4FNWA

Crystal structure of the apo f1174l anaplastic lymphoma kinase catalytic domain
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
322
structure length
304
Chain Sequence
RTSTIMTDYNPNYSFAGKTSSISDLKEVPRKNITLIRGLGGEVYEGQVSSPLQVAVKTLPEVCSEQDELDFLMEALIISKLNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK tyrosine kinase receptor
publication title The R1275Q Neuroblastoma Mutant and Certain ATP-competitive Inhibitors Stabilize Alternative Activation Loop Conformations of Anaplastic Lymphoma Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 304
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fnwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fnwA01
3DGKA 2OWBA 4DH7A 4G34A 4EH2A 4BCQA 4YC3A 3EQRA 3BELA 2XVDA 4TPTA 4FGBA 3QQHA 1TQIA 3V8SA 4Z3VA 4FYOA 4IVAA 2UW4A 5HBJA 4UXQA 2YM7A 4DCEA 4UMQA 4DGMA 3JVRA 1U59A 2C0TA 2CSNA 3DDPA 3IECA 2WQEA 3OWKA 4OBOA 4BGGA 4GT5A 2OG8A 3RALA 4FKPA 4QQCA 3MFRA 4MKCA 1WAKA 2A2AA 2XNEA 4R3RA 2C6KA 2XYNA 3NEWA 4J95A 4PF4A 4RWLA 5E8XA 2XMYA 2ITOA 5HU3A 2ERKA 2VAGA 2YITA 5IDNA 2IJMA 3POOA 4FMQA 5FP6A 5IA0A 3QLFA 4EH8A 5J79A 2X0GA 3QRUA 3HEGA 4FV9A 3LW0A 1O6KA 1H1WA 1ZYSA 4YTHA 3VO3A 3VS6A 4F7SA 3NYNA 2HK5A 3JUHA 4AW2A 3F69A 3GT8A 3ZXZA 5IQBA 4PY1A 5J1VA 3Q4TA 2EU9A 3FZPA 3OCBA 4XV3A 1GZKA 4FG7A 2YCSA 3DBCA 4FSRA 4KBCA 4YJUA 4PNKA 4RWIA 4DT9A 4FICA 3FZOA 2IG7A 4YZCA 3VRYA 4NUSA 4I22A 5CU4A 3DPKA 4X6RA 2XUUA 3VBXA 3PUPA 4ITIA 3RM7A 3V5TA 1V0PA 2QOKA 3KGAA 2RSVA 4KIOA 3U55A 4LG4A 4BL1A 3U6HA 3NW6A 4M13A 2UZNA 2WAJA 3R7IA 3TNHA 1FQ1B 3ZH8A 4CVAA 3NNXA 5M06A 5F9EA 1FINA 2Z7RA 2VWIA 2Y4IC 4RMZA 4L9IA 3V5JA 1BUHA 1Y8GA 1U4DA 2QVSE 3E88A 4JQ8A 1XBBA 4O0UA 4YJNA 5BVEA 4FF8A 3M42A 3PPJA 4MD9E 5M51A 3SOCA 2Y7JA 2E9UA 5C03A 1OKZA 3AC8A 4A4LA 3UGCA 4CFWA 3ULIA 5ICPA 3VS4A 5L3AA 3UZTA 4UV0A 4RLKA 3IW7A 4NIFA 2G2HA 4EOSA 5M4UA 4LUEA 3D2IA 1H8FA 1IRKA 2W1GA 5EDPA 3RVGA 3LMIA 2VTNA 3R1QA 5K5NA 2FSTX 3PJ1A 1GJOA 3I6UA 2AC3A 4O0SA 3NWWA 3GQIA 1YKRA 2WQNA 5M08A 3R1SA 4RT7A 5EM8A 5HOAA 5L6OA 4DT8A 3F5PA 3CPCA 4PL5A 3DJ5A 5I3OA 3D2KA 4W9WA 1Q62A 3DLSA 3ZSIA 2GNLA 5I4NA 4UWBA 4UN0C 2GS7A 2V62A 2BIKB 5ANKA 1PMNA 3L9LA 3D94A 5I9XA 3OOGA 3QFVA 5CI7A 4FKLA 4U81A 4AW1A 2YJSA 3LFCA 5CF5A 2YCQA 2J0JA 4IDVA 2YIWA 4KB8A 3FL5A 3FLYA 5CF4A 4FTAA 3VUIA 3SXRA 3PIYA 3FEGA 4EYMA 4R6VA 4DH1A 3L9MA 2PE0A 4O96A 3AG9A 3TIYA 3DXPA 2ERZE 4FOCA 3U6IA 5CSHA 3Q2JA 2OW3A 1UNLA 5C4KA 3LCKA 2WU7A 4QMXA 1Q4LA 3D83A 3DB6A 2DWBA 3FSFA 3SLSA 3NVMB 3V6SA 2EVAA 2WNTA 2NO3A 4YLKA 1UU3A 5DG5A 1QPJA 3SGCA 3G9NA 1PXKA 3IW5A 2QHMA 4X21A 3ZFMA 2QHNA 3GUBA 4FYNA 4K9YA 4AZVA 2QOFA 4I21A 1H24A 3HV7A 4H36A 4U9AA 1L8TA 4AP7A 5GZ9A 4D1XA 4NK9A 2VGPA 3QXPA 4MWHA 3MGYA 5EM6A 3POZA 4R1YA 1XR1A 2W5BA 5HTCA 2HZIA 3QQKA 1KV2A 4KRDA 5F95A 4PPAA 2GU8A 2HXLA 4FIJA 3SRVB 3FMKA 5AR2A 3TEIA 2I1MA 3D14A 2XM8A 4Q2AA 4BBMA 2B9JA 2YIYA 5JFVA 3JY0A 3PE1A 3GGFA 2PMOX 2JBOA 3KRWA 1L3RE 3H9RA 1WCCA 2J9MA 4IANA 4LOQA 2YAAA 4QTDA 3SX9A 3PVBA 4YTCA 3OCTA 1SZMA 4HGEA 3U9NA 2P0CA 3C4FA 4NEUA 4F0FA 2BAKA 4OTIA 4C59A 2HZNA 4JG8A 3LFBA 3AC4A 3PG1A 2ZV7A 4IWQA 4ANMA 3UOLA 2C5NA 4DFLA 3KB7A 2C3KA 3I60A 1YDRE 4EHZA 2JD5A 4FV7A 4M69B 4ZAUA 3PSDA 2QC6A 2YZAA 4AA0A 3E63A 3KFAA 4EH7A 4EK5A 4CKRA 3ZO3A 4FKSA 3CPBA 3H0YA 4G17A 1UNGA 3I0QA 3T9TA 2PU8A 4D0XA 4WRSA 2NRYA 3EFLA 5BMMA 3RAIA 1U5RA 2C4GA 4ZK5A 5DGZA 5EYKA 5HX6A 1FMOE 1PXPA 3HYHA 4GYGA 3RWPA 4EOIA 3DFCB 3MPTA 2EXCX 1W82A 2UZWE 3D7TA 4ZJJA 1B6CB 5HD7A 4AN9A 4DG0E 4CFFA 2HWOA 4FIFA 4LV8A 4K1BA 2YCRA 3EQIA 4H39A 3OWPA 4HPTE 5AIKA 4HGSA 2YIQA 3NNVA 4IM0A 3E7OA 4J53A 4RZVA 1ZARA 2X7OA 4YHTA 1GY3A 2C5YA 4XEYA 5DRBA 5B0XA 5D1JA 4PDPA 4BCOA 4CSVA 1YWVA 4RPVA 1PXNA 1SYKA 4QP9A 4ZZMA 4USEA 4BTKA 2XF0A 3MVLA 3UOJA 3HUBA 2Q0BA 2CGXA 2VX0A 1ERKA 4ERWA 2YJRA 3K5UA 5DWRA 2VO0A 5EHYA 5IQIA 5AAGA 4PQNA 2FSLX 5CAQA 2W96B 3D7ZA 1OECA 5LVNA 1OVEA 4P90A 2W7XA 4PTCA 5EHLA 2W9FB 3DXNA 3KK8A 4D9UA 2BUJA 4WSYA 3ZFXA 4FT3A 2R3OA 3E7VA 3BEGA 3AD6A 2XEZA 2HW6A 1HCLA 2SRCA 1M14A 2C0OA 2W1CA 3LCTA 4O22A 4Y85A 5C27A 4N6YA 4DEDA 5LVPA 2GQRA 5AADA 4BHNA 4MD8E 4XRJA 3R9HA 2H9VA 2BHEA 4BZOA 4EOOA 4F65A 1HCKA 4EOMA 1CM8A 4U44A 4FZDB 4BKYA 1Q24A 2PWLA 4HJOA 3QRTA 4I6FA 4AFJA 5A6OA 2C1AA 4CLIA 2A27A 3EKKA 5CT7A 4A4XA 4YO6A 5B2MA 1H4LA 4IJPA 3EQHA 4TT7A 3W1FA 2EUFB 5A4EA 4ITJA 2PMIA 3LLAA 3OHTA 1M2PA 4PMTA 4DEGA 3LFEA 4IB3A 4FK3A 1W8CA 1OMWA 2W1IA 3VJOA 4V05A 1YWRA 4BVUA 5FGKA 5JRSA 2BVAA 5HNGA 5EW8A 2XIXA 3TXOA 2VTTA 2WMVA 3NNUA 4XP2A 2RFNA 4YHFA 4EHVA 3T8OA 2XNBA 2W17A 5CU2A 4F9WA 2BKKA 3MFUA 2GPHA 3WZKA 4GFOA 3DY7A 3AC2A 5CXHA 1TQMA 2YM3A 4XH6A 4IB0A 3E8NA 5G1XA 4BZNA 5IEVA 1P14A 1SM2A 4WBBB 3AOXA 4UMPA 4ZTMA 4N57A 5I9WA 1QCFA 1PYXA 3CY3A 4O7YA 1PXJA 4X2NA 2OIQA 2VO6A 5EHOA 2AUHA 3ACJA 4J8NA 4H1MA 5LCJA 5FEDA 3ERKA 3ZRLA 1NT2A 1G8SA 3T3VA 2FVDA 1LPUA 4FSQA 3RJCA 3LFNA 4IFGA 5LQFA 3MH2A 5AMNA 2ITQA 2ETMA 2UZUE 5CVGA 1OZ1A 4EK6A 2XKEA 4L53A 3CKXA 4O91A 2B1PA 3TIZA 4QD6A 4NW5A 2F4JA 1CMKE 2QD9A 4JRNA 4G1WA 4U42A 3SV0A 2PTKA 2GNIA 4TWPA 3ZBFA 4IJ9A 1JQHA 4YZ9A 3BHVA 3V5LA 4O0XA 3UG1A 4F1MA 1QPEA 4GKHA 4JBVA 3QYZA 4WO5A 4AT4A 2UW6A 4M12A 4QMZA 4S30A 4Y5QA 4FT5A 4F9BA 3OUNB 2BKZA 4MK0A 4J96A 4OAUC 4CKJA 3A7HA 3PDTA 4RLLA 1PY5A 4IVDA 4RX5A 2GFCA 4IADA 3Q9ZA 5FRIA 3R01A 4QP2A 3HL7A 2DUVA 2PHKA 4DH5A 5M4IA 4G9CA 4R78A 5BVKA 2YHVA 3OBGA 3MA3A 3P7BA 4IC8A 3ZLYA 4EWQA 2X2MA 3GU7A 5I9VA 3R02A 5TOZA 2R3RA 3CC6A 2R7BA 2CMWA 4FZFB 4ACHA 1KE5A 3R8UA 2CN5A 2F7XE 4F64A 3CD8A 5HX8A 3UP2A 5EYMA 4O0TA 2VGOA 3JS2A 2ITTA 1JPAA 2XRWA 2YAKA 3I4BA 1YOLA 2PVFA 3U54A 4G5PA 4MWIA 4HVGA 4TNDA 2PUIA 1JSVA 1M17A 4FKRA 4B99A 4NJ3A 4LV5A 2XRUA 1UU9A 2VV9A 4O0VA 4RC3A 2UW0A 5LMKA 2B54A 5CSWA 5DNRA 3UIXA 3NMUF 5JFSA 4NIFB 1CDKA 4G6LA 4U6RA 2EB2A 4WA9A 3OW3A 3RKBA 3I7CA 4AA5A 1R78A 3F3UA 3ZC5A 4YJRA 3FLZA 3JXWA 4XUFA 2R3IA 4RVLA 1CKIA 3JY9A 2Y4PA 3UDBA 3U4UA 1YXSA 4LL5A 4QYEA 3UYSA 3SXSA 1BI7A 3KK9A 1H08A 3ORKA 5JZJA 1PJKA 4K11A 2C0IA 4MBJA 2XIZA 5AV0A 3EN9A 3LAUA 4NTSA 4GU9A 2UW8A 1R0PA 5FDXA 5ITAA 3I0OA 3Q4ZA 3R8MA 4IACA 5BYYA 4YC8A 3TI1A 3FMEA 3EFKA 4AOIA 5BUIA 3GCUA 4F09A 5F94A 2QLUA 3VC4A 4UWCA 2J0KA 3BGQA 3QD3A 3S2PA 3TTIA 3GU6A 1BKXA 5EM5A 3D0EA 3A62A 5KMMA 3LQ8A 4U79A 2YLEA 2ZM4A 2Y6MA 2CGUA 3UC3A 4C0TA 4RIYA 4JG6A 2OBJA 4MXOA 5H9BA 2VWVA 4IFCA 1K3AA 5HG9A 4JBPA 3HRCA 3W2QA 4NM7A 4IM3A 4MXAA 2G1TA 3WF5A 4B8LA 3PYYA 4F0GA 3A4PA 3QLGA 3QWKA 3SC1A 4EKLA 5KBQA 4D2PA 4DEIA 1TVOA 4WG4A 4L44A 3LFAA 2G01A 2WMQA 4E73A 2IPXA 2X8IA 5ACBC 5K4IA 2HAKA 4IQ6A 4ZSAA 3EN7A 3QA0A 4BWPA 3IDPA 3RM6A 4QMQA 4E93A 4ASXA 2JIIA 1CKJA 1ZYJA 3O2MA 4CD0A 4EORA 3NAYA 3QQGA 4M66A 1P4OA 3DOGA 3GP0A 3UC4A 4C4EA 4U41A 3NUXA 5CQWA 2I40A 4ZSEA 4KUJA 4XP0A 5L4QA 3VS2A 5CVHA 3W8LA 4IMYA 4BDGA 1BLXA 3BPRA 3ENHA 2WB8A 3UOKA 5IA4A 2BTSA 3COKA 4FKOA 2UZVA 2P33A 3R04A 3RPRA 1URCA 4JAIA 4JDKA 2IW6A 2UZEA 4TXCA 1YHVA 4Y8DA 4MEDA 2QCSA 4FTNA 3AMBA 1W84A 3LFSA 2FUMA 2OFUA 3HMMA 2C3LA 2E9OA 3VUDA 3FC1X 5AJQA 2PUPA 2RFEA 2WZJA 1YOJA 3KXNA 5AR5A 5L8KA 3MH1A 4FR4A 4FTTA 5H8GA 1HOWA 1YXVA 4O81A 3EWHA 1RW8A 4S2ZA 3RMFA 2IWIA 1WVWA 3VF9A 5IH5A 3G0EA 4MBLA 2PMNX 3PG3A 4B7TA 1JBPE 4ZEGA 3SW4A 4E26A 3EH9A 3FI4A 3G5DA 5CZIA 1IAHA 1ZYDA 1P2AA 1FVRA 4FNZA 2OIBA 4XG4A 5M07A 2WQOA 4EWHA 1MRVA 4YZBA 4ZTRA 4CFNA 4CRSA 1BX6A 3R9RA 5AR4A 3UOHA 3PZEA 5L2IA 3D5XA 4AG8A 1V1KA 1YI3A 2GQGA 5KHXA 1ZMUA 5HEZA 4NH1A 2YISA 4U45A 2ZDTA 5IH6A 3WE8A 4ANNA 3D7TB 4Y73A 5HO6A 2RG6A 1ATPE 5KMLA 2BDJA 2W99B 4TW9A 5J1WA 3FI8A 5J5TA 2W9ZB 4BZDA 4M14A 4BGHA 4NM0A 2BROA 4F7LA 4BI1A 2UZLA 5FTOA 4D4YA 4FUYA 4F7NA 4NFNA 3S0OA 3LQ3A 1H28A 2Z60A 4RFZA 2ZOQA 3DBQA 1JKLA 5C8NA 4KA3A 2WMAA 4EHEA 2WMWA 2GHMA 5L2QA 4IDTA 3U51A 4AN2A 4FTJA 2YDKA 4YP8A 2VWUA 1H0VA 1R39A 2C5OA 3CY2A 3MFSA 5K5XA 3QRIA 3EOCA 4LI5A 3EHAA 5HE3A 3BV2A 2PVKA 2YM8A 2QO2A 3CCNA 3MESA 3O51A 3UNZA 3NRMA 3PRIA 4F7JA 3TDVA 2C6OA 4YBJA 5CU6A 2ZMDA 3GCSA 2XNOA 4BN1A 4YJPA 3R8LA 4X0MA 4YTIA 3MY1A 4EOQA 5IF1A 1ZRZA 4AN3A 5HIDA 4NJDA 3ZS5A 5JMSA 2PVYA 2X39A 1KE9A 3DBEA 4D2WA 2XZSA 2IZRA 5AUYA 4KKEA 3SRVA 3ZSGA 4NTTA 4D4SA 3K3JA 2NNWB 1BL6A 3C0GA 2DYLA 4GK2A 4YNEA 1LR4A 3IG7A 2C69A 4WUNA 5JGBA 3F3VA 3QKLA 3L8PA 3Q53A 4FUXA 2BRMA 4H05A 1WFCA 3OOMA 4EUTA 1Q61A 5EQYA 2GMXA 2GNFA 5EDQA 4FTCA 2BRBA 3L1SA 3AXWA 3R21A 4GK4A 4A4OA 4EK8A 3MV5A 2QOQA 1A9UA 3GC9A 2JDSA 3CJFA 3ZEWA 4XP3A 4Z7HA 4Z9LA 2W1FA 4YC6A 4BDBA 2Z2WA 2OO8X 5CAOA 4QMUA 3G51A 3R9OA 4A9YA 4BCFA 2X4FA 3EQDA 4M69A 1OKVA 3OS3A 2G2FA 3A4OX 2EXEA 3MH0A 4F08A 1WMKA 3MJ1A 3G6GA 3UVQA 2BZIB 5B7VA 4D2RA 4DEHA 5IKWA 2WOUA 4M15A 2R2PA 4QMVA 2CKOA 1OKWA 3NYOA 4W8EA 2XIYA 4GH2A 3WIGA 5HICA 4IEBA 1MUOA 3FI3A 3GQLA 4NFMA 4QP7A 1CTPE 4RIXB 1BL7A 4IX6A 4FT7A 3ORIA 2WU6A 5E1EA 5E90A 5CSVA 5DEYA 3RPOA 4O84A 3TCPA 5E9EA 5B2LA 4WNOA 4R77A 2J6MA 4BRXA 3TKIA 3W2PA 1Q8YA 2QKRA 3CKWA 4I92A 5LVLA 4CV8A 4FL2A 4EH9A 1UU8A 3TM0A 4YJTA 5IA5A 4RX8A 4RVMA 3L8XA 4GMYA 2J0IA 4K77A 2EXMA 3ORLA 4R7IA 4CG8A 5I9UA 4AGCA 4P5ZA 4MXCA 3VS5A 3TN8A 3PP0A 2C5VA 3PWYA 4N6ZA 5J7BA 4QPMA 3E5AA 3HP2A 3PA4A 4O7TA 1GZOA 2J90A 2JLDA 2PVRA 3MVMA 5E8VA 3QZFA 4QNYA 4WT6A 2QOHA 1FVVA 4FE2A 5CF6A 3PXZA 4HYHA 5GIOE 2XB7A 3ZEPA 2JFLA 3BHYA 4FEQA 4C2WA 3UO5A 3UMXA 3CQWA 5HE2A 4FK6A 3MWUA 4HYIA 5KKRB 1ZYCA 2QO7A 2ITWA 1YOMA 3EQGA 5GIPE 4BY9E 3VBYA 3VRZA 3E64A 4AXAA 4LOOA 3DQXA 2HZ0A 1WVYA 4RJ6A 1G5SA 4O7ZA 2R3QA 5CVFA 5J87A 5JKGA 1OIUA 3QALE 4BDHA 4E6QA 1FBNA 4R7BA 4RJ7A 4ASEA 1OL2A 1PRYA 4BCGA 4QP3A 4GG7A 4GJ3A 4ZTNA 3P5KA 4F4PA 4FV3A 3O23A 4MF0A 3IDCA 3QRJA 1JKSA 4FIEA 5AR3A 4EOJA 5AM7A 3OBJA 4QNAA 2HOGA 4DFXE 4OTRA 2QR7A 2CKPA 4GK3A 4G5JA 3UMWA 1SVEA 3FDNA 2CDZA 3QZIA 4FV8A 2VWZA 1OIYA 4V0GA 3IDBA 3HV4A 4IAKA 2QURA 2V0DA 3BKBA 3L8VA 3A60A 5CAUA 1GZ8A 4JR7A 4XNEA 5GZAA 2W5AA 3QQFA 1ND4A 1F5QA 4YLJA 4AOJA 3VVHA 3ORTA 4ZTHA 4FV4A 3VW8A 3ZUTA 4LRKA 3KVXA 3AQVA 4RIYB 4O7SA 3M2WA 5AWMA 3TJCA 3TZ7A 1WBPA 2FSOX 1R1WA 3P23A 4F63A 4FEUA 5LMAA 5FG8A 2REIA 4UYAA 1KWPA 3O71A 4KD1A 4FTKA 3RNYA 5C26A 1JWHA 5EOBA 3C0HA 2C6MA 1YI4A 4A9SA 3QF9A 4D5HA 4RVKA 4LMUA 3UO6A 2GS2A 3QQJA 3HZTA 1GIIA 4XOYA 1REKA 4TZRA 4U5JA 5DH3A 3GFEA 4PRJA 5H8EA 4NM3A 3UIUA 4N70A 2X8DA 2PVLA 3FMJA 3FSKA 3IONA 3LCDA 1KE8A 1JKTA 3FY2A 4JT3A 4PUZA 2QONA 4TYJA 3UJGA 5KHWA 1BYGA 4GFGA 3S1HA 4P7EA 4CNHA 2WIPA 3G2FA 3VUGA 4V04A 4M8TA 4MVFA 1PKGA 2CNVA 2Z7LA 1U46A 1FGIA 5E92A 5TKDA 5CSPA 4KIPA 4L01A 3QBNA 5FQDC 2UVYA 3R2YA 1VJYA 3MJ2A 3ZUUA 4CFVA 4DFZE 1I44A 4FSTA 4HNFA 4JS8A 3FMHA 5KMNA 3PE2A 5AX9A 1OPJA 2YACA 3RHXA 2OICA 3BGZA 5I3RA 3UNJA 1H1SA 3RBWA 3W55A 2OJ9A 5CALA 3RWQA 1JSUA 2I0HA 4S33A 2DQ7X 2BDWA 3FJQE 3LXKA 4X2KA 2QG7A 4HVIA 5BVDA 2YWVA 4II5A 4BIEA 4C4GA 4EZ7A 4HZRA 3QCXA 4HGLA 2C6LA 4YJQA 2A19B 4MXZA 3P0MA 3KC3A 1XH8A 3ZLWA 3C4EA 3R00A 3W16A 3RINA 5JGDA 3S95A 2QU5A 3VJNA 4PMSA 3ODZX 2VO7A 1P4FA 4I6BA 4K0YA 4ZTQA 3R0TA 3OFMA 1LEWA 3OXZA 2WEIA 4EQMA 5A54A 3GI3A 3GVUA 1OL1A 3QTSA 5EKOA 3C5IA 4U0IA 3O7LB 3QKKA 2GHLA 3EB0A 4QMNA 2WEVA 3K2LA 4EBWA 4H3BA 3EZRA 3HP5A 2J2IB 3EL7A 4XBUA 3SAYA 3VN9A 4AGDA 4D4RA 4DH3A 5IU2A 3NW7A 3FXXA 5L6PA 4JVGA 3QYWA 3NAXA 3R30A 5EOLA 1MRYA 3ATTA 2XYUA 2R3MA 3SQQA 2PZIA 2XIRA 3FQSA 3NUSA 5AX3A 3TNPC 5CEIA 3UIMA 4ZLYA 1H1RA 3OCSA 3TKHA 5CAPA 4FNWA 2FO0A 2LAVA 2E2BA 3SOAA 5AA8A 1PF8A 4EQCA 1KSWA 2J4ZA 2O3PA 2C6IA 4PNIA 4DFNA 3ORNA 2C6TA 3KN6A 4GCJA 3ZTXA 4I1ZA 5CEMA 4ITHA 2PVJA 2QG5A 3E92A 4CLJA 2WMRA 3QCSA 4BDCA 5J9YA 1XH7A 3GU5A 5ETCA 4C4FA 4AT5A 3W33A 3HAMA 5JH6A 4AGUA 4BI0A 2PVMA 4OTFA 3KF4A 4QP8A 4W9XA 2WQMA 5FDPA 3UP7A 3QRKA 3LIJA 4R3CA 4TN6A 5AM6A 5J8IA 3ZM9A 4JRVA 3SG8A 2YEXA 4LOPA 5FWKK 3CS9A 2VTSA 1YXUA 3LLTA 5E8UA 2JAVA 3RK7A 4XLVA 4U7ZA 4F1OA 5KX8A 4FTMA 2UZTA 4G3CA 3MY5A 4AACA 4CG9A 4GG5A 1NY3A 5F4NA 3HA8A 4GVAA 2W4OA 3HRBA 3CR0A 2PULA 4RIOA 2V7AA 4C3PA 1ZOGA 3HDNA 3I79A 4F9YA 5C1QB 4DLJA 1A06A 5GINE 1NVRA 1UWHA 5HCYA 3JYAA 1Z57A 2QOOA 5HE0A 4BIDA 3CTHA 3AD5A 5DPVA 2V22A 4L6QA 4D2TA 5HORA 2UW5A 5FP5A 1YRPA 5BUEA 5CXZA 2PE1A 2Z7SA 4O6EA 2GNHA 4IAIA 3RNIA 3SG9A 1BMKA 1FPUA 2QR8A 2R0UA 3RZBA 5HQ0A 4IVBA 3HV3A 5AP4A 4CFUA 3DB8A 1IASA 4JIKA 5E91A 3TWJA 3AD4A 3A99A 3DKOA 5AAFA 1M7NA 3FZRA 5BQ0A 1Q41A 2F9GA 2QQ7A 2YIXA 3DCVA 4M0YA 2ITXA 4TY1A 4DAWA 3Q4CA 2VU3A 5DEWA 1UA2A 3C1XA 3PFQA 3RGFA 1MRUA 1ZOHA 4KBAA 4WD5A 4OTWA 3N4UA 1Y8YA 4GIIA 3BWJA 4FTUA 4KS7A 2WMXA 2J5FA 3LFQA 3IW4A 3R9DA 4BDFA 4YUQA 3MPAA 3QUDA 4KSPA 3SA0A 4DC2A 1DAYA 1YQJA 1SMHA 1Z5MA 4F70A 3VQHA 1PW2A 2O65A 1J3HA 2I0YA 3OWJA 4KS8A 3KU2A 3BYVA 5BX0A 3KN5A 4AF3A 4FA2A 4EBVA 1RE8A 3A7JA 4K6ZA 3OD6X 5M4CA 1WBWA 5HBEA 2PUNA 1EH4A 3RAKA 3TNIA 4ZOGA 3V01A 5BYLA 5M44A 5KCVA 2G2IA 3NUUA 3H9FA 4EZ3A 3NUNA 4RA5A 1VR2A 4Y95A 3F6XA 2ESMA 3NZ0A 2UUEA 4YZNA 2NPQA 2JITA 5IA3A 1IA9A 3QQLA 1NVSA 4PWNA 2XNMA 3PIXA 4L67A 4LMNA 5EW9A 2C6EA 1AGWA 2WTVA 3KMWA 4E4LA 3EQBA 2X7FA 3PTGA 4RX9A 4I6QA 1YXTA 3D5WA 1KOBA 3DS6A 2UZBA 4I0RA 1FOTA 2R3NA 5EI8A 4RA4A 4XOZA 4C57A 5LVMA 1T45A 3A8XA 4S31A 2JKQA 3Q6WA 4IE9A 5IQFA 5CAVA 4X2GA 2B9IA 2W05A 5AUWA 4ASDA 2JEDA 2BZHB 4BTMA 4UALA 2QNJA 3AC5A 4XJ0A 5AEPA 5CASA 5D9HA 4EQUA 2ITZA 3C4XA 4AZTA 3Q60A 4QMWA 3GCPA 4IZ5A 4QMPA 3DDQA 4ZZNA 1PMVA 5HKMA 3R83A 4U43A 3WYXA 3ET7A 5J9ZA 3OVVA 5JEBA 1Y6BA 4F9CA 5HLNA 5DN3A 2QOBA 3AMYA 3VQUA 5AUZA 1RJBA 4RZWA 5IUIA 4JOAA 3IKAA 3NSZA 4AOTA 5JZNA 3OMVA 3NUYA 4I0SA 3KY2A 2ZJWA 3QWJA 4V0GB 1YHWA 2PMLX 5E8WA 1H26A 3F3ZA 3NIZA 4TWCA 5L8JA 3DZOA 3P08A 3WZUA 4A06A 4GU6A 2XK8A 4O1OA 4UBAA 5CEQA 3OWLA 2FSMX 3PA5A 4R5SA 4A9TA 5LVOA 2JKOA 3P4KA 2BAQA 3V8WA 2XKFA 2Y0AA 2XA4A 4D0WA 1KUTA 3LMHA 3GNIB 3PJ3A 4MCVA 3ZLSA 2CPKE 4MYGA 4FTLA 4L68A 4IB5A 4FV5A 4RIXA 1FGKA 2OXXA 3VUHA 4ERKA 3NIEA 3KRXA 4ZTSA 3OW4A 3NS9A 2GCDA 3A8WA 4JJRA 3OXIA 1DI8A 3IOPA 3KXGA 4HPUE 3ALOA 3VAPA 4R1VA 2E9NA 2WTJA 2HWPA 3C13A 4GT3A 3O50A 5HGIA 1S9IA 2X9EA 2XNPA 3LVPA 2ZM1A 2R3KA 1TKIA 2W06A 3TNWA 2GDOA 4F0IA 3LOKA 5BVFA 4M84A 1R3CA 4MBIA 3FMMA 3QL8A 4OTDA 4O7WA 3R7VA 2PZPA 2JDVA 4X3JA 3D9VA 3BYOA 4PX6A 4B6LA 2CKEA 3P79A 2IO6A 3QC4A 2Y6OA 4ORKA 3RP9A 5H3QA 5IH4A 3DKGA 4CCUA 3KXHA 2XJ0A 5HNIX 5HU9A 3V04A 3P86A 3QD4A 2VNWA 4QP4A 2W4KA 3BV3A 3DKFA 3R7EA 3R1NA 3PJ8A 1OUYA 2XNGA 2FA2A 2VTLA 3PXKA 2BTRA 1RQQA 4IH8A 5H8BA 2QI8A 3FC2A 3U9CA 5TO8A 5ETIA 1ZY5A 1ZOEA 4AS0A 3HMOA 1OI9A 3GOKA 5EQEA 4J8MA 4AT3A 2Z7QA 4APPA 4PDOA 4RJ3A 5AP5A 4I24A 4O2PA 4IZYA 3II5A 2HYYA 2PY3A 4TRLA 3COIA 5EYCA 1ZZ2A 2A4LA 4MTAA 4EI4A 4YU2A 4DCAA 2Y4IB 4YJVA 4ACGA 4B9DA 3NVKI 5KZ0A 4A9RA 4EC8A 4DTAA 4L52A 2ITYA 3FKNA 2XKDA 4U97A 1PXMA 4CZTA 4J99A 1O6YA 3ZO1A 3OF0A 4JL9A 4NM5A 3OXTA 3HMNA 4V01A 5GZ8A 1UKHA 1UNHA 3HECA 4L3PA 3UE4A 3W18A 5KO1A 2YDJA 5AR8A 3PIZA 5DHJA 5B2KA 2CN8A 2I0VA 3F7ZA 4ZSGA 5HIBA 3TACA 4DYMA 3IW6A 3A7IA 3VF8A 2YM4A 3FHRA 5HTBA 4CYJA 5H2UA 4W4YA 1PMEA 4ONAA 4IWDA 1YXXA 2GTNA 2WTKC 3BBWA 1VZOA 3BZ3A 4I6HA 4NW6A 4FVRA 4HNIA 3COHA 3EQPA 1JSTA 3MI9A 3N51A 4QMTA 1O6LA 1JAMA 1OITA 1QPDA 2J0LA 4L42A 4OT5A 5EQPA 3C7QA 4O7LA 3AC1A 3KVWA 3R7OA 4EKKA 4EH3A 3S00A 5EI6A 4ZLOA 2G9XA 1K9AA 2WTDA 4P5QA 3DNDA 1U54A 3PVGA 4QP6A 5E4HA 3DAEA 4J1RA 2Q0NA 2ZB1A 3OZ6A 4TYIA 1J91A 4BCIA 4FG9A 3ZSHA 2HY81 3WBLA 4DINA 2I6LA 2VX3A 4I93A 4USDA 5A14A 3UNKA 5TT7A 4USFA 3LM5A 4GS6A 3CXWA 1OIQA 3UQFA 3EFJA 2OZOA 4CGAA 1DAWA 4PL3A 1KOAA 5DT3A 2RF9A 3ZRKA 3COMA 3ENMA 4RC2A 3FV8A 4RRVA 3E8DA 3LE6A 4AZFA 5D12A 4FZ6A 4FGRA 3ANRA 2DS1A 3R71A 1NXKA 3EJ1A 3H10A 3QTWA 3IO7A 4E5WA 5LCKA 2Y9QA 4BTJA 3PP1A 1WBOA 3O8UA 4QPSA 4AW0A 4EZ5A 4NKSA 4QMSA 3OT8A 4GV1A 4ZS4A 4B8MA 2OXDA 3QTIA 3FZTA 5JRQA 2HZ4A 4IM2A 3RHKA 2UVXA 4BDAA 1E9HA 2HCKA 3FZSA 4O0YA 5JGAA 4ALUA 4ZP5A 4FTIA 4I5CA 4U3YA 4F9AA 5I9YA 3SHEA 4GVJA 3MN3A 4FTRA 3QGYA 3UO4A 3UPXA 1GAGA 3BIZA 3BLQA 2C3JA 2FB8A 1JNKA 5DA3A 5AP3A 3ULZA 4PMMA 5IMXA 2GNGA 4WKQA 3KULA 5BVNA 3UPZA 5E8TA 2CKQA 3PPZA 3EFWA 1Y6AA 4C38A 2BIYA 2YERA 5F20A 4FKUA 3WIKA 2YZLA 2XM9A 5A4TA 3O8PA 3UZRA 3O8TA 4W4WA 3ZFYA 3HAVA 3DTCA 4FSYA 5HG7A 4J52A 2PPQA 3FE3A 2ACXA 2OXYA 1OL5A 3FLQA 3OEZA 2OLCA 4QQTA 3BLHA 4U8ZA 4PPBA 1GIJA 3C51A 4RGJA 4DN5A 1WBSA 4NKAA 5LJJA 2GS6A 3KMMA 2BPMA 1QMZA 3BGPA 4X3FA 4O83A 2CJMA 1GNGA 2ITVA 4X6QC 5IQAA 4F99A 5DT0A 4DGLC 4K8AA 4QO9A 2OJGA 5FBNC 3I6WA 3AC3A 4EYJA 4ENXA 1WVXA 3W2SA 3KQ7A 1WBNA 4XBRA 5ANOA 5HHWA 4DGGA 3LJ2A 1Q8TA 2QLQA 1H00A 3FI2A 4U40A 3ZLXA 1ZYLA 2YN8A 4RBLA 1UWJA 4AZSA 2X81A 4MH7A 5IG1A 2O2UA 4CTCA 4M68A 4DFYA 1DM2A 3DJ6A 3LQ5A 3ZHPC 1IA8A 2C3IB 3OT3A 3VULA 4DA5A 4IXPA 4CT2A 5M4FA 2WXVA 2OIDA 4BDIA 1XJDA 4UMUA 5LWNA 3LCOA 2BRHA 1GZNA 3OUKA 1YDTE 4LL0A 3N4TA 3B8QA 1GOLA 3IS5A 2XK4A 3DK3A 4BFMA 3MS9A 3GB2A 3P78A 5KNJA 1XKKA 4ZY5A 2OZAB 5AAEA 3D5UA 3LHJA 1Q8ZA 4M0ZA 3ROCA 3KXZA 3C4ZA 2CGWA 4D4VA 5AIRA 4CQGA 1J7IA 4C37A 1H27A 5K0KA 2H8HA 3QX4A 3RK9A 4BGQA 4OAVB 5FTQA 2W1HA 5EI2A 1Q5KA 4CXAA 3QHWA 4E7WA 5JSMA 2VZ6A 4HGTA 3S3IA 2C30A 4NYEA 4FNXA 3QTXA 3IQ7A 2WD1A 3OY3A 5D7AA 3CLYA 3F66A 2GSFA 4YURA 4ZLZA 4L45A 4MAOA 4AX8A 5A4LA 5DYJA 3R22A 4DFUA 3PLSA 2ZAZA 4JI9A 3DAJA 4KIKA 3EL8A 3BBTB 4D2VA 4H1JA 4C02A 2IW9A 4IVCA 1XBAA 3RAWA 5ETFA 3KCKA 3EMGA 4L46A 4MQ1A 2BALA 4G3DA 3FYJX 4TWNA 5HCXA 2VN9A 3H4JA 5E8ZA 2CNQA 3EN6A 1X8BA 4LUDA 5L2SA 3PWDA 4WHZA 2KTYA 3B8RA 3H30A 5CQUA 1W0XC 2W1ZA 3DBFA 2CCIA 3MVJA 4TNBA 4U80A 1M52A 4AGWA 3HGKA 2F7EE 3MH3A 4QMYA 3RZFA 2JC6A 3THBA 3H3CA 1SNUA 1M2QA 4BCJA 1PXLA 4MF1A 2J7TA 4QTAA 4ANQA 4FSZA 4RJ5A 2WQBA 4FIIA 3FY0A 4QYGA 5CWZA 4FC0A 3E8CA 3JPVA 2E9PA 4KSQA 5BVWA 1IAJA 3CTQA 1Q97A 3A7FA 3U8WA 1XWSA 3W10A 3VWAA 4JQ7A 5C01A 4FX3A 4FIHA 5L2TA 5C9CA 2YABA 3NPCA 2A1AB 3DQWA 4AUAA 4UYNA 3Q32A 2JDTA 3U87A 1UU7A 1OL7A 1H1QA 3MTFA 4EHGA 4JR3A 4YZMA 3Q52A 4H3PA 4MQ2A 4IWOA 2I7QA 3NX8A 2H6DA 1OB3A 2CCHA 3F3WA 3D15A 4G6OA 4MXXA 5AV1A 2BZKB 3TV4A 2W5HA 3FLSA 5CS6A 3DAKA 2YM5A 2OJJA 3GXLA 4BDDA 5I0BA 5JQ5A 3SD0A 3UQGA 5E8SA 2XP2A 5IQDA 4G9RA 1KV1A 4AE6A 4C33A 4LGDA 2OSCA 4TYHA 1UVRA 4CMUA 1E1VA 3V5QA 2VTRA 2KULA 1QPCA 4NCTC 5IA2A 2VWXA 4D58A 4FT9A 2ONLC 4DEEA 2IVUA 2B0QA 5FXQA 2IVTA 3BU6A 4HZSA 3NYXA 2XNNA 4HCUA 4KKHA 4XLIA 2J0MB 3A7GA 4CTBA 2R3FA 4FI1A 3FQHA 5TR6A 4EL9A 4B4LA 3P7CA 3WOWA 4FTOA 2ZB0A 2XCKA 3HV5A 4AE9A 4BI2A 1WBVA 5AA9A 3C9WA 4RWKA 5KE0A 3A2CA 3K5VA 4KWPA 3G15A 5EYDA 4FTQA 3RTPA 1KE6A 3Q9XA 4Q5HA 4EJ7A 4UMTA 2VTAA 3R1YA 3Q2MA 4DLIA 4IX4A 2P3GX 4UZHA 4P2KA 3IW8A 2RFDA 4WNPA 3KRLA 4NZWB 3GC7A 4BCPA 1WBTA 4QMMA 3RI1A 3TG1A 3EKNA 1A48A 3ZONA 4RJ4A 2ETRA 4DGOA 4CCBA 2X1NA 3F5XA 2R3HA 4QYFA 4D28A 4ANOA 3TUBA 1DI9A 5EDRA 3F9NA 2VRXA 1TQPA 1U54B 4DG2E 3F5UA 3BEAA 1F0QA 4DGNA 3CGOA 4L7FA 2PE2A 1XH9A 3C4WA 4J7BA 3FYKX 5ANEA 4YHJA 5KZIA 3U4WA 4ARKA 1CKPA 3T9IA 3ZCLA 3VS3A 5J95A 3ZC6A 4C36A 1AQ1A 5L2WA 3QKMA 1VEBA 4J97A 5HE1A 3VW6A 3RAHA 3DJ7A 4XV1A 1Q3WA 2B9FA 4X2JA 4ALWA 3AGMA 4JQEA 5DRDA 4YMJA 4H58A 5HO8A 3CBLA 2VTMA 1PYEA 5DT4A 4GT4A 4ANLA 4ID7A 4E4MA 2JAMA 3I1AA 1ZY4A 3FXWA 4OT6A 3W2CA 3QAME 2FH9A 1K2PA 2WMSA 4PTEA 3T3UA 5HLWA 1NVQA 3HRFA 3OROA 5KBRA 3K54A 3AT2A 3KMUA 3R6XA 3WZJA 5IQCA 4CV9A 5CEOA 1XO2B 4IC7A 4IZAA 3KXXA 4QOXA 2HY0A 4NU1A 1VYZA 4J71A 4I5HA 4Y5HA 3OCGA 4GRBA 4KINA 2VTQA 2B9HA 2C68A 3G90X 1ZAOA 3DA6A 5IQEA 2WTCA 2OI4X 3KULB 4I23A 4WOVA 4BKZA 3EYGA 3ORPA 4QT1A 3L9PA 1YVJA 1MP8A 2OGVA 3QQUA 3GENA 5DR6A 5A46A 3OY1A 4ZS0A 4ALVA 5IA1A 1FVTA 3QCQA 5EK7A 2X4ZA 5EFQA 3MB7A 3O7LD 2XJ2A 1QL6A 2CLXA 5K4JA 3R9NA 1CSNA 5ETAA 4Z16A 1STCE 3SVVA 2NRUA 4ASZA 4DH8A 2QU6A 3LKMA 5A4CA 5T3QA 4ENYA 2PYWA 3KRJA 3WF8A 2JDOA 4BCNA 1YDSE 3ANQA 3Q9WA 2ZYBA 4YLLA 4YSJA 2JGZA 3PSCA 1OUKA 3NYVA 4RC4A 2XH5A 3G9LX 2FYSA 3K3IA 4WSQA 4X3FB 5IQHA 3RPVA 4MXYA 3BU5A 3FMLA 4AWIA 3HVCA 4DBXA 4GIHA 3NCGA 3WI6A 3MBLA 3N9XA 3ODYX 4EK3A 5GJDA 4D55A 5JFXA 1Z9XA 5A3XA 4U3ZA 2R7IA 1MQBA 2XK6A 5AP1A 5FBOA 1SVHA 4FBXA 1OM1A 4JBOA 4QYHA 3VIDA 4ZY6A 3MB6A 3CTJA 3QX2A 4O0RA 1OGUA 4FEVA 3CJGA 4FKTA 4AFEA 1OKYA 1OPKA 3KEXA 5T6KA 4LYNA 4D5KA 1YI6A 3BYSA 2ITNA 2OJFE 4FL1A 2I0EA 3MVHA 2YLFA 4EEVA 3QGWA 5IPJA 2BHHA 4OTHA 3DV3A 1ZXEA 4HCVA 5D11A 3UVRA 4O21A 3TT0A 3FWQA 3DXQA 4GKIA 1LEZA 1OBDA 4NT4A 2PL0A 2VNYA 3HUCA 3QD0A 3WZDA 3H0ZA 1REJA 3P7AA 4FSUA 2UVZA 3QZGA 4QQ5A 4C3FA 4E5BA 4ANSA 3NDMA 4UY9A 4JLCA 1XBCA 1G3NA 2X7GA 2AYPA 4GL9A 3TJDA 4TL0A 4ZMEA 4IB1A 3NUAA 3PLAE 3M1SA 5HBHA 5AV3A 4PP9A 4EH4A 5DOSA 3DK6A 4FEXA 5ANDA 2RG5A 3BHUA 4KKGA 4JIAA 4AQCA 2R64A 3V6RA 2PK9A 3UIBA 1I09A 2UZDA 5FM2A 4EC9A 4LFIA 4WBOA 1XQZA 1LP4A 4O6LA 4FKVA 4LGGA 5GJFA 4KIKB 3JR1A 3MPMA 1P5EA 4RJ8A 4DITA 4Q9ZA 5CNOA 2XIKA 5K3YA 4Z7GA 3I7BA 4I94A 3KF7A 2XEYA 4O86A 5BPYA 3R7YA 4TWOA 3MY0A 3P1AA 5AR7A 4ZJVA 4JX3A 2V5QA 4E20A 4G3GA 5IMEA 5HZNA 4EH5A 2BFXA 3R28A 5ACKA 5FXRA 1APME 4O27B 1Q8WA 4C4IA 4RX7A 2WELA 1Q99A 3GCQA 3VUKA 4BR3A 4BCKA 2IW8A 4QP1A 5JFWA 3LMGA 4YO4A 2WKMA 5M55A 3CEKA 4IIRA 3PY1A 4QPAA 3ZXTA 3F2AA 3BLRA 4E5AX 2IVVA 5CT0A 3LFFA 2X6DA 4FZ7A 3CQEA 3RCDA 4E4NA 3IK3A 3O0GA 3R8PA 3ZO4A 4EOLA 2JIUA 4RVTA 1J1CA 3A61A 3VUMA 3FZ1A 2NP8A 3DNEA 5HVJA 4AW5A 5I9ZA 4PDYA 4R3PA 4JDJA 4IAFA 4RFMA 3QZHA 4IAAA 4WIHA 3BX5A 4A9UA 4HW7A 4D2SA 3TDWA 5DBXA 4FSWA 3FHIA 4BCHA 5A9UA 3BYMA 1KE7A 4LRMA 3C5UA 4BBEA 2HXQA 4TKSA 3C4CA 4H3QA 5BVOA 4LM5A 5FEQA 3VBVA 3FLWA 3ORZA 5CENA 3OEFX 3UZPA 4RQKA 1PXOA 4WUAA 2BAJA 4IWPA 4XV9A 4YSMA 2OJIA 3PXYA 3IGGA 3BE9A 4E1ZA 5D10A 4I3ZA 2R0IA 3PSBA 3R7GA 2WHBA 3IOKA 1Q8UA 2XK7A 5AV4A 4XG2A 4F6WA 4XRLA 4XG9A 4BIBA 5KMJA 3W2RA 4DHFA 3SW7A 4RIWA 4GEOA 4FKWA 4OBPA 4C8BA 2OFVA 5M53A 4FZAB 2WPAA 4UX9A 2OZAA 5AFVA 3FPQA 4G3EA 1J7LA 3MSSA 2YM6A 4YTFA 4TYHB 4K18A 1JLUE 1E1XA 4I5PA 5DLSA 1ZMVA 4ZY4A 2WO6A 2HW7A 3G0FA 3BHHA 2JDRA 4QTEA 2ZMCA 3B2WA 4GW8A 3UG2A 4HVSA 3EIDA 4M7IA 2R4BA 3DU8A 3LXPA 4W4XA 3PJ2A 3VBTA 2BRGA 4QMOA 3TUDA 4XS2A 2W0JA 5ANGA 1ZZLA 4PTGA 4UXLA 4EOPA 2B53A 3REPA 5CY3A 5IQGA 3R73A 3DK7A 4DTBA 4ZZOA 2W1EA 4O7VA 3F7WA 3PA3A 5DI1A 2XBJA 5C8MA 2O64A 2ZV2A 5LARA 4CRLA 4IW0A 5T68A 2H34A 5D7VA 4ACMA 2BILB 4NL0A 4HOKA 2WMTA 5CANA 4APCA 3AMAA 2ZDUA 3FL4A 2VD5A 4XV2A 2O8YA 4EK4A 2RL5A 3B2TA 3ZBXA 3VNTA 3R2BA 3S4QA 4O38A 2ITPA 3BYUA 3R7UA 3U6JA 5GNKA 5AP2A 4BWKA 3IPHA 5ANIA 4NSTA 4Q5EA 5AV2A 5M09A 5CTPA 3W8QA 4EH6A 1GIHA 4MX9A 5K9IA 2HIWA 3R8ZA 4FSNA 2ZVAA 3CQUA 4FKIA 4BYJA 4C4JA 5AUUA 3PY3A 3LXLA 3Q5IA 5GJGA 3WYYA 2WTIA 4YGAA 2WGJA 2WTWA 2XS0A 4IBMA 3UYTA 2VX1A 4A07A 4AZEA 4YJSA 2OF4A 4XX9A 4DE4A 5AUTA 3F2NA 4ACCA 5IEYA 3G6HA 1PHKA 2JKMA 2OK1A 4L7SA 3I5NA 4FV2A 4I4EA 3WZEA 2LGCA 4I41A 2B55A 2RGPA 4GJ2A 2PVHA 3QUPA 4IX3A 3UODA 4CFMA 5JT2A 3QTQA 2UV2A 2XK3A 4DG3E 1RDQE 3QC9A 3LXNA 4QMLA 3RPSA 2BDFA 3KA0A 3DZQA 5E8YA 4YNOA 1H0WA 2A0CX 2WMBA 4C7TA 4UZDA 2HENA 4XCUA 4GSBA 1SVGA 4Q9SA 3KXMA 4X7QA 3ROYA 3ZU7A 2JKKA 3QCYA 1PMUA 4E6DA 4OTPA 3F3TA 4X2FA 2YDIA 4ZTLA 3SXFA 2RFSA 2W1DA 3CE3A 5M56A 3CD3A 5HESA 5HTIA 4FT0A 5BMSA 5KMIA 3EQFA 4WG5A 5DFPA 3HMIA 2C6DA 2RKUA 3TZ9A 4FV6A 3TZMA 1YHSA 5FM3A 4CQEA 5AP6A 4MNEA 4FNYA 3TNQB 2VTHA 2YCFA 4G31A 2X2KA 5FD2A 2R3LA 4G3FA 2GTMA 1W98A 3LZBA 4HCTA 4L3LA 2IVSA 4LQMA 3LPBA 3HA6A 3WARA 5AUVA 3DT1A 4FODA 5DVRA 5KKRC 3CP9A 4EOKA 3PVUA 5LMKC 4D1ZA 3BRBA 3QUEA 4JDIA 4C3RA 4QRCA 2VWYA 4K2RA 4L3JA 4PV0A 2JIVA 3DFAA 2X8EA 2B4SB 4KRCA 5TF9A 1LUFA 1G8AA 3V3VA 5IUGA 1NA7A 3IGOA 4RG0A 1M2RA 2QO9A 4YZDA 1H25A 2QOLA 4C34A 1Y57A 3MTLA 4ACDA 5JK3A 4TYEA 3GU4A 3ITZA 4LRJA 4M3QA 3NLBA 3NW5A 5E1SA 3ZDUA 4HYUA 2PZ5A 4AZWA 1T46A 1U5QA 4IHPA 2HELA 3DLZA 3R63A 4BDKA 3BU3A 2FGIA 5HVYA 3ZUVA 4YBKA 4DEAA 4FEWA 4TTHB 3C50A 4S32A 5A6NA 3QA8A 4FVPA 3HMPA 3L8SA 4L00A 3WF6A 3AT3A 4BB4A 5IDPA 4O2ZA 4OW8A 5CEPA 4PPCA 2CHLA 2GFSA 3MFTA 3NR9A 4F6UA 1JKKA 3TV7A 2XJ1A 4GFMA 2CNUA 3F2RA 2OH4A 3DTWA 4C62A 2Q83A 4FVQA 4LGHA 5HG5A 4PDSA 2VTPA 2GHGA 4G6NA 3ORMA 5KUPA 5J9LA 2VTIA 2BFYA 4E4XA 3ZYAA 3PXQA 3PJCA 3LJ1A 4EJNA 1XH4A 4BTFA 2RIOA 2PZYA 3Q4UA 4R8QA 1J7UA 2X6EA 3Q3BA 4W4VA 2XCHA 2ZV9A 2EB3A 3BWFA 3FLNC 4IAYA 4OUCA 1O9UA 4BC6A 4O7NA 3TTJA 3Q9YA 5CU3A 4ZJIA 3CGFA 3QHRA 4F6SA 5FUTA 4OBQA 3QTZA 3ATSA 3BCEA 3PRFA 3BI6A 4ZSJA 5L8LA 4KAOA 2P55A 3VS0A 3E8EA 5LWMA 2XKCA 3O96A 5CLPA 5DR9A 3FKLA 4FKJA 4AA4A 5KMOA 3ORXA 4ZMFA 3FMNA 2R9SA 2V7OA 1FMKA 2XK9A 3NCZA 4BDJA 4YR8A 4QQJA 2B7AA 4CFXA 5AP0A 3SKCA 2P2IA 3ID6C 3ZZWA 5CNNA 5EM7A 5HO7A 4XG8A 3VBWA 4D9TA 3E62A 3O17A 4CZYB 5JN2A 4BBFA 1JVPP 3EN4A 1PKDA 3FAAA 3HLLA 2OKRA 4BWXA 2W4JA 4Z55A 5F1ZA 4OTQA 2GQSA 1B39A 2C5XA 4C61A 4FKGA 4FKQA 1IG1A 3BQCA 4OR5A 1URWA 5CX9A 3TL8A 4E8AA 3KKVA 3R8VA 1S9JA 2UW9A 2WIHA 3LM0A 2VTOA 2QOCA 3PXRA 1OPLA 2F2UA 2R3PA 3LCSA 4ZXTA 3I5ZA 3MW1A 3Q5ZA 3FXZA 3HNGA 3E93A 3MYGA 4XMOA 2YFXA 2BZJA 3ZRMA 1R0EA 3NUPA 1NW1A 4PP7A 4C2VA 5EKNA 4DEBA 4FOBA 3OC1A 2ZV8A 2J5EA 4IZ7A 4WG3A 1VYWA 3ACKA 1ZLTA 1XH5A 3F88A 5K0XA 1WZYA 4HVHA 5LOHA 3HV6A 4BYIA 5DR2A 3EYHA 1YW2A 1H01A 1OIRA 3L9NA 4YJOA 1OL6A 3JVSA 3MDYA 2OH0E 4X3FC 5EW3A 1H1PA 5HLPA 4CMOA 5FTGA 2F7ZE 2VWBA 3F5GA 1J1BA 2V55A 4CKIA 1JOWB 3I81A 2UW3A 3KRRA 3NNWA 2PVNA 4EONA 4UB7A 1XHAA 3NGAA 1B38A 2R5TA 1H07A 2IN6A 3QTRA 2H96A 2E9VA 2YWPA 2R3JA 4XG3A 4D1SA 4M97A 3E3PA 2O0UA 4E6CA 3PZHA 2IZTA 3CSVA 2BCJA 2EWAA 4FL3A 5AUXA 4O1PA 5JQ8A 4FV0A 5L6WL 4RIWB 4WNMA 4C35A 3VS7A 3GU8A 3AT4A 4YPSA 3KL8A 5BNJA 3TUCA 3FMDA 4R7HA 3RK5A 4XHKB 4AAAA 3BQRA 1DS5A 4JX7A 4UWYA 5LMBA 3GC0A 4C4HA 3DBDA 2XBAA 3PVWA 4J98A 4N0SA 3RCJA 4UMRA 5IISA 3BHTA 5CSXA 5D41A 2YA9A 4GYIA 3KREA 4CZUA 5BUJA 4I5MA 4GUBA 4L43A 5M57A 4E3CA 2UZOA 5AP7A 5C8KA 1Q3DA 3ZMMA 2R3GA 4RFYA 4BHZA 4WRGA 4YPDA 3TZ8A 3TV6A 4B0GA 4OTGA 4JAJA 4Y83A 5HVKA 4IX5A 4XYFA 3GEQA 5ANJA 5A4QA 4KBKA 5KMKA 5G6VA 4DFBA 3ETAA 3V5WA 2WFYA 3FQEA 3QTUA 3ZOSA 3VUTA 2O5KA 2ETKA 3F82A 3GFWA 4FSMA 5DIAA 4ANBA 4HVDA 2CLQA 3V51A 3MIAA 5E7RA 3WILA 3VS1A 2BR1A 2P2HA 4ZSLA 2OU7A 2BMCA 3F61A 2Z02A 4OLIA 4QTBA 5DMZA 4I4FA 2B52A 3CIKA 3E87A 3AGLA 3SDJA 2PZRA 4FV1A 3VHKA 4BCMA 3PY0A 3PXFA 2GNJA 4DBNA 4F1TA 2F57A 4RQVA 4TYGA 3GBZA 2JFMA 2C1BA 3ALNA 4JG7A 4EUUA 4KIQA 2X2LA 3EQCA 4S34A 3H9OA 5HNBA 3VHEA 1MQ4A 5HIEA 4CEGA 5HCZA 2O63A 5HI2A 3FKOA 4IAZA 1OBGA 3TKUA 3UBDA 2WOTA 4QTCA 4CT1A 4XG6A 2BRNA 3OG7A 2QKWB 4Y72A 1SNXA 4MHAA 1W83A 5J7HA 2CGVA 4FIGA 4JXFA 3OP5A 4BICA 2YIRA 2VWWA 1IR3A 4FG8A 5I5ZA 3KCFA 4BKJA 5HG8A 3ZDIA 5DE2A 3V8TA 2VTJA 3Q6UA 1XH6A 1Y91A 5CI6A 3PPKA 3N4VA 5EH0A 2IZUA 3MIYA 3UTOA 4O0WA 4G16A 3ZO2A 4MD7E 4DTKA 5CYIA 2G15A 3HDMA 4E6AA 3FPMA 4BF2A 5IEXA 5FXSA 4CYIA 5CEKA 1BI8A 2J51A 3Q96A 4JNWA 2C47A 4Y46A 2Z8CA 3FBVA 3Q04A 5CF8A 2VUWA 3C0IA 1ZWSA 3DKCA 5J5SA 3LJ0A 3WF7A 4A7CA 2ZM3A 3G33A 2QODA 4N4SA 4KNBA 4OGRA 2UW7A 3HKOA 3WF9A 1W7HA 4O7RA 4R5YA 1UKIA 3VBQA 4G2FA 3GC8A 4L8MA 2OF2A 1V0BA 2Y8OA 3QU0A 4I0TA 4I20A 4P4CA 3ELJA 3W32A 2ITUA 2AC5A 4RSSA 4ZIMA 5BYZA 1IEPA 3V5PA 4QYYA 3EN5A 3OTVA 4M67A 4MNEB 3HX4A 5IZFA 2P4IA 3D4QA 3E3BX 3GCVA 3UQCA 4O82A 2PSQA 1ZMWA 4AU8A 4XG7A 3D5VA 1AD5A 3P9JA 2VO3A 1F3MC 4JBQA 4NWMA 4NCTA 3QXOA 3RPYA 4K33A 4CMTA 2ONLA 2F2CB 5HD4A 5C4LA 4W8DA 4KABA 5LXMA 4C58A 2J50A 4RWJA 3ZM4A 3W2OA 5IUHA 4PMPA 5CZHA 4MNFA 2PUUA 1M7QA 5GHVA 3M11A 2IZSA 2JBPA 5FLFA 4DF3A 2QOIA 5TE0A 4BDEA 3MA6A 3BE2A 3OTUA 1YWNA 1PXIA 2WMUA 4JDHA 4PL4A 5EG3A 4UEUA 2F49A 1UV5A 3LFDA 5FEEA 1V0OA 3EZVA 3FUPA 4WNKA 4HYSA 3ZZEA 3QD2B 2X9FA 5CU0A 3WE4A 4GUEA 3UVPA 3GOPA 2WTKB
chains in the Genus database with same CATH superfamily
3DGKA 2OWBA 4DH7A 4G34A 4EH2A 4BCQA 4YC3A 3EQRA 3BELA 2XVDA 4TPTA 4FGBA 3QQHA 1TQIA 3V8SA 4Z3VA 4FYOA 4IVAA 2UW4A 5HBJA 4UXQA 2YM7A 4DCEA 4UMQA 4DGMA 3JVRA 1U59A 2C0TA 2CSNA 3DDPA 3IECA 2WQEA 3OWKA 4OBOA 4BGGA 4GT5A 2OG8A 3RALA 4FKPA 4QQCA 3MFRA 4MKCA 1WAKA 4QDEA 2A2AA 2XNEA 4R3RA 2C6KA 2XYNA 3NEWA 4J95A 4PF4A 4RWLA 5E8XA 2XMYA 2ITOA 5HU3A 2ERKA 2VAGA 2YITA 5IDNA 2IJMA 3POOA 4FMQA 5FP6A 5IA0A 3QLFA 4EH8A 5J79A 4QEBA 2X0GA 3QRUA 3HEGA 4FV9A 3LW0A 1O6KA 1H1WA 1ZYSA 4YTHA 3VO3A 3VS6A 4F7SA 3NYNA 2HK5A 3JUHA 4AW2A 3F69A 3GT8A 3ZXZA 5IQBA 4PY1A 5J1VA 3Q4TA 2EU9A 3FZPA 3OCBA 4XV3A 1GZKA 4FG7A 2YCSA 3DBCA 4FSRA 4KBCA 4O4DA 4YJUA 4PNKA 4RWIA 4DT9A 4FICA 3FZOA 2IG7A 4YZCA 3VRYA 4NUSA 4I22A 5CU4A 3DPKA 4X6RA 2XUUA 3VBXA 3PUPA 4ITIA 3RM7A 3V5TA 1V0PA 2QOKA 3KGAA 2RSVA 4KIOA 3U55A 4LG4A 4BL1A 3U6HA 3NW6A 4M13A 2UZNA 2WAJA 3R7IA 3TNHA 1FQ1B 3ZH8A 4CVAA 3NNXA 5M06A 5F9EA 1FINA 2Z7RA 2VWIA 2Y4IC 4RMZA 4L9IA 3V5JA 1BUHA 1Y8GA 1U4DA 2QVSE 3E88A 4JQ8A 1XBBA 4O0UA 4YJNA 5BVEA 4FF8A 3M42A 3PPJA 4MD9E 5M51A 3SOCA 2Y7JA 2E9UA 5C03A 1OKZA 3AC8A 4A4LA 3UGCA 4CFWA 3ULIA 5ICPA 3VS4A 5L3AA 3UZTA 4UV0A 4RLKA 3IW7A 4NIFA 2G2HA 4EOSA 5M4UA 4LUEA 3D2IA 1H8FA 1IRKA 2W1GA 5EDPA 3RVGA 3LMIA 2VTNA 3R1QA 5K5NA 2FSTX 3PJ1A 1GJOA 3I6UA 2AC3A 4O0SA 3NWWA 3GQIA 1YKRA 2WQNA 3W0PA 5M08A 3R1SA 4RT7A 5EM8A 5HOAA 5L6OA 4DT8A 3F5PA 3CPCA 4PL5A 3DJ5A 5I3OA 3D2KA 4W9WA 1Q62A 3DLSA 3ZSIA 2GNLA 5I4NA 4UWBA 4UN0C 2GS7A 2V62A 2BIKB 5ANKA 1PMNA 3L9LA 3D94A 5I9XA 3OOGA 3QFVA 5CI7A 3AKLA 4FKLA 4U81A 4AW1A 2YJSA 3LFCA 5CF5A 2YCQA 2J0JA 4IDVA 2YIWA 4KB8A 3FL5A 3FLYA 5CF4A 4FTAA 3VUIA 3SXRA 3PIYA 3FEGA 4EYMA 4R6VA 4DH1A 3L9MA 2PE0A 4O96A 3AG9A 3TIYA 3DXPA 2ERZE 4FOCA 3U6IA 5CSHA 3Q2JA 2OW3A 1UNLA 5C4KA 3LCKA 2WU7A 4QMXA 1Q4LA 3D83A 3DB6A 2DWBA 3FSFA 3SLSA 3NVMB 3V6SA 2EVAA 2WNTA 2NO3A 4YLKA 1UU3A 5DG5A 4AAYA 1QPJA 3SGCA 3G9NA 1PXKA 3IW5A 2QHMA 4X21A 3ZFMA 2QHNA 3GUBA 4FYNA 4K9YA 4AZVA 2QOFA 4I21A 1H24A 3HV7A 4H36A 4U9AA 1L8TA 4AP7A 5GZ9A 4D1XA 4NK9A 2VGPA 3QXPA 4MWHA 3MGYA 5EM6A 3POZA 4R1YA 1XR1A 2W5BA 5HTCA 2HZIA 3QQKA 1KV2A 4KRDA 5F95A 4PPAA 2GU8A 2HXLA 4FIJA 3SRVB 3FMKA 5AR2A 3TEIA 2I1MA 3D14A 2XM8A 4Q2AA 4BBMA 2B9JA 2YIYA 5JFVA 3JY0A 3PE1A 3GGFA 4QDVA 2PMOX 2JBOA 3KRWA 1L3RE 3H9RA 1WCCA 2J9MA 4IANA 4LOQA 2YAAA 4QTDA 3SX9A 3PVBA 4YTCA 3OCTA 1SZMA 4HGEA 3U9NA 2P0CA 3C4FA 4NEUA 4F0FA 2BAKA 4OTIA 4C59A 2HZNA 4JG8A 3LFBA 3AC4A 3PG1A 2ZV7A 4IWQA 4ANMA 3UOLA 3ML1A 2C5NA 4DFLA 3KB7A 2C3KA 3I60A 1YDRE 4EHZA 2JD5A 4FV7A 4M69B 4ZAUA 3PSDA 2QC6A 2YZAA 4AA0A 3E63A 3KFAA 4EH7A 4EK5A 4CKRA 3PFYA 3ZO3A 4FKSA 3CPBA 3H0YA 4G17A 1UNGA 3I0QA 3T9TA 2PU8A 4D0XA 4WRSA 2NRYA 3EFLA 5BMMA 3RAIA 1U5RA 2C4GA 4ZK5A 5DGZA 5EYKA 5HX6A 1FMOE 1PXPA 3HYHA 4GYGA 3RWPA 4EOIA 3DFCB 3MPTA 2EXCX 1W82A 2UZWE 3D7TA 4ZJJA 1B6CB 5HD7A 4AN9A 4DG0E 4CFFA 2HWOA 4FIFA 4LV8A 4K1BA 2YCRA 3EQIA 4H39A 3OWPA 4HPTE 5AIKA 4HGSA 2YIQA 3NNVA 4IM0A 3E7OA 4J53A 4RZVA 1ZARA 2X7OA 4YHTA 1GY3A 2C5YA 4XEYA 5DRBA 5B0XA 5D1JA 4PDPA 4BCOA 4CSVA 1YWVA 4RPVA 1PXNA 1SYKA 4QP9A 4ZZMA 4USEA 4BTKA 2XF0A 3MVLA 3UOJA 3HUBA 2Q0BA 2CGXA 2VX0A 1ERKA 4ERWA 2YJRA 3K5UA 5DWRA 2VO0A 4AXEA 5EHYA 5IQIA 5AAGA 4PQNA 2FSLX 5CAQA 2W96B 3D7ZA 1OECA 5LVNA 1OVEA 4P90A 2W7XA 4PTCA 5EHLA 2W9FB 3DXNA 3KK8A 4D9UA 2BUJA 4WSYA 3ZFXA 4FT3A 2R3OA 3E7VA 3BEGA 3AD6A 2XEZA 2HW6A 1HCLA 2SRCA 1M14A 2C0OA 2W1CA 3LCTA 4O22A 4Y85A 5C27A 4N6YA 4DEDA 5LVPA 2GQRA 5AADA 4BHNA 4MD8E 4XRJA 3R9HA 2H9VA 2BHEA 4BZOA 4EOOA 4F65A 1HCKA 4EOMA 1XMMA 1CM8A 4U44A 4FZDB 4BKYA 1Q24A 2PWLA 4HJOA 3QRTA 4I6FA 4AFJA 5A6OA 2C1AA 4CLIA 2A27A 3EKKA 5CT7A 4AQKA 4A4XA 4YO6A 5B2MA 1H4LA 4IJPA 3EQHA 4TT7A 3W1FA 2EUFB 5A4EA 4ITJA 2PMIA 3LLAA 3OHTA 1M2PA 4PMTA 4DEGA 3LFEA 4IB3A 4FK3A 1W8CA 1OMWA 2W1IA 3VJOA 3W0NA 4V05A 1YWRA 4BVUA 5FGKA 5JRSA 2BVAA 5HNGA 5EW8A 2XIXA 3TXOA 2VTTA 2WMVA 3NNUA 4XP2A 2RFNA 4YHFA 4EHVA 3T8OA 2XNBA 2W17A 5CU2A 4F9WA 2BKKA 3MFUA 2GPHA 3WZKA 4GFOA 3DY7A 3AC2A 5CXHA 1TQMA 2YM3A 4XH6A 4IB0A 3E8NA 5G1XA 4BZNA 5IEVA 1P14A 1SM2A 4WBBB 3AOXA 4UMPA 4ZTMA 4N57A 5I9WA 1QCFA 1PYXA 3CY3A 4O7YA 1PXJA 4X2NA 2OIQA 2VO6A 5EHOA 2AUHA 3ACJA 4J8NA 4H1MA 5LCJA 5FEDA 3ERKA 3ZRLA 1NT2A 1G8SA 3T3VA 2FVDA 1LPUA 4FSQA 3RJCA 3LFNA 4IFGA 5LQFA 3MH2A 5AMNA 2ITQA 2ETMA 2UZUE 5CVGA 1OZ1A 4EK6A 2XKEA 4L53A 3CKXA 4O91A 2B1PA 3TIZA 4QD6A 4NW5A 2F4JA 1CMKE 2QD9A 4JRNA 4G1WA 4U42A 3SV0A 2PTKA 2GNIA 4TWPA 3ZBFA 4IJ9A 1JQHA 4YZ9A 3BHVA 3V5LA 4O0XA 3UG1A 4F1MA 1QPEA 4GKHA 4JBVA 3QYZA 4WO5A 4AT4A 2UW6A 4M12A 4QMZA 4S30A 4Y5QA 4FT5A 4F9BA 3OUNB 2BKZA 4MK0A 4J96A 4OAUC 4CKJA 3A7HA 3PDTA 4RLLA 1PY5A 4IVDA 4RX5A 2GFCA 4IADA 3Q9ZA 5FRIA 3R01A 4QP2A 3HL7A 2DUVA 2PHKA 4DH5A 5M4IA 4G9CA 4R78A 5BVKA 2YHVA 3OBGA 3MA3A 3P7BA 4IC8A 3ZLYA 4EWQA 2X2MA 3GU7A 5I9VA 3R02A 5TOZA 2R3RA 3CC6A 2R7BA 2CMWA 4FZFB 4ACHA 1KE5A 3R8UA 2CN5A 2F7XE 4F64A 3CD8A 5HX8A 3UP2A 5EYMA 4O0TA 2VGOA 3JS2A 2ITTA 1JPAA 2XRWA 2YAKA 3I4BA 1YOLA 2PVFA 3U54A 4G5PA 4MWIA 4HVGA 4TNDA 2PUIA 1JSVA 1M17A 4FKRA 4B99A 4NJ3A 4LV5A 2XRUA 1UU9A 2VV9A 4O0VA 4RC3A 2UW0A 5LMKA 2B54A 5CSWA 5DNRA 3UIXA 3NMUF 5JFSA 4NIFB 1CDKA 4G6LA 4U6RA 2EB2A 4WA9A 3OW3A 3RKBA 3I7CA 4AA5A 1R78A 3F3UA 3ZC5A 4YJRA 3FLZA 3JXWA 4XUFA 2R3IA 4RVLA 1CKIA 3JY9A 2Y4PA 3UDBA 3U4UA 1YXSA 4LL5A 4QYEA 3UYSA 3SXSA 1BI7A 3KK9A 1H08A 3ORKA 5JZJA 1PJKA 4K11A 3W0OA 2XARA 4BJJA 2C0IA 4MBJA 2XIZA 5AV0A 3EN9A 3LAUA 4NTSA 4GU9A 2UW8A 1R0PA 5FDXA 5ITAA 3I0OA 3Q4ZA 3R8MA 4IACA 5BYYA 4YC8A 3TI1A 3FMEA 3EFKA 4AOIA 5BUIA 3GCUA 4F09A 5F94A 3P5JC 2QLUA 3VC4A 4UWCA 2J0KA 3BGQA 3QD3A 3S2PA 3TTIA 3GU6A 1BKXA 5EM5A 3D0EA 3A62A 5KMMA 3LQ8A 4U79A 2YLEA 2ZM4A 2Y6MA 2CGUA 4O4EA 3UC3A 4C0TA 4RIYA 4JG6A 2OBJA 4MXOA 5H9BA 2VWVA 4IFCA 1K3AA 5HG9A 4JBPA 3HRCA 3W2QA 4NM7A 4IM3A 4MXAA 2G1TA 3WF5A 4B8LA 3PYYA 4F0GA 3A4PA 3QLGA 3QWKA 3SC1A 4EKLA 5KBQA 4D2PA 4DEIA 1TVOA 4WG4A 4L44A 3LFAA 2G01A 2WMQA 4E73A 2IPXA 2X8IA 5ACBC 5K4IA 2HAKA 4IQ6A 4ZSAA 3EN7A 3QA0A 4BWPA 3IDPA 3RM6A 4QMQA 4E93A 4ASXA 2JIIA 1CKJA 1ZYJA 3O2MA 4CD0A 4EORA 3NAYA 3QQGA 4M66A 1P4OA 3DOGA 3GP0A 3UC4A 4C4EA 4U41A 3NUXA 5CQWA 2I40A 4ZSEA 4KUJA 4XP0A 5L4QA 3VS2A 5CVHA 3W8LA 4IMYA 4BDGA 1BLXA 3BPRA 3ENHA 2WB8A 3UOKA 5IA4A 2BTSA 3COKA 4FKOA 2UZVA 2P33A 3R04A 3RPRA 1URCA 4JAIA 4JDKA 2IW6A 2UZEA 4TXCA 1YHVA 4Y8DA 1ST4A 4MEDA 2QCSA 4FTNA 3AMBA 1W84A 3LFSA 2FUMA 2OFUA 3HMMA 3UDSA 2C3LA 2E9OA 3VUDA 3FC1X 5AJQA 3BLAA 2PUPA 2RFEA 2WZJA 1YOJA 3KXNA 5AR5A 5L8KA 3MH1A 4FR4A 4FTTA 5H8GA 1HOWA 1YXVA 4O81A 3EWHA 1RW8A 4S2ZA 3RMFA 2IWIA 1WVWA 3VF9A 5IH5A 3G0EA 4MBLA 2PMNX 3PG3A 4B7TA 1JBPE 4ZEGA 3SW4A 4E26A 3EH9A 3FI4A 3G5DA 5CZIA 1IAHA 1ZYDA 1P2AA 1FVRA 4FNZA 2OIBA 4XG4A 5M07A 2WQOA 4EWHA 1MRVA 4YZBA 4ZTRA 4CFNA 4CRSA 1BX6A 3R9RA 5AR4A 3UOHA 3PZEA 5L2IA 3D5XA 4AG8A 1V1KA 1YI3A 2GQGA 5KHXA 1ZMUA 5HEZA 4NH1A 2YISA 4U45A 2ZDTA 5IH6A 3WE8A 4ANNA 3D7TB 4Y73A 5HO6A 2RG6A 1ATPE 5KMLA 2BDJA 2W99B 4TW9A 5J1WA 3FI8A 5J5TA 2W9ZB 4BZDA 4M14A 4BGHA 4NM0A 2BROA 4F7LA 4BI1A 2UZLA 5FTOA 4D4YA 4FUYA 4F7NA 4NFNA 3S0OA 3LQ3A 1H28A 2Z60A 4RFZA 2NYAA 2ZOQA 3DBQA 1JKLA 5C8NA 4KA3A 2WMAA 4EHEA 2WMWA 2GHMA 5L2QA 4IDTA 3U51A 4AN2A 4FTJA 2YDKA 4YP8A 2VWUA 1H0VA 1R39A 2C5OA 3CY2A 3MFSA 5K5XA 3QRIA 3EOCA 4LI5A 3EHAA 5HE3A 3BV2A 2PVKA 2YM8A 2QO2A 3CCNA 3MESA 3O51A 3UNZA 3NRMA 3PRIA 4F7JA 3TDVA 2C6OA 4YBJA 5CU6A 2ZMDA 3GCSA 2XNOA 4BN1A 4YJPA 3R8LA 4X0MA 4YTIA 3MY1A 4EOQA 5IF1A 3VONA 1ZRZA 4AN3A 5HIDA 4NJDA 3ZS5A 5JMSA 2PVYA 2X39A 1KE9A 3DBEA 4D2WA 2XZSA 2IZRA 5AUYA 4KKEA 3SRVA 3ZSGA 4NTTA 4D4SA 3K3JA 2NNWB 1BL6A 3C0GA 2DYLA 4GK2A 4YNEA 1LR4A 3IG7A 2C69A 4WUNA 5JGBA 3F3VA 3QKLA 3L8PA 3Q53A 4FUXA 2BRMA 4H05A 1WFCA 3OOMA 4EUTA 1Q61A 5EQYA 2GMXA 2GNFA 5EDQA 4FTCA 2BRBA 3L1SA 3AXWA 3R21A 4GK4A 4A4OA 4EK8A 3MV5A 2QOQA 1A9UA 3GC9A 2JDSA 3CJFA 3ZEWA 4XP3A 4Z7HA 4Z9LA 2W1FA 4YC6A 4BDBA 4DDIA 2Z2WA 2OO8X 5CAOA 4QMUA 3W0RA 3G51A 3R9OA 4A9YA 4BCFA 2X4FA 3EQDA 4M69A 1OKVA 3OS3A 2G2FA 3A4OX 2EXEA 3MH0A 4F08A 1WMKA 3MJ1A 3G6GA 3UVQA 2BZIB 5B7VA 4D2RA 4DEHA 5IKWA 2WOUA 4M15A 2R2PA 4QMVA 2CKOA 1OKWA 3NYOA 4W8EA 2XIYA 4GH2A 3WIGA 5HICA 4IEBA 1MUOA 3FI3A 3GQLA 4NFMA 4QP7A 1CTPE 4RIXB 1BL7A 4IX6A 4FT7A 3ORIA 2WU6A 5E1EA 5E90A 5CSVA 5DEYA 3RPOA 4O84A 3TCPA 5E9EA 5B2LA 4WNOA 4R77A 2J6MA 4BRXA 3TKIA 3W2PA 1Q8YA 2QKRA 3CKWA 4I92A 5LVLA 4CV8A 4FL2A 4EH9A 1UU8A 3TM0A 4YJTA 5IA5A 4RX8A 4RVMA 3L8XA 4GMYA 2J0IA 4K77A 2EXMA 3ORLA 4R7IA 4CG8A 5I9UA 4AGCA 4P5ZA 4MXCA 3VS5A 3TN8A 3PP0A 2C5VA 3PWYA 4N6ZA 5J7BA 4QPMA 3E5AA 3HP2A 3PA4A 4O7TA 1GZOA 2J90A 2JLDA 2X0QA 2PVRA 3MVMA 5E8VA 3QZFA 4QNYA 4WT6A 2QOHA 1FVVA 4FE2A 5CF6A 3PXZA 4HYHA 5GIOE 2XB7A 3ZEPA 2JFLA 3BHYA 4FEQA 4C2WA 3UO5A 3UMXA 3CQWA 5HE2A 4FK6A 3MWUA 4HYIA 5KKRB 1ZYCA 2QO7A 2ITWA 1YOMA 3EQGA 5GIPE 4BY9E 3VBYA 3VRZA 3E64A 4AXAA 4LOOA 3DQXA 2HZ0A 1WVYA 4RJ6A 3UDZA 1G5SA 4O7ZA 2R3QA 5CVFA 5J87A 5JKGA 1TFFA 1OIUA 3QALE 4BDHA 4E6QA 1FBNA 4R7BA 4RJ7A 4ASEA 1OL2A 1PRYA 4BCGA 4QP3A 4GG7A 4GJ3A 4ZTNA 3P5KA 4F4PA 4FV3A 3O23A 4MF0A 3IDCA 3QRJA 4BJJB 1JKSA 4FIEA 5AR3A 4EOJA 5AM7A 3OBJA 4QNAA 2HOGA 4DFXE 4OTRA 2QR7A 2CKPA 4GK3A 4G5JA 3UMWA 1SVEA 3FDNA 2CDZA 3QZIA 4FV8A 2VWZA 1OIYA 4V0GA 3IDBA 3HV4A 4IAKA 2QURA 2V0DA 3BKBA 3L8VA 3A60A 5CAUA 1GZ8A 4JR7A 4XNEA 5GZAA 2W5AA 3QQFA 1ND4A 1F5QA 4YLJA 4AOJA 3VVHA 3ORTA 4ZTHA 4FV4A 3VW8A 3ZUTA 4LRKA 3KVXA 3AQVA 4RIYB 4O7SA 3M2WA 5AWMA 3TJCA 1G8JA 3TZ7A 1WBPA 2FSOX 1R1WA 3P23A 4F63A 4FEUA 5LMAA 5FG8A 2REIA 4UYAA 1KWPA 3O71A 4KD1A 4FTKA 3RNYA 5C26A 1JWHA 5EOBA 3C0HA 2C6MA 1YI4A 4A9SA 3QF9A 4D5HA 4RVKA 4LMUA 3UO6A 2GS2A 3QQJA 3HZTA 1GIIA 4XOYA 1REKA 4TZRA 4U5JA 5DH3A 3GFEA 4PRJA 5H8EA 4NM3A 3UIUA 1G8KA 4N70A 2X8DA 2PVLA 3FMJA 3FSKA 3IONA 3LCDA 1KE8A 1JKTA 3FY2A 4JT3A 4PUZA 2QONA 4TYJA 3UJGA 5KHWA 1BYGA 4GFGA 3S1HA 4P7EA 4CNHA 2WIPA 3G2FA 3VUGA 4V04A 4M8TA 4MVFA 1PKGA 2CNVA 2Z7LA 1U46A 1FGIA 5E92A 5TKDA 5CSPA 4KIPA 4L01A 3QBNA 5FQDC 2UVYA 3R2YA 1VJYA 3MJ2A 3ZUUA 4CFVA 4DFZE 3W0SA 1I44A 4FSTA 4HNFA 4JS8A 3FMHA 5KMNA 3PE2A 5AX9A 1OPJA 2YACA 3RHXA 2OICA 3BGZA 5I3RA 3UNJA 1H1SA 4FJVA 3RBWA 3W55A 2OJ9A 5CALA 3RWQA 1JSUA 2I0HA 4S33A 2DQ7X 2BDWA 3FJQE 3LXKA 4X2KA 2QG7A 4HVIA 5BVDA 2YWVA 4II5A 4BIEA 4C4GA 4EZ7A 4HZRA 3QCXA 4HGLA 2C6LA 4YJQA 2A19B 4MXZA 3P0MA 3KC3A 1XH8A 3ZLWA 3C4EA 3R00A 3W16A 3RINA 5JGDA 3S95A 2QU5A 3VJNA 4PMSA 3ODZX 2VO7A 1P4FA 4I6BA 4K0YA 4ZTQA 3R0TA 3OFMA 1LEWA 3OXZA 2WEIA 4EQMA 5A54A 3GI3A 3GVUA 1OL1A 3QTSA 5EKOA 3C5IA 4U0IA 3O7LB 3W0MA 3QKKA 2GHLA 3EB0A 4QMNA 2WEVA 3K2LA 4EBWA 4H3BA 3EZRA 3HP5A 2J2IB 3EL7A 4XBUA 3SAYA 3VN9A 4AGDA 4D4RA 4DH3A 5IU2A 3NW7A 3FXXA 5L6PA 4JVGA 3QYWA 3NAXA 3R30A 5EOLA 1MRYA 3ATTA 2XYUA 2R3MA 3SQQA 2PZIA 2XIRA 3FQSA 3NUSA 2X0PA 5AX3A 5CEIA 3TNPC 3UIMA 4ZLYA 1H1RA 3OCSA 3TKHA 5CAPA 4FNWA 2FO0A 2LAVA 2E2BA 3SOAA 5AA8A 1PF8A 4EQCA 1KSWA 2J4ZA 2O3PA 2C6IA 4PNIA 4DFNA 3ORNA 2C6TA 3KN6A 4GCJA 3ZTXA 4I1ZA 5CEMA 4ITHA 2PVJA 2QG5A 3E92A 4CLJA 2WMRA 3QCSA 4BDCA 5J9YA 1XH7A 3GU5A 5ETCA 4C4FA 4AT5A 3W33A 3HAMA 5JH6A 4AGUA 4BI0A 2PVMA 4OTFA 3KF4A 4QP8A 4W9XA 2WQMA 5FDPA 3UP7A 3QRKA 3LIJA 4R3CA 4TN6A 5AM6A 5J8IA 3ZM9A 4JRVA 3SG8A 2YEXA 4LOPA 5FWKK 3CS9A 2VTSA 1YXUA 3LLTA 5E8UA 2JAVA 3RK7A 4AXFA 4XLVA 4U7ZA 4F1OA 5KX8A 4FTMA 2UZTA 4G3CA 3MY5A 4AACA 4CG9A 4GG5A 1NY3A 5F4NA 3HA8A 4GVAA 2W4OA 3HRBA 3CR0A 2PULA 4RIOA 2V7AA 4C3PA 1ZOGA 3HDNA 3I79A 4F9YA 5C1QB 4DLJA 1A06A 5GINE 1NVRA 1UWHA 5HCYA 3JYAA 1Z57A 2QOOA 5HE0A 4BIDA 3CTHA 3AD5A 5DPVA 2V22A 4L6QA 4D2TA 5HORA 2UW5A 5FP5A 1YRPA 3UDTA 5BUEA 5CXZA 2PE1A 2Z7SA 4O6EA 3TMOA 2GNHA 4IAIA 3RNIA 3SG9A 2IEWA 1BMKA 1FPUA 2QR8A 2R0UA 3RZBA 5HQ0A 4IVBA 3HV3A 5AP4A 4CFUA 3DB8A 1IASA 4JIKA 5E91A 3TWJA 3AD4A 3A99A 3DKOA 5AAFA 1M7NA 3FZRA 5BQ0A 1Q41A 2F9GA 2QQ7A 2YIXA 3DCVA 4M0YA 2ITXA 4TY1A 4DAWA 3Q4CA 2VU3A 5DEWA 1UA2A 3C1XA 3PFQA 3RGFA 1MRUA 1ZOHA 4KBAA 4WD5A 4OTWA 3N4UA 1Y8YA 4GIIA 3BWJA 4FTUA 4KS7A 2WMXA 2J5FA 3LFQA 3IW4A 3R9DA 4BDFA 4YUQA 3MPAA 3QUDA 4KSPA 3SA0A 4DC2A 1DAYA 1YQJA 3W0QA 1SMHA 1Z5MA 4F70A 3VQHA 1PW2A 2O65A 1J3HA 2I0YA 3OWJA 4KS8A 3KU2A 3BYVA 5BX0A 3KN5A 4AF3A 4FA2A 4EBVA 1RE8A 3A7JA 4K6ZA 3OD6X 5M4CA 1WBWA 5HBEA 2PUNA 1EH4A 3RAKA 3TNIA 4ZOGA 3V01A 5BYLA 5M44A 5KCVA 2G2IA 3NUUA 3H9FA 4EZ3A 3NUNA 4RA5A 1VR2A 4Y95A 3F6XA 2ESMA 3NZ0A 2UUEA 4YZNA 2NPQA 2JITA 5IA3A 1IA9A 3QQLA 1NVSA 4PWNA 2XNMA 3PIXA 4L67A 4LMNA 5EW9A 2C6EA 1AGWA 2WTVA 3KMWA 4E4LA 3EQBA 2X7FA 3PTGA 4RX9A 4I6QA 1YXTA 3AKJA 3D5WA 1KOBA 3DS6A 2UZBA 4I0RA 1FOTA 2R3NA 5EI8A 4RA4A 4XOZA 4C57A 5LVMA 1T45A 3A8XA 4S31A 2JKQA 3KIOC 3Q6WA 4IE9A 5IQFA 5CAVA 4X2GA 2B9IA 2W05A 5AUWA 4ASDA 2JEDA 2BZHB 4BTMA 4UALA 3BL7A 4MUQA 2QNJA 3AC5A 4XJ0A 5AEPA 5CASA 5D9HA 4EQUA 2ITZA 3C4XA 4AZTA 3Q60A 4QMWA 3GCPA 4IZ5A 4QMPA 3DDQA 4ZZNA 1PMVA 5HKMA 3R83A 4U43A 3WYXA 3ET7A 5J9ZA 3OVVA 5JEBA 1Y6BA 4F9CA 5HLNA 5DN3A 2QOBA 3AMYA 3VQUA 5AUZA 1RJBA 4RZWA 5IUIA 4JOAA 3IKAA 3NSZA 4AOTA 5JZNA 3OMVA 3NUYA 3O5AA 4I0SA 3KY2A 2ZJWA 3QWJA 4V0GB 1YHWA 2PMLX 5E8WA 1H26A 3F3ZA 3NIZA 4TWCA 5L8JA 3DZOA 3P08A 3WZUA 4A06A 4GU6A 2XK8A 2XAOA 4O1OA 4UBAA 5CEQA 3OWLA 2FSMX 3PA5A 4R5SA 4A9TA 5LVOA 2JKOA 3P4KA 2BAQA 3V8WA 2XKFA 2Y0AA 2XA4A 4D0WA 1KUTA 3LMHA 3GNIB 3PJ3A 4MCVA 3ZLSA 2CPKE 4MYGA 4FTLA 4L68A 4IB5A 4FV5A 4RIXA 1FGKA 2OXXA 3VUHA 4ERKA 3NIEA 3KRXA 4ZTSA 3OW4A 3NS9A 2GCDA 3A8WA 4JJRA 3OXIA 1DI8A 3IOPA 3KXGA 4HPUE 3ALOA 3VAPA 4R1VA 2E9NA 2WTJA 2HWPA 3C13A 4GT3A 3O50A 5HGIA 1S9IA 2X9EA 2XNPA 3LVPA 2ZM1A 2R3KA 1TKIA 2W06A 3TNWA 2GDOA 4F0IA 3LOKA 5BVFA 4M84A 1R3CA 4MBIA 3FMMA 3QL8A 4OTDA 4O7WA 3R7VA 2PZPA 2JDVA 4X3JA 3D9VA 3BYOA 4PX6A 4B6LA 2CKEA 3P79A 2IO6A 3QC4A 2Y6OA 2XALA 3RP9A 4ORKA 5H3QA 5IH4A 4O4CA 3DKGA 4CCUA 3KXHA 2XJ0A 5HNIX 5HU9A 3V04A 3P86A 3QD4A 2VNWA 4QP4A 2W4KA 3BV3A 3DKFA 3R7EA 3R1NA 3PJ8A 1OUYA 2XNGA 2FA2A 2VTLA 3PXKA