5KMOA

Trka jm-kinase with 1-(2-methyl-4-phenyl-pyrimidin-5-yl)-3-(2-pyridyl)urea
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
298
structure length
291
Chain Sequence
ACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of nonactive site, TrkA-selective kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords High affinity nerve growth factor receptor
total genus 86
structure length 291
sequence length 298
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kmoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kmoA01
3DKOA 1ZYJA 3RWPA 3RK7A 4BCNA 4FL1A 3MA6A 3QQGA 2XNPA 3EQGA 3ORXA 3HV7A 3VUKA 3KVWA 4MWHA 2W1EA 1YDRE 5C8MA 4CVAA 4NK9A 4G3GA 4BCOA 1JQHA 4IANA 3ULZA 4EH7A 4IWQA 4AZTA 2XA4A 3PIXA 4KBCA 4JX7A 3MJ2A 2OXYA 4C4FA 3LFSA 4EK8A 3VW8A 4BWPA 1PXPA 4HCUA 1IA8A 2IN6A 2X7OA 3MV5A 4TT7A 4BDKA 4ASZA 2BILB 4XG9A 2ITTA 3FY2A 2VX0A 5B7VA 4XEYA 4MBIA 2HWOA 3UQGA 4FGBA 3FKNA 2J6MA 3LQ8A 2R3FA 4O7ZA 2YABA 4JJRA 4I5HA 2A0CX 3MVLA 4JG8A 4UMPA 3EN4A 3AQVA 3B8RA 1FGKA 5D7AA 3EN7A 3CPBA 3IDCA 2B54A 2ETMA 5HD7A 5KZIA 3TACA 3K5UA 4X3FB 4DLJA 4EBWA 2XNNA 3EKKA 3QZHA 3PG3A 2DS1A 2E9OA 3FDNA 4I0SA 4QMMA 5CS6A 4UZHA 4IFGA 5EW3A 2WTWA 2WXVA 3VBXA 3TTIA 4EKLA 3FZOA 4R3PA 3TIYA 5L8KA 4ZP5A 1W84A 5IA2A 2OW3A 2J0IA 2PTKA 4ERKA 4F0GA 5A4CA 2YIWA 1WMKA 2F2CB 2IW8A 2YLFA 3MH3A 4ERWA 1MRUA 1ZOGA 3Q60A 4O82A 3LFAA 4OAVB 3KKVA 3OTUA 3KY2A 1NT2A 2Q83A 4S2ZA 3R63A 3U55A 4AGCA 2Z02A 1H25A 2O63A 2PE2A 3VF8A 4AE6A 4EHGA 5IQHA 1Z9XA 4MBLA 4AA0A 3TIZA 5B0XA 5HI2A 4ZY6A 5AEPA 3S3IA 4KIQA 5KMOA 4J98A 4S34A 2XRUA 4ARKA 1KOBA 3MPAA 1H28A 5KBRA 4NM7A 2X2MA 5KO1A 1A06A 2QKRA 3PSBA 1HCLA 1M2QA 3OS3A 3R1NA 3R7EA 3BX5A 5EI8A 1OUYA 5IQDA 4QPMA 5K5NA 2UZUE 3P7BA 5KMLA 2QLUA 3SRVA 4L7SA 2W17A 4OTIA 3VUHA 4RJ6A 4CMUA 3DJ5A 4EOOA 3OG7A 3COKA 1GJOA 3RKBA 2WO6A 2VWYA 2YEXA 1XH6A 2V62A 2GPHA 5JZJA 2HWPA 3NUUA 5HX6A 3A7IA 4ZSJA 5I9WA 4XV1A 3FMJA 2C0TA 4MYGA 3RHXA 3FMKA 1JKKA 1YWNA 2GTNA 4TXCA 4WA9A 3G90X 2E9NA 4FKPA 4LV8A 3RK9A 2CGWA 5K9IA 3MVJA 1P5EA 1OVEA 2UW3A 4XG7A 5T3QA 5KMMA 3A7JA 1ZY4A 4CRSA 3NDMA 1OECA 3R7GA 4RWLA 3RZFA 1H1WA 5CZIA 4Z16A 3A61A 3L8SA 5D41A 2RL5A 2F9GA 3Q9YA 2R3PA 3WARA 4FG9A 4DH7A 3DAJA 3ZM4A 2XKDA 4RIYB 3COHA 4M7IA 4BTMA 4YSJA 3V3VA 3MH2A 4IAAA 4I6QA 5EH0A 4AOIA 4IZYA 4RIWB 4BR3A 4M15A 4OT6A 4ZMEA 4J52A 5CAOA 3PZHA 2WTKB 4CT1A 4ANLA 1UU7A 4I21A 3E5AA 4AFEA 4BCHA 1IA9A 3QZFA 2E9UA 3HUBA 2XF0A 4LQMA 4QQJA 3RVGA 1WVWA 4G2FA 2F7EE 5TF9A 4H58A 2Z7RA 3KRRA 4OTWA 3DB8A 3QGYA 2WMSA 3E7OA 5GINE 3HRBA 5I4NA 3ELJA 4XG4A 4I6FA 3PP1A 4KD1A 4IIRA 2ZOQA 3ORIA 5KBQA 3QRKA 3ATSA 3HRCA 3L9PA 4QMVA 3KCKA 3QTRA 4WSYA 3SHEA 3SKCA 4QMXA 3OMVA 2PUUA 4ANNA 1WBNA 1W7HA 1SZMA 4K77A 2GS2A 1KWPA 2VU3A 4BYJA 4HYHA 3BYVA 4PV0A 3R7UA 4ACHA 4FKVA 3MESA 3EQBA 3PJ3A 1PMNA 2XRWA 4FSZA 3A7HA 2JKMA 3PXQA 5ANJA 3KFAA 5KUPA 1XHAA 4D1SA 3OOGA 3QTXA 3PWYA 3F6XA 4H1JA 1KE6A 4PL3A 4QQCA 1FVRA 4RZWA 3SQQA 3O7LD 2FB8A 2WMUA 3D2IA 1B6CB 4L00A 4CTCA 4G3FA 5JRSA 4BHZA 1BYGA 4ZJIA 4D2PA 3KXHA 3MH1A 4V0GA 3OBGA 4UZDA 4BDDA 2VD5A 2WD1A 3D9VA 1PMEA 5K0XA 1LR4A 4DYMA 5DPVA 3Q2JA 3ERKA 4O0XA 1B39A 1IG1A 2ZV8A 3GU6A 3V51A 5M53A 4QMZA 3VJNA 2Y6OA 2RFDA 5K4JA 4N4SA 2QO9A 4O1OA 5IDNA 1H0VA 2VAGA 4IM3A 5E1EA 5LVNA 1UVRA 2A4LA 5EK7A 5L8LA 1GZOA 3QRTA 4O0YA 1IRKA 4C4JA 1JWHA 4ANOA 5AAGA 2ZV7A 3GENA 2IZTA 5L2IA 3EYHA 4IAIA 3V01A 2C5XA 5GJGA 4CKRA 4AAAA 4QYGA 4DFZE 4BDJA 2PE1A 4O7WA 1GNGA 2WB8A 3KN5A 3FZSA 2ITUA 1XH9A 3HZTA 4F9CA 3EL8A 5HBHA 4ACGA 3HMOA 2GFCA 5E8TA 1BUHA 2CSNA 3LM5A 4IZ5A 3UOJA 3SOCA 3ZO3A 2XK6A 2OU7A 4PDOA 3O50A 4EYMA 4DH5A 4YLKA 3CTHA 3DBDA 5E4HA 5CASA 4BKZA 1BL6A 4K18A 4NKAA 2ZMDA 4L01A 2UZTA 3ZOSA 4D4RA 2YM7A 5E92A 3NCGA 2GHLA 3BEAA 3OCSA 5AUYA 4DH8A 4FR4A 5M06A 5KMIA 4HJOA 4IE9A 2XS0A 3LFBA 4E6DA 4GSBA 5FXSA 4G3DA 4DITA 3RM7A 1OKYA 4O0UA 1SNUA 4ZMFA 2WHBA 4QMPA 4IVDA 4C4IA 5E8YA 2R3HA 3B8QA 1H1SA 3BLHA 4C35A 1MQ4A 2UW8A 5DNRA 5EYMA 1Y57A 5CXHA 4FTOA 3ROYA 3SDJA 5FUTA 2QR7A 4DBNA 2WMXA 2G1TA 5H8GA 2VZ6A 2PPQA 4AZVA 3EFJA 5AAFA 4EHEA 2VO3A 1CKPA 2BZHB 4U45A 5L6WL 5DVRA 3V5JA 3VULA 3UQFA 3CD3A 2V0DA 3FPMA 5E91A 3CSVA 3KREA 4QOXA 4PPBA 5HHWA 1L8TA 3FEGA 5TR6A 3GC0A 4GU9A 2VTLA 2F57A 4GS6A 2VWZA 2IZSA 3FSFA 3EQIA 3ZRLA 4BCKA 5LMKC 4FV0A 5DH3A 2YCSA 3PA5A 2VNWA 3VVHA 4K11A 3OWKA 5JQ8A 3BI6A 3W55A 3TV6A 5LVMA 3R8UA 3U87A 3FC1X 2JFLA 1R0PA 3D2KA 2ZM4A 1Y6AA 4DEAA 4DF3A 1U54A 3ZFYA 2WTIA 2VWWA 1JSTA 2PVFA 2CNQA 5AP0A 5IQBA 2REIA 5LCKA 4C33A 4WSQA 4UYNA 4I5PA 4IZ7A 3K54A 3OCGA 4N0SA 5IQIA 4E1ZA 3EMGA 3N4VA 4UMRA 1Z57A 2JBPA 4IQ6A 3LJ1A 2QOHA 3LCTA 3V5QA 1Q61A 4ENXA 1A9UA 4TWCA 2BROA 2W05A 3NNVA 3DK3A 4IM0A 4ZTQA 4FEWA 4D4VA 2YIQA 4Y73A 3FQHA 3WI6A 4A4LA 3RNYA 3LFQA 4BZDA 4F08A 4OT5A 3D15A 4MBJA 2PE0A 3PLSA 5DOSA 2W1IA 5ACBC 4W8EA 4I41A 3WZDA 4FL2A 4KWPA 3A8WA 2C6DA 5ETFA 2O5KA 3KK9A 2PZRA 4FTJA 3WILA 4B8LA 4ITJA 3UZTA 2X7FA 4Q9SA 4CT2A 3EQPA 3QC9A 2YCRA 3COIA 5CU4A 1G5SA 4PMSA 3DBFA 4E5BA 3V8SA 3E3PA 3LFCA 3QHRA 3E62A 3NIEA 5BMMA 5IEYA 3LPBA 1OIUA 2XK4A 3NW7A 4G31A 4M8TA 3FMEA 3R7OA 2QU6A 3VJOA 4Y5HA 4BFMA 4O6LA 1V1KA 3TDVA 2UZWE 3QTUA 1YI6A 3SX9A 3DKCA 5KKRB 4UWCA 1ZZLA 3NNWA 5CNOA 2JDTA 1URWA 4LOOA 4NTSA 5EYDA 3MFUA 5J8IA 4AG8A 4QP1A 3MFTA 1UU9A 5AR5A 4HGLA 4C62A 2JAMA 4A4XA 3C0IA 3EZRA 1H0WA 3K3JA 4X3FA 2QR8A 3BQCA 4YJPA 4GFOA 1H24A 2AUHA 4L43A 4PMMA 2BHEA 5HNGA 2ZDUA 4C38A 4FK3A 5AX3A 3LFDA 2UZEA 4DT9A 2C0IA 4MH7A 4QMNA 4IDVA 2CPKE 2QONA 4CG8A 3CEKA 4S30A 4IVCA 1KE7A 3HAMA 5CAUA 2JGZA 1TVOA 4CZTA 1SVEA 2YAKA 3TKIA 3F69A 3I7BA 3QRUA 4K0YA 5AUVA 3QRIA 5GNKA 5B2KA 5GZ8A 2RKUA 3FI4A 4FG8A 2C6EA 5JFSA 2WMQA 2BRGA 4AOJA 4XOZA 3NYOA 4MEDA 3C4CA 2GNGA 4Y46A 4ZTNA 2EXEA 3ZC5A 4D2RA 3AT4A 4EWHA 1BLXA 2B9FA 3SW7A 3RPRA 5I9XA 4E4LA 2QOQA 1HCKA 3UVRA 3M42A 2CNUA 4XJ0A 3ZYAA 5CU0A 2HCKA 3W18A 4HVHA 3P86A 3ZDIA 5CEPA 2VTSA 3UQCA 3CP9A 4KIKB 2LAVA 5L2TA 4YZ9A 5HBJA 1SVHA 3UZPA 3P08A 4MQ2A 4CQGA 5AX9A 3Q4UA 4OTPA 4I94A 3PXKA 4OUCA 3FHRA 4YC6A 4PL4A 3D5VA 4JXFA 5FG8A 5TKDA 3AXWA 3TZ7A 3RNIA 4RFZA 4YJQA 4E26A 3FZPA 4LYNA 5KX8A 2YJSA 3HYHA 3NNUA 3OP5A 5CI7A 5CU6A 4BIBA 2B9HA 4GKIA 3FY0A 1CDKA 3A60A 4HVDA 4L44A 5JSMA 4EOPA 2PVJA 5KMKA 3ZUTA 1OL1A 5DHJA 5IG1A 2ZYBA 3LE6A 4NM5A 5M08A 4IB1A 5HESA 2OZAB 3UIXA 1STCE 2CKEA 3LVPA 2PZPA 3F88A 2YDKA 3BHTA 2OG8A 2BRHA 3POZA 4Z7GA 2G15A 5DN3A 4AFJA 3CKWA 4ZK5A 3WYYA 4D5HA 3HL7A 4X3FC 3GCPA 4KS8A 1XO2B 5HZNA 3E92A 2R4BA 3ZLWA 5D7VA 1REJA 3FYKX 5HVYA 4FKRA 3RPYA 4OW8A 4JQ7A 3NUYA 3OEZA 4ZLZA 5T6KA 3DV3A 4NWMA 3R8ZA 4RX9A 3NLBA 2JKOA 3KRLA 3F2AA 4J53A 3HP5A 1E1VA 1JKSA 3QZIA 4J99A 3RAKA 3QTZA 2CGUA 3DAEA 5D12A 3UMXA 4YMJA 4HOKA 1VYZA 1R1WA 3GC7A 4LMUA 3PSDA 4RA5A 3AT2A 3TUDA 4LL5A 3H0YA 4EOIA 2ZVAA 4ANSA 1P14A 4ZSGA 4F99A 3DXPA 5CT0A 3OXTA 3V04A 2QOKA 2CKQA 2AC3A 1OKVA 3PXYA 3TXOA 3AT3A 3MFSA 4C58A 4QTEA 5A4TA 5J5SA 5AR7A 3PLAE 1FPUA 2I7QA 3NGAA 3VHKA 1GZNA 1O6YA 3TZMA 3SRVB 5LMKA 3Q04A 1OPLA 4E6CA 3WZJA 3A4OX 4ZTMA 5CAQA 4X2KA 4FE2A 4GUBA 4DGMA 5ITAA 4KSPA 5DT0A 4IX3A 5LJJA 5FD2A 2VWVA 5CI6A 2BTRA 5HG7A 3MIYA 5C27A 2O3PA 3N4TA 2OJFE 3PG1A 3A4PA 3GXLA 4DGLC 2YM8A 3NR9A 2BFYA 2W06A 3HV6A 5HE0A 5AA9A 4BB4A 3TUCA 5E90A 3QZGA 3RM6A 3QLGA 4D55A 2Y4IC 4U6RA 3FHIA 4QMUA 3L8VA 4OBQA 4XCUA 3TG1A 4B99A 2GDOA 3KU2A 3PJ8A 4IVBA 4OTHA 4RVMA 4D1ZA 4FEXA 2BIYA 3FPQA 2XK8A 5KKRC 5BVFA 2IVTA 4F9AA 4AGUA 5EM8A 3C50A 2VRXA 4PX6A 5CU3A 3UOLA 5HLNA 2QNJA 4RBLA 5IQCA 4BRXA 3QD4A 4YO6A 3UC4A 3MI9A 2WFYA 1XH4A 4JBOA 2BKKA 4UV0A 2R0IA 3EFWA 5HKMA 4E7WA 3RJCA 5KE0A 1PXNA 3P1AA 4QYEA 3F3UA 4XUFA 2HW7A 4K8AA 1H07A 3BHYA 2QLQA 4ANBA 4C3FA 2GHMA 3QKMA 3R1SA 4C59A 4D2VA 1KOAA 5CF6A 1JAMA 3VNTA 2VTMA 3T3UA 4GJ2A 3QUDA 3W16A 2W9ZB 2XM8A 3ZSIA 4BCFA 3I5ZA 4G5PA 4RIXA 2J4ZA 2ITNA 5H8EA 4FSQA 3F3ZA 4G17A 4OBPA 2HELA 4GFGA 4NKSA 5F4NA 3RP9A 3ZEPA 1VR2A 5F1ZA 5HE3A 2Y8OA 3GOKA 4L8MA 2IW9A 4RLLA 3S2PA 1ZWSA 4X3JA 4E4XA 3SOAA 5J95A 4IXPA 4EOMA 1ZOEA 5IU2A 3PZEA 5J79A 2PUIA 3NW5A 3ATTA 3HEGA 4I4EA 2XKEA 5EQEA 2RG5A 2YITA 1PXMA 3FMMA 4FZFB 4W8DA 2VWIA 3ZSGA 1ZYCA 4OBOA 4QO9A 4DC2A 4LOQA 4BCMA 3D7TA 1SYKA 4BWKA 2XUUA 5AUWA 5DLSA 3LOKA 4BBEA 5C1QB 3AGMA 4ZTHA 2PSQA 5C01A 4IVAA 3MPMA 1MRYA 2CLXA 2PL0A 5HCYA 4D0XA 4IACA 4FTMA 4RFMA 3W2PA 4A9UA 4O83A 3ORKA 2XJ0A 4JAJA 4AW5A 5EDPA 4NFNA 4UBAA 5FTQA 1BX6A 3NZ0A 3JUHA 1Q3DA 4M13A 4ACMA 3QD3A 4PF4A 4XV9A 5M55A 3EQFA 2NP8A 2W4KA 3EKNA 1ZARA 4PTGA 4YSMA 4R8QA 5HVKA 1IAJA 5IH5A 5L4QA 4JDKA 2BRBA 3DDPA 4A07A 2UZOA 4FKJA 2B52A 3IW8A 4QMTA 5FP5A 1L3RE 5HLPA 3ZMMA 3KL8A 4M69B 4LUEA 4O38A 4TTHB 2R3MA 1IR3A 5H2UA 4YURA 3T8OA 1ZYSA 4EH5A 4EWQA 1O9UA 2C1AA 2EB3A 1PF8A 2PHKA 3GU7A 5CEIA 5B2MA 2ONLA 4MQ1A 1K3AA 3G9LX 3E8CA 3JXWA 2IJMA 3KXXA 3O7LB 4IADA 5AP1A 5IA5A 5TT7A 3DXQA 4H3BA 4F9WA 2OFVA 2UZVA 5I9UA 4RZVA 2GFSA 4ANQA 1X8BA 2A19B 3MVHA 4M66A 2C68A 4YPDA 2WMVA 4HVIA 3ZZEA 2XCHA 4QPSA 5A3XA 3CIKA 3VRZA 2FVDA 4XP3A 4BBMA 4HVGA 4ZJVA 3UPXA 4JG6A 3GB2A 4FUXA 5DR6A 3CY2A 4FZDB 4MXOA 2VGOA 1YOLA 4U80A 4RC4A 4XMOA 2E9VA 1H8FA 3E7VA 4AF3A 3RHKA 5M07A 5BVWA 2JKKA 4JX3A 5BVOA 3E8NA 3VUIA 4GEOA 4UWYA 2XJ2A 3OCBA 3NS9A 3EN5A 2X2KA 1WVXA 3MY1A 3V8TA 3IO7A 4LGDA 5KCVA 3PY3A 1VJYA 4JDJA 4JL9A 3U6HA 5HCXA 5BYLA 1YXVA 1Q99A 2C3IB 3SA0A 5D1JA 2B55A 1H26A 4G1WA 2X7GA 4GYIA 2PVNA 5IUGA 4FNXA 2QOIA 1KE5A 3C5UA 4EC9A 1R3CA 4FKTA 4ZIMA 4GK3A 3PPKA 4BI2A 3W8QA 2XCKA 4FI1A 1UV5A 2XEYA 3R01A 3FJQE 4NCTA 3OY3A 3CTJA 3D83A 2FSOX 3GQLA 4XS2A 3IQ7A 2RF9A 5E8XA 5AR4A 3VUGA 3F82A 4TNDA 3BYSA 4AGDA 4DFLA 5A4LA 1FINA 2UZBA 2VNYA 4WG4A 4MF0A 3DLSA 4TRLA 2C1BA 4F1OA 2UVYA 2BDFA 2P0CA 4O84A 5BVKA 3PRIA 1YWRA 2I0EA 4OR5A 4U7ZA 3PJ2A 2RSVA 2C6TA 4YHTA 4DH3A 5A4QA 1QPCA 1QMZA 1NVSA 2C30A 4BCGA 2BHHA 3R0TA 3MFRA 4QD6A 3QTWA 3GFWA 4FT9A 3DCVA 1JKLA 2J0LA 2JDSA 2BRMA 3JPVA 1H00A 4FT3A 1H27A 2R3IA 3DJ6A 4R5SA 2OJ9A 2YAAA 1DS5A 5HO8A 2BZJA 4PDSA 3CPCA 2XBJA 4PMTA 5TO8A 3R9NA 4HGEA 2GS7A 4ID7A 3ZEWA 3KCFA 4E6AA 2YA9A 3D5UA 4GUEA 4BDIA 3NVMB 3W33A 3NUSA 5GZAA 5JRQA 2ZV2A 3ODZX 3PA4A 3PVWA 1V0PA 4RC3A 1WVYA 3P78A 1JPAA 5HIDA 3H4JA 5FM2A 4E4MA 2GMXA 2XIYA 4FTNA 4EK6A 2F4JA 4YBJA 1M7QA 3OTVA 1YWVA 3QFVA 3LLAA 2QHNA 3KXZA 2JFMA 2IW6A 4YO4A 1H1RA 3LXPA 4TYIA 4YC8A 4EQMA 4HW7A 2V55A 3NUXA 5M44A 2J0KA 4O86A 4PTCA 1ZXEA 5H8BA 1W8CA 3OXIA 4YZMA 4F6SA 4EOQA 3W2QA 3DBEA 4BF2A 2YCFA 2OIDA 2CCHA 3R8PA 4I22A 4L9IA 3TCPA 4QMYA 4LRKA 5IDPA 3CC6A 1YXTA 2BVAA 4NU1A 1RJBA 1B38A 2HIWA 3LFEA 4AN9A 3CQWA 1OIYA 4NM0A 2GSFA 3MWUA 3BRBA 2ITXA 3QQJA 4RJ8A 4S33A 4D5KA 3SG8A 3BPRA 2X4FA 4RWJA 3BCEA 5CVHA 3UGCA 5JKGA 1VEBA 5C4KA 2WU6A 1Q8UA 4FOCA 5GIOE 3QUEA 4W4XA 3R9DA 4DG0E 1KV1A 4FBXA 2YZLA 1AGWA 3DOGA 3EYGA 2UUEA 5DR2A 4EH3A 3UO4A 4DT8A 3ODYX 2O2UA 3SLSA 4RQKA 4FTRA 3KXNA 2EXCX 2R7BA 3R2BA 4EONA 3VRYA 1V0BA 4NIFA 4YZBA 4EZ5A 2J2IB 1GOLA 2RGPA 5BNJA 4UX9A 5GJFA 3SD0A 4C2WA 4ITHA 4ACCA 5HICA 4XV3A 4MTAA 4AW1A 5BPYA 3M11A 4O91A 3UO5A 1GIIA 3MPTA 4YGAA 2R3JA 2WEIA 3U54A 2C3KA 5FXRA 4XV2A 5M4CA 4Y83A 3JVRA 3QKKA 1RQQA 2C6KA 5LMAA 3SXFA 4NW5A 3Q52A 4RJ3A 3TNIA 3C4FA 1J3HA 3C4EA 4KKHA 2XIZA 5FDPA 4MCVA 3ZBFA 5CVFA 5AP5A 2CGVA 3UC3A 1IAHA 4S31A 2CJMA 2PWLA 1LUFA 3IG7A 5CXZA 5DGZA 3SXRA 4FNZA 4BICA 3DFAA 3GT8A 4M0ZA 4I3ZA 4DTKA 2R3LA 3ALNA 3CS9A 3IGGA 2UVZA 5IEVA 3UYSA 2JITA 3EWHA 5HGIA 3KMMA 3ZO1A 3COMA 2OLCA 4GG5A 2W96B 3DS6A 3OHTA 4EUUA 3R8VA 3LW0A 3VS0A 4RLKA 2YM4A 5DWRA 3I1AA 4WUAA 3UMWA 1UNGA 3GVUA 4QQ5A 4R7BA 5I3OA 5CANA 4U41A 3IONA 4FZAB 1FVTA 3AC8A 5IH4A 3QALE 2CKPA 1XH8A 1XJDA 4CGAA 5HBEA 4HYIA 5CSXA 3VBVA 4C36A 3MDYA 5J1VA 4Z7HA 4FICA 2UW4A 2VX3A 1PJKA 4LGGA 1BI7A 4HVSA 1WBPA 4FIEA 2C6IA 2JKQA 4XLIA 3Q96A 4AA5A 4WNMA 4AS0A 3VIDA 3MIAA 1FMOE 4GCJA 3UIMA 3K5VA 4JR7A 5DT3A 3F5PA 4DFYA 3HVCA 4WHZA 3EQRA 3DPKA 1G3NA 5EDQA 4FKGA 3QWJA 4QTDA 4YNEA 5GZ9A 2XH5A 3PY0A 3VS7A 2QKWB 2VTOA 4JBVA 4F1TA 5AWMA 4XLVA 4CFUA 1YDSE 2B1PA 2VWUA 3SAYA 4TYHB 4FSWA 4XH6A 4R1YA 3FXZA 5J9ZA 1OZ1A 1S9JA 3VS4A 4RIYA 3E3BX 3AC5A 3PVBA 4GVJA 4FGRA 3GGFA 1YXSA 4M68A 3QU0A 4MXCA 1SM2A 4FIHA 3TKHA 3QCXA 4D1XA 4U44A 3DLZA 2XVDA 4W9XA 3JVSA 3CJFA 1PYEA 3HV3A 3VBQA 2RIOA 4DLIA 3FKOA 4O7LA 1OKWA 4JG7A 3HMIA 5CY3A 3WF7A 3QYWA 4F0IA 5KHXA 2IG7A 2PYWA 2RFEA 3GOPA 4AQCA 4MF1A 4LOPA 5FTOA 4TYJA 3BGQA 3EB0A 2FSLX 3P23A 4XYFA 4PP7A 1JSVA 3FMHA 5L6PA 3BQRA 4J96A 3KMUA 4ZS0A 3RALA 3SGCA 4L45A 4B0GA 3PPJA 4ZLOA 5CF5A 5HVJA 4DEDA 2UZDA 3F3WA 4ZOGA 1QPEA 4O7RA 3TJCA 2R9SA 3PYYA 1NW1A 4E73A 2C69A 2BCJA 4RT7A 3SG9A 3NMUF 4O21A 1PRYA 4RX7A 4UALA 4H36A 2R3NA 4I24A 5B2LA 2I1MA 2QO7A 3C0HA 4OTDA 4QT1A 3Q9WA 4FTCA 3C4ZA 4MKCA 4H3QA 3FQEA 2JDOA 4TN6A 1PMVA 3DKFA 4QYHA 4EJ7A 1PXIA 3NWWA 3OC1A 3FI8A 3GP0A 3DQXA 3KEXA 4NUSA 3CXWA 3OOMA 4PPAA 4TZRA 3UJGA 4XHKB 2QHMA 3PIZA 4EBVA 4L68A 4P5ZA 3G2FA 5JZNA 4AU8A 4ITIA 4XG3A 3ORTA 2J7TA 3PRFA 2P33A 4GFMA 4TWNA 4CQEA 5JEBA 3H10A 2HYYA 3A62A 3EQCA 4U0IA 1U5QA 5FLFA 2Z7SA 4MWIA 3MYGA 5EI2A 2W1FA 4DG2E 1NXKA 3CKXA 4QYYA 2BZKB 3QBNA 4E4NA 2WTVA 5I9YA 3AD4A 5HLWA 4KAOA 5BYZA 3PA3A 3R8LA 3TEIA 5C26A 4DFUA 4FIJA 3R28A 1ATPE 2X0GA 4H1MA 4JAIA 3AC3A 4CFXA 3Q4ZA 4EYJA 5AR3A 4AW2A 5BQ0A 4MXYA 5CX9A 5HQ0A 1WCCA 3DY7A 1OB3A 4FNYA 1WZYA 3IW5A 3QQUA 4WBOA 4U5JA 2C5VA 1DI8A 5E1SA 3I81A 3H30A 4M67A 5D11A 3RWQA 4O22A 4XOYA 5FXQA 5JGAA 4W4YA 5I9VA 3HKOA 5HORA 4AT4A 3WIKA 1GZKA 4O7YA 2PVLA 2OXDA 3Q2MA 3I4BA 1OBGA 3LMIA 1DM2A 1OPKA 4PDYA 1OL5A 4FYOA 4PWNA 2J5EA 4I93A 2WZJA 4L46A 4IC8A 3S0OA 4E5WA 2C3JA 3FMDA 4WNPA 5IA4A 4QTCA 4FKIA 4EH8A 4HCTA 1ZYLA 4FTKA 2VX1A 3HMNA 5JN2A 4QPAA 4RJ7A 4RX8A 4IX5A 3BV2A 2EU9A 3GFEA 4AT5A 4F4PA 4Z9LA 3HP2A 3TNWA 4BCPA 2QOFA 4AZFA 4FVRA 3KF4A 2PZ5A 3CGOA 3OFMA 5A14A 4FIGA 4C57A 2UW6A 1FQ1B 3LZBA 2QD9A 2EB2A 2PVHA 3RTPA 2HOGA 4YZDA 3BLRA 1J7UA 4NSTA 4QNAA 3VC4A 5HTBA 3P9JA 1R39A 3F5XA 4ZSEA 3FMNA 4UMTA 2QOOA 2WQOA 2HENA 3TL8A 4O0VA 3CLYA 4IMYA 4UB7A 4V05A 2G01A 2XKFA 1Q4LA 2IZUA 4OTFA 2C5NA 3ZU7A 3CGFA 4DH1A 3OWPA 4FMQA 1XBBA 3FMLA 5JFXA 3ANRA 3HUCA 1YXUA 2J50A 4DTAA 5CEQA 3E87A 5AV4A 3GI3A 3PPZA 2WIHA 4JQ8A 4R3CA 3LJ2A 3DBCA 1REKA 3QKLA 3ZO2A 4L3JA 4RQVA 2OF4A 4CLJA 2JDVA 3DGKA 4QP2A 4R78A 5F94A 2QG5A 4WG5A 1OL2A 2FO0A 2OO8X 2W9FB 3BWJA 2FH9A 2WEVA 3QWKA 4R3RA 3BE9A 4J7BA 4ALUA 4XRJA 4KIPA 3NYNA 5AMNA 2X1NA 4EI4A 4QMSA 3TZ8A 4BL1A 5AM7A 3D7ZA 4IWDA 4QNYA 4FSUA 3FAAA 4CCBA 4ZLYA 2H8HA 3QD0A 3DZQA 4WKQA 3F5GA 1PXOA 4YZNA 4X0MA 3VUTA 2C6MA 4J8MA 5EM5A 1XQZA 4AW0A 2IO6A 4FSMA 4AZWA 4D28A 4LFIA 5DBXA 5H3QA 4BKJA 2OJJA 3FLSA 3VS1A 3OROA 4Y85A 1JSUA 2B53A 3BE2A 4GH2A 3LCKA 3Q5ZA 5K4IA 1PXJA 5CQWA 4JT3A 2B9JA 4KIKA 4BDGA 5BVDA 4GKHA 2QI8A 2Z2WA 1U46A 2FYSA 3AOXA 1GY3A 1Q41A 1UKHA 1A48A 4TWPA 4YJNA 3VS3A 3FYJX 3Q4TA 4C2VA 3ENMA 5ETAA 4DCEA 5ANOA 5TE0A 4AXAA 4N70A 1G8AA 4AOTA 2E2BA 3LXLA 5EHLA 1J91A 3BLQA 4EK3A 3D94A 3VS5A 4QP4A 4RJ4A 1FBNA 5HO7A 4FKWA 3RZBA 1OITA 4DN5A 4DTBA 1W98A 1M14A 2OH0E 2ITVA 3FZ1A 4AZSA 4FKSA 3LLTA 4FV3A 2F7ZE 1TQIA 5JFWA 3VS6A 1QPDA 2GTMA 4NZWB 3EL7A 3ENHA 3ORLA 4GL9A 2A2AA 4ZXTA 3NPCA 2BFXA 3T9IA 2C4GA 4ALVA 4IAZA 1UWHA 2WNTA 3Q32A 4FKLA 3N9XA 3MA3A 4YHJA 3VBYA 2BAQA 1PYXA 5K5XA 2YIRA 3TM0A 2XNBA 3SC1A 1YOJA 4PDPA 1J1BA 5FEEA 1XKKA 1LEWA 4BDHA 5M4IA 3KRXA 2FUMA 4Q9ZA 5M09A 4EUTA 5DA3A 2I0HA 2W5HA 3AMAA 4H39A 4N6ZA 3QQFA 3ALOA 2WKMA 1LPUA 3H3CA 2GQGA 4NFMA 3FI2A 4J8NA 5EW8A 5AUXA 5AFVA 4GK4A 5C8KA 4LI5A 3U6IA 4YU2A 2C3LA 2PMIA 5AUZA 2VTJA 4A9YA 5IQAA 1XH7A 5IQFA 2BTSA 3KMWA 3FQSA 3OZ6A 3VAPA 3IPHA 3LQ5A 4RRVA 4ONAA 4CKJA 3V8WA 5C03A 5GHVA 1CM8A 3LCSA 2YZAA 1WBSA 2ERZE 2H9VA 3CTQA 4KIOA 2FA2A 4YPSA 4FV4A 1KE9A 4C37A 4FF8A 5E7RA 3DXNA 4AZEA 2YERA 5IQEA 4UMQA 4BDFA 2R3RA 2DQ7X 3EN6A 3G6HA 4FSYA 4RPVA 1FOTA 2HZIA 2X2LA 4D2TA 2NNWB 5EQYA 4FT5A 3MTLA 4YLJA 2O8YA 3MTFA 1O6LA 4WRSA 2X8EA 1PKGA 3NSZA 3PXZA 2YM5A 2AYPA 3K3IA 4DGNA 2ZAZA 3N51A 4HNIA 4J1RA 2I0VA 5IPJA 3PWDA 1F5QA 4IB3A 5L6OA 1P4OA 2YWVA 1JNKA 4G9RA 5LVOA 5HNIX 3DA6A 3PE2A 2UW9A 4RWKA 2HY0A 1NVRA 4F64A 4UN0C 3ZLXA 2BAJA 5CYIA 2ITQA 3OBJA 5FEDA 5A54A 5ANEA 2I40A 4O1PA 4FX3A 2YM6A 3KQ7A 4USEA 3R71A 2XP2A 2B0QA 1QPJA 4IAKA 5AIKA 3CQUA 3DB6A 3E88A 4JS8A 2Y9QA 3UTOA 3BU6A 4EEVA 1RW8A 3NIZA 2XMYA 2XJ1A 3FLYA 4G6NA 2JDRA 3HDNA 3G0FA 2GNFA 3ETAA 3LHJA 5FRIA 3DK6A 4D2SA 3R22A 5J5TA 1OM1A 2ERKA 3QTSA 3EH9A 3ZZWA 4D4YA 4C7TA 4P4CA 2WQEA 4F7NA 3KK8A 1YXXA 5I5ZA 1OGUA 1ZYDA 2BAKA 2B7AA 2OFUA 4GU6A 4BTFA 2W1GA 3VHEA 5A4EA 2ACXA 5J1WA 2XNOA 3LXKA 3DBQA 5KZ0A 4USFA 2XZSA 3D4QA 4LV5A 3CQEA 4RX5A 5KMJA 4S32A 4GK2A 3MB6A 1WBWA 4DFNA 1URCA 1BKXA 2P4IA 1KUTA 2XYUA 4XBUA 1OPJA 3H9FA 3L8PA 4MNEA 3UIBA 2WQMA 4DBXA 3G6GA 3A99A 1SVGA 5AADA 4ACDA 2J9MA 5IEXA 3TDWA 4O7SA 5AR2A 2JIUA 2PZYA 4JR3A 5E8UA 1SNXA 4HGSA 5AV0A 4ASXA 4ZZOA 4EQUA 4O2PA 3JY0A 2CN8A 5ACKA 2WQBA 2JIVA 1Q8TA 3MS9A 3N4UA 3E8EA 5DRDA 1HOWA 3C0GA 3DTCA 4O0SA 1M52A 4B4LA 4RJ5A 4FV5A 2JC6A 4MX9A 1R78A 1Q8YA 4O27B 4RGJA 2OZOA 3I7CA 5EFQA 4NIFB 4IX4A 4I4FA 3WZKA 4A9RA 3OWLA 2J51A 4CYIA 1YQJA 4TL0A 4EOLA 2XNMA 4LRMA 2OSCA 2YLEA 5DYJA 4FK6A 1Q5KA 2ESMA 5G6VA 3TNHA 3NW6A 3TNQB 1NVQA 4FTTA 3ZXTA 4QMOA 4UY9A 3F3VA 4FL3A 3NRMA 1PW2A 3AMBA 4MNFA 3ZDUA 4R6VA 4ZY4A 3DNEA 2PZIA 5CAPA 3D14A 5L2SA 2O0UA 3NVKI 2CLQA 1TQMA 3FV8A 4USDA 2P55A 4DG3E 2OICA 2X6DA 2HZ4A 3UG2A 3ZFXA 4F0FA 3UVQA 5LQFA 2W1CA 3EFLA 4D9TA 4YTCA 5HIEA 5J9LA 4NL0A 2PVKA 1CKJA 4NW6A 3C4XA 1R0EA 1YI4A 3ZONA 3L1SA 4CLIA 4CZYB 4RC2A 4EH2A 4X2FA 4B8MA 2OBJA 2WOTA 4K2RA 5CAVA 3VO3A 5HIBA 3WF6A 4C02A 3OVVA 5KHWA 2ITOA 4K9YA 5EKOA 4L7FA 1GIJA 5AM6A 3R1QA 4ZZMA 4HZRA 3NAYA 2J0MB 4RFYA 3R9RA 2W0JA 3CCNA 2RG6A 5CSVA 4FVQA 4BCJA 1FMKA 2Z60A 5CZHA 5I3RA 2BIKB 3W10A 3PXRA 1OIRA 5FGKA 2RFSA 5M4UA 4WG3A 2OK1A 4ASEA 5EQPA 4GVAA 3UBDA 3GC8A 5EI6A 4GMYA 3FZRA 4HPTE 4FV6A 4FUYA 3OW4A 5ANGA 2FGIA 3II5A 3OF0A 5DRBA 3OW3A 5BUJA 4WIHA 3E63A 3NEWA 4EK5A 1Y91A 2OF2A 3NX8A 5JMSA 1H1QA 4KNBA 1UNHA 3EQHA 3SVVA 4PPCA 2EXMA 3RPVA 4EORA 1ND4A 2VGPA 2ZM1A 3IOKA 4R1VA 5EG3A 4U43A 3G33A 4Y95A 1K9AA 4KBAA 4LG4A 2CCIA 1Q62A 1ZMUA 3RBWA 3W8LA 3A7FA 3MH0A 5IA0A 4EOJA 4TWOA 4RVTA 4YJUA 4BDEA 3UNJA 3IW7A 3W2SA 3AC2A 3FL4A 3WIGA 5AIRA 4MD7E 3BYUA 4FIIA 4B9DA 5LOHA 4BI0A 2WU7A 1JBPE 4IX6A 3HMMA 4NT4A 3V6RA 4QP6A 5E8SA 4EZ3A 3OUNB 3TV7A 3ACJA 3I6WA 3MJ1A 4Q5HA 3GUBA 5A6OA 5M51A 2OIQA 3EJ1A 2Q0BA 2W5AA 4YBKA 2VN9A 5IZFA 1E1XA 1Y6BA 2WAJA 2XIKA 1YHWA 2F7XE 4BBFA 2KTYA 4BGQA 1BMKA 5CEKA 4TY1A 2PULA 5BYYA 4E8AA 1JOWB 2WMAA 3WE8A 2SRCA 4MXZA 3HAVA 3BELA 2CHLA 3C4WA 4FODA 2BDJA 4U97A 2W7XA 5FQDC 2Z8CA 2BUJA 4BTJA 2I0YA 4U3YA 4L67A 3GEQA 4JIAA 4N6YA 2C5OA 1OKZA 3KGAA 4UXLA 1WFCA 4QTBA 1MUOA 2F2UA 3KULA 4V04A 1PXLA 3QL8A 4C4HA 3Q53A 4I0TA 5E8VA 3JY9A 1XH5A 1RE8A 1OI9A 5EHOA 3QC4A 4K33A 1S9IA 2WELA 2X9EA 3G15A 4FKUA 3TJDA 3R83A 2DYLA 3LAUA 3ID6C 2VV9A 4IJPA 4M69A 5IQGA 3BYMA 4Q5EA 3FC2A 4R5YA 3GCSA 1FVVA 5IUIA 2HAKA 1CSNA 2R7IA 5CF8A 2VTPA 5J7HA 4BDCA 4YJTA 3PUPA 2CNVA 4IAFA 5E9EA 3F5UA 2OWBA 3QCQA 4G3EA 5FWKK 4Z3VA 4U42A 4M12A 4KSQA 5ANIA 5KNJA 2PVMA 1ZMVA 4WD5A 2VO6A 4DEGA 5C8NA 4ZSLA 4ALWA 3MB7A 4YHFA 1CMKE 1RDQE 2Z7QA 4P2KA 5F9EA 4F6UA 1SMHA 2CKOA 4YJOA 1PMUA 3EOCA 4FTIA 3ZFMA 2YFXA 2QOBA 4X2NA 4BGGA 1OBDA 3PDTA 4FZ6A 4UMUA 3WZEA 3GQIA 4MD8E 5AV2A 3WBLA 2WTDA 3GCUA 3IGOA 4KINA 2PUPA 4NJ3A 3WOWA 2OIBA 4NTTA 5A6NA 4P7EA 3UVPA 1UWJA 4R77A 4E93A 3AD6A 4O0TA 3GU8A 4DCAA 4C4EA 1XBAA 2C6OA 3BBWA 3OT3A 4YJRA 3ORMA 5DE2A 4F7JA 5LVPA 5LWNA 3UYTA 4FG7A 3QX4A 2X39A 3T9TA 4KRCA 3NYVA 4O96A 1ERKA 4L6QA 4A9TA 4E3CA 3F7WA 4CSVA 2XK9A 1Z5MA 2ITYA 4FV9A 4O6EA 1V0OA 3DZOA 3ZH8A 3HX4A 3LFNA 3NYXA 4AWIA 3W2RA 5CSHA 2BKZA 4OTQA 3QD2B 3HA6A 2ZM3A 3FBVA 3P7AA 4L3PA 4G6OA 4FEQA 5AP7A 2GQRA 1KV2A 2UW5A 2O64A 3DJ7A 4NEUA 4JI9A 2CGXA 2PY3A 4J95A 1ZLTA 3HGKA 4FT7A 5JK3A 4YTIA 3DU8A 4HYSA 5E8ZA 4YR8A 3C9WA 3QA0A 3Q9XA 4CV9A 4D58A 3MBLA 3QGWA 4WUNA 5M57A 2PU8A 5H9BA 1Y8YA 3G5DA 3NCZA 3UPZA 4FNWA 3KN6A 3D5WA 4ZAUA 5A9UA 1APME 3UNKA 4YJSA 3FL5A 4FSRA 2J0JA 2ZDTA 2O65A 2DUVA 5AJQA 4JDHA 2C0OA 3BBTB 5HNBA 4CYJA 5LCJA 3JS2A 4XRLA 5M56A 1YHVA 5LWMA 5ETIA 3KULB 3TI1A 2BALA 4BIEA 2ZV9A 3BYOA 4BKYA 4EK4A 2H6DA 5EM6A 2B4SB 5IUHA 2HK5A 4N57A 3I79A 3QYZA 1ZRZA 2XEZA 3L9NA 2IZRA 1M2RA 5EYCA 1GAGA 2PUNA 3RAIA 5LARA 1CKIA 1M7NA 4WO5A 5IKWA 3D0EA 4K6ZA 4RIXB 2P2IA 3ZBXA 3FLZA 4BDAA 4DEIA 4CFNA 4BZOA 2XM9A 4QMQA 1QL6A 4BWXA 1PY5A 2PMLX 2OXXA 3Q6UA 4OTGA 2Y6MA 4BCQA 3CY3A 3W1FA 4II5A 4F7SA 2VO7A 4CZUA 1UNLA 4EQCA 1J1CA 2NRYA 4FV1A 4K1BA 3ZTXA 3ZM9A 3GCQA 3QLFA 3NUPA 4EC8A 2BMCA 1XBCA 3H9OA 4IC7A 2C6LA 2JEDA 4O0RA 4OTRA 5HX8A 4C3PA 3M1SA 3Q9ZA 4ZZNA 3R6XA 3TUBA 2GU8A 5BUIA 5AP6A 3F7ZA 4O7TA 1DAYA 3IK3A 4G9CA 3RCDA 3F3TA 3VUDA 2X6EA 2X8DA 4P5QA 5IH6A 4ZS4A 2WMRA 1JKTA 4EHZA 3Q6WA 4RSSA 3PIYA 4GG7A 3I60A 4DE4A 1DAWA 2NO3A 4YNOA 3E93A 3ZC6A 4I0RA 3ZHPC 5HCZA 4ZY5A 3LKMA 2WTKC 5DEYA 5EDRA 2B9IA 4BIDA 3U9NA 4D0WA 5AUUA 4FC0A 2ETKA 3V5LA 5HU3A 3FXWA 2VO0A 4ORKA 4TYEA 4G3CA 3FKLA 3QF9A 4IWPA 1P4FA 4RWIA 4XBRA 4ZSAA 3Q3BA 5AV3A 4FSTA 4HCVA 2YACA 2UZNA 4U3ZA 1MRVA 2NPQA 5JH6A 4C34A 3JR1A 3BU3A 4HYUA 5FEQA 3THBA 3FWQA 4KA3A 4CV8A 5J87A 2XKCA 4WT6A 5G1XA 3E64A 3C1XA 4PUZA 3EZVA 3R02A 3UIUA 4G5JA 1I09A 3AMYA 3BEGA 2OH4A 4IFCA 5HG8A 4BCIA 1J7IA 2X81A 3QTQA 4NM3A 2GNIA 4EH9A 3DFCB 2YCQA 4GIHA 2QO2A 5ANKA 5FBOA 4AUAA 3LCOA 4FKQA 5FDXA 5BVNA 4MAOA 1T45A 3NUNA 5GIPE 3HRFA 3G0EA 3QCYA 4HNFA 5FM3A 3RINA 3G9NA 2ITPA 3R73A 4CTBA 4E5AX 1O6KA 3GU5A 3KRJA 4TYGA 4PQNA 3TT0A 2PMOX 2YDJA 2PVYA 4I20A 2J5FA 2YIYA 3P7CA 5D9HA 3BHVA 3TN8A 3V6SA 1UKIA 3IW6A 3C13A 4ZTRA 4GJ3A 5AAEA 4O7VA 3ZUVA 3FSKA 3ACKA 3O0GA 4JBQA 5BVEA 3RPSA 3QUPA 3A2CA 3F2RA 1MQBA 4HPUE 4IWOA 4DAWA 3LM0A 3W2CA 1F0QA 4KKEA 3BKBA 3DT1A 3OWJA 3TWJA 3U9CA 3IS5A 2EWAA 3B2WA 1WBVA 3PP0A 4DEEA 2GS6A 5JFVA 3R30A 1GZ8A 4KUJA 4QRCA 1JVPP 4M84A 4XP2A 5DT4A 5HG5A 2OGVA 3R7YA 3S4QA 5CEMA 4F9BA 1MP8A 5HE2A 1LP4A 1YI3A 1U54B 3HV4A 1YDTE 3OT8A 4OGRA 4PNKA 3F66A 3VBWA 3PVGA 2GNHA 2R2PA 2CDZA 3OD6X 4WNOA 4GT3A 4IM2A 4KKGA 4L42A 3PJCA 4O2ZA 3ZLSA 1NY3A 3QQHA 4JDIA 2HW6A 4JIKA 4L53A 5DMZA 3RK5A 4PP9A 4G16A 3VBTA 2ETRA 4I92A 2XNGA 3FZTA 2R3QA 3F9NA 3QTIA 5EM7A 5E8WA 4XNEA 3RPOA 3OXZA 5EYKA 2YN8A 3K2LA 4CXAA 1Q8ZA 5LVLA 4MNEB 2R5TA 1Y8GA 1ZMWA 4NJDA 4Q2AA 4FSNA 5F95A 5DR9A 4U40A 4M3QA 3ORZA 4FZ7A 1PKDA 2R3OA 4BZNA 2W1DA 4IH8A 4MVFA 5JQ5A 3O51A 2LGCA 2ZB1A 2X9FA 3OY1A 4FV2A 4IW0A 3ORPA 5DFPA 1H4LA 2R3GA 3QRJA 1ZOHA 2ITZA 2X8IA 3IKAA 3PY1A 4A06A 4L3LA 5DG5A 4D4SA 3CR0A 3IDBA 1UA2A 2G2IA 2QCSA 2WMWA 3V5WA 3HMPA 3VQUA 4Y72A 4CD0A 4TYHA 4X2JA 3R9OA 3UP2A 3WE4A 3MGYA 3R21A 4NH1A 1DI9A 5A46A 2HXLA 2HZ0A 2UW0A 4I6BA 5AP3A 3MY0A 2VTIA 4FVPA 1Q24A 3FE3A 3JYAA 3ET7A 3F61A 1YVJA 4BVUA 3P0MA 2G2FA 2C47A 1W83A 4RMZA 2H34A 3RCJA 5HD4A 2J90A 2BRNA 3G51A 4PMPA 4U81A 4I1ZA 3W32A 3R2YA 5DIAA 3QX2A 1KE8A 1U59A 2W1HA 3AC4A 3PXFA 3LXNA 3DNDA 4FTQA 5AV1A 4AA4A 4EOKA 4X21A 4J97A 2WQNA 5CLPA 3VUMA 4RG0A 2UVXA 3DAKA 4AACA 1FGIA 2I6LA 3R9HA 3QXPA 2VTQA 3R00A 5KMNA 1XWSA 4LMNA 4X7QA 4U8ZA 2QODA 3HDMA 2WMBA 4CCUA 2NRUA 2E9PA 4YUQA 3UOHA 2VTAA 4GT4A 5HU9A 4ASDA 5CF4A 2BR1A 1EH4A 3TV4A 4A4OA 3KA0A 5IISA 4YLLA 2AC5A 3NNXA 4C4GA 4BTKA 4AP7A 4L52A 2V5QA 4AE9A 4D2WA 5BMSA 4F65A 4ZEGA 4H3PA 4XG8A 5EW9A 4FOBA 3GU4A 4M97A 4R7HA 1CTPE 3QCSA 3PE1A 4RVLA 4ZJJA 4LL0A 3TTJA 2GQSA 4DEHA 4JQEA 5IA3A 5ANDA 4ZTLA 4DA5A 3V5PA 3PSCA 3DTWA 4EJNA 2FSTX 2PVRA 3RI1A 4CRLA 4DHFA 4IJ9A 4EH6A 2VWBA 3O96A 4CFWA 2VTRA 3I6UA 4UWBA 3WF9A 4QYFA 4CFMA 4U9AA 2IPXA 2P3GX 3LIJA 5L3AA 3BGZA 4MXXA 3OEFX 4AN3A 4FEVA 4Y8DA 1W82A 3O8PA 3S00A 5IMXA 2FSMX 5HG9A 1KSWA 2QU5A 3AGLA 3L9MA 2YHVA 4QP8A 1OL6A 4KB8A 3R7IA 3REPA 3A8XA 5FTGA 5C9CA 1VYWA 3AG9A 3PFQA 2QVSE 2R3KA 4J71A 5HEZA 3V5TA 3ZS5A 4ENYA 3ZLYA 4JLCA 4D9UA 5DEWA 4FKOA 3AD5A 2JD5A 3SW4A 4EH4A 4DINA 4JBPA 2YIXA 4E6QA 2BDWA 5L8JA 4APPA 4FV7A 3PVUA 4XG6A 4I5CA 5C4LA 3QA8A 3EFKA 5AUTA 3MY5A 3CD8A 3C7QA 2KULA 1Q97A 2YISA 2IVVA 4B7TA 4MD9E 4B6LA 1OUKA 3LFFA 1OMWA 4BHNA 4YJVA 3Q4CA 3U4UA 2W4OA 4O7NA 1BI8A 4C0TA 2HXQA 5JGBA 1YW2A 4XG2A 4RIWA 3OUKA 2YDIA 3VW6A 4W9WA 2A27A 1G8SA 3VN9A 4F9YA 3VF9A 1TKIA 3ZRMA 4H05A 1YRPA 2VWXA 4TW9A 3FXXA 4O0WA 3WF8A 3U8WA 2XB7A 3P4KA 4P90A 4X6RA 1M17A 3RMFA 3TKUA 3TNPC 4M0YA 3S95A 2IVUA 4LGHA 4MXAA 1AQ1A 4BDBA 4DFXE 3BIZA 4JOAA 2OKRA 3UODA 2XYNA 5AP2A 3FI3A 4MK0A 2EVAA 3UNZA 3ZRKA 4GV1A 4F70A 1E9HA 4KRDA 2VTNA 4YTFA 1P2AA 1Q3WA 2Y4PA 3O23A 4I5MA 3QXOA 1W0XC 3DQWA 2QOCA 5M4FA 4WBBB 3WF5A 5CSPA 5ICPA 5EKNA 5HTIA 4R7IA 4WNKA 3GBZA 3UOKA 5AR8A 3TZ9A 2PMNX 5FBNC 4AT3A 2QC6A 4V0GB 1Q8WA 3D7TB 4KBKA 4F1MA 5IF1A 3BZ3A 3OCTA 3EN9A 4JVGA 1IASA 3MW1A 4BI1A 4ZTSA 2G2HA 3VWAA 4I23A 2Y4IB 2OJIA 1JLUE 2Y0AA 4X2GA 3ZO4A 4AX8A 5J7BA 1ZAOA 5CSWA 4WOVA 2VUWA 3BHUA 2A1AB 1PHKA 4IBMA 4KS7A 1M2PA 4GIIA 5DI1A 1H01A 5CT7A 3BV3A 4BN1A 3LMGA 3KF7A 4YTHA 3EIDA 5EOLA 2WTCA 3ZCLA 4RA4A 3UE4A 2V22A 3KXMA 3MVMA 3ZSHA 4C8BA 4GW8A 4PTEA 4GYGA 3RAWA 1YOMA 5AA8A 2RFNA 2XK3A 3FLQA 1NA7A 3ITZA 4F09A 2ZB0A 3HV5A 2YWPA 2ZMCA 3CBLA 3R1YA 4JRNA 3I0OA 4E20A 3F2NA 3L9LA 4EKKA 2XIXA 3HNGA 4GRBA 4QP7A 4U79A 5EHYA 2ZJWA 3UG1A 4FTAA 2HY81 4XP0A 1UU8A 3C51A 2WIPA 3S1HA 3GNIB 3UO6A 3IOPA 1YHSA 1QCFA 5HOAA 5HO6A 3UZRA 3EHAA 3KVXA 2WGJA 3KC3A 3SV0A 5CU2A 4YZCA 2XNEA 4NCTC 5LXMA 2C5YA 4IB5A 4KABA 1GIHA 4PL5A 3U4WA 3H0ZA 3DK7A 4M14A 1YKRA 1UU3A 3R8MA 2X4ZA 3QQLA 1ZZ2A 3CE3A 3O2MA 2UZLA 2PK9A 3PJ1A 5CENA 1H08A 2EUFB 3ULIA 5BX0A 3C5IA 4FT0A 3H9RA 3ROCA 4A7CA 5HTCA 1TQPA 1WAKA 3R04A 3O8UA 3KRWA 4QMLA 4LM5A 3QAME 4TPTA 2JIIA 2GNJA 4O81A 5CEOA 3LMHA 4G34A 2F49A 4C3RA 4EZ7A 5HE1A 4FA2A 3QQKA 5I0BA 5JT2A 2XK7A 4FEUA 2GHGA 3U51A 5I9ZA 5J9YA 3HLLA 2R0UA 4HGTA 4YC3A 3BWFA 2XIRA 3M2WA 3P79A 4GT5A 3ANQA 3RAHA 1XR1A 3UP7A 2QG7A 4AGWA 3CJGA 4CMTA 5CALA 2CMWA 5CQUA 4IEBA 4AN2A 4HZSA 1K2PA 4Z55A 3P5KA 3A7GA 3PTGA 2HZNA 3FUPA 2CN5A 2VTHA 1IEPA 4IAYA 4EHVA 4CG9A 1F3MC 4LUDA 4DEBA 5GJDA 2R64A 3O71A 3B2TA 3DKGA 3WZUA 5TOZA 2G9XA 2IVSA 3LJ0A 2ONLC 3GC9A 2XBAA 5CNNA 2W1ZA 4CFVA 4NYEA 4PNIA 3FLWA 4F7LA 4FV8A 4EL9A 5JGDA 5AP4A 5LMBA 2UV2A 5L2WA 1T46A 2Z7LA 4DGOA 2WOUA 3GCVA 3KXGA 4BGHA 2OI4X 4FYNA 4APCA 2WPAA 4Y5QA 2WMTA 4BC6A 2W99B 3NAXA 5F20A 2GNLA 4OLIA 3HA8A 3QHWA 5ETCA 1ZY5A 1BL7A 2QQ7A 4FTLA 3ORNA 4UYAA 5CWZA 4X6QC 3DDQA 1I44A 2Q0NA 4JRVA 2BPMA 2W5BA 4W4WA 1J7LA 4CEGA 4IB0A 1PXKA 5CVGA 1OL7A 4CNHA 4TKSA 4I6HA 4G6LA 4RIOA 2JLDA 2OZAA 4QTAA 4QMWA 2YJRA 1OIQA 4W4VA 4DGGA 3KB7A 4F63A 3IW4A 3EQDA 3I5NA 4YP8A 3T3VA 2QURA 4V01A 4XX9A 4FIFA 4IZAA 3AC1A 3W2OA 3FLNC 1H1PA 3SXSA 3ZUUA 4CMOA 2BZIB 2UW7A 4OAUC 1WBOA 5K0KA 4QQTA 3IECA 2W4JA 4QP3A 3POOA 4QP9A 4WRGA 2ITWA 2GCDA 4FTUA 4C61A 3VS2A 3L8XA 5D10A 4UXQA 2Y7JA 3ZXZA 5IMEA 4PY1A 2QOLA 1U5RA 4ANMA 4CFFA 3U6JA 2P2HA 3MN3A 2V7OA 2IWIA 4BYIA 4F6WA 5L2QA 4LRJA 4JNWA 3I0QA 3HECA 5CTPA 4RVKA 3RGFA 2OJGA 2JAVA 4IDTA 5EOBA 1WBTA 2V7AA 5BUEA 3R7VA 3Q5IA 3O8TA 3E8DA 4DFBA 5IA1A 4A9SA 4MHAA 2JBOA 4TNBA 3BU5A 3BGPA 3MSSA 1VZOA 3O17A 3LCDA 4UEUA 5FP6A 3VQHA 2DWBA 4IHPA 1AD5A 2H96A 2YM3A 3IDPA 5K3YA 3UDBA 3WYXA 3NUAA 2WTJA 1LEZA 2VTTA 4PRJA 4EOSA 3D5XA 3LQ3A 1U4DA 4CKIA 5T68A 3BHHA 4BY9E
chains in the Genus database with same CATH superfamily
3DKOA 1ZYJA 3RWPA 3RK7A 4BCNA 4FL1A 3MA6A 3QQGA 2XNPA 3EQGA 3ORXA 3HV7A 3VUKA 3KVWA 4MWHA 2W1EA 1YDRE 5C8MA 4CVAA 4NK9A 4G3GA 4BCOA 1JQHA 4IANA 3ULZA 4EH7A 4IWQA 4AZTA 2XA4A 3PIXA 4KBCA 4JX7A 3MJ2A 2OXYA 4C4FA 3UDZA 3LFSA 4EK8A 3VW8A 4BWPA 1PXPA 4HCUA 1IA8A 2IN6A 2X7OA 3MV5A 4TT7A 4BDKA 4ASZA 2BILB 4XG9A 2ITTA 3FY2A 2VX0A 5B7VA 4XEYA 4MBIA 2HWOA 3UQGA 4FGBA 3FKNA 2J6MA 3LQ8A 2R3FA 4O7ZA 2YABA 4JJRA 4I5HA 2A0CX 3MVLA 4JG8A 4UMPA 3EN4A 3AQVA 3B8RA 1FGKA 5D7AA 3EN7A 3CPBA 3IDCA 2B54A 2ETMA 5HD7A 5KZIA 3TACA 3K5UA 4X3FB 4DLJA 4EBWA 2XNNA 3EKKA 3QZHA 3PG3A 2DS1A 2E9OA 3FDNA 4I0SA 4QMMA 5CS6A 4UZHA 4IFGA 5EW3A 2WTWA 2WXVA 3VBXA 3TTIA 4EKLA 3FZOA 4R3PA 3TIYA 5L8KA 4ZP5A 1W84A 5IA2A 2OW3A 2J0IA 2PTKA 4ERKA 4F0GA 5A4CA 2YIWA 1WMKA 2F2CB 2IW8A 2YLFA 3MH3A 4ERWA 1MRUA 1ZOGA 3Q60A 4O82A 3LFAA 4OAVB 3KKVA 3OTUA 3KY2A 1NT2A 2Q83A 4S2ZA 3R63A 3U55A 4AGCA 2Z02A 1H25A 2O63A 2PE2A 3VF8A 4AE6A 4EHGA 5IQHA 1Z9XA 4MBLA 4AA0A 3TIZA 5B0XA 5HI2A 4ZY6A 5AEPA 3S3IA 4KIQA 5KMOA 4J98A 4S34A 2XRUA 4ARKA 1KOBA 3MPAA 1H28A 5KBRA 4NM7A 2X2MA 5KO1A 1A06A 2QKRA 3PSBA 1HCLA 1M2QA 3OS3A 3R1NA 3R7EA 3BX5A 5EI8A 1OUYA 5IQDA 4QPMA 5K5NA 2UZUE 3P7BA 5KMLA 2QLUA 3SRVA 4L7SA 2W17A 4OTIA 3VUHA 4RJ6A 4CMUA 3DJ5A 4EOOA 3OG7A 3COKA 1GJOA 3RKBA 2WO6A 2VWYA 2YEXA 1XH6A 2V62A 2GPHA 5JZJA 2HWPA 3NUUA 5HX6A 3A7IA 4ZSJA 5I9WA 4XV1A 3FMJA 2C0TA 4MYGA 3RHXA 3FMKA 1JKKA 1YWNA 2GTNA 4TXCA 4WA9A 3G90X 2E9NA 4FKPA 4LV8A 3RK9A 2CGWA 5K9IA 3MVJA 1P5EA 1OVEA 2UW3A 4XG7A 5T3QA 5KMMA 3A7JA 1ZY4A 4CRSA 3NDMA 1OECA 3R7GA 4RWLA 3RZFA 1H1WA 5CZIA 4Z16A 3A61A 3L8SA 5D41A 2RL5A 2F9GA 3Q9YA 2R3PA 3WARA 4FG9A 4DH7A 3DAJA 3ZM4A 2XKDA 4RIYB 3COHA 4M7IA 4BTMA 4YSJA 3V3VA 3MH2A 4IAAA 4I6QA 5EH0A 1G8JA 4AOIA 1XMLA 4IZYA 4RIWB 4BR3A 4M15A 4OT6A 4ZMEA 4J52A 5CAOA 3PZHA 2WTKB 4CT1A 4ANLA 4DHZA 1UU7A 4I21A 3E5AA 4AFEA 4BCHA 1IA9A 3QZFA 2E9UA 3HUBA 2XF0A 4LQMA 4QQJA 3RVGA 1WVWA 4G2FA 2F7EE 5TF9A 4H58A 2Z7RA 3KRRA 4OTWA 3DB8A 3QGYA 2WMSA 3E7OA 5GINE 3HRBA 5I4NA 3ELJA 4XG4A 4I6FA 3PP1A 4KD1A 4IIRA 2ZOQA 3ORIA 5KBQA 3QRKA 3ATSA 3HRCA 3L9PA 4QMVA 3KCKA 3QTRA 4WSYA 3SHEA 3SKCA 4QMXA 3OMVA 2PUUA 4ANNA 1WBNA 1W7HA 1SZMA 4K77A 2GS2A 1KWPA 2VU3A 4BYJA 4HYHA 3BYVA 4PV0A 3R7UA 4ACHA 4FKVA 3MESA 3EQBA 3PJ3A 1PMNA 2XRWA 4FSZA 3A7HA 2JKMA 3PXQA 5ANJA 3KFAA 5KUPA 1XHAA 4D1SA 3OOGA 3QTXA 3PWYA 3F6XA 4H1JA 1KE6A 4PL3A 4QQCA 1FVRA 4RZWA 3SQQA 3O7LD 2FB8A 2WMUA 3D2IA 1B6CB 4L00A 4CTCA 4G3FA 5JRSA 4BHZA 1BYGA 4ZJIA 4D2PA 3KXHA 3MH1A 4V0GA 3OBGA 4UZDA 4BDDA 2VD5A 2XANA 2WD1A 3D9VA 1PMEA 5K0XA 1LR4A 4DYMA 5DPVA 3Q2JA 3ERKA 4O0XA 3NFGB 1B39A 1IG1A 2ZV8A 3GU6A 3V51A 5M53A 4QMZA 3VJNA 2Y6OA 2RFDA 5K4JA 4N4SA 2QO9A 4O1OA 5IDNA 1H0VA 2VAGA 4IM3A 5E1EA 5LVNA 1UVRA 2A4LA 5EK7A 5L8LA 1GZOA 3QRTA 4O0YA 1IRKA 4C4JA 1JWHA 4ANOA 5AAGA 2ZV7A 3GENA 2IZTA 2X0OA 5L2IA 3EYHA 4IAIA 3V01A 2C5XA 5GJGA 4CKRA 4AAAA 4QYGA 4DFZE 4BDJA 2PE1A 4O7WA 1GNGA 2WB8A 3KN5A 3FZSA 2ITUA 1XH9A 3HZTA 4F9CA 3EL8A 5HBHA 4ACGA 3HMOA 2GFCA 5E8TA 1BUHA 2CSNA 3LM5A 4IZ5A 3UOJA 3SOCA 3ZO3A 2XK6A 2OU7A 4PDOA 3O50A 4EYMA 4DH5A 4YLKA 3CTHA 3DBDA 5E4HA 5CASA 4BKZA 1BL6A 4K18A 4NKAA 2ZMDA 4L01A 2UZTA 3ZOSA 4D4RA 2YM7A 5E92A 3NCGA 2GHLA 3BEAA 3OCSA 5AUYA 4DH8A 4FR4A 5M06A 5KMIA 4HJOA 4IE9A 2XS0A 3LFBA 4E6DA 4GSBA 3W0PA 5FXSA 4G3DA 4DITA 3RM7A 1OKYA 4O0UA 1SNUA 4ZMFA 2WHBA 4QMPA 4IVDA 4C4IA 5E8YA 2R3HA 3B8QA 1H1SA 3BLHA 4C35A 1MQ4A 2UW8A 5DNRA 5EYMA 1Y57A 5CXHA 4FTOA 3ROYA 3SDJA 5FUTA 2QR7A 4DBNA 2WMXA 2G1TA 5H8GA 2VZ6A 2PPQA 4AZVA 3EFJA 5AAFA 4EHEA 2VO3A 1CKPA 2BZHB 4U45A 5L6WL 5DVRA 3V5JA 3VULA 3UQFA 3CD3A 2V0DA 3FPMA 5E91A 3CSVA 3KREA 4QOXA 4PPBA 5HHWA 1L8TA 3FEGA 5TR6A 3GC0A 4GU9A 2VTLA 2XAMA 2F57A 4GS6A 2VWZA 2IZSA 3FSFA 3EQIA 3ZRLA 4BCKA 5LMKC 4FV0A 5DH3A 2YCSA 3PA5A 2VNWA 3VVHA 4K11A 3OWKA 5JQ8A 3BI6A 3W55A 3TV6A 5LVMA 3R8UA 3U87A 3FC1X 2JFLA 1R0PA 3D2KA 2ZM4A 1Y6AA 4DEAA 4DF3A 1U54A 3ZFYA 2WTIA 2VWWA 1JSTA 2PVFA 2CNQA 5AP0A 5IQBA 2REIA 5LCKA 4C33A 4WSQA 4UYNA 4I5PA 4IZ7A 3K54A 3OCGA 4N0SA 5IQIA 4E1ZA 3EMGA 3N4VA 4UMRA 1Z57A 2JBPA 4IQ6A 3LJ1A 2QOHA 3LCTA 3V5QA 1Q61A 4ENXA 1A9UA 4TWCA 2BROA 2W05A 3NNVA 3DK3A 4IM0A 4ZTQA 4FEWA 4D4VA 2YIQA 4Y73A 3FQHA 3WI6A 4A4LA 3RNYA 3LFQA 4BZDA 4F08A 4OT5A 3D15A 4MBJA 2PE0A 3PLSA 5DOSA 2W1IA 5ACBC 4W8EA 4I41A 3WZDA 1ST0A 4FL2A 4KWPA 3A8WA 2C6DA 5ETFA 2O5KA 3KK9A 3UDSA 2PZRA 4FTJA 3WILA 4B8LA 4ITJA 3UZTA 2X7FA 4Q9SA 4CT2A 3EQPA 3QC9A 2YCRA 3COIA 5CU4A 1G5SA 4PMSA 3DBFA 4E5BA 3V8SA 3E3PA 3LFCA 3QHRA 3E62A 3NIEA 5BMMA 5IEYA 3LPBA 1OIUA 2XK4A 3NW7A 4G31A 4M8TA 3FMEA 3R7OA 2QU6A 3VJOA 4Y5HA 4BFMA 4O6LA 1V1KA 3TDVA 2UZWE 3QTUA 1YI6A 3SX9A 3DKCA 5KKRB 4UWCA 1ZZLA 3NNWA 5CNOA 2JDTA 1URWA 4LOOA 4NTSA 5EYDA 3MFUA 5J8IA 4AG8A 4QP1A 3MFTA 1UU9A 5AR5A 4HGLA 4C62A 2JAMA 4A4XA 3C0IA 3EZRA 1H0WA 3K3JA 4AXFA 4X3FA 2QR8A 3BQCA 4YJPA 4GFOA 1H24A 2AUHA 4L43A 4PMMA 2BHEA 5HNGA 2ZDUA 4C38A 4FK3A 5AX3A 3LFDA 2UZEA 4DT9A 2C0IA 4MH7A 4QMNA 4IDVA 2CPKE 2QONA 4CG8A 3CEKA 4S30A 4IVCA 1KE7A 3HAMA 5CAUA 2JGZA 1TVOA 4CZTA 1SVEA 2YAKA 3TKIA 3F69A 3I7BA 3QRUA 4K0YA 5AUVA 3QRIA 5GNKA 5B2KA 5GZ8A 2RKUA 3FI4A 4FG8A 2C6EA 5JFSA 2WMQA 1G8KA 2BRGA 4AOJA 4XOZA 3NYOA 4MEDA 3C4CA 2GNGA 4Y46A 4ZTNA 2EXEA 3ZC5A 4D2RA 3AT4A 4EWHA 1BLXA 2B9FA 3SW7A 3RPRA 5I9XA 4E4LA 2QOQA 1HCKA 3UVRA 3M42A 2CNUA 4XJ0A 3ZYAA 5CU0A 2HCKA 3W18A 4HVHA 3P86A 3ZDIA 5CEPA 2VTSA 3UQCA 3CP9A 4KIKB 2LAVA 5L2TA 4YZ9A 5HBJA 1SVHA 3UZPA 3P08A 4MQ2A 4CQGA 5AX9A 3Q4UA 4OTPA 4I94A 3PXKA 4OUCA 3FHRA 3P5JC 4YC6A 4PL4A 3D5VA 4JXFA 5FG8A 5TKDA 3AXWA 3TZ7A 3RNIA 4RFZA 4YJQA 4E26A 3FZPA 4LYNA 5KX8A 2YJSA 3HYHA 3NNUA 3OP5A 5CI7A 5CU6A 4BIBA 2B9HA 4GKIA 3FY0A 1CDKA 3A60A 4HVDA 4L44A 5JSMA 4EOPA 2PVJA 5KMKA 3ZUTA 1OL1A 5DHJA 5IG1A 2ZYBA 3LE6A 4NM5A 5M08A 4IB1A 5HESA 2OZAB 3UIXA 1STCE 2CKEA 3LVPA 2PZPA 3F88A 2YDKA 3BHTA 2OG8A 2BRHA 3POZA 4Z7GA 2G15A 5DN3A 4AFJA 3CKWA 4ZK5A 3WYYA 4D5HA 3HL7A 4X3FC 3GCPA 4KS8A 1XO2B 5HZNA 3E92A 2R4BA 3ZLWA 5D7VA 1REJA 3FYKX 5HVYA 4FKRA 3RPYA 4OW8A 4JQ7A 3NUYA 3OEZA 4ZLZA 5T6KA 3DV3A 4NWMA 3R8ZA 4RX9A 3NLBA 2JKOA 3KRLA 3F2AA 4J53A 3HP5A 1E1VA 1JKSA 3QZIA 4J99A 3RAKA 3QTZA 2CGUA 3DAEA 5D12A 3UMXA 2ZFYA 4YMJA 4HOKA 1VYZA 1R1WA 3GC7A 4LMUA 3PSDA 4RA5A 3AT2A 3TUDA 4DHJA 4LL5A 3H0YA 4EOIA 2ZVAA 4ANSA 4FJVA 1P14A 4ZSGA 4F99A 3DXPA 5CT0A 3OXTA 3V04A 2QOKA 2CKQA 2AC3A 1OKVA 3PXYA 3TXOA 3AT3A 3MFSA 4C58A 4QTEA 5A4TA 5J5SA 5AR7A 3PLAE 1FPUA 3W0NA 2I7QA 3NGAA 3VHKA 1GZNA 1O6YA 3TZMA 3SRVB 5LMKA 3Q04A 1OPLA 4E6CA 3WZJA 3A4OX 4ZTMA 5CAQA 4X2KA 4FE2A 4GUBA 4DGMA 4AXDA 5ITAA 4KSPA 5DT0A 4IX3A 5LJJA 5FD2A 2VWVA 5CI6A 2BTRA 5HG7A 3MIYA 5C27A 2O3PA 3N4TA 2OJFE 3PG1A 3A4PA 3GXLA 4DGLC 2YM8A 3NR9A 2BFYA 2W06A 3HV6A 5HE0A 5AA9A 4BB4A 3TUCA 5E90A 3QZGA 3RM6A 3QLGA 4D55A 2Y4IC 4U6RA 3FHIA 4QMUA 3L8VA 4OBQA 4XCUA 3TG1A 4B99A 2GDOA 3KU2A 3PJ8A 4IVBA 4OTHA 4RVMA 4D1ZA 4FEXA 2BIYA 3FPQA 2XK8A 5KKRC 5BVFA 2IVTA 4F9AA 4AGUA 1VLRA 5EM8A 3C50A 2VRXA 4PX6A 5CU3A 3UOLA 5HLNA 2QNJA 4RBLA 5IQCA 4BRXA 3QD4A 4YO6A 3UC4A 3MI9A 2WFYA 1XH4A 4JBOA 2BKKA 4UV0A 2R0IA 3EFWA 5HKMA 4E7WA 3RJCA 5BV3A 5KE0A 1PXNA 3P1AA 4QYEA 3F3UA 4XUFA 2HW7A 4K8AA 1H07A 3BHYA 2QLQA 4ANBA 4C3FA 4LV7A 2GHMA 3QKMA 3R1SA 4C59A 4D2VA 1KOAA 5CF6A 1JAMA 3VNTA 2VTMA 3T3UA 4GJ2A 3QUDA 3W16A 2W9ZB 2XM8A 3ZSIA 4BCFA 3I5ZA 4G5PA 4RIXA 2J4ZA 2ITNA 5H8EA 4FSQA 3F3ZA 4G17A 4OBPA 2HELA 4GFGA 4NKSA 5F4NA 3RP9A 3ZEPA 2XAOA 1VR2A 5F1ZA 5HE3A 2Y8OA 3GOKA 4L8MA 2IW9A 4RLLA 3S2PA 1ZWSA 4X3JA 4E4XA 3SOAA 5J95A 4IXPA 4EOMA 1ZOEA 5IU2A 3PZEA 5J79A 2PUIA 3NW5A 3ATTA 3HEGA 4I4EA 2XKEA 5EQEA 2RG5A 2YITA 1PXMA 3FMMA 4FZFB 4W8DA 2VWIA 3ZSGA 1ZYCA 4OBOA 4QO9A 4DC2A 4LOQA 4BCMA 3D7TA 1SYKA 4BWKA 2XUUA 5AUWA 5DLSA 3LOKA 4BBEA 5C1QB 3AGMA 4ZTHA 2PSQA 5C01A 4IVAA 3MPMA 1MRYA 2CLXA 2PL0A 5HCYA 4D0XA 4IACA 4FTMA 4RFMA 3W2PA 4A9UA 4O83A 3ORKA 2XJ0A 4JAJA 4AW5A 5EDPA 4NFNA 4O4BB 4UBAA 5FTQA 1BX6A 3NZ0A 3VONA 3JUHA 1Q3DA 4M13A 4ACMA 3QD3A 4PF4A 4XV9A 5M55A 3EQFA 2NP8A 2W4KA 3EKNA 1ZARA 4PTGA 4YSMA 4R8QA 5HVKA 1IAJA 5IH5A 5L4QA 4JDKA 2BRBA 3DDPA 4A07A 2UZOA 4FKJA 2B52A 3IW8A 4QMTA 5FP5A 1L3RE 5HLPA 3ZMMA 3KL8A 4M69B 4LUEA 4O38A 4TTHB 2R3MA 1IR3A 5H2UA 4YURA 3T8OA 1ZYSA 4EH5A 4EWQA 1O9UA 2C1AA 2EB3A 1PF8A 2PHKA 3GU7A 5CEIA 5B2MA 2ONLA 4MQ1A 1K3AA 3G9LX 3E8CA 3JXWA 2IJMA 3KXXA 3O7LB 4IADA 5AP1A 5IA5A 5TT7A 3DXQA 3ML1A 4H3BA 4F9WA 2OFVA 2UZVA 5I9UA 4RZVA 2GFSA 4ANQA 1X8BA 2A19B 3MVHA 4M66A 2C68A 4YPDA 2WMVA 4HVIA 3ZZEA 2XCHA 4QPSA 5A3XA 3CIKA 3VRZA 2FVDA 4XP3A 4BBMA 4HVGA 4ZJVA 3TYKA 3UPXA 4JG6A 3GB2A 4FUXA 5DR6A 3CY2A 4FZDB 1ST4A 4MXOA 2VGOA 1YOLA 4U80A 4RC4A 4XMOA 2E9VA 1H8FA 3E7VA 4AF3A 3RHKA 5M07A 5BVWA 2JKKA 4JX3A 5BVOA 3E8NA 3VUIA 4GEOA 4UWYA 2XJ2A 3OCBA 3NS9A 3EN5A 2X2KA 1WVXA 3MY1A 3V8TA 3IO7A 4LGDA 5KCVA 3PY3A 1VJYA 4JDJA 4JL9A 3U6HA 5HCXA 5BYLA 1YXVA 1Q99A 2C3IB 3SA0A 5D1JA 2B55A 1H26A 4G1WA 2X7GA 4GYIA 2PVNA 5IUGA 4FNXA 2QOIA 1KE5A 3C5UA 4EC9A 1R3CA 4FKTA 4ZIMA 4GK3A 3PPKA 4BI2A 3W8QA 2XCKA 4FI1A 1UV5A 2XEYA 3R01A 3FJQE 4NCTA 3OY3A 3CTJA 3D83A 2FSOX 3GQLA 4XS2A 3IQ7A 2RF9A 5E8XA 5AR4A 3VUGA 3F82A 4TNDA 3BYSA 4AGDA 4DFLA 5A4LA 1FINA 2UZBA 2VNYA 4WG4A 4MF0A 3DLSA 4TRLA 4DDIA 2C1BA 4F1OA 2UVYA 3PUFC 2BDFA 2P0CA 4O84A 5BVKA 3PRIA 1YWRA 2I0EA 4OR5A 4U7ZA 3PJ2A 2RSVA 2C6TA 4YHTA 4DH3A 5A4QA 1QPCA 1QMZA 1NVSA 2C30A 4BCGA 2BHHA 3R0TA 3MFRA 4QD6A 2AQXA 3QTWA 3GFWA 4FT9A 3DCVA 1JKLA 2J0LA 2JDSA 2BRMA 3JPVA 1H00A 4FT3A 1H27A 2R3IA 3DJ6A 4R5SA 2OJ9A 2YAAA 1DS5A 5HO8A 2BZJA 4PDSA 3CPCA 2XBJA 4PMTA 5TO8A 3R9NA 4HGEA 2GS7A 4ID7A 3ZEWA 3KCFA 4E6AA 2YA9A 3D5UA 4GUEA 4BDIA 3NVMB 3W33A 3NUSA 5GZAA 5JRQA 2ZV2A 3ODZX 3PA4A 3PVWA 1V0PA 4RC3A 1WVYA 3P78A 1JPAA 5HIDA 3H4JA 5FM2A 4E4MA 2GMXA 2XIYA 4FTNA 4EK6A 2F4JA 4YBJA 1M7QA 3OTVA 1YWVA 3QFVA 3LLAA 2QHNA 3KXZA 2JFMA 2IW6A 4YO4A 1H1RA 3LXPA 4TYIA 4YC8A 4EQMA 4HW7A 4F78A 2V55A 3NUXA 5M44A 2J0KA 4O86A 4PTCA 1ZXEA 5H8BA 1W8CA 3OXIA 4YZMA 4F6SA 4EOQA 3W2QA 3DBEA 4BF2A 2YCFA 2OIDA 2CCHA 3R8PA 4I22A 4L9IA 3TCPA 4QMYA 4LRKA 5IDPA 3CC6A 1YXTA 2BVAA 4NU1A 1RJBA 1B38A 2HIWA 3LFEA 4AN9A 3CQWA 1OIYA 4NM0A 2GSFA 3MWUA 3BRBA 2ITXA 3QQJA 4RJ8A 4S33A 4D5KA 3SG8A 3BPRA 2X4FA 4RWJA 3BCEA 5CVHA 3UGCA 5JKGA 1VEBA 5C4KA 2WU6A 1Q8UA 4FOCA 5GIOE 3QUEA 4W4XA 3R9DA 4DG0E 1KV1A 4FBXA 2YZLA 1AGWA 3DOGA 3EYGA 2UUEA 5DR2A 4EH3A 3UO4A 4DT8A 3ODYX 2O2UA 3SLSA 4RQKA 4FTRA 3KXNA 2EXCX 2R7BA 3R2BA 4EONA 3VRYA 1V0BA 4NIFA 4YZBA 4EZ5A 2J2IB 1GOLA 2RGPA 5BNJA 4UX9A 5GJFA 3SD0A 4C2WA 4ITHA 4ACCA 5HICA 4XV3A 4MTAA 4AW1A 5BPYA 3M11A 4O91A 3UO5A 1GIIA 3MPTA 4YGAA 2R3JA 2WEIA 3U54A 2C3KA 2IF8A 4XV2A 5FXRA 4Y83A 5M4CA 3JVRA 3QKKA 1RQQA 2C6KA 5LMAA 3SXFA 4NW5A 3Q52A 4RJ3A 3TNIA 3C4FA 1J3HA 3C4EA 4KKHA 2XIZA 5FDPA 4MCVA 3ZBFA 5CVFA 5AP5A 2CGVA 3UC3A 1IAHA 4S31A 2CJMA 2PWLA 1LUFA 3IG7A 5CXZA 5DGZA 3SXRA 4FNZA 4BICA 3DFAA 3GT8A 4M0ZA 4I3ZA 4DTKA 2R3LA 3ALNA 3CS9A 3IGGA 2UVZA 5IEVA 3UYSA 2JITA 3EWHA 5HGIA 3KMMA 3ZO1A 3COMA 2OLCA 4GG5A 2W96B 3DS6A 3OHTA 4EUUA 3R8VA 3LW0A 4I6LA 3VS0A 4RLKA 2YM4A 5DWRA 3I1AA 4WUAA 3UMWA 1UNGA 3GVUA 4QQ5A 4R7BA 5I3OA 5CANA 4U41A 3IONA 4FZAB 2X0PA 1FVTA 3AC8A 5IH4A 3QALE 2CKPA 1XH8A 1XJDA 4CGAA 5HBEA 4HYIA 5CSXA 3VBVA 4C36A 3MDYA 5J1VA 4Z7HA 4FICA 2UW4A 2VX3A 1PJKA 4LGGA 1BI7A 4HVSA 4FRFA 1WBPA 4FIEA 2C6IA 2JKQA 4XLIA 3Q96A 4AA5A 4WNMA 4AS0A 3VIDA 3MIAA 1FMOE 4GCJA 3UIMA 3K5VA 4JR7A 5DT3A 3F5PA 4DFYA 3HVCA 4WHZA 3EQRA 3DPKA 1G3NA 5EDQA 4FKGA 3QWJA 4QTDA 4YNEA 5GZ9A 2XH5A 3PY0A 3VS7A 2QKWB 2VTOA 4JBVA 4F1TA 5AWMA 4XLVA 4CFUA 1YDSE 2B1PA 2VWUA 3SAYA 4TYHB 4FSWA 4XH6A 4R1YA 3FXZA 4O4FA 5J9ZA 1OZ1A 1S9JA 3VS4A 4RIYA 3E3BX 3AC5A 3PVBA 4GVJA 4FGRA 3GGFA 1YXSA 4M68A 3QU0A 4MXCA 1SM2A 4FIHA 3TKHA 3QCXA 4D1XA 4U44A 3DLZA 2XVDA 4W9XA 3JVSA 3CJFA 1PYEA 3HV3A 3VBQA 2RIOA 4DLIA 3FKOA 4O7LA 1OKWA 4JG7A 3HMIA 1W2CA 5CY3A 3QYWA 3WF7A 4F0IA 5KHXA 2IG7A 2PYWA 2RFEA 3GOPA 4AQCA 4MF1A 4LOPA 5FTOA 4TYJA 3BGQA 3EB0A 2FSLX 3P23A 4XYFA 4PP7A 1JSVA 3FMHA 5L6PA 3BQRA 4J96A 3KMUA 4ZS0A 3RALA 3SGCA 4L45A 4B0GA 3PPJA 4ZLOA 5CF5A 5HVJA 4DEDA 2UZDA 3F3WA 4ZOGA 1QPEA 4O7RA 3TJCA 2R9SA 3PYYA 1NW1A 4E73A 2C69A 2BCJA 4RT7A 4MUQA 3SG9A 3NMUF 4O21A 1PRYA 4RX7A 4UALA 4H36A 2R3NA 4I24A 5B2LA 2I1MA 2QO7A 3C0HA 4QEBA 4OTDA 4QT1A 3Q9WA 4FTCA 3C4ZA 4MKCA 4H3QA 3FQEA 2JDOA 4TN6A 1PMVA 3DKFA 4QYHA 4EJ7A 1PXIA 3NWWA 3OC1A 3FI8A 3GP0A 3DQXA 3KEXA 4NUSA 3CXWA 4AAYA 3OOMA 4PPAA 4TZRA 3UJGA 4XHKB 2QHMA 3PIZA 4EBVA 4L68A 4P5ZA 3G2FA 5JZNA 4AU8A 4ITIA 4XG3A 3ORTA 2J7TA 3PRFA 2P33A 4GFMA 4TWNA 4CQEA 5JEBA 3H10A 2HYYA 3A62A 3EQCA 4U0IA 1U5QA 5FLFA 2Z7SA 4MWIA 3MYGA 5EI2A 2W1FA 4DG2E 1NXKA 3CKXA 4QYYA 2BZKB 3QBNA 4E4NA 2WTVA 3PFYA 5I9YA 3AD4A 5HLWA 4KAOA 5BYZA 3PA3A 3R8LA 3TEIA 5C26A 4DFUA 4FIJA 3BL7A 3R28A 1ATPE 2X0GA 4H1MA 4JAIA 3AC3A 4CFXA 3Q4ZA 4EYJA 5AR3A 4AW2A 5BQ0A 4MXYA 5CX9A 5HQ0A 1WCCA 3DY7A 1OB3A 4FNYA 1WZYA 3IW5A 3QQUA 4WBOA 4U5JA 2C5VA 1DI8A 5E1SA 3I81A 3H30A 4M67A 5D11A 3RWQA 4O22A 4XOYA 5FXQA 5JGAA 4W4YA 5I9VA 3HKOA 5HORA 4AT4A 3WIKA 1GZKA 4O7YA 2PVLA 2OXDA 3Q2MA 3I4BA 1OBGA 3LMIA 1DM2A 1OPKA 4PDYA 1OL5A 4FYOA 4PWNA 2J5EA 4I93A 2WZJA 4L46A 4IC8A 3S0OA 4E5WA 2C3JA 3FMDA 4WNPA 5IA4A 4QTCA 4FKIA 4EH8A 4HCTA 1ZYLA 4FTKA 2VX1A 3HMNA 5JN2A 4QPAA 4RJ7A 4RX8A 4IX5A 3BV2A 2EU9A 3GFEA 4AT5A 4F4PA 4Z9LA 3HP2A 3TNWA 4BCPA 2QOFA 4AZFA 4FVRA 3KF4A 2PZ5A 3CGOA 3OFMA 5A14A 4FIGA 4C57A 2AEGA 2UW6A 1FQ1B 3LZBA 2QD9A 2EB2A 2PVHA 3RTPA 2HOGA 4YZDA 3BLRA 1J7UA 4NSTA 4QNAA 3VC4A 5HTBA 3P9JA 1R39A 3F5XA 4ZSEA 3FMNA 4UMTA 2QOOA 2WQOA 2HENA 3TL8A 4O0VA 3CLYA 4IMYA 4UB7A 4V05A 2G01A 2XKFA 1Q4LA 2IZUA 4OTFA 2C5NA 3ZU7A 3CGFA 4DH1A 3OWPA 4FMQA 1XBBA 3FMLA 5JFXA 3ANRA 3HUCA 1YXUA 2J50A 4DTAA 5CEQA 3E87A 5AV4A 3GI3A 3PPZA 2WIHA 4JQ8A 4R3CA 3LJ2A 3DBCA 1REKA 3TMOA 3QKLA 3ZO2A 4L3JA 4RQVA 2OF4A 4CLJA 2JDVA 3DGKA