4FNWA

Crystal structure of the apo f1174l anaplastic lymphoma kinase catalytic domain
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
322
structure length
304
Chain Sequence
RTSTIMTDYNPNYSFAGKTSSISDLKEVPRKNITLIRGLGGEVYEGQVSSPLQVAVKTLPEVCSEQDELDFLMEALIISKLNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK tyrosine kinase receptor
publication title The R1275Q Neuroblastoma Mutant and Certain ATP-competitive Inhibitors Stabilize Alternative Activation Loop Conformations of Anaplastic Lymphoma Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 304
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fnwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fnwA01
4NKSA 2AC3A 3MB7A 1LUFA 2RSVA 5IH6A 2OICA 5AR4A 4DLIA 1FVVA 2XEYA 1FPUA 3QTXA 4ZTNA 3ZO2A 5AV2A 4QTDA 4NJDA 5I9VA 4KA3A 2SRCA 1WBWA 1IA8A 1PMNA 4IFCA 5H8BA 1M17A 1EH4A 5EW9A 2OO8X 3KN5A 4RBLA 2CKQA 3MY0A 3TZMA 4GVAA 3VUMA 3F5GA 3MY5A 3I81A 3HNGA 4V05A 2OJFE 5FEDA 3R8ZA 2VWZA 4TYHB 3OBJA 4IIRA 4AUAA 5C03A 2UZBA 1H1RA 3NUNA 2XNOA 1OZ1A 4BR3A 4OTWA 5KMJA 1NVRA 4NU1A 5E91A 1H01A 2VO6A 5CASA 4ZMEA 4IZ7A 1W83A 4E3CA 4EJ7A 4JQEA 2BRBA 4CNHA 3ZSIA 3QL8A 3S3IA 2XCKA 3DY7A 4MQ1A 5ITAA 2X4ZA 3EKNA 4DH7A 4EK6A 3Q4TA 3LXLA 3DTCA 3IW6A 3S95A 2YM4A 5HORA 3UVPA 4TKSA 5IQAA 5FXQA 4C02A 4B6LA 5HLNA 1XH6A 2EB2A 3TNPC 3LM5A 4FV8A 4D1ZA 2YAKA 4BI0A 1PXIA 3BE2A 4S31A 2BROA 5ANJA 4IDTA 5AWMA 5JKGA 3WARA 5AIRA 2HY0A 3ORMA 4APPA 4GVJA 4UWCA 4FKOA 2WHBA 2W17A 2QOLA 3C13A 4ALWA 4FZ6A 5CSXA 4E6CA 2CGVA 3CD3A 2I0VA 3BV3A 4U40A 2VO0A 2C5VA 5IQIA 2WOUA 5I9WA 4EOMA 4O0UA 4UWYA 3EZRA 5JFXA 5J8IA 5AAGA 4S30A 1XH5A 1UNHA 4WUAA 3Q3BA 5KZ0A 4ACMA 2YCSA 2PZYA 3FQHA 4RJ3A 4XOZA 4FTTA 5K0KA 3ATTA 3QXOA 2O0UA 4BRXA 5IU2A 4DEGA 2R3JA 2ITWA 5DMZA 4OLIA 2R5TA 1WVYA 3UO4A 3VUHA 1OL7A 4C2WA 5AUZA 4IWPA 3MDYA 3WZDA 3N4VA 2PTKA 3I60A 3Q5ZA 3R04A 4E73A 3PWYA 5CQWA 5EH0A 3RALA 4RX5A 4A9YA 1TQMA 2XCHA 4F6UA 5A4QA 4EQUA 5B2MA 2YCQA 4QQCA 3LCKA 3VRZA 2UZNA 3LMGA 4Q5EA 2ZDUA 4EH2A 3AXWA 2JDVA 3POOA 2A1AB 4OTHA 1YI4A 4G9RA 4FEWA 4TY1A 5FTQA 4DEDA 4BTMA 2XK9A 3QF9A 4ZZOA 1BUHA 3DKOA 4ZTMA 3P9JA 4M14A 2GDOA 5CLPA 3RI1A 5GNKA 1MQ4A 4BIEA 3UNKA 4R5YA 4KINA 3OY3A 2F57A 4IX5A 5HOAA 1H0VA 4ASXA 2PVHA 3O50A 5IQGA 1Q8ZA 4JX3A 3DV3A 4N6YA 2YM3A 4OTGA 4D0XA 2J9MA 5L2SA 2QD9A 2UW6A 2VV9A 3W2RA 4ANBA 2JKQA 3RPOA 5JGAA 1G8AA 5BPYA 4WT6A 5ETAA 3OP5A 2Y9QA 2GHMA 2YABA 1H0WA 3E88A 2A4LA 4ACHA 4KS8A 4DTBA 4GG7A 5EHLA 1JLUE 5AUVA 5JEBA 5FUTA 3DBQA 4Z7GA 3OG7A 5FP6A 3BYUA 4FYNA 3L8PA 1PJKA 4MWHA 4PDOA 5HICA 4EYJA 3IW4A 2X81A 5KMKA 4R78A 3DLZA 5EYDA 2GQSA 2XKEA 4CLJA 4AW2A 3ZZWA 4O27B 4EHZA 4R7HA 5A4CA 3TACA 5CU4A 5DRDA 4I5PA 4BIDA 4Z3VA 4Y5HA 5AUUA 4O83A 2AC5A 4FV0A 2Z7RA 1QPCA 2VWIA 5J5SA 3V3VA 4F7NA 3QLGA 4O7RA 4IVDA 3N9XA 4L42A 1PKGA 3DQXA 2HCKA 1FQ1B 3FMMA 3HRFA 4IJ9A 4U3ZA 3ETAA 1PXNA 2V5QA 4JNWA 4A4XA 3PJ2A 3R22A 1ATPE 4FEUA 4KIOA 4CLIA 4H1JA 5AP2A 1O6LA 4YJVA 4YJUA 1JBPE 3R7IA 1KE8A 5F94A 5C4KA 1JAMA 4HZRA 4CYJA 5DBXA 1Q8TA 3QUEA 4UMRA 5J7BA 5C4LA 2ZMDA 2GFSA 3NYXA 3VJNA 3TV7A 2PMLX 3POZA 4LUEA 5CZHA 4WRGA 4CVAA 4FTAA 4HYUA 3TNWA 4FA2A 3PJ8A 1IEPA 3HKOA 4I6FA 4YC8A 5L8LA 3O23A 3E8EA 2BZHB 2W7XA 5CI7A 4KUJA 4B9DA 5KE0A 5EQYA 3ZS5A 5AV4A 1JQHA 1WVXA 3FMDA 3GCVA 4E4XA 3S1HA 1WBNA 3NNXA 4JG7A 4AZFA 2WTJA 1GJOA 3ODZX 1PXPA 1QCFA 3A2CA 2VTSA 5E1EA 3R28A 3ZC6A 3KMWA 3ULZA 4BZNA 4CEGA 3D14A 3FXWA 4CTCA 1KOAA 3BGQA 2B52A 2VNYA 3FKOA 4GG5A 3VAPA 3SXSA 3CCNA 3M42A 2VTQA 5JQ5A 4UYNA 5BVDA 1G5SA 1XBBA 2QOOA 3QHRA 4TL0A 5CEMA 4AZSA 4RC3A 5HI2A 1NVQA 4JDKA 4A9SA 4O1PA 3OWPA 4NW6A 4U45A 3UOKA 2BFXA 2JKKA 2ESMA 1H27A 2W5HA 4FSQA 4ZP5A 5DEYA 1ZY4A 4QP7A 2ITOA 2R7IA 4FT5A 3MIYA 4I4FA 4L3PA 4YPDA 1J1BA 5FXSA 4L8MA 3KF7A 2WTVA 4RMZA 3NGAA 5DVRA 3FZRA 4LGGA 2YLFA 4WG3A 4DGLC 5KMLA 4NTTA 4AXAA 4MHAA 5BMMA 1KWPA 4FV9A 2R3IA 1CKPA 2XJ1A 4ZK5A 4AT4A 2WU6A 2ETMA 2IVVA 3UIMA 2XF0A 2XNGA 3P4KA 4J97A 2BKKA 2PVJA 4WD5A 4QPSA 3ZLWA 4CFVA 5DIAA 4EEVA 3Q6WA 5M4FA 2OK1A 4CFWA 2BAJA 4FKUA 1A06A 3NPCA 2BZIB 4NW5A 4F99A 4MF1A 4ACGA 4F63A 2XK4A 2YJRA 3K54A 4LG4A 3O7LD 4JAJA 3VQUA 4Y95A 4AA5A 2QOFA 5ICPA 4JAIA 1KE6A 4FTMA 2W05A 3B2WA 3NZ0A 4XV9A 1AGWA 3A4OX 3UOJA 5LCKA 4O0RA 3LW0A 1U5QA 5I5ZA 4AOTA 4WSQA 3PG1A 4KIPA 1JKKA 3HLLA 4QP1A 3K5VA 4BICA 5GINE 2WTKC 3OC1A 3U87A 3EFWA 5FLFA 1ZYSA 2PVYA 4NZWB 2B1PA 2R9SA 2VTAA 3U51A 3S00A 1O9UA 2W5AA 4V01A 5CVFA 2ETRA 5KMMA 2BKZA 4EZ3A 1KE5A 2BTRA 3VS3A 2XM9A 3KMUA 4DTAA 2RF9A 4QP4A 4XLIA 2BFYA 4M69A 1YWNA 4JBOA 5E8WA 3HV7A 3ALNA 3EQRA 4MXAA 4XG8A 2OG8A 3MVJA 3OCSA 3RKBA 1YW2A 3SQQA 3U6HA 5E7RA 4DFZE 2BAKA 3NDMA 4K18A 3TJDA 4EKLA 4F1TA 5AR3A 4FKRA 3TTIA 3OUNB 4NFNA 4Q5HA 2GS6A 3E8CA 3R8PA 4CCUA 1PXLA 2UZWE 3QTZA 4EWQA 1XKKA 2X2KA 3K3JA 4JQ7A 1JNKA 3GB2A 2QR8A 4XP2A 3AC4A 5M55A 4RVKA 4XEYA 3SX9A 2G15A 3GFWA 5TR6A 2WMXA 5AR7A 1WVWA 2OGVA 3T8OA 4GFOA 3A7IA 4A7CA 5JMSA 5FBNC 2JDTA 4C38A 3DDQA 4MD9E 3ZXTA 3I79A 4C62A 3LMIA 2FUMA 2WQEA 3QD0A 1YXSA 3ITZA 4QMWA 2VX1A 4C4JA 3ZDIA 3NW7A 2WPAA 4LI5A 1GY3A 4HVHA 4RX7A 3TV6A 5L6PA 2GNGA 3MH3A 4ZTRA 4NSTA 5FWKK 5M44A 4UXLA 4O38A 4L01A 2OWBA 3GU5A 5EDPA 4MAOA 3HP5A 3ACJA 2CN8A 4GSBA 4DFLA 4FV1A 2R64A 2XYUA 4EC9A 1F5QA 2O63A 4C37A 5IA4A 5EDRA 2C0IA 1DI8A 4QP3A 4OAVB 2EUFB 4FT7A 4OAUC 5EK7A 5EI2A 3R30A 1G8SA 4D1XA 5A6OA 3I7BA 2JLDA 4O1OA 4W4XA 3QCYA 4Z16A 5AX3A 3P0MA 5CF5A 5I9YA 5CSHA 3NVKI 2YISA 3WYXA 4ANOA 5KBQA 4FT3A 4FK3A 4BCGA 3KFAA 2UW5A 1OB3A 4FKQA 4RLKA 4QMPA 5FRIA 5FTOA 2BRNA 2XA4A 4JDHA 3KK8A 4NFMA 3SAYA 3ZO3A 3R8UA 4DT9A 2VZ6A 2CHLA 5M07A 4O0SA 5HU3A 2IZUA 3NAYA 3G6HA 3TCPA 2OI4X 3GQIA 4L6QA 4WNKA 2F49A 4X2NA 4DA5A 2C3KA 4RZWA 3SG9A 2RFNA 2H9VA 2FB8A 2V22A 4FL1A 3BHTA 3VS4A 2W5BA 3NYVA 5HO7A 2B9IA 2R3PA 4FIHA 4N70A 2WD1A 2GU8A 2IG7A 4NCTC 4EQCA 3CJGA 3OTUA 1L8TA 3D83A 4CG8A 2P3GX 3DK3A 4QMTA 2B0QA 2BCJA 4DBXA 5CY3A 4IB0A 3RK7A 5DGZA 3A62A 1VZOA 3HL7A 3FLNC 1YDSE 2R3MA 4I0TA 4QNYA 5DG5A 5TO8A 3G15A 5B7VA 3G2FA 2E9OA 3JS2A 3MFRA 4Q2AA 3GI3A 3HMNA 3BU5A 5J95A 3UMXA 3VHEA 4EK4A 4ZLYA 2CKOA 4M8TA 3W8QA 1JKLA 1T45A 2HW7A 4QP6A 4U0IA 4W8EA 3DBCA 1ZOHA 3WYYA 4XJ0A 3WOWA 3CQUA 3ANQA 3PPKA 3QRIA 4D5KA 4AX8A 2YZAA 4C57A 3EN9A 4FIJA 3COIA 4ID7A 3TN8A 3DBFA 2VN9A 4ZTSA 3O8UA 4XV1A 3UO6A 4GUEA 2CCHA 3TV4A 4F65A 4XG3A 3Q9ZA 4EK5A 2FSLX 4FTCA 5HCYA 4M0ZA 4FOCA 4IXPA 4PL3A 3UQCA 3F2RA 5CX9A 2Y8OA 5CF6A 2XP2A 5DT0A 5GJFA 4RT7A 5KZIA 5E90A 3WZEA 2IPXA 1B39A 2OIBA 3DKGA 3OS3A 3I0QA 2JKMA 3KULA 3QRUA 4OUCA 3TZ8A 4DH3A 3CJFA 2ZM4A 2EU9A 4BI1A 4CFXA 5AUTA 2BIKB 4FKIA 3EQFA 4O6LA 3P7CA 4LL0A 2C68A 3FHRA 2CKPA 5TKDA 3KRJA 3EQBA 3ORLA 4FL3A 2XUUA 2R3NA 3EQDA 3VC4A 3FE3A 2UZUE 5EM8A 4IAFA 2IZTA 3GU8A 3CKXA 4EH4A 4HVDA 4XHKB 5TOZA 3U8WA 4DEIA 3SXFA 3JR1A 1F0QA 4AAAA 4WHZA 2DWBA 4TWCA 1UNLA 1ND4A 1U59A 4GU6A 5HLPA 1M2RA 1QPJA 1ZOEA 4NKAA 4FVPA 1R3CA 5BVOA 3RK5A 3FYJX 2WTIA 2PE2A 4IVAA 4CKIA 3QA8A 5ETIA 1BI7A 4ZSAA 2ZM1A 3ZMMA 1ZYJA 5HTBA 1ZXEA 4A06A 1YHSA 2C1AA 5F95A 1Z5MA 4ZEGA 1FGIA 1SVGA 4NIFA 2WTCA 4I41A 4AWIA 3KGAA 2QONA 3UO5A 2XM8A 3DKCA 3R8VA 4BZOA 5GZAA 5L8JA 4R77A 3U54A 1G3NA 2W1ZA 5L2IA 4I94A 3WILA 1GIHA 4FUXA 4GKIA 3O8TA 2B9JA 3O51A 3FI3A 3HMIA 4J95A 2OFVA 5IA2A 4AT5A 5CVGA 3OFMA 4M97A 4FX3A 2PMIA 3PXFA 4K2RA 3KVWA 4O0TA 3U4WA 1ZRZA 1ZYCA 5AAEA 2F2CB 3AMYA 3LFQA 3MJ2A 5D12A 2J7TA 4EL9A 3REPA 3VUGA 4FSYA 2QLQA 2G2HA 2OXDA 4F0IA 2UVZA 2HZ0A 3NUYA 4JIKA 4UMTA 3UGCA 2P2IA 3UOLA 4I1ZA 1F3MC 4HCTA 4HVGA 5IQFA 3RGFA 3FPMA 3DDPA 2XKCA 5AMNA 3NUAA 4BCJA 3RTPA 4I5HA 4LM5A 3PVWA 1H07A 3BEGA 4IHPA 2QVSE 2R3GA 4MBJA 3A61A 3VHKA 3ORXA 2WTWA 2ITYA 4TN6A 3DS6A 4ZTQA 4BDCA 4D2WA 4F9CA 3TM0A 3PLAE 3C9WA 4YSMA 4A4LA 1WAKA 2FH9A 3EN5A 4O7SA 5IEXA 5L2WA 4QP8A 4D4SA 2B7AA 4WG5A 4BHZA 5C8KA 4FG7A 2WIPA 3ZEPA 2ONLC 3C0HA 3RAWA 4U42A 1NW1A 5AP4A 3LQ8A 4RIYB 4PTEA 4KBKA 5I9ZA 2OJIA 2P2HA 3L9MA 3Q5IA 4LV8A 4ENYA 4RIOA 2J0LA 2JGZA 5K3YA 5IQDA 4AN3A 3PSDA 1SM2A 3QD4A 2XNBA 4D0WA 1VEBA 4QD6A 5HO6A 3OBGA 3ZH8A 4B0GA 5HGIA 5C8MA 2WFYA 1H1WA 3BBWA 3COHA 4LGDA 4MNEB 1H1SA 1GZOA 1UV5A 4FSNA 1U4DA 2OF4A 5DPVA 4UMUA 3U55A 3GNIB 1CSNA 4D5HA 5HTIA 2YWVA 5AR8A 4TNDA 4BL1A 4Y85A 3FLZA 3HZTA 4XBRA 3LFDA 3SG8A 3EZVA 3O96A 4MNFA 3UZRA 4ZJJA 4NTSA 4M0YA 3RMFA 3Q2MA 5ANKA 5LCJA 3BI6A 1TVOA 2ZM3A 4QYGA 5GIOE 2QO7A 4KWPA 1APME 1IRKA 1PW2A 3BBTB 5FP5A 3TL8A 3MIAA 5GZ9A 1REKA 4GK3A 4K0YA 3EHAA 5M08A 2BUJA 5E8XA 5EYCA 2XNNA 1P14A 3W1FA 3IS5A 4JT3A 2G2FA 4NCTA 4OBOA 4TRLA 4BDIA 2WMWA 4OTRA 3SDJA 4FICA 1AD5A 3F5UA 3NMUF 5LMKC 4FI1A 2C5XA 1I44A 3E3BX 4YNOA 2I7QA 5BVWA 4WNPA 3B8RA 4XG4A 3MVMA 5EI6A 3SD0A 4BDDA 4ZSEA 4ITJA 3MW1A 2WQBA 4D28A 3CXWA 3GEQA 4ZS0A 5JK3A 3ZC5A 1OKVA 4ZZNA 1R0EA 2O5KA 2BZJA 4L3LA 3ULIA 4UMQA 3MPAA 4NUSA 2W1DA 3G6GA 2BVAA 3DZOA 2XBJA 4EZ7A 4AZTA 2W1IA 2J2IB 1HCLA 2VTLA 1IR3A 3KMMA 4FEQA 3TUBA 2CGWA 3VS0A 5E8TA 2YA9A 4E4MA 4IZ5A 1DM2A 4WRSA 2VTPA 4I20A 4QMYA 4X3FC 1XBCA 3I4BA 3R7GA 3KN6A 3BRBA 4KBCA 4C4GA 3N4UA 4LRKA 3DLSA 1NT2A 4N57A 2VTTA 3ZLXA 3DB8A 1UWJA 4U7ZA 5ANEA 3R0TA 4RJ6A 3F3VA 5IZFA 3CPCA 1J7LA 3O0GA 3MJ1A 4HGLA 2J0KA 1JKTA 3LXPA 4J7BA 3E87A 3GCQA 4MYGA 2BR1A 4A07A 4IQ6A 3N4TA 3V51A 5ANGA 3LCOA 2YERA 4YMJA 4OTDA 3IW7A 3BEAA 4LQMA 4BZDA 3ZUVA 3HMMA 2WMTA 5TE0A 4GYIA 4GJ3A 3AG9A 4Y46A 4FODA 4IACA 4C59A 4DHFA 1JVPP 3MFUA 4M15A 3HVCA 4BDGA 3N51A 4I5MA 4RA5A 3D7TA 3LOKA 5DOSA 3HP2A 4GT5A 1OBDA 4EOIA 3ET7A 2CLXA 5CENA 4JQ8A 3EQCA 5HE1A 4EH5A 1XBAA 1YDTE 3F3WA 3I6UA 4CMUA 4ENXA 1QL6A 5M4CA 2X6DA 3CR0A 3P5KA 4UB7A 4FKLA 3ENHA 3OWJA 2E9NA 4JDJA 4RVLA 2ERZE 2F9GA 3ZO4A 5LQFA 3KK9A 3PY0A 2BZKB 2YIRA 3MY1A 5LWMA 3ZM4A 1M2QA 3QA0A 5AUXA 4K33A 3EYGA 4ITIA 4TWOA 3MH0A 5CYIA 4PPCA 4RA4A 1SMHA 2C4GA 5FQDC 1Y91A 1OKZA 2O65A 5LMBA 4LV5A 1OPLA 5FM2A 4AGDA 4FV4A 5EFQA 2C3JA 4N4SA 4BDKA 5LVMA 1W98A 3S2PA 4YTHA 4TT7A 3VF9A 4FBXA 3H0ZA 1UVRA 2C0TA 5I3RA 5CT7A 3CLYA 4ZY6A 5HKMA 1M2PA 3BQRA 4GIIA 2PMOX 2FVDA 1S9IA 4CMTA 1ZZLA 3H30A 1YWRA 4CD0A 4F9BA 2ITNA 1S9JA 4C3PA 4PPAA 4XX9A 3RAIA 3ZBXA 4IH8A 1J1CA 1LEZA 3OUKA 5EM5A 5FDXA 3WIGA 2P55A 4E4NA 2RFDA 5AJQA 1T46A 5M09A 3HDMA 3LJ2A 4EZ5A 5AP7A 4BFMA 5DN3A 4RJ7A 2X0GA 4GRBA 3PRIA 4HNIA 1Y57A 4CTBA 2O8YA 3PXYA 3IW8A 3DBDA 4PDYA 4HOKA 3PZHA 4CRLA 5AP3A 5AV0A 5TT7A 4YZCA 1O6YA 5B2KA 3PXRA 4EBVA 3ALOA 3PIYA 4O7TA 3ZLYA 2P0CA 3A7HA 2XK3A 3MI9A 2ONLA 5IUHA 4I0SA 4HYIA 4BKJA 3AT2A 2YM7A 2X6EA 4E1ZA 3PVBA 5IQHA 2QKWB 3NSZA 4ZAUA 3NYNA 5CU6A 3R71A 3NUPA 1UWHA 2VGPA 5CSPA 3ZSHA 3NUUA 3PLSA 4MF0A 4BCMA 4XUFA 3D15A 5AIKA 5LARA 4G6LA 5ANDA 4YBKA 1IASA 4FNYA 3QQGA 4GH2A 4O7WA 5L6OA 3T3VA 1GOLA 4TW9A 2BRMA 5HNGA 2XKFA 2YIQA 4ZSJA 4EH9A 3FKLA 1MQBA 4K11A 1FOTA 3OXZA 3W33A 2VTMA 3KKVA 2JDSA 3KXXA 3L8VA 4MH7A 4QO9A 3WF9A 2ZV8A 5AP6A 2XH5A 5CAPA 3OVVA 5KBRA 4L46A 5IEVA 2QI8A 3T9IA 2KTYA 4WKQA 5HD7A 1OIYA 1RQQA 3Q32A 4F6SA 4KKGA 3HV4A 4XYFA 2GS2A 3DGKA 4UWBA 1ZMVA 5LVOA 2C6EA 4MBIA 2WU7A 5IQBA 1Z57A 2IZSA 5CS6A 2RFEA 4CKRA 5T68A 1DAYA 2CN5A 3M2WA 4FTLA 4DGOA 4BDBA 4EUUA 4G16A 4GYGA 4IAYA 1ZWSA 2P4IA 4KS7A 1XR1A 2V55A 4QNAA 3AQVA 4RPVA 3EFLA 3KRWA 4O82A 4AQCA 1OPJA 5E8UA 3RWQA 4O7NA 3RPVA 4BB4A 3Q04A 4J8MA 5CEQA 4DG0E 2PUIA 3PWDA 4C3FA 3R9NA 4ZY4A 3MESA 3AC5A 4ZTHA 3ANRA 4U44A 4ZIMA 3G5DA 3FLYA 2UZDA 4MCVA 2EWAA 4O0YA 1H00A 1YI3A 3OTVA 4GT3A 2ITTA 4B4LA 3QUDA 3DPKA 4C4EA 5HIEA 5IDNA 4FEXA 4TYEA 4DCEA 5LMKA 3F2NA 5GHVA 2VX3A 5I4NA 4WUNA 4J71A 2QR7A 2QURA 5JZNA 4C34A 5J87A 5BMSA 3BHUA 3SXRA 3KU2A 2BALA 3CC6A 3VIDA 4R5SA 2GNJA 4FT9A 2Q83A 3QGWA 2GTNA 5IMXA 2CLQA 2WTDA 4LRJA 3P78A 1MP8A 3AC1A 4M13A 5BVKA 1R1WA 1OIRA 4DTKA 4EUTA 3MWUA 4AGUA 5C01A 2F7ZE 5I9XA 3NIZA 4BWKA 4YHTA 4FGBA 2QOIA 3VWAA 4IB5A 3TTJA 3F5PA 4LOQA 5EM7A 3VO3A 3ZYAA 4YLKA 5AX9A 4X3FA 1E9HA 3D5XA 3IO7A 1MRUA 3EOCA 5DEWA 4D2RA 2WKMA 4NM3A 3R7VA 4H3QA 2C30A 5HE3A 3UZPA 3ZBFA 2J0MB 4UMPA 3C5IA 3IG7A 1U46A 3PSCA 4Y5QA 1V0BA 5C26A 1UU3A 3ZONA 4IBMA 5E8VA 3H0YA 3ZFYA 4DGGA 2C6DA 2X9FA 4M68A 4ACDA 4S34A 3TIYA 5LVPA 3R83A 1YQJA 4ANLA 4QMVA 5KHWA 5HNIX 3EQGA 3IW5A 3G9NA 3OEFX 2X2LA 4C4HA 4HCVA 5JGBA 3F9NA 4L7FA 4G3CA 5EHOA 3VS2A 3HV3A 5D10A 1TQIA 2VWYA 3IDCA 5KKRB 4FTQA 3ZEWA 1MRYA 4I24A 4L00A 4YJTA 4F9WA 3HX4A 1PXKA 1ZLTA 5DT3A 2G01A 2O2UA 2JFMA 2PVNA 3EN6A 3AC2A 3MSSA 2C6MA 3QLFA 3AC8A 5CTPA 3ZLSA 4HGSA 1OITA 4RLLA 3VJOA 5EOLA 5ETFA 2F2UA 4LGHA 4S32A 4CKJA 5JFSA 2XRWA 3BQCA 3QGYA 3GCPA 3QWJA 3G51A 3HAMA 4JRVA 5HZNA 4XBUA 1OIQA 2W1HA 2PK9A 2W4KA 5DE2A 3E3PA 1E1VA 2PVRA 3E62A 3FZTA 3NW5A 3O2MA 1OUYA 4FIGA 2H6DA 4IZAA 4MD7E 2EXEA 5DI1A 4LOPA 3GC0A 4EKKA 3ORZA 3WZJA 2HZIA 4HNFA 3QHWA 4AW5A 1RJBA 4CQGA 2YM8A 3UDBA 2OJGA 2I40A 4F0GA 3Q4ZA 4EH6A 3FEGA 5IEYA 4I4EA 3IECA 2XVDA 3L9LA 4FKVA 4AFEA 3BGPA 3BPRA 3L1SA 1KV1A 1OL2A 3PA3A 3ZRMA 3II5A 2XBAA 5GJDA 3VS5A 5IUGA 3DK6A 1J3HA 4FTJA 5IQEA 4CZUA 3C5UA 4USEA 2X8DA 2HIWA 3COKA 3EN4A 3JXWA 3F69A 3QALE 3QQKA 4ZJVA 5CU0A 3V5LA 4AW1A 3AOXA 3EB0A 2QO2A 4K8AA 2YM6A 4TTHB 4ACCA 3MV5A 2I6LA 4RQKA 4JBVA 4F08A 2WQNA 3UZTA 3OY1A 1BMKA 4KB8A 4UXQA 4MXCA 4DINA 3OROA 3PXZA 4O2ZA 3GVUA 5AM6A 2GNIA 4KSQA 5LVLA 4BGHA 4AN2A 4G6OA 3V6RA 4RJ8A 3BYOA 5IISA 4C0TA 1U54A 3EH9A 2JC6A 2GPHA 4FC0A 4QMMA 2XNMA 4MXXA 5AP5A 2PVKA 5EG3A 4RWKA 4D1SA 3TJCA 4D4YA 4UEUA 4QQTA 4XP3A 4QTEA 3EIDA 3V8SA 1YKRA 2GHGA 5AAFA 2HXLA 1PMVA 1STCE 3BWJA 3F3TA 3PJCA 4Y83A 1OBGA 3PE2A 3BGZA 3BKBA 3TG1A 4XLVA 3PVUA 1FMKA 5HLWA 3GU7A 4AGCA 3R63A 4G5PA 4IANA 2E2BA 3QX2A 1VYZA 3LCSA 3FQSA 4PQNA 2OW3A 4YC6A 4U79A 2JAMA 5FEQA 5K0XA 3QYWA 1U5RA 5F1ZA 2QU5A 2HXQA 2ZOQA 3GGFA 3NS9A 4DAWA 4FKJA 4O22A 1Q8UA 3WE4A 4O2PA 4AOIA 4PMPA 5A14A 5M4UA 5BNJA 4XNEA 2XIKA 5K5NA 3BHHA 5CNOA 3FC1X 2Z02A 4QT1A 2Z60A 2RFSA 3BU6A 3FY0A 3TNHA 2BRGA 3UJGA 5KMNA 3CEKA 2OU7A 2XNEA 3KY2A 3OWKA 2C6IA 4PPBA 4BGQA 4NJ3A 4RIWA 2W1FA 4CV9A 5M57A 5IDPA 2QOQA 3D94A 3RM6A 4EOPA 1GZ8A 4MTAA 3SW4A 4E6DA 4YTCA 3MTFA 3PPZA 1YXXA 2QHNA 4OGRA 5BVFA 2NRYA 3FMHA 4L53A 5HO8A 3ZOSA 4DFXE 1KUTA 5EQPA 3D5UA 4H1MA 3FHIA 3PIXA 5EKOA 3BHYA 3JYAA 3OXTA 1M52A 3OT3A 3R9OA 3R1NA 4FSZA 1NA7A 3TKUA 3Q4UA 4YTFA 3ORTA 1ZMUA 3Q9XA 3E64A 3IONA 4ZLOA 4RWJA 3P86A 4XV3A 2YZLA 3D5VA 1Q8WA 1PXMA 2XIRA 3F82A 4E8AA 5GZ8A 3E7OA 4IX6A 3FKNA 3QX4A 5ANIA 5JSMA 1P4OA 5EYMA 4MNEA 3NNUA 3NWWA 4LOOA 3TUDA 1Q3WA 2DYLA 4KD1A 4PP9A 1ZARA 2QLUA 4WO5A 4MK0A 3LMHA 3VVHA 4I3ZA 3CSVA 3IKAA 4D4RA 3CY2A 5E92A 3SOAA 5A54A 4HW7A 4FIIA 3A60A 5CEIA 2FA2A 3R7YA 4IFGA 4K6ZA 3SW7A 4FTOA 3R8LA 3PRFA 4QQJA 3O71A 2WMBA 2J4ZA 4C3RA 5GIPE 3AGLA 3FI2A 3NX8A 3ZO1A 3GOKA 4BKYA 2UW4A 3PDTA 4H3BA 5EM6A 2CKEA 2PVFA 4U97A 2FSOX 4HPUE 5HX8A 4C8BA 5CAUA 2W96B 4FF8A 3PXKA 4E5WA 2ZAZA 4X2KA 4FTIA 4XG2A 3MYGA 1AQ1A 5AM7A 3W2OA 4IM0A 4J96A 4ALVA 4EHEA 4HYSA 3GC9A 2YDKA 4OTIA 5HCXA 4H05A 1WBTA 2UUEA 2PSQA 4RIXA 4RWLA 2OJJA 4AE6A 3LM0A 4FZAB 4CFNA 3D4QA 4X2FA 4XS2A 1WMKA 4ITHA 1RE8A 5FEEA 3CBLA 5IA3A 2Y4IB 2R0UA 4B99A 3QRTA 4U3YA 1JSTA 4MKCA 1RDQE 4O86A 1Q99A 4P4CA 5LOHA 2JITA 2VTJA 3BZ3A 4PMTA 1CDKA 2BHEA 4B7TA 3V8WA 2I1MA 1DS5A 3FV8A 4YTIA 4BCHA 4LUDA 4Z55A 3BYVA 4YPSA 2BHHA 1BI8A 4G2FA 2QKRA 3CGFA 3CTJA 3VS6A 2CNVA 3SHEA 2YM5A 2Y0AA 1TQPA 4G31A 4BTJA 3FC2A 3NUXA 4XG9A 3EFJA 3OXIA 1UA2A 4O21A 2LAVA 2PULA 4RVTA 5ACKA 2WQOA 4E5AX 5HX6A 4JX7A 4YLJA 1OKYA 3H9FA 2OF2A 4B8MA 5HHWA 5H8GA 3TNQB 4F64A 3MPTA 3IQ7A 4HZSA 2FO0A 1SNUA 2X2MA 3KEXA 5DWRA 4PDPA 4O7LA 5J9LA 4PMSA 4DFUA 3G90X 5DRBA 2WMVA 3T9TA 1CKIA 2ERKA 2R3FA 4AZEA 2HENA 5EQEA 4IADA 1UKIA 1OL1A 2OH4A 3QC9A 5L6WL 4RFZA 4DYMA 4EOOA 5HE0A 1Q4LA 4TXCA 2WEVA 3LFBA 4FR4A 3ZUTA 3QQFA 2R0IA 4BDHA 5EW3A 2PMNX 2OBJA 2QG5A 4EC8A 4FSUA 5CSVA 4ZXTA 2CGXA 2OZOA 3O8PA 5HBHA 4BC6A 3OZ6A 4BCIA 4EOKA 1IAJA 4FTKA 5BUIA 4H58A 5KKRC 1M7QA 5E8SA 2I0EA 1ZY5A 2WXVA 3CTQA 2WO6A 3QBNA 4YGAA 2Y6MA 5T6KA 3WBLA 2J0JA 4XP0A 4ANQA 3QXPA 4G6NA 5AA9A 2UZEA 4AA4A 4L68A 4FTUA 4U8ZA 4QPAA 4BVUA 4TYHA 4FTNA 4WG4A 2WNTA 2CMWA 4X3JA 4AF3A 4ORKA 4DFBA 2GQRA 4YZBA 3R1SA 3UG2A 1PXOA 4V0GB 4ANNA 2YN8A 2PY3A 2WOTA 3UP7A 3NVMB 1LPUA 1FGKA 2OFUA 4QTCA 2UVYA 4X6QC 4YC3A 4NL0A 1BL6A 2CDZA 1XH7A 3LJ0A 4G3DA 2QOBA 5JH6A 3KREA 3VRYA 4JL9A 2G9XA 2HELA 4WNMA 3KRLA 4AP7A 4M69B 4C2VA 4DH5A 2UZOA 4AE9A 3CGOA 1YOMA 4IX3A 4W4YA 2GMXA 4IX4A 3U4UA 3S0OA 2IVSA 1NY3A 4IWQA 3BCEA 4USDA 5FGKA 3KXMA 3LQ3A 3O17A 5E8YA 5ACBC 3AD6A 2WMRA 4IB3A 5CZIA 3R7OA 4M84A 4JS8A 2PWLA 5DH3A 5BVNA 4ZMFA 4ERWA 3HEGA 3K3IA 3HA8A 2WEIA 5CI6A 4O96A 5AR2A 5HIBA 3U9CA 4ZOGA 3RCJA 1W84A 3DCVA 4L67A 1FINA 3QZHA 4NM5A 4BCPA 4EK8A 5A4LA 2HWOA 3RP9A 4MWIA 5CALA 4F6WA 3AMBA 3F6XA 2ZJWA 4JIAA 3TKIA 2PUNA 3WE8A 2JD5A 1XH4A 5HQ0A 2C69A 4R7BA 4Z7HA 4FV2A 1YXTA 2IVUA 3DNEA 3FZ1A 1OGUA 4EOJA 2QODA 4GFGA 1OI9A 3FJQE 2C5YA 3H3CA 3PYYA 3H10A 4I0RA 4DEAA 2A19B 3HUBA 2FSTX 3TWJA 3OW4A 2J5EA 5JT2A 3BU3A 2C1BA 1SYKA 2WGJA 4XH6A 3EN7A 2ZB1A 4EI4A 4I6BA 3VW8A 1Z9XA 3CE3A 3KXZA 1LR4A 2FSMX 4IVCA 3RVGA 3U6IA 2R3LA 4DT8A 1NXKA 3GENA 4AGWA 4OTFA 4LFIA 4BBMA 4EHGA 5TF9A 5F4NA 5JFWA 5E8ZA 3UQFA 2ZDTA 5IH5A 3E8NA 5K9IA 1Q61A 4L3JA 4QMNA 1WBVA 4GMYA 4DEEA 2GSFA 1R0PA 4J98A 3VUIA 2PL0A 3BIZA 3C7QA 5CEOA 4XG7A 4G5JA 5DNRA 2XIXA 3G0EA 2YITA 4EJNA 3LE6A 2XNPA 3ZZEA 3P7BA 2CJMA 2W9ZB 4X0MA 5CEPA 3IDBA 2QCSA 1V0OA 4P7EA 3DXPA 3CY3A 3KF4A 2KULA 3C4XA 4PF4A 4CMOA 3F5XA 4LRMA 3IOKA 1ZAOA 4FZ7A 3TZ7A 3V01A 4DH1A 2JFLA 2ZV7A 3R2BA 2RIOA 2ITVA 4X2GA 1YVJA 3PTGA 5M06A 4FK6A 4R1VA 3UPXA 1PYEA 2PE1A 2OIQA 3ZFXA 2IJMA 5KX8A 1L3RE 4EORA 3MVHA 4UZHA 4M12A 3BWFA 3FUPA 3NYOA 2PHKA 3KL8A 3VBWA 1OL5A 1YXVA 2X9EA 4ALUA 1X8BA 1Q62A 4QMQA 4FSMA 3P23A 2UV2A 4II5A 3GUBA 4R7IA 5IMEA 4E5BA 4S2ZA 5FBOA 5AUYA 5A4TA 3BELA 5CXZA 2FYSA 3QD3A 2C47A 1PHKA 4D9UA 2YEXA 3ROCA 3FI8A 5HVJA 4GK4A 2WB8A 1PF8A 3QKLA 4FUYA 2X4FA 3GFEA 4BYIA 2Q0BA 2DQ7X 5KHXA 1JPAA 2V62A 2WZJA 4F7SA 3B2TA 5DFPA 3Q60A 3SRVB 5HD4A 4CSVA 2JBOA 3O7LB 1A9UA 1GNGA 1PMUA 4Y8DA 4J8NA 4BBFA 5E9EA 4EK3A 2OZAB 3W8LA 2XIZA 3NCZA 2VO7A 4CQEA 3LCDA 5J1VA 4JR3A 4BCKA 2R2PA 3PPJA 3RWPA 3OWLA 3PUPA 3WZUA 1CKJA 4F09A 3KULB 3V5PA 4DEHA 3I5NA 5AV3A 4DITA 3IOPA 2I0HA 3FLWA 4AN9A 5M4IA 3R7UA 2GCDA 2Y4IC 4ZZMA 1J7IA 1KE7A 4R3RA 3NNVA 4K77A 4HVSA 4TWNA 2VWVA 4ZS4A 3NRMA 4J99A 3MFTA 4IB1A 4MBLA 3GC8A 4JBQA 1Q97A 4O0VA 4UV0A 2XJ0A 5KMOA 2XEZA 4ANSA 5M56A 2PZ5A 4JR7A 5AP1A 2GNLA 2VWBA 3K2LA 2ZMCA 3ROYA 2PUUA 4IMYA 4HGTA 3VBXA 2HYYA 1WFCA 3MS9A 5KCVA 4P5ZA 4GFMA 4IW0A 2YCRA 4P90A 4Y72A 4UBAA 4DN5A 5CEKA 4C7TA 4PY1A 5ANOA 3FMKA 4AU8A 2R7BA 3DQWA 4JG8A 2OJ9A 4QYHA 2IVTA 3RZFA 3UP2A 3Q2JA 5KNJA 5LWNA 4I23A 4NIFB 4UYAA 5DA3A 5HE2A 5D11A 3NW6A 3JVSA 4QYEA 4RG0A 4TPTA 2HAKA 3P1AA 4O84A 4F9AA 4FE2A 4S33A 5JFVA 2WTKB 4PNKA 4XV2A 2BRHA 2JIVA 4E93A 4QP9A 1YRPA 2PZPA 3EKKA 4ZLZA 2GQGA 3KRXA 4PNIA 3M11A 1URCA 2W4JA 4O91A 2H96A 4KNBA 4ASZA 2VTIA 3OOMA 4YZNA 3QCQA 5E1SA 4ONAA 5L2TA 3OOGA 2Z7LA 4QYFA 4C33A 5CAOA 3DFCB 5J9YA 3KXNA 4GS6A 1YOLA 2QOHA 4QMXA 1H28A 4DGNA 4BTKA 4YO4A 2BDFA 2IN6A 3QTQA 1XH9A 5AEPA 2OH0E 3FQEA 2Y6OA 2R3HA 2YHVA 3EL8A 3PP1A 4UY9A 3KC3A 3VBYA 4O0WA 4UN0C 5IA0A 2R4BA 4O7ZA 3UOHA 4G17A 3UBDA 1M14A 4KIQA 4PMMA 4Q9SA 2W1GA 3C0IA 2EXCX 3DXQA 5EKNA 4PDSA 5IG1A 5E4HA 3A99A 3W2CA 3FBVA 4AW0A 4D2SA 4B8LA 2GFCA 5BUJA 1J7UA 4U81A 2ZVAA 4MQ2A 4KABA 3QZGA 3RJCA 2J6MA 2B4SB 2JDOA 3GOPA 4I5CA 4Z9LA 3FI4A 3DOGA 4U9AA 5AV1A 3JVRA 4DEBA 4RX8A 1SZMA 4YZ9A 3OCTA 4FIEA 4YJRA 3UNZA 4AOJA 2CNUA 3ZXZA 4CG9A 1OKWA 2QNJA 3SC1A 3RAHA 1M7NA 4JLCA 4YJPA 4BDAA 5AA8A 3Q6UA 3A4PA 4FNXA 2GNFA 2PE0A 2W06A 4PUZA 1QPDA 2DS1A 4DG3E 1QPEA 1YXUA 4DCAA 2YDIA 3SGCA 3AGMA 3OF0A 5JGDA 3W55A 4W9XA 3NLBA 3R01A 3E8DA 2UW9A 2VU3A 4QMSA 4YJOA 3C4FA 3ERKA 3OEZA 3SV0A 4MXOA 4AG8A 3EYHA 5D7VA 3FZOA 3E92A 3QTUA 4GL9A 3HRBA 4FG9A 4FV6A 3H9OA 3HMPA 3NAXA 3WF7A 2PYWA 5C1QB 5HESA 3UNJA 4ARKA 3ELJA 3HRCA 3PZEA 2ACXA 5HTCA 1H24A 3Q52A 4ASEA 5D9HA 5H3QA 2JAVA 2OIDA 4MXYA 2C5OA 3BYMA 3QTIA 2QO9A 3MH1A 2VNWA 2BTSA 5KMIA 4H36A 4I21A 5HIDA 3GXLA 3RINA 3QUPA 3AT3A 4I6HA 3C50A 4KKEA 3F61A 3HA6A 4V04A 3R9HA 3D2KA 5H8EA 4FNZA 4GV1A 4BF2A 2B53A 1GIJA 4GU9A 4IEBA 5KUPA 3KRRA 3I5ZA 3FMEA 3PY3A 4G3GA 4PL4A 5D7AA 1OPKA 3DJ7A 3QRJA 3VBQA 3MFSA 3TIZA 3R2YA 3V5WA 4F1OA 3BYSA 2VWXA 4DFNA 5A9UA 3PXQA 4U80A 4CT2A 3MBLA 1KE9A 4FKSA 2G1TA 4R3PA 3SA0A 3FXXA 3R6XA 3Q4CA 3CKWA 4AFJA 2C6OA 3GQLA 5DT4A 2PVMA 3F3UA 4P5QA 3VULA 4CCBA 3QQLA 3IGOA 3LKMA 2X8IA 4LYNA 4USFA 3PA4A 3FLQA 4BWXA 2UW0A 3CPBA 1K3AA 3ZHPC 2OKRA 4DE4A 2HY81 2XZSA 3CQWA 3R73A 4DFYA 3FDNA 3RCDA 4IAZA 5DR9A 2E9VA 2YFXA 2XK7A 3L8XA 5JRSA 3V6SA 2WMSA 4IAAA 4KIKB 3ZRKA 2W9FB 3VN9A 5B2LA 4D9TA 3OD6X 3PJ1A 1J91A 4WIHA 1UU7A 3QQJA 3BLQA 5I0BA 4TZRA 3SOCA 3KXHA 4P2KA 3I6WA 5CWZA 4LL5A 4F9YA 4RFYA 5L3AA 2EXMA 2CCIA 3D2IA 4QRCA 3F2AA 4MXZA 2YJSA 3RPYA 5DYJA 2GNHA 2J51A 4YZDA 4WOVA 3RPRA 4W9WA 1IG1A 4WBBB 3EJ1A 5HG9A 4APCA 3G0FA 2P33A 4OT5A 1WBOA 3TT0A 4IWOA 4KSPA 5CVHA 3WZKA 4NH1A 3OCBA 3ZFMA 3QU0A 4O81A 2CSNA 4O7VA 4CT1A 4D2TA 1BX6A 4JVGA 3ID6C 4NK9A 5HBEA 3EQIA 2QG7A 2VWUA 3FAAA 4HPTE 2R3OA 2CGUA 4BN1A 2UVXA 3BLRA 1YDRE 3QKMA 5BYZA 3BE9A 4OTPA 4EBWA 5HBJA 3PP0A 2ITPA 5J5TA 4FKTA 3D7TB 3E5AA 4IC7A 3ZCLA 3NUSA 2Y7JA 1P4FA 2RKUA 1PMEA 2UW7A 4M66A 4M67A 4MEDA 4RVMA 3RBWA 4FIFA 3UIUA 2YAAA 3CQEA 2PZIA 4R6VA 4WNOA 4HCUA 3CIKA 4CZTA 3UYSA 4EOLA 3DJ5A 5CU2A 4BI2A 2GTMA 3FMLA 3R1QA 2XK8A 2NP8A 2EB3A 2WQMA 4AT3A 4W8DA 4CFMA 2YIXA 5EHYA 5A3XA 4FZDB 3FXZA 3S4QA 1XH8A 2VD5A 3GP0A 3DK7A 3EQHA 3GBZA 4E26A 3BLHA 3OMVA 4YJSA 3QCSA 1W7HA 3C4EA 1W82A 2BDWA 3JUHA 2BILB 3QZIA 3PFQA 1MRVA 1CMKE 1OIUA 2ZV9A 4H39A 4JOAA 2ETKA 1GZKA 2OXXA 4PP7A 4YHFA 3LFNA 2VRXA 4EH8A 4HVIA 4L45A 1UU8A 4BCQA 2X7FA 3LVPA 5HG7A 2Y4PA 5LJJA 5HG5A 2QU6A 3FSFA 4YJNA 5CNNA 3FLSA 2VUWA 2NPQA 3LPBA 3QTRA 4G34A 5F20A 3QFVA 4FV3A 3AT4A 3LCTA 3L8SA 4KRCA 4WBOA 3RHXA 3ATSA 3R9DA 1HOWA 1UNGA 2UZTA 4R8QA 2OSCA 1Q41A 3ZTXA 4E20A 3JY0A 5IH4A 3NR9A 5G6VA 4JDIA 4FSTA 4TWPA 4Y73A 2F7XE 5D41A 3VNTA 2XS0A 1Y6AA 1XJDA 2YIYA 4E6QA 2X8EA 5IQCA 4V0GA 3GCSA 3R7EA 3KCFA 4FSWA 2Z7SA 4GJ2A 4PRJA 4PWNA 1XHAA 2ZYBA 3LQ5A 3F7ZA 2VTRA 2QQ7A 4E4LA 1ERKA 1E1XA 4IAKA 4GCJA 3JPVA 2YACA 5DHJA 5KO1A 4YNEA 2PUPA 4OT6A 3Q53A 3QCXA 4KBAA 2OXYA 2EVAA 3ZRLA 1PRYA 2A2AA 4TNBA 3UTOA 2UZLA 1FBNA 4GEOA 5CANA 4EWHA 2CNQA 1OVEA 2B9HA 5HVYA 4YR8A 3VUTA 3VS1A 5A6NA 4LMUA 5BYYA 4ASDA 2J50A 3A7FA 1ZMWA 3C1XA 3QC4A 4DGMA 2W0JA 4G3EA 3HECA 4YHJA 5JN2A 3KXGA 3RZBA 3DBEA 2HOGA 1DI9A 4TYJA 4WA9A 4PTCA 3HMOA 4A4OA 5C8NA 3F3ZA 1YWVA 1UKHA 2NO3A 4CV8A 3V04A 2H34A 1Q5KA 2XJ2A 3ZDUA 2HZNA 3A7GA 3MB6A 3R9RA 1HCKA 3OW3A 4JXFA 2YLEA 3IPHA 2JBPA 1A48A 3SVVA 4RX9A 4AZWA 5EDQA 3TUCA 5BUEA 2WMQA 4L9IA 3RAKA 3LFSA 4D55A 4BCNA 3ENMA 2YDJA 2Z2WA 5C27A 2VAGA 5T3QA 1KSWA 1VR2A 1VYWA 3RPSA 4RIYA 3FYKX 5LMAA 3D9VA 3FY2A 1FMOE 4BWPA 3FL4A 3D7ZA 1QMZA 3DAEA 3HAVA 4K1BA 4PX6A 1R78A 3L9NA 4MD8E 2REIA 4L52A 4G9CA 5HNBA 4A9RA 3UVRA 2A0CX 2W1CA 4QOXA 3QYZA 3G9LX 4R3CA 3TDVA 3PJ3A 4BDEA 4JI9A 4KKHA 4UZDA 2IZRA 2X39A 3UVQA 1SVHA 5CT0A 4AA0A 4A9UA 1ZYDA 1H1QA 3Q96A 2HK5A 3AD4A 4L7SA 4J1RA 1B38A 2C3IB 4EONA 3TDWA 3PG3A 3VBTA 3W16A 4W4WA 3V5TA 3FL5A 2W1EA 3KVXA 4IAIA 4BDFA 3CS9A 1YHVA 3K5UA 3UE4A 4YU2A 1OMWA 4QMZA 2J90A 3DB6A 4RJ5A 4FVRA 3LLTA 1W0XC 3U6JA 2R3QA 1Y8GA 4DF3A 4EH7A 5AUWA 3U9NA 5HCZA 3UIXA 3F88A 1WBSA 2BMCA 4CGAA 3UYTA 4RC2A 3QQHA 3FPQA 2VTOA 4JG6A 3UODA 3RNYA 4QMOA 1XWSA 2XKDA 5L8KA 5M51A 4YURA 2BAQA 5CQUA 3WF8A 3WF5A 3D0EA 3L9PA 2DUVA 2ITUA 3LXNA 5I9UA 2X1NA 3VUKA 3TI1A 3ACKA 4O0XA 4X3FB 4PTGA 2B55A 4RC4A 4AS0A 2B9FA 4DC2A 5BQ0A 1LP4A 2QOKA 4JJRA 4NM0A 4BY9E 1ZOGA 4FL2A 1Y8YA 3VW6A 2QHMA 1TKIA 3A8WA 4EYMA 3MN3A 3AMAA 4FTRA 2ZB0A 3UQGA 3C4WA 2AYPA 3C51A 3CD8A 3C4ZA 1O6KA 2JIIA 4BBEA 4OBQA 2PU8A 3NNWA 3MTLA 3TNIA 5J1WA 3GCUA 5BVEA 4EQMA 4D2VA 1ZYLA 1JOWB 1P2AA 1BLXA 2IW6A 1KOBA 3Q9WA 3RM7A 3KB7A 5FG8A 4YUQA 2XB7A 3GT8A 4RRVA 5AP0A 3LFEA 3I7CA 4BTFA 3EL7A 4K9YA 1WZYA 3QZFA 2F4JA 2WAJA 3KA0A 2G2IA 4QTBA 3FMNA 3HUCA 2WMUA 4FV7A 3SRVA 3LAUA 3V5QA 2E9PA 3T3UA 5CF4A 3WIKA 2Z7QA 4ZJIA 3MH2A 1H1PA 5IUIA 4C4IA 3DTWA 1IA9A 2OZAA 5H9BA 2R3RA 4ZSLA 4F7LA 1B6CB 4Q9ZA 3W2QA 5H2UA 4UX9A 2Z8CA 4TYGA 3QTWA 2BIYA 2I0YA 4FV5A 5IF1A 3DAJA 4I6QA 3PVGA 3DA6A 1MUOA 3HGKA 3UG1A 4QPMA 3QKKA 4QTAA 3R00A 3DNDA 2Q0NA 4YO6A 5G1XA 1H26A 1Q24A 5GJGA 4DLJA 4ZY5A 1YI6A 3MA6A 3TXOA 3UIBA 4IC8A 4QQ5A 5EOBA 3P79A 1OL6A 2XK6A 4MVFA 1Q3DA 4OR5A 2B54A 4FNWA 1JSUA 2ITQA 1URWA 4RJ4A 3UC3A 2V7AA 3A8XA 3QD2B 1ZZ2A 3OCGA 2J0IA 2IW9A 4IE9A 5HG8A 2HW6A 4YZMA 3NIEA 1OM1A 4FEVA 4RFMA 2ITXA 2WIHA 4N6ZA 1FVTA 1REJA 4MX9A 4N0SA 5HEZA 4ERKA 1R39A 3FMJA 1UU9A 1K2PA 3FZPA 4XMOA 3W32A 3FWQA 4YSJA 1Y6BA 4NEUA 4HYHA 3ZSGA 1GAGA 4L43A 4KRDA 3H9RA 1CTPE 3HDNA 3FSKA 1OECA 3UMWA 3F66A 3ORNA 4BKZA 5F9EA 3LLAA 5J79A 4IM2A 3IDPA 4X7QA 2XIYA 4GIHA 3EFKA 3FZSA 1PY5A 1YOJA 3PIZA 4QMUA 4AZVA 2IW8A 4DBNA 3QQUA 1BKXA 4FOBA 1U54B 1VJYA 5ETCA 4YLLA 4IJPA 5JQ8A 3DKFA 4M7IA 4I92A 5IA1A 3PSBA 3ORIA 4FKWA 4ANMA 3TKHA 1GZNA 3DZQA 3TEIA 5EW8A 4UALA 2NNWB 2BDJA 4ZSGA 2PPQA 4OW8A 4RSSA 3C4CA 1K9AA 3QWKA 3LFCA 2YIWA 5D1JA 5JZJA 2R3KA 4U43A 1H8FA 1KV2A 3HV6A 4WSYA 4BDJA 4BGGA 5CU3A 4KAOA 4CFUA 3HYHA 3EWHA 3NEWA 1XQZA 1Q8YA 4I22A 4RQVA 3QAME 5JRQA 2UW3A 3IK3A 1XO2B 3SKCA 5J9ZA 2JIUA 2PVLA 1PYXA 2JKOA 4I93A 4YBJA 2AUHA 3RHKA 3GC7A 1FVRA 1DAWA 3LXKA 2IO6A 3W10A 2NRUA 3RNIA 3LZBA 1PKDA 4EOSA 4HJOA 5EI8A 3V5JA 1BYGA 3R02A 5DR2A 4BIBA 2X7GA 3I1AA 4BYJA 3OT8A 4G1WA 5J7HA 3PA5A 4NT4A 3VBVA 4NWMA 4RIWB 1LEWA 2VGOA 2HWPA 4EHVA 2IWIA 2C3LA 2C6TA 2WELA 5AR5A 3LJ1A 4C4FA 4D2PA 4DH8A 4DG2E 4F0FA 3CP9A 4GK2A 5K4JA 4W4VA 3C0GA 1JKSA 1BL7A 1SNXA 3WF6A 5LVNA 5CAQA 2V0DA 2W4OA 2FGIA 4F4PA 3RK9A 4XG6A 4C36A 5IA5A 4GUBA 4E6AA 3LIJA 1SVEA 4PV0A 2QOCA 4D58A 3DT1A 3E7VA 3THBA 5DR6A 4CRSA 4QMLA 5AADA 3E93A 2ZV2A 3DFAA 4J52A 2O3PA 4IZYA 2GHLA 4FZFB 4JRNA 4XCUA 5CXHA 4U5JA 4NM7A 2LGCA 2O64A 2QC6A 2C5NA 1WCCA 4U41A 3ZU7A 2ITZA 2VX0A 3DJ6A 4FYOA 4IDVA 4FGRA 5HU9A 5HVKA 2PZRA 5FM3A 3UPZA 1JWHA 2RG6A 2YWPA 3EQPA 5FXRA 4ZTLA 5CAVA 3TZ9A 1PXJA 4GW8A 5BYLA 3MA3A 3LFAA 4OBPA 3M1SA 2RL5A 2XMYA 3VQHA 4FKGA 5FD2A 2H8HA 3R21A 2E9UA 4GKHA 3F7WA 3SLSA 2VTHA 2W99B 4J53A 3Q9YA 4E7WA 2GS7A 5C9CA 4EH3A 4CXAA 4QP2A 4F70A 4PL5A 5K4IA 5K5XA 4X2JA 5DLSA 2X7OA 3KQ7A 3W2PA 4O7YA 4C58A 2OLCA 2WMAA 2XRUA 4M3QA 4X6RA 3ORKA 4BHNA 4QYYA 4NYEA 1YHWA 4OTQA 2BPMA 1W8CA 2CPKE 2HZ4A 5CSWA 4G3FA 5A4EA 3P08A 5L4QA 1V1KA 4TYIA 3BV2A 4XRLA 3BHVA 1H25A 4C61A 4FMQA 4F7JA 4L44A 3GU4A 4RGJA 4FG8A 4H3PA 2XYNA 2RGPA 3H4JA 3DAKA 4FVQA 4RIXB 2UW8A 4IWDA 1OUKA 3QRKA 2VWWA 3BX5A 4GT4A 5L2QA 1JSVA 3MVLA 3OHTA 1NVSA 3AD5A 5FDPA 3EMGA 5B0XA 3QTSA 4O6EA 4U6RA 3PY1A 3ORPA 3CTHA 3DXNA 3I0OA 5EYKA 5IPJA 1IAHA 2YCFA 5M53A 1CM8A 4LMNA 4R1YA 3VUDA 3G33A 2VTNA 3PE1A 4JBPA 4AACA 1H4LA 2C0OA 4KIKA 5CF8A 5AFVA 5FTGA 2F7EE 3ODYX 2A27A 3KCKA 3MGYA 2JDRA 3VF8A 3ZUUA 4RWIA 4X21A 4YP8A 4CYIA 2V7OA 3W18A 1RW8A 3HV5A 4F1MA 5IKWA 3ZM9A 4XOYA 5A46A 2RG5A 3B8QA 4IM3A 3COMA 5BX0A 3V8TA 4YJQA 4C35A 3P7AA 3DU8A 4FKPA 4A9TA 4RZVA 4IVBA 3AC3A 1P5EA 2VO3A 2UZVA 3A7JA 3NCGA 3IGGA 4D4VA 5LXMA 3LFFA 3GU6A 4EOQA 3UC4A 3W2SA 3JY9A 2JEDA 3MPMA 4CZYB 3E63A 4XRJA 4FT0A 5I3OA 1WBPA 3R1YA 3VS7A 4BCFA 1V0PA 2J5FA 3LHJA 3WI6A 1H08A 3D5WA 4CFFA 4FSRA 1I09A 4BCOA 1GIIA 3R8MA 2C6KA 4HGEA 2C6LA
chains in the Genus database with same CATH superfamily
4NKSA 2AC3A 3MB7A 1LUFA 2RSVA 5IH6A 2OICA 5AR4A 4DLIA 1FVVA 2XEYA 1FPUA 3QTXA 4ZTNA 3ZO2A 5AV2A 4QTDA 4NJDA 5I9VA 4KA3A 2SRCA 1WBWA 1IA8A 1PMNA 4IFCA 5H8BA 1M17A 1EH4A 5EW9A 2OO8X 3KN5A 4RBLA 2CKQA 3MY0A 3TZMA 3AKJA 4GVAA 3VUMA 3F5GA 3MY5A 3I81A 3HNGA 4V05A 2OJFE 5FEDA 3R8ZA 2VWZA 4TYHB 3OBJA 4IIRA 4AUAA 5C03A 2UZBA 1H1RA 3NUNA 2XNOA 1OZ1A 4BR3A 4OTWA 5KMJA 1NVRA 4NU1A 3BLAA 5E91A 1H01A 2VO6A 5CASA 4ZMEA 4IZ7A 1W83A 4E3CA 4EJ7A 4JQEA 2BRBA 4CNHA 3ZSIA 3QL8A 3S3IA 2XCKA 3DY7A 4MQ1A 5ITAA 2X4ZA 3EKNA 4DH7A 4EK6A 3Q4TA 3LXLA 3DTCA 3IW6A 3S95A 2YM4A 5HORA 3UVPA 4TKSA 5IQAA 5FXQA 4C02A 4B6LA 5HLNA 1XH6A 2EB2A 3TNPC 3LM5A 4FV8A 4D1ZA 2YAKA 4BI0A 1PXIA 3BE2A 4S31A 2BROA 5ANJA 4IDTA 5AWMA 5JKGA 3WARA 5AIRA 2HY0A 3ORMA 4APPA 4GVJA 4UWCA 4FKOA 2WHBA 2W17A 2QOLA 3C13A 4ALWA 4FZ6A 5CSXA 4E6CA 2CGVA 3CD3A 2I0VA 3BV3A 4U40A 2VO0A 2C5VA 5IQIA 2WOUA 5I9WA 4EOMA 4O0UA 4UWYA 3EZRA 5JFXA 5J8IA 5AAGA 4S30A 1XH5A 1UNHA 4WUAA 3Q3BA 5KZ0A 4ACMA 2YCSA 2PZYA 3FQHA 4RJ3A 4XOZA 4FTTA 5K0KA 3ATTA 3QXOA 2O0UA 4BRXA 5IU2A 4DEGA 2R3JA 2ITWA 5DMZA 4OLIA 2R5TA 1WVYA 3UO4A 3VUHA 1OL7A 4C2WA 5AUZA 4IWPA 3MDYA 3WZDA 3N4VA 2PTKA 3I60A 3Q5ZA 3R04A 4E73A 3PWYA 5CQWA 5EH0A 3RALA 4RX5A 4A9YA 1TQMA 2XCHA 4F6UA 5A4QA 4EQUA 5B2MA 2YCQA 4QQCA 3LCKA 3VRZA 2UZNA 3LMGA 4Q5EA 2ZDUA 4EH2A 3AXWA 2JDVA 3POOA 2A1AB 4OTHA 1YI4A 4G9RA 4FEWA 4TY1A 5FTQA 4DEDA 4BTMA 2XK9A 3QF9A 4ZZOA 1BUHA 3DKOA 4ZTMA 3P9JA 4M14A 2GDOA 5CLPA 3RI1A 5GNKA 2NYAA 1MQ4A 3W0NA 4BIEA 3UNKA 4R5YA 4KINA 3OY3A 2F57A 4IX5A 5HOAA 1H0VA 4ASXA 2PVHA 3O50A 5IQGA 1Q8ZA 4JX3A 3DV3A 4N6YA 2YM3A 4OTGA 4D0XA 3UDZA 2J9MA 5L2SA 2QD9A 2UW6A 2VV9A 3W2RA 4ANBA 2JKQA 3RPOA 5JGAA 1G8AA 5BPYA 4WT6A 5ETAA 3OP5A 2Y9QA 2GHMA 2YABA 1H0WA 3E88A 1W2FA 2A4LA 4KS8A 4ACHA 4DTBA 4GG7A 5EHLA 1JLUE 5AUVA 5JEBA 5FUTA 3DBQA 4Z7GA 3OG7A 5FP6A 3BYUA 4FYNA 3L8PA 1PJKA 4MWHA 4PDOA 5HICA 4EYJA 3IW4A 2X81A 5KMKA 4R78A 3DLZA 5EYDA 2GQSA 2XKEA 4CLJA 4AW2A 3ZZWA 4O27B 4EHZA 4R7HA 5A4CA 3TACA 5CU4A 5DRDA 4I5PA 4BIDA 2IEWA 4Z3VA 4Y5HA 5AUUA 4O83A 2AC5A 4FV0A 2Z7RA 1QPCA 2VWIA 5J5SA 3V3VA 4F7NA 3QLGA 4O7RA 4IVDA 4AXEA 3N9XA 4L42A 1PKGA 3DQXA 2HCKA 1FQ1B 3FMMA 3HRFA 4IJ9A 4U3ZA 3ETAA 1PXNA 2V5QA 4JNWA 4A4XA 3PJ2A 3R22A 1ATPE 4FEUA 4KIOA 4CLIA 4H1JA 5AP2A 1O6LA 4YJVA 4YJUA 1JBPE 3R7IA 1KE8A 5F94A 5C4KA 1JAMA 4HZRA 4CYJA 5DBXA 1Q8TA 3QUEA 4UMRA 5J7BA 5C4LA 2ZMDA 2GFSA 3NYXA 3VJNA 3TV7A 2PMLX 3POZA 4LUEA 5CZHA 4WRGA 4CVAA 4FTAA 4HYUA 3TNWA 4FA2A 3PJ8A 1IEPA 3HKOA 4I6FA 4YC8A 5L8LA 3O23A 3E8EA 2BZHB 2W7XA 5CI7A 4KUJA 4B9DA 5KE0A 5EQYA 3ZS5A 5AV4A 1JQHA 1WVXA 3FMDA 3GCVA 4E4XA 3S1HA 1WBNA 3NNXA 4JG7A 4AZFA 2WTJA 1GJOA 3ODZX 1PXPA 1QCFA 3A2CA 2VTSA 5E1EA 3R28A 3ZC6A 3KMWA 3ULZA 4BZNA 4CEGA 3D14A 3FXWA 4CTCA 1KOAA 3BGQA 2B52A 2VNYA 3FKOA 4GG5A 3VAPA 3SXSA 3W0SA 3CCNA 3M42A 2VTQA 5JQ5A 4UYNA 5BVDA 1G5SA 1XBBA 2QOOA 3QHRA 4TL0A 5CEMA 4AZSA 4RC3A 5HI2A 1NVQA 4JDKA 4A9SA 2X0PA 4O1PA 3OWPA 4NW6A 4U45A 3UOKA 2BFXA 2JKKA 2ESMA 1H27A 2W5HA 4FSQA 4ZP5A 5DEYA 1ZY4A 4QP7A 2ITOA 2R7IA 4FT5A 3MIYA 4I4FA 4L3PA 4YPDA 1J1BA 5FXSA 4L8MA 3KF7A 2WTVA 4RMZA 3NGAA 5DVRA 3FZRA 4LGGA 2YLFA 4WG3A 4DGLC 5KMLA 3W0PA 4NTTA 4AXAA 4MHAA 5BMMA 1KWPA 4FV9A 2R3IA 1CKPA 2XJ1A 4ZK5A 4AT4A 2WU6A 2ETMA 2IVVA 3UIMA 2XF0A 2XNGA 3P4KA 4J97A 2BKKA 4AAYA 2PVJA 4WD5A 4QPSA 3ZLWA 4CFVA 5DIAA 4EEVA 3Q6WA 5M4FA 2OK1A 4CFWA 2BAJA 4FKUA 1A06A 3NPCA 3PUFC 2BZIB 4NW5A 4F99A 4MF1A 4ACGA 4F63A 2XK4A 2YJRA 3K54A 4LG4A 3O7LD 4JAJA 3VQUA 4Y95A 4AA5A 2XANA 2QOFA 5ICPA 4JAIA 1KE6A 4FTMA 2W05A 3B2WA 3NZ0A 4XV9A 1AGWA 3A4OX 3UOJA 3P5JC 5LCKA 4O0RA 3LW0A 1U5QA 5I5ZA 4AOTA 4WSQA 3PG1A 4KIPA 1JKKA 3HLLA 4QP1A 3K5VA 4BICA 5GINE 2WTKC 3OC1A 3U87A 3EFWA 5FLFA 1ZYSA 2PVYA 4NZWB 2B1PA 2R9SA 2VTAA 3U51A 3S00A 1O9UA 2W5AA 4V01A 5CVFA 2ETRA 5KMMA 2BKZA 4EZ3A 1KE5A 2BTRA 3VS3A 2XM9A 3KMUA 4DTAA 2RF9A 4QP4A 4XLIA 2BFYA 4M69A 1YWNA 4JBOA 5E8WA 3HV7A 3ALNA 3EQRA 4MXAA 4XG8A 2OG8A 3MVJA 3OCSA 3RKBA 1YW2A 3SQQA 3U6HA 5E7RA 4DFZE 2BAKA 3NDMA 4K18A 3TJDA 4EKLA 4F1TA 5AR3A 4FKRA 3TTIA 3OUNB 4DHIB 4NFNA 4Q5HA 2GS6A 3E8CA 3R8PA 4CCUA 1PXLA 2UZWE 3QTZA 4EWQA 1XKKA 2X2KA 3K3JA 4JQ7A 1JNKA 3GB2A 2QR8A 4XP2A 3AC4A 5M55A 4RVKA 4XEYA 3SX9A 2G15A 3GFWA 5TR6A 2WMXA 5AR7A 1WVWA 2OGVA 3T8OA 4GFOA 3A7IA 4A7CA 5JMSA 5FBNC 2JDTA 4C38A 3DDQA 4MD9E 3ZXTA 3I79A 4C62A 3LMIA 2FUMA 2WQEA 3QD0A 1YXSA 3ITZA 4QMWA 2VX1A 4C4JA 3ZDIA 3NW7A 2WPAA 4LI5A 1GY3A 4HVHA 4RX7A 3TV6A 5L6PA 2GNGA 3MH3A 4ZTRA 4NSTA 5FWKK 5M44A 4UXLA 4O38A 4L01A 2OWBA 3GU5A 5EDPA 4MAOA 3HP5A 3ACJA 2CN8A 4GSBA 4DFLA 4FV1A 2R64A 2XYUA 4EC9A 1F5QA 2O63A 4C37A 5IA4A 5EDRA 2C0IA 1DI8A 4QP3A 4OAVB 2EUFB 4FT7A 4OAUC 5EK7A 5EI2A 3R30A 1G8SA 4D1XA 5A6OA 3I7BA 2JLDA 4O1OA 4W4XA 3QCYA 4Z16A 5AX3A 3P0MA 5CF5A 5I9YA 5CSHA 3NVKI 2YISA 3WYXA 4ANOA 5KBQA 4FT3A 4FK3A 4BCGA 3KFAA 2UW5A 1OB3A 4FKQA 4RLKA 4QMPA 5FRIA 5FTOA 1G8JA 2BRNA 2XA4A 4JDHA 3KK8A 4NFMA 3SAYA 3ZO3A 3R8UA 4DT9A 2VZ6A 2CHLA 5M07A 4O0SA 5HU3A 2IZUA 3NAYA 3G6HA 3TCPA 2OI4X 2IF8A 3GQIA 4L6QA 4WNKA 2F49A 4X2NA 4DA5A 2C3KA 4RZWA 3SG9A 2RFNA 2H9VA 2FB8A 2V22A 4FL1A 3BHTA 3VS4A 2W5BA 3NYVA 5HO7A 2B9IA 2R3PA 4FIHA 4N70A 2WD1A 2GU8A 2IG7A 4NCTC 4EQCA 3CJGA 3OTUA 1L8TA 3D83A 4CG8A 2P3GX 3DK3A 4QMTA 2B0QA 2BCJA 4DBXA 5CY3A 4IB0A 3RK7A 5DGZA 3A62A 1VZOA 3HL7A 3FLNC 1YDSE 2R3MA 4I0TA 4QNYA 5DG5A 5TO8A 3G15A 5B7VA 3G2FA 2E9OA 3JS2A 3MFRA 4Q2AA 3GI3A 3HMNA 3BU5A 5J95A 3UMXA 3VHEA 4EK4A 4ZLYA 2CKOA 4M8TA 3W8QA 1JKLA 1T45A 2HW7A 4QP6A 4U0IA 4W8EA 3DBCA 1ZOHA 3WYYA 4XJ0A 3WOWA 3CQUA 3ANQA 3BL9A 3PPKA 3QRIA 4D5KA 4AX8A 2YZAA 4C57A 3EN9A 4FIJA 3COIA 4ID7A 3TN8A 3DBFA 2VN9A 4ZTSA 3O8UA 4XV1A 3UO6A 4GUEA 2CCHA 3TV4A 4F65A 4XG3A 3Q9ZA 4EK5A 2FSLX 4FTCA 5HCYA 4M0ZA 4FOCA 4IXPA 4PL3A 3UQCA 3F2RA 3TYKA 5CX9A 2Y8OA 5CF6A 2XP2A 5DT0A 5GJFA 4RT7A 5KZIA 5E90A 3WZEA 2IPXA 1B39A 2OIBA 3DKGA 3OS3A 3I0QA 2JKMA 3KULA 3QRUA 4OUCA 3TZ8A 4DH3A 3CJFA 2ZM4A 2EU9A 4BI1A 4CFXA 5AUTA 2BIKB 4FKIA 3EQFA 4O6LA 3P7CA 4LL0A 2C68A 3FHRA 2CKPA 5TKDA 3KRJA 3EQBA 3ORLA 4FL3A 2XUUA 2R3NA 3EQDA 3VC4A 3FE3A 2UZUE 5EM8A 4IAFA 2IZTA 3GU8A 3CKXA 4EH4A 4HVDA 4XHKB 5TOZA 3U8WA 4DEIA 3SXFA 3JR1A 1F0QA 4AAAA 4WHZA 2DWBA 4TWCA 1UNLA 1ND4A 1U59A 4GU6A 5HLPA 1M2RA 1QPJA 1ZOEA 4NKAA 4FVPA 1R3CA 5BVOA 3RK5A 3FYJX 2WTIA 2PE2A 4IVAA 4CKIA 3QA8A 5ETIA 1BI7A 4ZSAA 2ZM1A 3ZMMA 1ZYJA 5HTBA 1ZXEA 4A06A 1YHSA 2C1AA 5F95A 1Z5MA 4ZEGA 1FGIA 1SVGA 4NIFA 2WTCA 4I41A 4AWIA 3KGAA 3UDSA 2QONA 3UO5A 2XM8A 3DKCA 3R8VA 4BZOA 5GZAA 5L8JA 4R77A 3U54A 1G3NA 2W1ZA 5L2IA 4I94A 3WILA 1GIHA 4FUXA 4GKIA 3O8TA 2B9JA 3O51A 3FI3A 3HMIA 4J95A 2OFVA 5IA2A 4AT5A 5CVGA 3OFMA 4M97A 4FX3A 2PMIA 3PXFA 4K2RA 3KVWA 4O0TA 3U4WA 1ZRZA 1ZYCA 5AAEA 2F2CB 3AMYA 3LFQA 3MJ2A 5D12A 2J7TA 4EL9A 3REPA 3VUGA 4FSYA 2QLQA 2G2HA 2OXDA 4F0IA 2UVZA 2HZ0A 3NUYA 4JIKA 4UMTA 3UGCA 2P2IA 3UOLA 4I1ZA 1F3MC 4HCTA 4HVGA 5IQFA 3RGFA 3FPMA 3DDPA 2XKCA 5AMNA 3NUAA 4BCJA 3RTPA 4I5HA 4LM5A 3PVWA 1H07A 3BEGA 4IHPA 2QVSE 2R3GA 4MBJA 3A61A 3VHKA 3ORXA 2WTWA 2ITYA 4TN6A 3DS6A 4ZTQA 4BDCA 4D2WA 4F9CA 3TM0A 2XALA 3PLAE 3C9WA 4YSMA 4A4LA 1WAKA 2FH9A 3EN5A 4O7SA 5IEXA 5L2WA 4QP8A 4D4SA 2B7AA 4WG5A 4BHZA 5C8KA 4FG7A 2WIPA 3ZEPA 2ONLC 3C0HA 3RAWA 4U42A 1NW1A 5AP4A 3LQ8A 4RIYB 4PTEA 4KBKA 5I9ZA 3PFYA 2OJIA 2P2HA 3L9MA 3Q5IA 4LV8A 4ENYA 4RIOA 2J0LA 2JGZA 5K3YA 5IQDA 4AN3A 3PSDA 1SM2A 3QD4A 2XNBA 4D0WA 1VEBA 4QD6A 5HO6A 3OBGA 3ZH8A 4B0GA 5HGIA 5C8MA 2WFYA 1H1WA 3BBWA 3COHA 4LGDA 4MNEB 1H1SA 1GZOA 1UV5A 4FSNA 1U4DA 2OF4A 5DPVA 4UMUA 3U55A 3W0OA 3GNIB 1CSNA 4D5HA 5HTIA 2YWVA 5AR8A 4TNDA 4BL1A 4Y85A 3FLZA 3HZTA 4XBRA 3LFDA 3SG8A 3EZVA 3O96A 4MNFA 3UZRA 4ZJJA 4NTSA 4M0YA 3RMFA 3Q2MA 5ANKA 5LCJA 3BI6A 1TVOA 2ZM3A 4QYGA 5GIOE 2QO7A 4KWPA 4BJJA 1APME 1IRKA 1PW2A 3BBTB 5FP5A 3TL8A 3MIAA 5GZ9A 1REKA 4GK3A 4K0YA 3EHAA 5M08A 2BUJA 5E8XA 5EYCA 2XNNA 1P14A 3W1FA 3IS5A 4JT3A 2G2FA 4NCTA 4OBOA 4TRLA 4BDIA 2WMWA 4OTRA 3SDJA 4FICA 1AD5A 3F5UA 3NMUF 5LMKC 4FI1A 2C5XA 1I44A 3E3BX 4YNOA 2I7QA 5BVWA 4WNPA 3B8RA 4XG4A 3MVMA 5EI6A 3SD0A 4BDDA 4ZSEA 4ITJA 3MW1A 2WQBA 4D28A 3CXWA 3GEQA 4ZS0A 5JK3A 3ZC5A 1OKVA 4ZZNA 1R0EA 2O5KA 2BZJA 4L3LA 3ULIA 4UMQA 3MPAA 4NUSA 2W1DA 3G6GA 2X0QA 2BVAA 3DZOA 2XBJA 4EZ7A 4AZTA 2W1IA 2J2IB 1HCLA 2VTLA 1IR3A 3KMMA 4FEQA 3TUBA 2CGWA 3VS0A 5E8TA 2YA9A 4E4MA 4IZ5A 1DM2A 4WRSA 2VTPA 4I20A 4QMYA 4X3FC 1XBCA 3I4BA 3R7GA 3KN6A 3BRBA 4KBCA 4C4GA 3N4UA 4LRKA 3DLSA 1NT2A 4N57A 2VTTA 3ZLXA 3DB8A 1UWJA 4U7ZA 5ANEA 3R0TA 4RJ6A 3F3VA 5IZFA 3CPCA 1J7LA 3O0GA 3MJ1A 4HGLA 2J0KA 1JKTA 3LXPA 4J7BA 3E87A 3GCQA 4MYGA 2BR1A 4A07A 4IQ6A 3N4TA 3V51A 5ANGA 3LCOA 2YERA 4YMJA 4OTDA 3IW7A 3BEAA 4LQMA 4BZDA 3ZUVA 3HMMA 2WMTA 5TE0A 4GYIA 2A98A 4GJ3A 3AG9A 4Y46A 4FODA 4IACA 4C59A 4DHFA 1JVPP 3MFUA 4M15A 3HVCA 4BDGA 3N51A 4I5MA 4RA5A 2AQXA 3D7TA 3LOKA 5DOSA 3HP2A 4GT5A 1OBDA 4EOIA 3ET7A 2CLXA 5CENA 4JQ8A 3EQCA 5HE1A 4EH5A 1XBAA 1YDTE 3F3WA 3I6UA 4CMUA 4ENXA 1QL6A 5M4CA 2X6DA 3CR0A 3P5KA 4UB7A 4FKLA 3ENHA 3OWJA 2E9NA 4JDJA 4RVLA 2ERZE 2F9GA 3ZO4A 5LQFA 3KK9A 3PY0A 2BZKB 2YIRA 3MY1A 5LWMA 3ZM4A 1M2QA 3QA0A 5AUXA 4K33A 3EYGA 4ITIA 4TWOA 3MH0A 5CYIA 4PPCA 4RA4A 1SMHA 2C4GA 5FQDC 1Y91A 1OKZA 2O65A 5LMBA 4LV5A 1OPLA 5FM2A 4AGDA 4FV4A 5EFQA 2C3JA 4N4SA 4BDKA 5LVMA 1W98A 3S2PA 4YTHA 4TT7A 3VF9A 4FBXA 3H0ZA 1UVRA 2C0TA 5I3RA 5CT7A 3CLYA 4ZY6A 5HKMA 1M2PA 3BQRA 4GIIA 2PMOX 2FVDA 1S9IA 4CMTA 1ZZLA 3H30A 1YWRA 4CD0A 4F9BA 2ITNA 1S9JA 4C3PA 4PPAA 4XX9A 3RAIA 3ZBXA 4IH8A 1J1CA 1LEZA 3OUKA 5EM5A 5FDXA 3WIGA 2P55A 4E4NA 2RFDA 5AJQA 1T46A 5M09A 3HDMA 3LJ2A 4EZ5A 5AP7A 4BFMA 5DN3A 4RJ7A 2X0GA 4GRBA 3PRIA 4HNIA 1Y57A 4CTBA 2O8YA 4O4CA 3PXYA 3IW8A 3DBDA 4PDYA 4HOKA 3PZHA 4CRLA 5AP3A 5AV0A 5TT7A 4YZCA 1O6YA 5B2KA 3PXRA 4EBVA 3ALOA 3PIYA 4O7TA 3ZLYA 1TZDA 2P0CA 3A7HA 2XK3A 3MI9A 2ONLA 5IUHA 4I0SA 4HYIA 4BKJA 3AT2A 2YM7A 2X6EA 4E1ZA 3PVBA 5IQHA 2QKWB 3NSZA 4ZAUA 3NYNA 5CU6A 3R71A 3NUPA 1UWHA 2VGPA 5CSPA 3ZSHA 3NUUA 3PLSA 4MF0A 4BCMA 4XUFA 3D15A 5AIKA 5LARA 4G6LA 5ANDA 4YBKA 1IASA 4FNYA 3QQGA 4GH2A 4O7WA 5L6OA 3T3VA 1GOLA 4TW9A 2BRMA 5HNGA 2XKFA 2XAMA 3AKLA 2YIQA 4ZSJA 4EH9A 3FKLA 1MQBA 4K11A 1FOTA 3OXZA 4QEBA 3W33A 2VTMA 3KKVA 2JDSA 3KXXA 3L8VA 4MH7A 4QO9A 3WF9A 2ZV8A 5AP6A 2XH5A 5CAPA 3OVVA 5KBRA 4L46A 5IEVA 2QI8A 3T9IA 2KTYA 4WKQA 5HD7A 1OIYA 1RQQA 3Q32A 4F6SA 4KKGA 3HV4A 4XYFA 2GS2A 3DGKA 4UWBA 1ZMVA 2ZFYA 5LVOA 2C6EA 4MBIA 2WU7A 5IQBA 1Z57A 2IZSA 5CS6A 2RFEA 4CKRA 5T68A 1DAYA 2CN5A 3M2WA 4FTLA 4DGOA 4BDBA 4EUUA 4G16A 4GYGA 4IAYA 1ZWSA 2P4IA 4KS7A 1XR1A 2V55A 4QNAA 3AQVA 4RPVA 3EFLA 3KRWA 4O82A 4AQCA 1OPJA 5E8UA 3RWQA 4O7NA 3RPVA 4BB4A 3Q04A 4J8MA 5CEQA 4DG0E 2PUIA 3PWDA 4C3FA 3R9NA 4ZY4A 3MESA 3AC5A 4ZTHA 3ANRA 4U44A 4ZIMA 3G5DA 3FLYA 2UZDA 4MCVA 2EWAA 4O0YA 1H00A 1YI3A 3OTVA 4GT3A 2ITTA 4B4LA 3QUDA 3DPKA 4C4EA 5HIEA 5IDNA 1OGYA 4FEXA 4TYEA 4DCEA 5LMKA 3F2NA 5GHVA 2VX3A 5I4NA 4WUNA 4J71A 2QR7A 2QURA 5JZNA 4C34A 5J87A 5BMSA 3BHUA 3SXRA 3KU2A 2BALA 3CC6A 3VIDA 4R5SA 2GNJA 4FT9A 2Q83A 3QGWA 2GTNA 5IMXA 4F78A 2CLQA 2WTDA 4LRJA 3P78A 1MP8A 3AC1A 4M13A 5BVKA 1R1WA 1OIRA 4DTKA 4EUTA 3MWUA 4AGUA 5C01A 2F7ZE 5I9XA 3NIZA 4BWKA 4YHTA 4FGBA 2QOIA 3VWAA 4IB5A 3TTJA 3F5PA 4LOQA 5EM7A 3VO3A 3ZYAA 4YLKA 5AX9A 4X3FA 1E9HA 3D5XA 4MUQA 3IO7A 1MRUA 3EOCA 5DEWA 4D2RA 2WKMA 4NM3A 3R7VA 4H3QA 2C30A 5HE3A 3UZPA 3ZBFA 2J0MB 4UMPA 3C5IA 3IG7A 1U46A 3PSCA 4Y5QA 1V0BA 5C26A 1UU3A 3ZONA 4IBMA 5E8VA 3H0YA 3ZFYA 4DGGA 2C6DA 2X9FA 4M68A 4ACDA 4S34A 3TIYA 5LVPA 4O4BB 3R83A 1YQJA 4ANLA 4QMVA 5KHWA 5HNIX 3EQGA 3IW5A 3G9NA 3OEFX 2X2LA 4C4HA 4HCVA 5JGBA 3F9NA 4L7FA 4G3CA 5EHOA 3VS2A 3HV3A 5D10A 3W0QA 1TQIA 2VWYA 3IDCA 5KKRB 4FTQA 3ZEWA 1MRYA 4I24A 4L00A 4YJTA 4F9WA 3HX4A 1PXKA 1ZLTA 5DT3A 2G01A 2O2UA 2JFMA 2PVNA 3EN6A 3AC2A 3MSSA 2C6MA 3QLFA 3AC8A 5CTPA 3ZLSA 4HGSA 1OITA 4RLLA 3VJOA 5EOLA 5ETFA 2F2UA 4LGHA 4S32A 4CKJA 5JFSA 2XRWA 3BQCA 3QGYA 3GCPA 3QWJA 3G51A 3HAMA 4JRVA 5HZNA 4XBUA 1OIQA 2W1HA 2PK9A 2W4KA 5DE2A 3E3PA 1E1VA 2PVRA 3E62A 3FZTA 3NW5A 3O2MA 1OUYA 4FIGA 2H6DA 4IZAA 4MD7E 2EXEA 5DI1A 4LOPA 3GC0A 4EKKA 3ORZA 3WZJA 2HZIA 4HNFA 3QHWA 4AW5A 1RJBA 4CQGA 2YM8A 3UDBA 2OJGA 2I40A 4F0GA 3Q4ZA 4EH6A 3FEGA 5IEYA 4I4EA 3IECA 2XVDA 3L9LA 4FKVA 4AFEA 3BGPA 3BPRA 3L1SA 1KV1A 1OL2A 3PA3A 3ZRMA 3II5A 2XBAA 5GJDA 3VS5A 5IUGA 3DK6A 1J3HA 4FTJA 5IQEA 4CZUA 3C5UA 4USEA 2X8DA 2HIWA 3COKA 3EN4A 3JXWA 3F69A 3QALE 3QQKA 4ZJVA 5CU0A 3V5LA 4AW1A 3UDTA 3AOXA 3EB0A 2QO2A 4K8AA 2YM6A 4TTHB 4ACCA 3MV5A 2I6LA 4RQKA 4JBVA 4F08A 2WQNA 3UZTA 3OY1A 1BMKA 4KB8A 4UXQA 4MXCA 4DINA 3OROA 3PXZA 4O2ZA 3GVUA 5AM6A 2GNIA 4KSQA 5LVLA 4BGHA 4AN2A 4G6OA 3V6RA 4RJ8A 3BYOA 5IISA 4C0TA 1U54A 3EH9A 2JC6A 2GPHA 4FC0A 4QMMA 2XNMA 4MXXA 5AP5A 2PVKA 5EG3A 4RWKA 4D1SA 3TJCA 4D4YA 4UEUA 4QQTA 4XP3A 4QTEA 3EIDA 3V8SA 1YKRA 2GHGA 5AAFA 2HXLA 1PMVA 4O4EA 1STCE 3BWJA 3F3TA 3PJCA 4Y83A 1OBGA 3PE2A 3BGZA 3BKBA 3TG1A 4XLVA 3PVUA 1FMKA 5HLWA 3GU7A 4AGCA 4AXCA 3R63A 4G5PA 4IANA 2E2BA 3QX2A 1VYZA 3LCSA 3FQSA 4PQNA 2OW3A 4YC6A 4U79A 2JAMA 5FEQA 5K0XA 3QYWA 1U5RA 5F1ZA 2QU5A 2HXQA 2ZOQA 3GGFA 3NS9A 4DAWA 4FKJA 4O22A 1Q8UA 3WE4A 4O2PA 4AOIA 4PMPA 5A14A 5M4UA 5BNJA 4XNEA 2XIKA 5K5NA 3BHHA 5CNOA 3FC1X 2Z02A 4QT1A 2Z60A 2RFSA 3BU6A 3FY0A 3TNHA 2BRGA 3UJGA 5KMNA 3CEKA 2OU7A 2XNEA 3KY2A 3OWKA 2C6IA 4PPBA 4BGQA 4NJ3A 4RIWA 2W1FA 4CV9A 5M57A 5IDPA 2QOQA 3D94A 3RM6A 4EOPA 4FJVA 1GZ8A 4MTAA 3SW4A 4E6DA 4YTCA 3MTFA 3PPZA 1YXXA 2QHNA 4OGRA 5BVFA 2NRYA 3FMHA 4L53A 5HO8A 3ZOSA 4DFXE 1KUTA 5EQPA 3D5UA 4H1MA 3FHIA 3PIXA 5EKOA 3BHYA 3JYAA 3OXTA 1M52A 3OT3A 3R9OA 3R1NA 4FSZA 1NA7A 3TKUA 3Q4UA 4YTFA 3ORTA 1ZMUA 3Q9XA 3E64A 3IONA 4ZLOA 4AQKA 4RWJA 3P86A 4XV3A 2YZLA 3D5VA 1Q8WA 1PXMA 2XIRA 3F82A 4E8AA 5GZ8A 3E7OA 4IX6A 3FKNA 3QX4A 5ANIA 5JSMA 1P4OA 5EYMA 4MNEA 3NNUA 3NWWA 4LOOA 3TUDA 1Q3WA 2DYLA 4KD1