3F7ZA 4YU2A 1OI9A 3FE3A 4E1ZA 2C5XA 2EUFB 3GCQA 4A7CA 2VTTA 2WELA 3Q4UA 4BGQA 1OL6A 3MFSA 4EQMA 4BY9E 2UZDA 4IVAA 4WG3A 3G6HA 3HMIA 4NKAA 3WZDA 5HVKA 2GNLA 3SD0A 4MF1A 3ATTA 2CPKE 5I9ZA 3N9XA 2KULA 2E9NA 4E26A 2XYNA 4GSBA 5L4QA 1H8FA 1W7HA 1J7UA 2C6KA 4PDOA 2QD9A 5CAQA 1TVOA 4RWLA 4U42A 2Q83A 1TQPA 2I0YA 5EYCA 2PVKA 4ONAA 4QD6A 3RM6A 3W2PA 2VO7A 5IEXA 3BU5A 3O17A 1OMWA 1PMNA 3EL8A 3NDMA 1JPAA 4O0SA 3W0QA 3ROCA 5ANKA 2UW5A 4JRNA 5KX8A 5AR2A 4KBKA 2BRGA 3HVCA 3H30A 4FTLA 5JGBA 1OKYA 4F99A 4NL0A 4FKGA 4B8MA 2X0PA 1B6CB 2V7AA 4C7TA 1Z57A 4APCA 3TNHA 3COIA 3EFLA 3L9LA 2VTIA 4R7IA 5CS6A 5HIEA 3W0MA 4BDAA 3ATSA 5DHJA 4FTMA 2JDVA 2R3FA 4EH8A 3JS2A 5L2IA 5JH6A 3E7VA 4DTBA 3UP2A 1MP8A 3VUDA 2C5NA 4YPSA 4YNEA 3BE9A 4JDHA 4DFLA 4QMTA 4QOXA 3ZEPA 1YI4A 3VS5A 2CN5A 3ZO1A 2R7BA 3KFAA 1UNGA 5EOBA 3SDJA 2J0IA 3FJQE 4JS8A 1PXIA 4Q5EA 3R30A 3VBWA 1CTPE 5EDPA 2C6DA 3ETAA 3MY0A 3SHEA 5IQIA 1PXMA 2NRYA 4N57A 2XB7A 4Q5HA 3PXYA 3V8SA 2WGJA 1KE9A 2VTJA 4ZSJA 5IKWA 1J1CA 5C26A 3F5PA 3QQUA 2E9VA 1NY3A 2OZAB 3QQKA 1TFFA 5HU3A 4EWQA 3GC9A 4FV8A 5JZJA 2QR7A 2W96B 3C4ZA 4Y95A 3TACA 4MXCA 2ITVA 3HAVA 3CEKA 4O7YA 2BAQA 3UIBA 3C4EA 3KXZA 3TJDA 3QD0A 4WBOA 3PUPA 1OBGA 2YIQA 4RIXB 4O4FA 4U8ZA 4D0XA 3ULZA 4NTTA 3FLQA 3AD4A 3D4QA 4YO6A 1GZKA 2XCHA 3EFWA 5DLSA 4BDKA 3QD4A 3HAMA 3NFGB 3DKCA 3NWWA 3N51A 2XK6A 4D9TA 4I0SA 4EHZA 5LCJA 4I22A 2AYPA 2W4JA 4WD5A 5J79A 4WNKA 2QU5A 5CZHA 4AG8A 2QHMA 1Y8GA 2DS1A 3FKNA 3AKLA 3OUNB 4DTKA 4FTQA 3W16A 3FI8A 2HWPA 4ZTMA 3PPJA 3EKKA 4G5PA 3IDPA 4R7HA 3AQVA 2J51A 2YDIA 2FB8A 2B9FA 2O0UA 1SVHA 5LVMA 3QALE 4ANBA 2JBOA 4FYNA 3TEIA 3QZGA 2QNJA 4A06A 1F0QA 4WNOA 4QTCA 5T3QA 2YHVA 4R3RA 3KXHA 4JDKA 4MBLA 4ACHA 3IW5A 1Q5KA 2O3PA 3OXIA 4ZK5A 1QPDA 5D11A 3HV4A 3I0QA 4UMPA 3OP5A 4GW8A 3GCPA 1DI9A 4CXAA 4QP2A 1Y6BA 2YA9A 1CKJA 1Q62A 2OK1A 3ANQA 3DCVA 3R2YA 4W4VA 2WTJA 4XMOA 5M4FA 5C8NA 2YCFA 3MW1A 5G6VA 4U6RA 2XNOA 4USDA 4DFXE 5HLWA 4OGRA 1Y91A 2F2CB 3EQHA 5K0KA 2X81A 1GZNA 4C62A 3CD3A 3OWJA 3E88A 3C4WA 3P0MA 2E9UA 4YC3A 3DBQA 3ORTA 3TIYA 3UOLA 2X9FA 4TYIA 3ANRA 1FGIA 4QTBA 4O7RA 1BX6A 4YTFA 2Y4IC 4BDCA 1O6LA 2V55A 4IVCA 4BC6A 4EQUA 4ALWA 5CVGA 2FSTX 3DOGA 1YOLA 2X7GA 4F9CA 3PPKA 4RFZA 4ZP5A 4PQNA 4QNAA 2FSOX 2HY0A 4E5WA 3GCUA 5K5NA 3RPYA 2JITA 2UZOA 2VAGA 3MVJA 3IW6A 1ZWSA 3PG3A 1KSWA 3C7QA 4FUXA 3ZRKA 2XNGA 4F0GA 4CFWA 4X2GA 4NZWB 3MH2A 4E4LA 5BVFA 4ZSLA 2BVAA 4J8NA 5IDPA 4O7LA 4QMYA 4AWIA 3HUCA 4DFBA 4EYMA 4AN2A 2JKQA 2WMXA 1XR1A 3SG9A 4BCOA 2XJ1A 2BZJA 3A4OX 3RAHA 4YTHA 3OOGA 2EXEA 2A19B 3V6RA 2BFXA 4M68A 1DI8A 3ML1A 5M06A 2PY3A 3MTFA 3AOXA 4FTAA 4IHPA 2PVRA 3TUDA 3PJCA 1AQ1A 4O2ZA 2WB8A 4II5A 5DT0A 5GHVA 3TNPC 4BKJA 3LAUA 3CQUA 4MXAA 4TYEA 4EBVA 5AV4A 5IH6A 3HDNA 5L2WA 1BI8A 4FKTA 5GJDA 5DBXA 3BIZA 4BDHA 2CGVA 3SOAA 4DGGA 1IA9A 2Z02A 3HV5A 4OT5A 4FVRA 3V5LA 4QMXA 1NT2A 5ITAA 4R77A 4G6LA 1ZRZA 5J95A 4EJ7A 4PL3A 3R1NA 1IASA 1KOAA 4FSUA 2WMQA 1GNGA 2RGPA 5AJQA 4AS0A 3O2MA 5CF5A 3RPOA 3JR1A 3EYGA 5HQ0A 4JIKA 2VO6A 4LG4A 4IB3A 2YWVA 4ZSAA 5CZIA 3PE1A 4I6FA 2J7TA 3QC4A 4R3PA 4S34A 4U97A 4FJVA 5M4UA 3UC3A 3PFYA 3FYJX 5C8MA 5LVOA 2PZPA 3ZC6A 3QL8A 3GQLA 5K4IA 4C4HA 3JY0A 3ZM4A 4JQ7A 4EOMA