4FNWA

Crystal structure of the apo f1174l anaplastic lymphoma kinase catalytic domain
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
322
structure length
304
Chain Sequence
RTSTIMTDYNPNYSFAGKTSSISDLKEVPRKNITLIRGLGGEVYEGQVSSPLQVAVKTLPEVCSEQDELDFLMEALIISKLNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The R1275Q Neuroblastoma Mutant and Certain ATP-competitive Inhibitors Stabilize Alternative Activation Loop Conformations of Anaplastic Lymphoma Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords ALK tyrosine kinase receptor
total genus 102
structure length 304
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fnwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fnwA01
4RQKA 4JAJA 1K3AA 2HW6A 2E9VA 5FTOA 4FIHA 4FIEA 4RIXB 4CLIA 4G5JA 4UMRA 2WMBA 4IZ5A 4AA4A 2CHLA 2Z02A 1J1BA 1R1WA 5L2QA 4C4GA 2B9FA 3BYVA 1KWPA 2VTSA 3NUYA 3OD6X 5J9YA 3CBLA 1LUFA 3ETAA 2JC6A 3CTJA 5ACKA 4FTIA 4AG8A 4FTMA 5J9LA 3RGFA 2UZBA 1W82A 3ROYA 4QMNA 3GCVA 2PMOX 3CLYA 2J0JA 4C62A 4E5AX 3A8WA 4OAVB 1Q61A 3LFBA 3Q5ZA 4X2JA 4DGNA 4WOVA 2AC3A 4RX8A 1LP4A 4JIKA 3HDMA 4KKHA 3UIUA 3VS6A 5DBXA 4YP8A 3RKBA 1G8SA 3NNVA 3QKKA 4QP7A 3RAWA 2GQGA 4BCPA 3R04A 3CQWA 3IDPA 3ZRLA 4DH7A 2VAGA 3PRIA 5HQ0A 4L3JA 1J7LA 3ORXA 4GMYA 4NJ3A 4YJUA 4FV0A 4IAIA 4ZJVA 4FV6A 2X7FA 2YIYA 3GUBA 3CD8A 2X7GA 4CEGA 3HUBA 3UVQA 4BCGA 2OJJA 3MYGA 4J8NA 4U80A 3FZPA 3CGOA 3QTRA 4C4FA 1URCA 2F9GA 4C8BA 2UZVA 3GENA 3RAHA 3F82A 2IW9A 4AZFA 1ZZLA 5A4CA 1DM2A 4DINA 4RWIA 3EJ1A 4O84A 3UQGA 4W9WA 3FMDA 4PNKA 5DEYA 1TKIA 4RA4A 1OL6A 2PVRA 2VGOA 3IQ7A 3HZTA 4CKRA 3S00A 2GDOA 3W8LA 5HZNA 2WQEA 2QQ7A 4Z16A 1QMZA 4O7WA 2ITQA 4ANOA 4EBWA 4O0VA 3AD5A 5CS6A 3QKMA 4B7TA 2C5NA 2CLXA 4NJDA 4ARKA 2JDSA 4FEXA 4N70A 5EQEA 2QU5A 3FXZA 5ETAA 2ITVA 4GFMA 2LAVA 4AW0A 4ZTQA 3PXRA 2O63A 2X8EA 4AOJA 4R3RA 4H36A 3RAKA 2OF2A 2FSTX 3Q52A 2O8YA 3MBLA 4TPTA 5AM6A 4DFNA 2G01A 2WFYA 4FKTA 3BI6A 5LVOA 1BI7A 4ENYA 3UOHA 3QU0A 4RA5A 3P0MA 3ORPA 3LJ2A 4DBXA 4O7YA 2I40A 5ETIA 4D5HA 2GCDA 2IO6A 1ZARA 2XK7A 3F69A 3LAUA 4ZY4A 3I5ZA 5HIBA 1BLXA 3BEGA 3L1SA 4AAAA 4BRXA 2R7BA 4BTJA 3OC1A 2YN8A 2PK9A 2VWBA 2WMVA 3FI2A 5DFPA 4FSNA 5DT4A 4GRBA 3TZMA 3KFAA 1OIYA 4CV8A 2P55A 2ZMCA 3IOKA 2RFEA 3SHEA 4XYFA 4HPUE 3W8QA 2R3FA 3AQVA 3RNIA 4AOTA 4ZZOA 4F9BA 2F2UA 4DFLA 2NRUA 5AJQA 3VUTA 4FTUA 2RIOA 3NYOA 1PMVA 4AN2A 3ZFMA 4C59A 3NRMA 2YACA 3ORLA 4BDDA 3LKMA 4K8AA 3HMPA 3KRJA 4WIHA 1Z9XA 2R3PA 2PTKA 4AFEA 3ZHPC 2EXMA 4NU1A 3WZEA 5IA2A 3RPOA 4QNAA 5LCJA 1UWHA 3QRUA 3COIA 2BZIB 2ETKA 2CKQA 4I6HA 4OBOA 3L8PA 4CFUA 3UG1A 4Z55A 5KNJA 1W98A 2OSCA 1PXPA 3DLZA 3QA0A 4LYNA 4QP4A 3OXTA 5HCXA 3SRVB 3V6SA 4CMUA 1H1SA 4E4MA 4O7VA 2BTRA 4RIYB 4FKRA 2CN5A 3WE8A 3CKWA 3I79A 1YOJA 3W2RA 4BN1A 3IOPA 4IHPA 3S0OA 4FSWA 4DH1A 2WTCA 4JDHA 2GQSA 3SQQA 5LWNA 3DBQA 2CCIA 3KQ7A 4OBPA 2CNVA 2PU8A 3WIKA 2FUMA 5IA5A 2XF0A 4UEUA 2X6EA 4FKJA 1W8CA 4FV7A 4G5PA 4BVUA 3CTQA 4EONA 2OO8X 2JFMA 3W18A 3ZDUA 4A9RA 5I9YA 3FMNA 4O0XA 3ZBFA 3OT8A 3ROCA 4I93A 1PYXA 3M42A 3BBTB 4RIYA 2CCHA 3B2TA 4IMYA 1FVTA 1BUHA 4LG4A 3ATSA 5JFXA 4ZMEA 3ODZX 2BAQA 3PY0A 1XR1A 4MNFA 4EKKA 5AR8A 5L8KA 5CSPA 3ZO2A 3ZC6A 2B9JA 1OKVA 3KB7A 4TXCA 4ZOGA 4L7FA 2GHMA 3R7OA 3IDBA 1JQHA 4O96A 3QGWA 4ASXA 4QP2A 2G1TA 2R3LA 1FMKA 4GFOA 4GT3A 1ZY4A 5FXRA 3E3BX 3FKOA 3EH9A 3WYYA 5J9ZA 3QD0A 4UXLA 4BHNA 3ZLWA 4J96A 5HU3A 4XV3A 4OT6A 5IUGA 4KSPA 3TEIA 1ZAOA 3OROA 4D1XA 3HAVA 3ZEWA 3KXZA 5FXSA 3EZRA 1SVGA 1CSNA 3RCDA 5IMXA 3KL8A 4D58A 5F94A 5KMKA 4C57A 4ZTHA 3SV0A 3B8QA 1JKKA 3PLSA 4U81A 1YI4A 3D94A 3UE4A 4JI9A 4O38A 4YU2A 2ITXA 3BYSA 4I41A 4BTKA 1WCCA 5CZIA 2C30A 2HCKA 3OBJA 4I5HA 3S1HA 3LCSA 2UW0A 3VBQA 4QMVA 2YA9A 2DUVA 1OIQA 2GNFA 2HYYA 1R78A 2QLQA 2OF4A 3LCTA 2V0DA 2VTIA 3FAAA 3NGAA 5AP0A 3ZXTA 1GNGA 5TO8A 1PMNA 3VUDA 2XM8A 1KSWA 5FEEA 1UWJA 4EQMA 3MIAA 3OEFX 4QYHA 4GUBA 3BZ3A 4IX6A 2UVZA 3Q2MA 1KE8A 1ZYSA 3C5UA 4V01A 3E88A 3EFLA 3U4WA 3VNTA 4BDKA 1RDQE 2Z7QA 1YXTA 4TWCA 4B99A 3QKLA 4QYGA 4Z7GA 2HENA 4MXCA 5M08A 2X0GA 4Q5EA 3BWFA 3PJ1A 5ETCA 3MVJA 4S33A 3RK5A 1YWNA 3BQRA 2QKRA 1JKTA 3OP5A 2UZDA 3GI3A 3UODA 4BC6A 4RIOA 4R5YA 2A1AB 3F5UA 1UV5A 4FEQA 2W1EA 3VUKA 5E9EA 5DWRA 3WZKA 2DQ7X 4P5QA 3PZHA 2PZIA 3V5JA 3WIGA 5IQAA 3NPCA 1FQ1B 4RSSA 2P0CA 4FBXA 4BY9E 5CEOA 3LW0A 2UZLA 5EYDA 4U7ZA 1FVRA 3TG1A 5CU0A 3GU4A 4XHKB 4FZ7A 5HTCA 4KIOA 1FGIA 2XRWA 3OCTA 3NAXA 4EORA 4IZYA 5CZHA 5J95A 1O6KA 3E7OA 3D7TA 4GK2A 3QUDA 4EEVA 1M7NA 1UU9A 2Q83A 2YERA 3MY0A 3E64A 4O0RA 2A0CX 4FKGA 5HCZA 2P2HA 3ZUUA 4ZLYA 4FV1A 3I7BA 2W1ZA 3QRTA 5LVNA 2C47A 5DR2A 4A9TA 5B2MA 3OVVA 2YJRA 3KRLA 3E62A 4CV9A 4EK3A 5EKNA 4S34A 4C2VA 2PY3A 4YJVA 3V8TA 1Y6BA 2F57A 4FT7A 4U3ZA 4JX3A 5L2IA 4D5KA 4FIFA 3PG3A 1M7QA 2ACXA 1NVQA 4TYIA 3C0IA 4RJ8A 4GV1A 4MTAA 4UV0A 3QAME 3V5LA 5FM3A 4DEAA 3VC4A 3PG1A 3NYVA 4ITJA 4PV0A 4W8DA 3AXWA 2ITWA 4IX4A 3VS3A 4XG2A 4TNBA 4OUCA 3DXNA 1YDSE 4HGSA 2J6MA 3CJGA 4QP8A 4AW1A 4YLLA 4DTAA 2PPQA 3QXPA 1K2PA 3NCGA 5A4TA 4AZEA 1UKHA 3A4OX 3HEGA 1L8TA 2VTAA 3HA8A 4NSTA 2AUHA 5AFVA 5DHJA 2OGVA 2XH5A 4JXFA 1PMEA 2R64A 2C5OA 3EQCA 5I3RA 4IDVA 1S9IA 2X9FA 3HV7A 4C4HA 4D2PA 5ITAA 3IW4A 2PVHA 3R9OA 4YZ9A 3WZUA 4PPCA 4EWHA 2H9VA 4FTCA 3Q60A 4HGTA 3E7VA 4D0WA 2FH9A 3JUHA 3SD0A 4B8MA 3FLNC 4USDA 4EJ7A 4OBQA 4AQCA 2XM9A 3KXHA 3NYXA 3PXYA 4NM0A 5HLWA 4YZMA 4XS2A 4QQ5A 1OL2A 1REKA 3E93A 5HG8A 5AMNA 3COKA 3DGKA 5EI2A 3TDVA 2R7IA 2E9UA 4YURA 2HOGA 4D4SA 4CFNA 4TWPA 4J97A 3TIYA 4UMUA 2BROA 4F1TA 2JKKA 4GK3A 4JDIA 2HWPA 3OUNB 2JKOA 3A7GA 2B52A 4WA9A 4M68A 5LMKA 3FZSA 1M2PA 2UZNA 4I21A 1JWHA 2F4JA 2XNBA 4JQEA 5DLSA 3UOJA 4GIIA 5E8XA 1H8FA 5JKGA 4EUUA 3Q2JA 2Y0AA 1SYKA 3R30A 2XKCA 5JMSA 4EK4A 1MQ4A 4I94A 3QRJA 1BL6A 3R1YA 4FIGA 2VTHA 5IISA 3U51A 3TWJA 1JVPP 5AV3A 3KY2A 2EXCX 4G3CA 1FGKA 4QD6A 3FMHA 4U43A 1H27A 4V05A 4CRSA 4LV5A 5CEMA 2VTNA 3DJ5A 3FKLA 3KCKA 2QOOA 1OL7A 5HNBA 3BCEA 4EHZA 2YLEA 4BDGA 4EZ7A 5JGAA 4M69B 4JT3A 4EH6A 4TN6A 4UX9A 4EHGA 4HJOA 2OICA 5KO1A 3DFAA 5FM2A 2BIYA 3TUDA 3UNKA 4IB3A 2C1AA 2KTYA 2VTMA 5F95A 4ERWA 3O23A 4W8EA 2XEZA 3NNUA 3UOKA 4PMSA 4F7JA 4O2ZA 4GUEA 2Z7LA 3DK3A 3VS0A 4X3JA 2VO0A 3A2CA 3U8WA 3TJCA 2OK1A 3H9FA 3IDCA 4NEUA 5TR6A 1JBPE 5IEVA 2W1FA 4GJ2A 2YDKA 5D7AA 3FC2A 5JT2A 2X2KA 4FICA 1YDRE 3LFSA 2GS2A 5GJFA 1MQBA 4QNYA 1MRYA 3P79A 4DH8A 1OI9A 2IJMA 5TKDA 1GY3A 4NWMA 4O0TA 4Y73A 3P1AA 2VTJA 5BUEA 5BPYA 2VWUA 3C7QA 5C03A 4E73A 2WTJA 3UIMA 2XIRA 5DRBA 1WBSA 5BUJA 4G3FA 2IVTA 3RK7A 3FMEA 2VX3A 3G90X 3PPKA 1Y57A 2YISA 3NNWA 4YUQA 3PY3A 4DG0E 3O71A 3TV7A 3G5DA 4DC2A 4CT1A 3MPAA 3U6JA 4RGJA 2FGIA 2W05A 2V62A 4FVPA 3VF8A 3HMMA 4NCTC 4QMYA 4II5A 4WUAA 5CTPA 4O0UA 4UALA 3RCJA 4BCFA 5M57A 3CY2A 3OOGA 4IAZA 1WBVA 4DTBA 3W55A 4QMQA 3O7LB 4H1JA 4LI5A 1L3RE 4FKOA 2R3NA 4FSZA 4FUYA 3K5VA 4R1YA 3KKVA 2PVMA 3LE6A 4GIHA 3UPXA 5AV0A 2RFDA 3A99A 4ACCA 3CSVA 2E2BA 3FL5A 4BCNA 4CQGA 4DGOA 2XUUA 3UJGA 1CM8A 3II5A 4C02A 3CIKA 3Q9ZA 4I0TA 4LM5A 3DKGA 2J51A 1H4LA 4BTMA 2UUEA 4I4FA 5EFQA 4IWDA 4C38A 4AACA 3BHVA 3MFSA 1OITA 3UMWA 5BQ0A 4LQMA 2XKEA 4KD1A 3LXLA 4BKZA 5EK7A 4DFUA 4NUSA 4ZIMA 4PMPA 2R3KA 5AP2A 2CNQA 4G9CA 4YZNA 3HA6A 3UNZA 3VBTA 4OTHA 2Y4IB 5L2TA 2R3HA 4D4RA 5C9CA 3BPRA 4J98A 2YM4A 2EWAA 1A9UA 4U3YA 3KXGA 3RPRA 1DAWA 4GU9A 5DYJA 3UO6A 2GNHA 4D1SA 2UW9A 3BIZA 4QTAA 4K11A 3R73A 2G9XA 4M0ZA 5FP6A 2VV9A 2V22A 2VTRA 1KE6A 4X2NA 5IH5A 3R22A 2BKZA 4ALUA 4AX8A 3RVGA 4AGUA 3SG8A 5FUTA 3SG9A 5CANA 3R1QA 3ZUTA 2F7EE 3BELA 2WZJA 4KSQA 3OZ6A 3CPBA 5BVFA 4PDSA 3OMVA 1IRKA 2J9MA 4UY9A 5JQ8A 4B6LA 5BMMA 2EXEA 5EM6A 2OH0E 3FYKX 1FMOE 1T46A 5AIRA 4HZRA 3KXXA 4ZP5A 5F20A 3I0OA 3GP0A 4YPDA 3DBDA 3QL8A 2XNMA 2P3GX 2WEVA 2CLQA 4YC8A 3H4JA 2IZUA 4IB1A 4KKGA 2IW6A 5B2KA 3UIXA 2CJMA 2YLFA 4H3QA 2XBAA 4JBVA 4I5PA 2BRGA 3DBEA 3DU8A 4CTCA 1MRVA 2OIDA 3VHEA 4O27B 3SW4A 4F4PA 1R0EA 5C8NA 5GIPE 2FO0A 3FLSA 2YABA 2YDJA 5T6KA 1IEPA 4FODA 3PIXA 3EL8A 2RG5A 2OZAA 5HVKA 2BZKB 5AP7A 2FA2A 4RMZA 3FI3A 4BCJA 4BI0A 3FSKA 4ALWA 2NPQA 3FE3A 4FTJA 4YJOA 4ZLZA 5M09A 5KBRA 4BDEA 3CR0A 3W32A 3C9WA 1UVRA 4LRJA 3W2QA 3BGPA 4BDIA 4CZUA 2JEDA 4GL9A 5I9ZA 5IA4A 4ITHA 1B6CB 3JXWA 4F7SA 4CFWA 5C26A 3QC4A 5HIEA 4RQVA 4BZDA 5CVHA 3CD3A 4FT5A 4FEWA 1YXUA 4FK3A 2WTIA 2YDIA 5EQYA 3MH0A 4FKUA 4Y95A 1J3HA 2XJ0A 4RWLA 3KEXA 5J7HA 2ESMA 4QMWA 5C4KA 3EKNA 2XCHA 3PUPA 5JGBA 2ITNA 3ZXZA 3NR9A 3TJDA 3SVVA 2W4OA 1M17A 1V1KA 1ZMWA 2GS6A 2IWIA 4XLIA 4YLKA 2W96B 1Q8WA 3I4BA 4EH4A 1OPJA 1V0OA 1H00A 2O0UA 4OTQA 2C6LA 2WQMA 4RFYA 5AUVA 2YCFA 3LM5A 4BHZA 4MQ2A 1CKJA 1JKLA 2QCSA 4WBBB 1PJKA 1IAHA 4PL4A 5CU6A 1YDTE 4FT0A 2H34A 4DGGA 1K9AA 4G6NA 4QMTA 4CRLA 1KOAA 5AUYA 4CMOA 2B54A 5AV4A 4IM2A 3MW1A 5JFVA 5M06A 4ANNA 2XYNA 1ZMUA 4G2FA 1REJA 4PWNA 1OMWA 4L52A 3UDBA 1ZRZA 3KMMA 3WF5A 4HZSA 3ZSHA 3TUCA 4F6UA 3FZTA 4WD5A 4IBMA 3HYHA 3OTUA 4DEHA 3CXWA 2HZ0A 2OKRA 3LFQA 4JG6A 3PTGA 5H8BA 3D4QA 4PTCA 1YKRA 2WQBA 4FSMA 4FNXA 5A4EA 4AZVA 2XK4A 3QD3A 2ZYBA 3PXFA 3R21A 3EIDA 4L46A 2X2MA 2YIWA 3EN7A 4OT5A 5IQGA 3UYSA 2ZV9A 1ZXEA 3SW7A 4XOZA 2W1IA 2IVVA 2YM5A 3NVMB 2QO2A 3IGGA 3MA6A 3C0GA 2WD1A 3O2MA 3KA0A 3PSDA 1UU3A 3QRKA 2YHVA 5AADA 1PXMA 1PXOA 4HOKA 3V3VA 3HL7A 4ZK5A 3LMHA 4I5MA 2XJ1A 3QTSA 5ANOA 4A7CA 3A8XA 3NS9A 4YTCA 1Y8GA 1G5SA 2O65A 4IH8A 5HEZA 3GCPA 4CKJA 3NUAA 4FYNA 5I3OA 2OIQA 2XNOA 4MXAA 2R3QA 1XBAA 3IECA 4JDJA 3R1SA 5FDXA 5C27A 1GZKA 1XH8A 3P5KA 4N4SA 5CEQA 1Q24A 2REIA 4ZSEA 3QTXA 4NZWB 5L2SA 5IQBA 3WE4A 4EH2A 2W06A 4ZTSA 4USEA 2I6LA 1AQ1A 3LFNA 3MY5A 4EK6A 3QLGA 4BI1A 3PVBA 4EOPA 5CQUA 1OIRA 3F6XA 5M4UA 4DT9A 4RX5A 4IX5A 4IZAA 3UPZA 4C2WA 2Y9QA 3GGFA 2O3PA 3IK3A 3PWDA 2F2CB 4PP9A 5HESA 4LL0A 2FSOX 4O82A 4UWCA 3UVPA 3GC8A 4XP0A 1ZZ2A 4MF0A 4CXAA 2WMTA 1B38A 5JQ5A 3AC5A 4BI2A 1WZYA 3QTZA 2XJ2A 3IW7A 4KB8A 4OTPA 3LOKA 4K6ZA 4CKIA 4F09A 2UV2A 2JIIA 3BYUA 4GJ3A 4I20A 5G6VA 4B0GA 1VR2A 4BBEA 5CVFA 5AUUA 4MBJA 4KIPA 2X1NA 1XWSA 2C5XA 4WKQA 3FZOA 4WUNA 3DTCA 3PIZA 4MWHA 4R7BA 5AX9A 1NA7A 2X4FA 4YHJA 2RFSA 4FT9A 4A9SA 1WBOA 2CDZA 3DAEA 1KUTA 3ACJA 2BDJA 4QMUA 2C6TA 3H3CA 3OXZA 5FGKA 4M12A 3VBYA 4F7NA 4JLCA 4TKSA 3NYNA 4FKLA 5CXZA 3JYAA 4FKPA 1OGUA 2VZ6A 3QCSA 4OTIA 4TYHB 4XRJA 3UC4A 2QNJA 4CFXA 2EU9A 5AP5A 2XEYA 5A6OA 1PRYA 3NW5A 4QPSA 4EYJA 5D7VA 2FSLX 5B2LA 1EH4A 2X6DA 1YW2A 4L68A 4IADA 3DAKA 4IB5A 3ZBXA 4W4YA 1Y6AA 4L53A 2ZV7A 3P78A 4E26A 4PL3A 2CSNA 2X8IA 1E9HA 4C4EA 4ORKA 2QO9A 2I0VA 5M53A 2VWYA 1XO2B 2QVSE 2XCKA 4RFMA 4FTNA 3UO4A 4AFJA 3PA5A 3I5NA 1G3NA 5L6WL 3TDWA 4AT3A 3HMIA 4FZFB 4NKAA 3WF7A 5HVJA 4QMLA 2QG7A 4X6QC 2JIVA 5HORA 2VWWA 3BE2A 1TQIA 5F1ZA 1GIJA 2G15A 3LLTA 5CLPA 4O22A 3VBVA 4R5SA 4F08A 3U4UA 5IH6A 3A7HA 3OY1A 1VYWA 3MVMA 3QHWA 1R3CA 2PVFA 4FKWA 3UYTA 4QQCA 3ZO4A 3U55A 4KNBA 3VUGA 3NUPA 4EK8A 3VAPA 3IKAA 1RW8A 4BCMA 4FIIA 4RVKA 3NIEA 3EQIA 4U45A 3SOAA 4Y46A 3CCNA 4DEDA 4WRGA 4HNIA 3HRCA 3VRYA 2EB3A 4EC9A 5BVOA 1W7HA 4I6QA 3NSZA 5EM5A 2VNWA 1UU8A 2C0IA 4RPVA 5JN2A 2BAKA 4JR3A 3GEQA 1NY3A 3Q32A 3H0ZA 5AR4A 4O83A 3OW3A 3JVSA 3LPBA 4AN3A 2VO3A 3R7GA 5IQCA 2WHBA 3BLQA 3DOGA 5BUIA 4U9AA 4XG8A 4YTIA 2ZM1A 2I7QA 4ZTMA 1HCKA 2HK5A 4QP3A 4YJPA 4UN0C 3QWKA 1YQJA 2WTVA 2XK3A 3D5XA 3MH1A 3QYZA 3QGYA 3PY1A 4G1WA 4RWKA 5FBOA 3TCPA 3W2SA 4BDHA 4BYJA 4CSVA 4BKJA 4FK6A 5HKMA 4BGGA 2R3OA 3NUNA 4EOMA 4H58A 1M2QA 4K2RA 4D9TA 5EHLA 2BDFA 5IU2A 3F5XA 2VO6A 3CJFA 3KU2A 3LXNA 3ORMA 3GBZA 4JJRA 5KKRB 3CTHA 3F2NA 4XBUA 4CMTA 1Z57A 5F4NA 2BAJA 3ZLXA 4DITA 4FTOA 2B53A 3LIJA 4WG3A 3TV6A 5GZ9A 4U41A 2GFSA 4C3RA 4D9UA 5LVLA 3ULZA 3EFJA 4KIKA 3QCXA 4GVAA 1NXKA 1ZWSA 4K9YA 4KBAA 4U44A 4C34A 4CFFA 5LMBA 3BV2A 4XNEA 3AD6A 3G6GA 1WAKA 3P86A 1O6YA 3C4EA 4X2GA 3F5PA 3FJQE 4I5CA 4NTSA 1P14A 4GFGA 3N4VA 3EMGA 4M67A 2JDVA 4FV9A 3IPHA 3O8TA 3R8PA 4AZSA 4JBPA 4UYAA 2WU7A 5KX8A 2CGVA 3BQCA 4O7NA 4CG8A 4O0SA 4QRCA 1XJDA 2YWPA 4BBMA 4JBQA 2OXDA 4WG5A 4HCUA 3BGQA 3A61A 4HVDA 3VUMA 2DWBA 2WO6A 4WNOA 4AA0A 1XKKA 4N6ZA 4QMZA 1H07A 1OKZA 3A7FA 4GCJA 2C69A 5L8JA 2ITYA 4I1ZA 4D0XA 2HELA 3P9JA 5GZAA 3E3PA 3EL7A 5EOBA 3SXRA 3O50A 4MAOA 3AT4A 2F49A 3FHIA 5DA3A 5H8EA 1YXVA 4XEYA 5ACBC 4O86A 5AP1A 1DI9A 2O5KA 4YHTA 4MEDA 3DCVA 4WSYA 4G3DA 3F9NA 4LFIA 4BDFA 2XZSA 4ZXTA 3L8VA 4FNYA 3WILA 3G6HA 1LEWA 4Y72A 3W33A 4F64A 5E4HA 4X6RA 2Y8OA 3KF7A 4MX9A 2YEXA 2XIXA 4RFZA 4EBVA 1YWRA 3P7CA 1UNLA 3C4ZA 1PXLA 5E1EA 5DIAA 4DLIA 4O81A 4KBCA 4O2PA 4MH7A 3N4TA 2C6DA 4JIAA 4HYSA 2JGZA 2OXXA 4QPMA 2YIRA 2WTKC 3UNJA 2ZM4A 3H9OA 5IEYA 2ETMA 3KRXA 3HMOA 2J5FA 5AAGA 3MFUA 1BL7A 4GSBA 5HE2A 4PNIA 3ZUVA 4NYEA 2HIWA 3DK7A 5AM7A 3L9PA 3LM0A 3QF9A 1VYZA 3MTFA 4XG6A 5G1XA 2Q0NA 4AT4A 4BDJA 3PJ2A 3SOCA 5L6OA 1QL6A 4LGDA 2WTKB 4U40A 4B9DA 1J7UA 1WBNA 4X2FA 2QONA 3T3UA 4RVMA 4DG2E 4I23A 1O6LA 3PYYA 5CEKA 3JR1A 4IVBA 4WHZA 4ZJJA 4M69A 3EYHA 5M56A 4FG8A 3PE2A 1GAGA 3ALNA 2W4JA 5CASA 2OZOA 3I60A 3MH3A 4GT4A 4QPAA 3ELJA 2XNPA 2C5VA 4MD7E 4MF1A 4QYEA 4YZCA 5GJDA 3R7IA 4NM5A 4Y5HA 4HVSA 3VW8A 5JK3A 2W5BA 3QZFA 1SNUA 3KRWA 2VWIA 4RC4A 3ULIA 5EHOA 3QQUA 4YC6A 4F0GA 2PE1A 2ZDTA 3FLZA 3FYJX 3V5PA 4E6AA 4DEGA 5IDPA 5LARA 4HGEA 4EK5A 1FVVA 4PP7A 1HOWA 4OLIA 4D2VA 3NUUA 3DQWA 5IDNA 2CN8A 1BI8A 4HYUA 3E8NA 2CGWA 2R5TA 2LGCA 4M0YA 4U8ZA 1TQMA 2OLCA 4IC7A 1STCE 1O9UA 5HG5A 2GPHA 3QZGA 5AA9A 2QR7A 3DNEA 3UZPA 5FQDC 3ZONA 2VGPA 4FG7A 2VTLA 1H1WA 3EQFA 3PE1A 4F6SA 2BIKB 1TQPA 1AD5A 3D5UA 5HICA 4DN5A 3S4QA 4F7LA 3PVWA 4WNMA 1ZLTA 2V55A 3PVUA 2GSFA 4WT6A 4FV8A 3Q96A 4UWYA 4NFMA 2W1CA 4XMOA 5I9UA 1P2AA 1KE5A 1DI8A 3HP2A 3PP0A 2QOQA 5CENA 4ZLOA 4JG7A 4R3PA 4EOKA 4HCTA 1WVWA 5IQIA 3ZZWA 3GU6A 2W5HA 5EDRA 1RQQA 5DI1A 4R78A 3Q53A 3OOMA 4PQNA 5ANEA 1ZOGA 4BZOA 4NT4A 3QQKA 3CGFA 3LVPA 4PMTA 4U42A 5CSHA 2VWXA 3BBWA 3FY0A 3K3IA 5BVEA 4C0TA 4C37A 3OEZA 5LWMA 5IQFA 2WB8A 4IW0A 4YR8A 2P4IA 3N4UA 3EQBA 4XX9A 4Y85A 4H39A 4I0RA 5EDQA 4FMQA 4H1MA 3KULA 4EQUA 4ZTRA 3MVHA 1DAYA 2X2LA 3ZOSA 1F3MC 4QYYA 2QOHA 4HVGA 5M4FA 5H8GA 4L9IA 3ORIA 4IIRA 5CF6A 5KHXA 3NW7A 5HX8A 4JOAA 2C6EA 2QOKA 2OW3A 3EHAA 2OJIA 2V7OA 2XK6A 3FI4A 3R9DA 2J5EA 2JDOA 2QLUA 4FSYA 3E92A 1URWA 3HX4A 3POZA 4FL3A 4FI1A 4ENXA 5HD4A 3R7UA 3TN8A 3MN3A 5AP4A 4FKIA 4L01A 3ANRA 2BRNA 3KREA 5GINE 2XK9A 3I6UA 4G3EA 3S3IA 2IVUA 1GZOA 2OFUA 5E91A 4ZY5A 2ZV8A 5TF9A 5KMIA 3H30A 3VVHA 1U54A 2ZV2A 3NAYA 5JGDA 1RJBA 2GNLA 2YIXA 4GYGA 3HVCA 2JD5A 1XH5A 3ZCLA 3PJ3A 5A9UA 4FZDB 4XV2A 1CMKE 4FA2A 1J91A 3G0EA 2QO7A 3GC7A 1XH6A 2PE0A 3PIYA 1Q8UA 4N6YA 2ERZE 2QOBA 5AEPA 4IM0A 4IAAA 2WOTA 4I0SA 4WRSA 4JS8A 3AMAA 3FLQA 1NVSA 3SRVA 2A4LA 3PSBA 3JVRA 4P5ZA 4MHAA 1JSUA 1KV2A 2GQRA 5JZNA 1R39A 3GU5A 3C13A 2GNGA 2HAKA 3TXOA 2P2IA 5DGZA 2HW7A 1PHKA 2PZPA 4AGWA 4M7IA 1QPCA 3KK9A 5IG1A 3Q4ZA 4LOPA 4GEOA 2FSMX 4Z3VA 5HBHA 5E8UA 4L8MA 3JY0A 1U46A 5A6NA 5JZJA 4IWQA 4ANSA 2XA4A 5E92A 4WO5A 5KCVA 3PP1A 5ANGA 1U5QA 3C4WA 4FV4A 2C3JA 4LL5A 4ZSLA 2PE2A 4RWJA 2XNEA 4O6LA 4MD8E 2BZHB 5M4CA 3EN9A 4MYGA 4ZTLA 3GU7A 4FVRA 4ANBA 2Z7RA 3BU3A 1P4FA 2IZRA 3TNHA 4TRLA 2HZIA 4YJSA 3GNIB 3EKKA 2B4SB 4QQJA 2C0TA 2WMRA 3AT2A 3F3TA 3F3ZA 2X7OA 5CSWA 4FEVA 3DTWA 3LFDA 4C35A 4IJPA 1IA8A 2NO3A 3LFAA 4U97A 2OG8A 4YBJA 4L00A 3NDMA 3ZFXA 5HE3A 2GFCA 2WNTA 1JSTA 2GHLA 3W2OA 5IA3A 4E4LA 4IC8A 4XG7A 3ZH8A 4YJNA 4AE9A 3R00A 1PF8A 2OFVA 1PW2A 3C5IA 3FLYA 1OIUA 4DH5A 5HGIA 4FOCA 3SDJA 4W4VA 4TL0A 4DF3A 2ITZA 4RC2A 4MCVA 4UBAA 1FPUA 4E20A 3O8PA 2HY81 4IJ9A 4ZSGA 4RC3A 2YM3A 4XV9A 4Y83A 2J50A 3FBVA 3TNQB 2BTSA 4OAUC 1WFCA 1OKWA 2UZTA 4TYJA 5EM8A 2HXQA 2WMWA 2C6KA 3EB0A 3FZRA 3P7BA 5BMSA 3HV4A 3F5GA 5LVPA 5AV1A 1HCLA 4DGLC 2C3IB 5FEDA 1I09A 3NUSA 4E8AA 5DPVA 1H1RA 1Y8YA 3Q6WA 1NW1A 5D11A 4ACHA 4QP1A 3I1AA 3NIZA 5HHWA 4IFCA 4AW5A 3RHKA 3F7ZA 3F66A 3K54A 3LJ0A 5EKOA 3OCGA 1Y91A 3PVGA 3ZM4A 3MIYA 1E1XA 1GIHA 1Q8YA 4IX3A 3TZ9A 4AS0A 4Y5QA 4FX3A 3TKHA 3K3JA 4NL0A 1H0VA 4UWBA 4AN9A 4J95A 4IANA 2XS0A 4AF3A 3VJOA 4AGDA 4G31A 3GOKA 4IXPA 4IVCA 4E93A 2SRCA 2VN9A 5EG3A 3KGAA 3VN9A 3HP5A 4ZAUA 2YM6A 5EM7A 3E8DA 3KCFA 5LJJA 3DXPA 4Y8DA 2YITA 3D0EA 3OWLA 2IVSA 3D5VA 4FGBA 4KAOA 3OTVA 3U87A 5D10A 2BRHA 3ZLYA 5D41A 2RKUA 2JLDA 3BRBA 3QQJA 2WIPA 5CSVA 4EOJA 4R1VA 2EVAA 3AC4A 4RZWA 5IUHA 3QX2A 4AU8A 4D28A 1BYGA 2CKOA 4OW8A 1SVEA 3DKFA 2V5QA 3BHTA 3M11A 3PA3A 4DTKA 1T45A 3T9TA 4LRMA 4X7QA 3IGOA 3R01A 2WOUA 3CPCA 5CAOA 3MV5A 5E7RA 4S31A 2H8HA 4UB7A 5CF8A 4AP7A 2HZ4A 4V04A 1M14A 2VX0A 2RG6A 4GG5A 2NRYA 4XG4A 4O7TA 4FKVA 5CT0A 3VRZA 5AUZA 3F3VA 3EYGA 4CQEA 3PA4A 4PTGA 3ZU7A 3B2WA 2PMNX 3T3VA 4C33A 4BBFA 3E8EA 2WIHA 3TTIA 5FTQA 2X39A 4ZEGA 4NTTA 4DGMA 1GZ8A 1IR3A 2C6IA 2O64A 2OZAB 4MVFA 3HAMA 1VZOA 3BV3A 4ZSJA 1F5QA 4NCTA 4R7HA 5GHVA 5CAVA 3CEKA 1LR4A 4K33A 2IN6A 3QFVA 2XRUA 3QCQA 3E5AA 4JNWA 4E6DA 4KABA 4GK4A 3U9NA 5EHYA 5BYYA 4KUJA 4DLJA 4EQCA 3PXKA 1UU7A 2WMAA 3O17A 3QTIA 4JBOA 5FXQA 4GW8A 2YIQA 3SKCA 5HO8A 3R9HA 4YNOA 3OF0A 4EH9A 2C1BA 3Q6UA 2C3LA 4RIWA 4XG3A 3UOLA 1GZNA 3PRFA 2VO7A 3LQ8A 1YHWA 5HIDA 4YPSA 3G2FA 4PDYA 4EWQA 2J4ZA 3R63A 5JH6A 3LCKA 4FSQA 1WBWA 2BALA 5J87A 3TZ7A 2BRMA 2FB8A 3ODYX 4P4CA 3O0GA 4I24A 4D4YA 1JSVA 5LCKA 4OGRA 4FGRA 4JR7A 4PDPA 2JBOA 3O7LD 2R9SA 4H3PA 1I44A 1QPDA 3V51A 2ITPA 1JOWB 4J99A 3R8UA 2JITA 4E5BA 2UZEA 4ID7A 4I92A 4WSQA 3FMKA 4YJTA 3CC6A 5KZIA 1IA9A 5BVNA 2YAKA 5DE2A 3LHJA 3REPA 4ZSAA 4EOSA 4YTHA 4U6RA 4E6QA 2WTWA 1H25A 2W5AA 4HGLA 3EQRA 3F7WA 2BDWA 3QTUA 4BYIA 4WNKA 5AAEA 1Q99A 4P2KA 1SM2A 2X8DA 2YM8A 3KC3A 3FQSA 4IDTA 5EH0A 1A48A 3FMMA 4FL1A 5H3QA 1OL5A 3V8SA 4CCBA 4BCKA 3PFQA 3Q4CA 5IUIA 3Q9YA 4YLJA 3QQFA 2RFNA 1WBTA 3NZ0A 5EYMA 2CPKE 2P33A 4FEUA 4K0YA 4I6BA 5TE0A 4R7IA 2QODA 5E1SA 5J1VA 1Z5MA 5M51A 2UW5A 1QPEA 2EB2A 3ZZEA 5HI2A 4FE2A 2X9EA 3MWUA 1MP8A 3QZIA 4IWOA 4NW6A 5A46A 5CNOA 2Y4PA 3VW6A 5C8KA 3CQUA 3MPMA 4LMUA 5FP5A 2BVAA 3ZLSA 2UW8A 5CWZA 4DFYA 4F9AA 3RHXA 2XIKA 3SA0A 2Z8CA 5H9BA 5J79A 4GT5A 2B1PA 3AC2A 4PPAA 5E8YA 2Y4IC 4ZS0A 1WVXA 4AT5A 5GZ8A 3HKOA 4CYIA 5I9VA 2C3KA 1OUKA 4FSUA 4DCEA 5JFSA 5GNKA 4Q9ZA 3HRFA 3P23A 2ONLA 2X4ZA 3JY9A 4YZDA 1OZ1A 5FG8A 5JRQA 4GU6A 4BDAA 1BKXA 3IW5A 5EW9A 2YCQA 2I0YA 4ALVA 4OTGA 4QTDA 1XH9A 2JAMA 2OXYA 3UGCA 4EKLA 5AAFA 5CU2A 5K0XA 3RWPA 2VD5A 4YJRA 3MESA 4YZBA 4L42A 5M4IA 4W9XA 1PXNA 1YOLA 3R7EA 1UKIA 5I5ZA 2R3JA 5M07A 1AGWA 3L8XA 4D55A 1QCFA 2NP8A 1OVEA 4S30A 3C51A 3OWJA 2WXVA 5DG5A 1JLUE 2YCRA 3EN4A 3FKNA 3FWQA 3QTQA 1U4DA 5IQDA 1ERKA 2KULA 4KIQA 1E1VA 4QMMA 4M3QA 2VNYA 4D2SA 3FZ1A 5FD2A 5I4NA 5T68A 4FTRA 5HBEA 4BR3A 3GXLA 2XNGA 1ATPE 4L67A 4YSMA 4LOOA 3R8LA 4DFBA 5AR3A 3NW6A 3DA6A 4ITIA 2ZAZA 1V0BA 3BU6A 5LQFA 4FTKA 4PUZA 4NIFB 5DR9A 3TM0A 3EZVA 2UZWE 3R8VA 5B7VA 3SGCA 1J7IA 3OCSA 4V0GB 1M2RA 3OXIA 2C6OA 5IQEA 3HV5A 4IAKA 5DOSA 3MH2A 3ORTA 3WF6A 4RG0A 4ZJIA 4LMNA 5HTBA 4AZWA 4B8LA 5ANKA 4R6VA 4WBOA 5AA8A 4CGAA 5M55A 3UVRA 3CY3A 3F3WA 5DVRA 3MY1A 2AC5A 2QD9A 1BMKA 3PWYA 3UQFA 5E8VA 5HE0A 3DXQA 4Z7HA 1JNKA 4X3FA 2C68A 4IFGA 4M84A 4IEBA 3D83A 3RM7A 3UTOA 1W84A 4ZS4A 2CKPA 4GYIA 3BYMA 3NLBA 4KS8A 2UVXA 2A2AA 2JDTA 2PVKA 4F1OA 2BHEA 4DEEA 2W9ZB 5CAPA 5J5TA 3R71A 4JQ7A 3G51A 3TACA 4RX7A 2BKKA 4M97A 1Q4LA 3OG7A 2HZNA 3ALOA 3F61A 4KA3A 2W99B 4XP3A 5EW8A 3TNIA 4QTEA 1Q5KA 2XKFA 2B9IA 2Z7SA 3ZO1A 1OL1A 4L43A 5ANIA 4DEBA 5HBJA 2WELA 5JSMA 3VJNA 5FTGA 3SAYA 4JX7A 4EJNA 3Q9XA 3RWQA 2CGUA 2ZM3A 5HNGA 3V01A 1H24A 3EQHA 1JAMA 4C7TA 3T9IA 3EN6A 4UXQA 2GMXA 4MD9E 4XOYA 5IPJA 2QC6A 2VRXA 2WMQA 3DDQA 3DT1A 3PJCA 4J8MA 3VUIA 4A06A 4FV5A 3KRRA 3TZ8A 4ONAA 3LFCA 5IH4A 3S95A 3QXOA 5ANJA 2W1GA 4KRCA 4OTFA 2PWLA 3SXFA 2R4BA 2FVDA 3LXPA 4UZHA 4IVAA 4EH8A 3KVXA 3Q5IA 4BL1A 5HX6A 4Q2AA 4C61A 3FL4A 1WBPA 2RSVA 3PXZA 4XP2A 4UMQA 1SMHA 4RRVA 2RGPA 4IVDA 2PZRA 2YWVA 3VQHA 3E8CA 4AZTA 2W1DA 4EH7A 4FV2A 3K5UA 4KRDA 4ZZMA 1H1PA 4IACA 1WMKA 4IZ7A 4CYJA 4MK0A 3UQCA 2J0MB 4H05A 4BCHA 4R8QA 3D14A 3DV3A 5LVMA 3O96A 3G9LX 4EHEA 4GKIA 4PMMA 2YFXA 4DEIA 1JKSA 3KF4A 3F3UA 4W4WA 1P4OA 1YRPA 2G2HA 4I3ZA 3BLHA 5AP6A 4ACDA 5DT3A 4YNEA 2CKEA 4UMPA 1XHAA 3DPKA 1UA2A 1VJYA 4MBLA 2ETRA 3QD4A 4XUFA 4BWPA 4N0SA 3DZOA 3MGYA 2PL0A 3D15A 5EI6A 1ZOEA 3P08A 5CEPA 4XH6A 3F2AA 4E7WA 2WQOA 4EC8A 1Q3DA 1ZYJA 4FTLA 4E4XA 3IS5A 5EI8A 4FUXA 2XVDA 4Z9LA 3AD4A 3UZRA 3MPTA 5J7BA 4GS6A 1XBBA 2BILB 4O0YA 3KXNA 5HCYA 2PVLA 2X81A 3GQLA 3ZSGA 3RK9A 3FQHA 4KS7A 5K5NA 5HD7A 2DS1A 4G17A 4O6EA 4TYGA 3VS5A 3WOWA 1OBDA 5HO6A 2OI4X 2HWOA 4ZZNA 1OKYA 3CE3A 1CKPA 3UG2A 5AR2A 4ERKA 4W4XA 5K5XA 5LMKC 2PSQA 2QKWB 2YAAA 4FNWA 3VS7A 3QHRA 1TVOA 3OW4A 3GCQA 3W10A 4B4LA 4BIDA 3OBGA 3FEGA 2JAVA 1XQZA 5TT7A 5EDPA 3TI1A 3R7VA 3V04A 3EWHA 2I0HA 1GOLA 3V5WA 5E8WA 4RJ3A 4G9RA 5HNIX 3PDTA 2JIUA 5A4LA 2IW8A 5A14A 4FTAA 4GKHA 2OIBA 2GTNA 3MJ1A 4RIXA 2YZLA 3U54A 3BEAA 3VF9A 2CGXA 5IF1A 1ZY5A 4E1ZA 4J1RA 5AIKA 4F0FA 3NVKI 3VHKA 4QTCA 3EFWA 4MWIA 3PSCA 3I6WA 5TOZA 5DT0A 3ZYAA 4O7RA 2QOCA 5HG9A 4AW2A 4BGHA 5HE1A 3OCBA 5CF4A 4RJ4A 4F9WA 3ZSIA 3G15A 4Q5HA 2OJ9A 2PUUA 4O1OA 1GIIA 2QURA 4C4JA 3ZRMA 3COHA 3WYXA 3GB2A 3Q4UA 1PXJA 3UP2A 2R3RA 4DAWA 2VTPA 2J2IB 4ASDA 5K9IA 3QALE 1ZYCA 3FSFA 4TTHB 5EYCA 3RI1A 3RPSA 1YHVA 2W0JA 3DDPA 1DS5A 4CNHA 2J90A 3KN5A 3CKXA 2PZYA 4M8TA 4QMXA 4C36A 3R83A 3VUHA 3I7CA 4ASEA 5EW3A 4DBNA 1OPLA 3KVWA 5BYZA 5F9EA 4IQ6A 2I0EA 3Q3BA 2PMIA 4FR4A 4PF4A 5ICPA 2VUWA 4O91A 3R6XA 1W0XC 3F88A 1X8BA 3NCZA 3FY2A 2IZSA 3OT3A 3VQUA 4EOIA 4YMJA 5AUTA 2J0LA 1ZMVA 3FMJA 1APME 2ZJWA 2WAJA 2UW7A 4WNPA 4YSJA 2UZOA 3TL8A 2PUPA 3C4CA 3DKOA 4EHVA 5JEBA 3SLSA 4XBRA 3OY3A 5EYKA 2QOIA 2CMWA 3D5WA 3TT0A 4DG3E 4O7ZA 5GIOE 2XP2A 2XIYA 4FF8A 2DYLA 2JBPA 4PL5A 3RINA 4BTFA 4G6LA 1J1CA 5CI7A 2VTQA 3R9NA 4HVHA 3IW8A 2PVYA 3ZMMA 3DY7A 4A4OA 4QQTA 5KMNA 4G3GA 2H6DA 3ZTXA 1B39A 1S9JA 2PVNA 5KBQA 5M44A 3DKCA 3IO7A 2ZDUA 1U5RA 1YXXA 1UNGA 3MDYA 3HLLA 3AGLA 3H9RA 2BZJA 4HCVA 4IAYA 3Q4TA 3R0TA 2O2UA 1IASA 1MUOA 3UP7A 4PY1A 3HDNA 3HRBA 4TYHA 4CD0A 5LXMA 3A60A 5KHWA 2Y7JA 5FLFA 1MRUA 3AC8A 3LCDA 3FXXA 3RTPA 2J7TA 2B55A 1XH4A 3VWAA 5FRIA 3QQGA 4HNFA 5L2WA 2C6MA 2WQNA 3M1SA 5E8ZA 3JPVA 3DBFA 5HU9A 1YOMA 4C4IA 3A7JA 3COMA 4FIJA 3EQGA 4D2RA 2OJGA 2QI8A 4KBKA 5BVKA 5KMJA 3NNXA 4L7SA 5D12A 3Q9WA 4FT3A 4JL9A 4RLLA 4AA5A 5CVGA 3VULA 2B7AA 2ZMDA 5FWKK 2PUIA 2QHNA 4WG4A 3AG9A 2UVYA 3KULB 3A62A 3C4XA 3BLRA 1PMUA 2AYPA 3FMLA 3KXMA 2RF9A 3MJ2A 3V5QA 3LQ5A 4FKSA 3MB6A 5K4IA 4BZNA 2QG5A 2QOFA 3DK6A 4LRKA 2NNWB 2E9OA 2W4KA 4L45A 4TWNA 4RVTA 3L9LA 5T3QA 4JQ8A 4BCQA 3R8MA 2IPXA 4KINA 5KUPA 3N9XA 5KMLA 4M14A 3QCYA 5KMMA 5E8SA 4QT1A 3TNPC 2E9NA 4NKSA 1FOTA 5CU3A 2BRBA 3OUKA 3CS9A 4RJ5A 4A4XA 1PYEA 3BHHA 3O8UA 3DBCA 2OJFE 4J53A 4S32A 2WKMA 3QYWA 4EOLA 3U6IA 4CG9A 3AGMA 3R2YA 3D7TB 1U59A 4R3CA 2ITUA 1JPAA 2PMLX 5DEWA 3W16A 1FBNA 4DFZE 4CCUA 2PYWA 2YM7A 4OTWA 5HTIA 3A4PA 4CLJA 4LGGA 3VBWA 4APPA 3H10A 2W1HA 2HXLA 4FV3A 4YGAA 3W2CA 1YI3A 3BHYA 3A7IA 5L3AA 5AR7A 3QQLA 1H26A 2XNNA 2PZ5A 4I6FA 5IQHA 1YXSA 3MB7A 3W2PA 3QUPA 1CKIA 3EQPA 1R0PA 1M52A 2E9PA 3HV6A 4GVJA 3PZEA 3NUXA 5EQPA 3DB6A 4DCAA 5CT7A 3F2RA 5AWMA 2JDRA 5FBNC 5HLNA 3RAIA 4F63A 2IG7A 2I1MA 3IW6A 4P90A 1Q3WA 3ORZA 3GVUA 3LMIA 3DJ6A 1XH7A 4G16A 3P7AA 4MQ1A 2F7ZE 5AR5A 4AGCA 4RZVA 4ZY6A 4XV1A 5L8LA 4F1MA 4DT8A 4OTDA 1OBGA 3FUPA 4PTEA 2OH4A 1ZYLA 5D1JA 5DH3A 3G9NA 4X21A 5K3YA 5IKWA 3R8ZA 4AE6A 4OR5A 3UZTA 5BYLA 3TNWA 1XBCA 3OS3A 4NW5A 3RPVA 2Q0BA 2R3MA 4HPTE 4YO4A 3ZC5A 1PY5A 4E4NA 2UZUE 2Z60A 2J0IA 1YI6A 4X0MA 3C0HA 3QRIA 4HYIA 4TNDA 3WF8A 2GTMA 4D2TA 2ZOQA 1G8AA 2OWBA 3ACKA 3D2IA 3ET7A 2W9FB 4RVLA 4CZTA 4EZ3A 1H28A 1LEZA 2GS7A 2G2IA 3LCOA 3WZJA 4JG8A 4ANLA 4IB0A 5FDPA 5H2UA 1Q8ZA 2Z2WA 2BR1A 3AT3A 3GCSA 4DYMA 4NM7A 5CI6A 3ID6C 2ZB0A 3E63A 5LMAA 2C0OA 4LUEA 3U6HA 3E87A 3ORNA 4JAIA 3QQHA 4NH1A 2QU6A 4YHFA 3VBXA 4L3PA 2VTOA 3IG7A 5B0XA 3ZO3A 4FKQA 5CAUA 4CVAA 3GFWA 2BPMA 3PXQA 3SXSA 2VX1A 3ENMA 3FDNA 3PJ8A 1UNHA 4RBLA 5CXHA 2C5YA 3EQDA 4TY1A 5AP3A 2QOLA 5C4LA 2JFLA 4MXXA 4TW9A 5IA1A 2GHGA 3MTLA 3QUEA 3WZDA 4RJ7A 3ANQA 4TZRA 3FC1X 1NT2A 3WI6A 5CX9A 1IG1A 4K1BA 5GJGA 5K0KA 2ERKA 3UIBA 5LOHA 1YWVA 3DAJA 4I22A 1Q62A 3L9NA 2QR8A 3WF9A 3RBWA 5A3XA 4MBIA 3V8WA 4N57A 3C4FA 3OWKA 4GG7A 4KWPA 1PKDA 1OM1A 5IA0A 2EUFB 4NFNA 5CYIA 4TT7A 4NM3A 3W1FA 4X3FC 4ZTNA 4FZ6A 5CU4A 3FQEA 4BWKA 5DMZA 1YVJA 2WGJA 3MSSA 4QMSA 1FINA 3M2WA 1VEBA 2XKDA 4XJ0A 4L44A 4M13A 5KMOA 5EOLA 5AUXA 3RNYA 2GU8A 4QOXA 2PVJA 3S2PA 4EOOA 3G0FA 4D1ZA 3HMNA 3MI9A 4PRJA 2F7XE 3LMGA 4UMTA 3QLFA 5HLPA 5J5SA 5K4JA 5BVDA 2RL5A 4F70A 2YZAA 2Y6MA 4XLVA 3HV3A 3Q04A 4LV8A 2B0QA 4MXOA 3NWWA 4FSTA 4FVQA 4C3FA 4XG9A 3CP9A 4E3CA 3POOA 4RT7A 4O7LA 5D9HA 3MFTA 4HYHA 5CNNA 3R28A 2W7XA 2YCSA 1CTPE 1H01A 2ZB1A 2H96A 5CALA 3ENHA 2QHMA 3D2KA 4LUDA 2FYSA 4MNEA 4Q9SA 3HNGA 2ZVAA 4NK9A 4P7EA 3QC9A 5CY3A 3NMUF 5DR6A 2BFYA 4K77A 3AC3A 4EYMA 2ITOA 3L8SA 2BUJA 4TWOA 5HVYA 4F6WA 1OUYA 2WTDA 3FHRA 4YBKA 2R3GA 5L4QA 4FSRA 3TKUA 4FZAB 4CFMA 3V6RA 1A06A 3RMFA 2BCJA 4J7BA 3VS1A 4ACGA 2B9HA 5JRSA 2G2FA 4EL9A 4YO6A 3AC1A 4JDKA 3HECA 4E6CA 2BMCA 2R0UA 5AX3A 4DHFA 4O0WA 1ZYDA 1RE8A 4KKEA 3GFEA 2WMUA 5ETFA 3BX5A 4MNEB 4JRNA 3THBA 3QD2B 5CAQA 3MVLA 3LQ3A 1W83A 4ANQA 2XK8A 3BE9A 3ERKA 4J52A 5HOAA 3LFFA 3H0YA 4RIWB 4EUTA 1KE7A 5C1QB 3O51A 4QP6A 2HY0A 3ZDIA 1PXKA 3L9MA 4RJ6A 4BGQA 4BKYA 3CQEA 4FC0A 3QTWA 2UW4A 5J8IA 3EN5A 2JKMA 4M15A 2CNUA 2JKQA 4M66A 5I0BA 5A4QA 1Q8TA 2XIZA 4QP9A 4QMPA 3TIZA 5BVWA 1OPKA 4LGHA 4YJQA 1H1QA 3RP9A 2IZTA 1GJOA 1LPUA 1PKGA 4H3BA 4YC3A 4BF2A 3MS9A 3FI8A 3GQIA 1CDKA 4U5JA 4RX9A 4BDBA 4IM3A 3ZEPA 2WEIA 4A4LA 3WBLA 4APCA 3VS2A 4NIFA 4QMOA 5AUWA 3FLWA 4PX6A 1WVYA 5KZ0A 2XYUA 4IWPA 4HW7A 3P4KA 3TKIA 4V0GA 3ORKA 3KK8A 4LOQA 3LXKA 1ZOHA 5CSXA 3RZFA 5BNJA 3U9CA 4DE4A 3GU8A 4ANMA 4AWIA 3TTJA 1SZMA 1U54B 2VTTA 3QX4A 2OBJA 5ANDA 3UMXA 4DFXE 4G6OA 3N51A 2XMYA 4OTRA 4ZMFA 3ITZA 3RJCA 4MKCA 5I9WA 4FYOA 4BCIA 4EI4A 4QTBA 4G34A 2VWZA 5CEIA 3RPYA 4BIEA 2PULA 4S2ZA 4TYEA 3MA3A 3TUBA 3DS6A 4FTTA 4O1PA 3UO5A 3ATTA 4I4EA 3VS4A 4UZDA 3SC1A 2PUNA 4XCUA 4BB4A 3DNDA 4HVIA 3GC0A 4FNZA 5I9XA 5L6PA 3B8RA 5C8MA 3OWPA 3AMBA 1Q41A 2XB7A 2PHKA 3R02A 3R7YA 3D7ZA 3DLSA 2WU6A 3ZFYA 4DH3A 3HGKA 3GC9A 4F0IA 4BCOA 2WMXA 4QYFA 3ZS5A 5HG7A 3BU5A 3NX8A 3NEWA 4L3LA 3RALA 1H0WA 3FXWA 4XRLA 3KMUA 4QO9A 2OU7A 5DN3A 4CZYB 4BICA 3BWJA 4PDOA 3EFKA 4U79A 3QA8A 2BHHA 3ZRKA 3QBNA 4F9YA 1PXIA 3EOCA 4CTBA 4UYNA 3VO3A 4DA5A 3T8OA 3V5TA 4JRVA 4AXAA 5J1WA 3RZBA 3WARA 2BFXA 4IE9A 3I81A 4CFVA 1OECA 3FV8A 4CT2A 2C4GA 3FPMA 4FOBA 3PLAE 2GNJA 2XBJA 3JS2A 4L6QA 1QPJA 4RLKA 5E8TA 4F65A 4E5WA 3MFRA 5IEXA 4GH2A 3DJ7A 4D4VA 3PPZA 4C3PA 3C50A 2ITTA 1KV1A 1V0PA 3DB8A 3UBDA 4MXZA 2YJSA 3ZM9A 2VU3A 3KN6A 2UW3A 2WMSA 3BYOA 3G33A 4KIKB 4C58A 5IZFA 1ND4A 3R9RA 2V7AA 3LZBA 3GCUA 5CQWA 5HO7A 3DQXA 2UW6A 2Y6OA 5DNRA 4F99A 5A54A 4A07A 5E90A 3RM6A 3DZQA 4JVGA 4X2KA 3R2BA 4J71A 3FPQA 1NVRA 3OHTA 4ASZA 1F0QA 4O7SA 3VIDA 3AMYA 4BWXA 4BFMA 5DRDA 3I0QA 4FTQA 3LFEA 4BDCA 1SVHA 5KE0A 3GOPA 4USFA 2W17A 4A9UA 2R0IA 2WPAA 3LLAA 4IAFA 2R2PA 5CF5A 4YTFA 2VWVA 1KE9A 5IMEA 2A27A 4O21A 4F9CA 1P5EA 5KKRC 4A9YA 3TV4A 2J0KA 5FEQA 4EH5A 4PPBA 3KMWA 4ACMA 4AOIA 3QZHA 3BHUA 4U0IA 3K2LA 2GNIA 5AV2A 4FL2A 3HUCA 4FG9A 5JFWA 4R77A 1Q97A 3LJ1A 4EZ5A 1IAJA 4K18A 3SX9A 1SNXA 4MXYA 3UC3A 3BKBA 2ONLC 3GT8A 1YHSA 2A19B 3C1XA 3DFCB 4AUAA 2R3IA 1BX6A 3IONA 3OFMA 3PPJA 4X3FB 4D2WA 5C01A 1KOBA 3AOXA 4BIBA 4EH3A 5BX0A 3R1NA 4EOQA 3D9VA 3BGZA 1OB3A 3QWJA 1H08A
chains in the Genus database with same CATH superfamily
4RQKA 4JAJA 1K3AA 2HW6A 2E9VA 5FTOA 4FIHA 4FIEA 4RIXB 4CLIA 4G5JA 4UMRA 2WMBA 4IZ5A 4AA4A 2CHLA 2Z02A 1J1BA 1R1WA 5L2QA 4C4GA 2B9FA 3BYVA 1KWPA 2VTSA 3NUYA 3OD6X 5J9YA 3CBLA 1LUFA 3ETAA 2JC6A 3CTJA 5ACKA 4FTIA 4AG8A 4FTMA 5J9LA 3RGFA 2UZBA 1W82A 3ROYA 4QMNA 3GCVA 2PMOX 3CLYA 2J0JA 4C62A 4E5AX 3A8WA 4OAVB 1Q61A 3LFBA 3Q5ZA 4X2JA 4DGNA 4WOVA 2AC3A 4RX8A 1LP4A 4JIKA 3HDMA 4KKHA 3UIUA 3VS6A 5DBXA 4YP8A 3RKBA 1G8SA 3NNVA 3QKKA 4QP7A 3RAWA 2GQGA 4BCPA 3R04A 3CQWA 3IDPA 3ZRLA 4DH7A 2VAGA 3PRIA 5HQ0A 4L3JA 1J7LA 3ORXA 4GMYA 4NJ3A 4YJUA 4FV0A 4IAIA 4ZJVA 4FV6A 2X7FA 2YIYA 3GUBA 3CD8A 2X7GA 4CEGA 3HUBA 3UVQA 4BCGA 2OJJA 3MYGA 4J8NA 4U80A 3FZPA 3CGOA 3QTRA 4C4FA 1URCA 2F9GA 4C8BA 2UZVA 3GENA 3RAHA 3F82A 2IW9A 4AZFA 1ZZLA 5A4CA 1DM2A 4DINA 4RWIA 3EJ1A 4O84A 3UQGA 4W9WA 3FMDA 4PNKA 5DEYA 1TKIA 4RA4A 1OL6A 2PVRA 4MUQA 2VGOA 3IQ7A 3HZTA 4CKRA 3S00A 2GDOA 3W8LA 2AQXA 5HZNA 2WQEA 2QQ7A 4Z16A 1QMZA 4O7WA 2ITQA 4ANOA 4EBWA 4O0VA 3AD5A 5CS6A 3QKMA 4B7TA 2C5NA 2CLXA 4NJDA 4ARKA 2JDSA 4FEXA 4N70A 5EQEA 2QU5A 3FXZA 5ETAA 2ITVA 4GFMA 2LAVA 4AW0A 4ZTQA 3PXRA 2O63A 2X8EA 4AOJA 4R3RA 4H36A 3RAKA 2OF2A 2FSTX 3Q52A 2O8YA 3MBLA 4TPTA 5AM6A 4DFNA 2G01A 2WFYA 4FKTA 3BI6A 5LVOA 1BI7A 4ENYA 3UOHA 3QU0A 4RA5A 3P0MA 3ORPA 3LJ2A 4DBXA 4O7YA 2I40A 5ETIA 4D5HA 2GCDA 2IO6A 1ZARA 2XK7A 3F69A 3LAUA 4ZY4A 3I5ZA 5HIBA 1BLXA 3BEGA 3L1SA 4AAAA 4BRXA 2R7BA 4BTJA 3OC1A 2YN8A 2PK9A 2VWBA 2WMVA 3FI2A 5DFPA 4FSNA 5DT4A 4GRBA 3TZMA 3KFAA 1OIYA 4CV8A 2P55A 2ZMCA 3IOKA 2RFEA 3SHEA 3P5JC 4XYFA 4HPUE 3W8QA 2R3FA 3AQVA 3RNIA 4AOTA 4ZZOA 4F9BA 2F2UA 4DFLA 2NRUA 5AJQA 3VUTA 4FTUA 2RIOA 3NYOA 1PMVA 4AN2A 3ZFMA 4C59A 3NRMA 2YACA 3ORLA 4BDDA 3LKMA 4K8AA 3HMPA 3KRJA 4WIHA 1Z9XA 2R3PA 2PTKA 4AFEA 3ZHPC 2EXMA 4NU1A 3WZEA 5IA2A 3RPOA 4QNAA 5LCJA 1UWHA 3QRUA 3COIA 2BZIB 2ETKA 2CKQA 4I6HA 4OBOA 3L8PA 4CFUA 3UG1A 4Z55A 5KNJA 1W98A 2OSCA 1PXPA 3DLZA 3QA0A 4LYNA 4QP4A 3OXTA 5HCXA 3SRVB 3V6SA 4CMUA 1H1SA 4E4MA 4O7VA 2BTRA 4RIYB 4FKRA 2CN5A 3WE8A 3CKWA 3I79A 1YOJA 3W2RA 4BN1A 3IOPA 4IHPA 3S0OA 4FSWA 4DH1A 2WTCA 4JDHA 2GQSA 3SQQA 5LWNA 3DBQA 2CCIA 3KQ7A 4OBPA 2CNVA 2PU8A 3WIKA 2FUMA 5IA5A 2XF0A 4UEUA 4FRFA 2X6EA 4FKJA 1W8CA 4FV7A 4G5PA 4BVUA 3CTQA 4EONA 2OO8X 2JFMA 3W18A 3ZDUA 4A9RA 5I9YA 3FMNA 4O0XA 3ZBFA 3OT8A 3ROCA 4I93A 1PYXA 3M42A 3BBTB 4RIYA 2CCHA 3B2TA 4IMYA 1FVTA 1BUHA 4LG4A 3ATSA 5JFXA 4ZMEA 3ODZX 2BAQA 2XALA 3PY0A 1XR1A 4MNFA 4EKKA 5AR8A 5L8KA 5CSPA 3ZO2A 3ZC6A 2B9JA 1OKVA 3KB7A 4TXCA 4ZOGA 4L7FA 2GHMA 3R7OA 3IDBA 1JQHA 4O96A 3QGWA 4ASXA 4QP2A 2G1TA 2R3LA 1FMKA 4GFOA 4GT3A 1ZY4A 5FXRA 3E3BX 3FKOA 3EH9A 3WYYA 5J9ZA 3QD0A 4UXLA 4BHNA 3ZLWA 4J96A 5HU3A 4XV3A 4OT6A 5IUGA 4KSPA 3TEIA 1ZAOA 3OROA 4D1XA 3HAVA 3ZEWA 3KXZA 5FXSA 3EZRA 1SVGA 1CSNA 3RCDA 5IMXA 3KL8A 4D58A 5F94A 5KMKA 4C57A 4ZTHA 3SV0A 3B8QA 1JKKA 3PLSA 4U81A 1YI4A 3D94A 3UE4A 4JI9A 4O38A 4YU2A 2ITXA 3BYSA 4I41A 4BTKA 1WCCA 5CZIA 2C30A 2HCKA 3OBJA 4I5HA 3S1HA 3LCSA 2UW0A 3VBQA 4QMVA 2YA9A 2DUVA 1OIQA 2GNFA 2HYYA 1R78A 2QLQA 2OF4A 3LCTA 2V0DA 2VTIA 3FAAA 3NGAA 5AP0A 3ZXTA 1GNGA 5TO8A 1PMNA 3VUDA 2XM8A 1KSWA 5FEEA 1UWJA 4EQMA 3MIAA 3OEFX 4QYHA 4GUBA 3BZ3A 4IX6A 2UVZA 3Q2MA 1KE8A 1ZYSA 3C5UA 4V01A 3E88A 3EFLA 3U4WA 3VNTA 4BDKA 1RDQE 2Z7QA 1YXTA 4TWCA 4B99A 3QKLA 4QYGA 4Z7GA 2HENA 4MXCA 5M08A 2X0GA 4Q5EA 3BWFA 3PJ1A 5ETCA 3MVJA 4S33A 3RK5A 1YWNA 3BQRA 2QKRA 1JKTA 3OP5A 2UZDA 3GI3A 3UODA 4BC6A 4RIOA 4R5YA 2A1AB 3F5UA 1UV5A 4FEQA 2W1EA 3VUKA 5E9EA 5DWRA 3WZKA 2DQ7X 4P5QA 3PZHA 2PZIA 3V5JA 3WIGA 5IQAA 3NPCA 1FQ1B 4RSSA 2P0CA 4FBXA 4BY9E 5CEOA 3LW0A 2UZLA 5EYDA 4U7ZA 1FVRA 3TG1A 5CU0A 3GU4A 4XHKB 4FZ7A 5HTCA 4LV7A 4KIOA 1FGIA 2XRWA 3OCTA 3NAXA 4EORA 4DDIA 4IZYA 5CZHA 5J95A 1O6KA 3E7OA 3D7TA 4GK2A 3QUDA 4EEVA 1M7NA 1UU9A 2Q83A 2YERA 3MY0A 3E64A 4O0RA 2A0CX 4FKGA 5HCZA 2P2HA 3ZUUA 4ZLYA 4LDTA 4FV1A 3I7BA 2W1ZA 3QRTA 5LVNA 2C47A 5DR2A 4A9TA 5B2MA 3OVVA 2YJRA 3KRLA 3E62A 4CV9A 4EK3A 5EKNA 4S34A 4C2VA 2PY3A 4YJVA 3V8TA 1Y6BA 2F57A 4FT7A 4U3ZA 4JX3A 5L2IA 4D5KA 4FIFA 3PG3A 1M7QA 2ACXA 1NVQA 4TYIA 3C0IA 4RJ8A 2XARA 4GV1A 4MTAA 4UV0A 3QAME 3V5LA 5FM3A 4DEAA 3VC4A 3PG1A 3NYVA 4ITJA 4PV0A 4W8DA 3AXWA 2ITWA 4IX4A 3VS3A 4XG2A 4TNBA 2NYAA 4OUCA 3DXNA 1YDSE 4HGSA 3W0PA 2J6MA 3CJGA 4QP8A 4AW1A 4YLLA 4DTAA 2PPQA 3QXPA 1K2PA 3NCGA 5A4TA 4AZEA 1UKHA 3A4OX 3HEGA 1L8TA 2VTAA 3HA8A 4NSTA 2AUHA 5AFVA 5DHJA 2OGVA 2XH5A 4JXFA 1PMEA 2R64A 2C5OA 3EQCA 5I3RA 4IDVA 1S9IA 2X9FA 3HV7A 4C4HA 4D2PA 5ITAA 3IW4A 2PVHA 1ST4A 3R9OA 4YZ9A 3WZUA 4PPCA 4EWHA 2H9VA 4FTCA 3Q60A 4HGTA 3E7VA 4D0WA 2FH9A 3JUHA 3SD0A 4B8MA 3FLNC 4USDA 4EJ7A 4OBQA 4AQCA 2XM9A 3KXHA 3NYXA 3PXYA 4NM0A 5HLWA 4YZMA 4XS2A 4QQ5A 1OL2A 1REKA 3E93A 5HG8A 5AMNA 3COKA 3DGKA 5EI2A 3TDVA 5BV3A 2R7IA 2E9UA 1W2FA 4YURA 2HOGA 4D4SA 4CFNA 4TWPA 4J97A 3TIYA 4UMUA 2BROA 4F1TA 2JKKA 4GK3A 4JDIA 2HWPA 3OUNB 2JKOA 3A7GA 2B52A 4WA9A 4M68A 5LMKA 3FZSA 1M2PA 2UZNA 4I21A 1JWHA 2F4JA 2XNBA 4JQEA 5DLSA 3UOJA 4GIIA 5E8XA 1H8FA 5JKGA 4EUUA 3Q2JA 2Y0AA 1SYKA 3R30A 2XKCA 5JMSA 4EK4A 1MQ4A 4I94A 4BJJB 3QRJA 1BL6A 3R1YA 4FIGA 2VTHA 5IISA 3U51A 3TWJA 1JVPP 5AV3A 3KY2A 2EXCX 4G3CA 1FGKA 4QD6A 3FMHA 4U43A 1H27A 4V05A 4CRSA 4LV5A 5CEMA 2VTNA 3DJ5A 3FKLA 3KCKA 2QOOA 1OL7A 5HNBA 3BCEA 4EHZA 2YLEA 4BDGA 4EZ7A 5JGAA 4M69B 4JT3A 4EH6A 4TN6A 4UX9A 4EHGA 4HJOA 2OICA 5KO1A 3DFAA 5FM2A 2BIYA 3TUDA 3UNKA 4IB3A 2C1AA 2KTYA 2VTMA 5F95A 4ERWA 3O23A 4W8EA 2XEZA 3NNUA 3UOKA 4PMSA 4F7JA 4O2ZA 4GUEA 2Z7LA 3DK3A 3VS0A 4X3JA 2VO0A 3A2CA 3U8WA 3TJCA 2OK1A 3H9FA 3IDCA 4NEUA 5TR6A 1JBPE 5IEVA 2W1FA 4GJ2A 2YDKA 5D7AA 3FC2A 5JT2A 2X2KA 4FICA 1YDRE 3LFSA 2GS2A 5GJFA 1MQBA 1ST0A 4QNYA 1MRYA 3P79A 4DH8A 1OI9A 2IJMA 5TKDA 1GY3A 4NWMA 4O0TA 4Y73A 3P1AA 2VTJA 5BUEA 5BPYA 2VWUA 3C7QA 5C03A 4E73A 2WTJA 1W2CA 3UIMA 2XIRA 5DRBA 1WBSA 5BUJA 4G3FA 2IVTA 3RK7A 3FMEA 2VX3A 3G90X 3PPKA 1Y57A 2YISA 3NNWA 4YUQA 3PY3A 4DG0E 3O71A 3TV7A 3G5DA 4DC2A 4CT1A 3MPAA 3U6JA 4RGJA 2FGIA 2W05A 2V62A 4FVPA 3VF8A 3HMMA 4NCTC 4QMYA 4II5A 4WUAA 5CTPA 4O0UA 4UALA 3RCJA 4BCFA 5M57A 3CY2A 3OOGA 4IAZA 1WBVA 4DTBA 3W55A 4QMQA 3O7LB 4H1JA 4LI5A 1L3RE 4FKOA 2R3NA 4FSZA 4FUYA 3K5VA 4R1YA 3KKVA 2PVMA 3LE6A 4GIHA 3UPXA 5AV0A 2RFDA 3A99A 4ACCA 3CSVA 2E2BA 3FL5A 4BCNA 4CQGA 4DGOA 2XUUA 2ZFYA 3UJGA 1CM8A 3II5A 4C02A 3CIKA 3Q9ZA 4I0TA 4LM5A 3DKGA 2J51A 1H4LA 4BTMA 2UUEA 4I4FA 5EFQA 4IWDA 4C38A 4AACA 3BHVA 3MFSA 1OITA 3UMWA 5BQ0A 4LQMA 2XKEA 4KD1A 3LXLA 4BKZA 5EK7A 4DFUA 4NUSA 4ZIMA 4PMPA 2R3KA 5AP2A 2CNQA 4G9CA 4YZNA 3HA6A 3UNZA 3VBTA 4OTHA 2Y4IB 5L2TA 2R3HA 4D4RA 5C9CA 3BPRA 4J98A 2YM4A 2EWAA 3PUFC 1A9UA 4U3YA 3KXGA 3RPRA 1XMMA 1DAWA 4GU9A 5DYJA 3UO6A 2GNHA 4D1SA 2UW9A 3BIZA 3NFGB 4QTAA 4K11A 3R73A 2G9XA 4M0ZA 5FP6A 2VV9A 2V22A 2VTRA 1KE6A 4X2NA 5IH5A 3R22A 2BKZA 4ALUA 4AX8A 3RVGA 4AGUA 3SG8A 5FUTA 3SG9A 5CANA 3R1QA 3ZUTA 2F7EE 3BELA 2WZJA 4KSQA 3OZ6A 3CPBA 5BVFA 4PDSA 3OMVA 1IRKA 2J9MA 4UY9A 5JQ8A 4B6LA 5BMMA 2EXEA 5EM6A 2OH0E 3FYKX 1FMOE 1T46A 5AIRA 4HZRA 3KXXA 4ZP5A 5F20A 3I0OA 3GP0A 4YPDA 3DBDA 3QL8A 2XNMA 2P3GX 2WEVA 2CLQA 4YC8A 3H4JA 2IZUA 4IB1A 4KKGA 2IW6A 5B2KA 3UIXA 2CJMA 2YLFA 4H3QA 2XBAA 4JBVA 4I5PA 2BRGA 3DBEA 3DU8A 4CTCA 1MRVA 2OIDA 3VHEA 4O27B 3SW4A 4F4PA 1R0EA 5C8NA 5GIPE 2FO0A 3FLSA 2YABA 2YDJA 5T6KA 1IEPA 4FODA 3PIXA 3EL8A 2RG5A 3W0MA 2OZAA 5HVKA 2BZKB 5AP7A 2FA2A 4RMZA 3FI3A 4BCJA 4BI0A 3FSKA 4ALWA 2NPQA 3FE3A 4FTJA 4YJOA 4ZLZA 5M09A 5KBRA 4BDEA 3CR0A 3W32A 3C9WA 1UVRA 4LRJA 3W2QA 3BGPA 4BDIA 4CZUA 2JEDA 4GL9A 5I9ZA 5IA4A 4ITHA 1B6CB 4QEBA 3JXWA 4F7SA 4CFWA 5C26A 3QC4A 5HIEA 1G8JA 4RQVA 4BZDA 5CVHA 3CD3A 4FT5A 4FEWA 1YXUA 4FK3A 2WTIA 2YDIA 5EQYA 3MH0A 4FKUA 4Y95A 1J3HA 2XJ0A 4RWLA 2AEGA 3KEXA 5J7HA 2ESMA 4QMWA 5C4KA 3EKNA 2XCHA 3PUPA 5JGBA 2ITNA 3ZXZA 3NR9A 3TJDA 3SVVA 2W4OA 1M17A 1V1KA 1ZMWA 2GS6A 2IWIA 4XLIA 4YLKA 2W96B 1Q8WA 3I4BA 4EH4A 2IF8A 1OPJA 1V0OA 1H00A 3ML1A 2O0UA 4OTQA 2C6LA 2WQMA 4RFYA 5AUVA 2YCFA 3LM5A 4BHZA 4MQ2A 1CKJA 1JKLA 2QCSA 4WBBB 1PJKA 1IAHA 4PL4A 5CU6A 1YDTE 4FT0A 2H34A 4DGGA 1K9AA 4G6NA 4QMTA 4CRLA 1KOAA 5AUYA 4CMOA 2B54A 5AV4A 4IM2A 3MW1A 5JFVA 5M06A 4ANNA 2XYNA 1ZMUA 4G2FA 1REJA 4PWNA 1OMWA 4L52A 3UDBA 1ZRZA 3KMMA 3WF5A 4HZSA 3ZSHA 3TUCA 4F6UA 3FZTA 4WD5A 4IBMA 3HYHA 3OTUA 4DEHA 3CXWA 2HZ0A 2OKRA 3LFQA 4JG6A 3PTGA 5H8BA 3D4QA 4PTCA 1YKRA 2WQBA 4FSMA 4FNXA 5A4EA 4AZVA 2XK4A 3QD3A 2ZYBA 3PXFA 3R21A 3EIDA 4L46A 2X2MA 2YIWA 3EN7A 4OT5A 5IQGA 3UYSA 2ZV9A 1ZXEA 3SW7A 4XOZA 2W1IA 2IVVA 2YM5A 3NVMB 2QO2A 3IGGA 3MA6A 3C0GA 2WD1A 3O2MA 3KA0A 3PSDA 1UU3A 3QRKA 2YHVA 5AADA 1PXMA 1PXOA 4HOKA 3V3VA 3HL7A 4ZK5A 3LMHA 4I5MA 2XJ1A 3QTSA 5ANOA 4A7CA 3A8XA 3NS9A 4YTCA 1Y8GA 1G5SA 2O65A 4IH8A 5HEZA 3GCPA 4CKJA 3NUAA 4FYNA 5I3OA 2OIQA 2XNOA 4MXAA 2R3QA 1XBAA 3IECA 4JDJA 3R1SA 5FDXA 5C27A 1GZKA 1XH8A 3P5KA 4N4SA 5CEQA 1Q24A 2REIA 4ZSEA 3QTXA 4NZWB 5L2SA 5IQBA 3WE4A 4EH2A 2W06A 4ZTSA 4USEA 2I6LA 1AQ1A 3LFNA 3MY5A 4EK6A 3QLGA 4BI1A 3PVBA 4EOPA 5CQUA 1OIRA 3F6XA 5M4UA 4DT9A 4RX5A 4IX5A 4IZAA 3UPZA 4C2WA 2Y9QA 3GGFA 2O3PA 3IK3A 3PWDA 2F2CB 4PP9A 5HESA 4LL0A 2FSOX 4O82A 4UWCA 3UVPA 3GC8A 4XP0A 1ZZ2A 4MF0A 4CXAA 2WMTA 1B38A 5JQ5A 3AC5A 4BI2A 1WZYA 3QTZA 2XJ2A 3IW7A 4KB8A 4OTPA 3LOKA 4K6ZA 4CKIA 4F09A 2UV2A 2JIIA 3BYUA 4GJ3A 4I20A 5G6VA 4B0GA 1VR2A 4BBEA 5CVFA 5AUUA 4MBJA 4KIPA 2X1NA 1XWSA 2C5XA 4WKQA 3FZOA 4WUNA 3DTCA 3PIZA 4MWHA 4R7BA 5AX9A 1NA7A 2X4FA 4YHJA 2RFSA 4FT9A 4A9SA 1WBOA 2CDZA 3DAEA 1KUTA 3ACJA 2BDJA 4QMUA 2C6TA 3H3CA 3OXZA 5FGKA 4M12A 3VBYA 4F7NA 4JLCA 4TKSA 3NYNA 4FKLA 5CXZA 3JYAA 4FKPA 1OGUA 2VZ6A 3QCSA 4OTIA 4TYHB 4XRJA 3UC4A 2QNJA 4CFXA 2EU9A 5AP5A 2XEYA 5A6OA 1PRYA 3NW5A 4QPSA 4EYJA 5D7VA 2FSLX 5B2LA 1EH4A 2X6DA 1YW2A 4L68A 4IADA 3DAKA 4IB5A 3ZBXA 4W4YA 1Y6AA 4L53A 2ZV7A 3P78A 4E26A 4PL3A 2CSNA 2X8IA 1E9HA 4C4EA 4ORKA 2QO9A 2I0VA 5M53A 2VWYA 1XO2B 2QVSE 2XCKA 4RFMA 4FTNA 3UO4A 4AFJA 3PA5A 3I5NA 1G3NA 5L6WL 2XAMA 4AT3A 3HMIA 4FZFB 4NKAA 3WF7A 3TDWA 5HVJA 4QMLA 2QG7A 4X6QC 2JIVA 5HORA 2VWWA 3BE2A 1TQIA 5F1ZA 1GIJA 2G15A 3LLTA 5CLPA 4O22A 3VBVA 4R5SA 4F08A 3U4UA 5IH6A 3A7HA 3OY1A 1VYWA 3MVMA 3QHWA 1R3CA 2PVFA 4FKWA 3UYTA 4QQCA 3ZO4A 3U55A 4KNBA 3VUGA 3NUPA 4EK8A 3VAPA 3IKAA 1RW8A 4BCMA 4FIIA 4RVKA 3NIEA 3EQIA 4U45A 3SOAA 4Y46A 3CCNA 4DEDA 4WRGA 4HNIA 3HRCA 3VRYA 2EB3A 4EC9A 5BVOA 1W7HA 4I6QA 3NSZA 5EM5A 2VNWA 1UU8A 2C0IA 4RPVA 5JN2A 2BAKA 4JR3A 3GEQA 1NY3A 3Q32A 3H0ZA 5AR4A 4O83A 3OW3A 3JVSA 3LPBA 4AN3A 2VO3A 3R7GA 5IQCA 2WHBA 3BLQA 3DOGA 5BUIA 4U9AA 4XG8A 4YTIA 2ZM1A 2I7QA 4ZTMA 1HCKA 2HK5A 4QP3A 4YJPA 4UN0C 3QWKA 1YQJA 2WTVA 2XK3A 3D5XA 3MH1A 3QYZA 3QGYA 3PY1A 4G1WA 4RWKA 5FBOA 3TCPA 3W2SA 4BDHA 4BYJA 4CSVA 4BKJA 4FK6A 5HKMA 4BGGA 2R3OA 3NUNA 4EOMA 4H58A 1M2QA 4K2RA 4D9TA 5EHLA 2BDFA 5IU2A 3F5XA 2VO6A 3CJFA 3KU2A 3LXNA 3ORMA 3GBZA 4JJRA 5KKRB 3CTHA 3F2NA 4XBUA 4CMTA 1Z57A 5F4NA 2BAJA 3ZLXA 4DITA 4FTOA 2B53A 3LIJA 4WG3A 3TV6A 5GZ9A 4U41A 2GFSA 4C3RA 4D9UA 5LVLA 3ULZA 3EFJA 4KIKA 3QCXA 4GVAA 1NXKA 1ZWSA 4K9YA 4KBAA 4U44A 4C34A 4CFFA 5LMBA 3BV2A 4XNEA 3AD6A 3G6GA 1WAKA 3P86A 1O6YA 3C4EA 4X2GA 3F5PA 3FJQE 4I5CA 4NTSA 1P14A 4GFGA 3N4VA 3EMGA 4M67A 2JDVA 4FV9A 3IPHA 3O8TA 3R8PA 4AZSA 4JBPA 4UYAA 2WU7A 5KX8A 2CGVA 3BQCA 4O7NA 4CG8A 4O0SA 4QRCA 1XJDA 2YWPA 4BBMA 4JBQA 2OXDA 4WG5A 4HCUA 3BGQA 3A61A 4HVDA 3VUMA 2DWBA 2WO6A 4WNOA 4AA0A 1XKKA 4N6ZA 4QMZA 1H07A 1OKZA 3A7FA 4GCJA 2C69A 5L8JA 2ITYA 4I1ZA 4D0XA 2HELA 3P9JA 5GZAA 3E3PA 3EL7A 5EOBA 3SXRA 3O50A 4MAOA 3AT4A 2F49A 3FHIA 5DA3A 5H8EA 1YXVA 4XEYA 5ACBC 4O86A 5AP1A 1DI9A 2O5KA 4YHTA 4MEDA 3DCVA 4WSYA 4G3DA 3F9NA 4LFIA 4BDFA 2XZSA 4ZXTA 3L8VA 3VONA 4FNYA 3WILA 3G6HA 1LEWA 4Y72A 3W33A 4F64A 5E4HA 4X6RA 2Y8OA 1TZDA 3KF7A 2YEXA 2XIXA 4MX9A 4RFZA 4O4FA 1YWRA 3P7CA 1UNLA 3C4ZA 1PXLA 5E1EA 5DIAA 4DLIA 4EBVA 4O81A 4KBCA 4O2PA 4MH7A 3N4TA 2C6DA 4JIAA 4HYSA 2JGZA 2OXXA 4QPMA 2YIRA 2WTKC 3UNJA 2ZM4A 3H9OA 5IEYA 2ETMA 3KRXA 3HMOA 2J5FA 5AAGA 3MFUA 1BL7A 4GSBA 5HE2A 4PNIA 3ZUVA 4NYEA 2HIWA 3DK7A 5AM7A 3L9PA 3LM0A 3QF9A 1VYZA 3MTFA 4XG6A 5G1XA 2Q0NA 4AT4A 4BDJA 3PJ2A 3SOCA 5L6OA 1QL6A 4LGDA 2WTKB 4U40A 4B9DA 1J7UA 1WBNA 4X2FA 2QONA 3T3UA 4RVMA 4DG2E 4I23A 1O6LA 3PYYA 4JMQA 5CEKA 3JR1A 4IVBA 4WHZA 4ZJJA 4M69A 3EYHA 5M56A 4FG8A 3PE2A 1GAGA 3ALNA 2W4JA 5CASA 2OZOA 3I60A 3MH3A 4GT4A 4QPAA 3ELJA 2XNPA 2C5VA 4MD7E 4MF1A 4QYEA 4YZCA 5GJDA 3R7IA 4NM5A 4Y5HA 4HVSA 3VW8A 5JK3A 2W5BA 3QZFA 1SNUA 3KRWA 2VWIA 4RC4A 3ULIA 5EHOA 3QQUA 4YC6A 4F0GA 2PE1A 2ZDTA 3FLZA 3FYJX 3V5PA 4E6AA 4DEGA 5IDPA 5LARA 4HGEA 4EK5A 1FVVA 4PP7A 1HOWA 4OLIA 4D2VA 3NUUA 3DQWA 1XMLA 5IDNA 2CN8A 1BI8A 4HYUA 3E8NA 2CGWA 2R5TA 2LGCA 4M0YA 4U8ZA 1TQMA 2OLCA 4IC7A 1STCE 1O9UA 5HG5A 2GPHA 3QZGA 5AA9A 2QR7A 3DNEA 3UDZA 3UZPA 5FQDC 3ZONA 2VGPA 4FG7A 2VTLA 1H1WA 3EQFA 3PE1A 4F6SA 2BIKB 1TQPA 1AD5A 3D5UA 5HICA 4DN5A 3S4QA 4F7LA 3PVWA 4WNMA 1ZLTA 2V55A 3PVUA 2GSFA 4WT6A 4FV8A 3Q96A 4UWYA 4NFMA 2W1CA 4XMOA 5I9UA 1P2AA 1KE5A 1DI8A 3HP2A 3PP0A 2QOQA 5CENA 4ZLOA 4JG7A 4R3PA 4EOKA 4HCTA 1WVWA 5IQIA 3ZZWA 3GU6A 2W5HA 5EDRA 1RQQA 5DI1A 4R78A 2X0OA 3Q53A 3OOMA 4PQNA 5ANEA 1ZOGA 4BZOA 4NT4A 3QQKA 3CGFA 3LVPA 4PMTA 4U42A 5CSHA 2VWXA 3BBWA 3FY0A 3K3IA 5BVEA 4C0TA 4C37A 3OEZA 5LWMA 5IQFA 2WB8A 4IW0A 4YR8A 2P4IA 3N4UA 3EQBA 4XX9A 4Y85A 4H39A 4I0RA 5EDQA 4FMQA 4H1MA 3KULA 4EQUA 4ZTRA 3MVHA 1DAYA 2X2LA 3ZOSA 1F3MC 4QYYA 2QOHA 4HVGA 5M4FA 5H8GA 4L9IA 2XAOA 3ORIA 4IIRA 5CF6A 5KHXA 3NW7A 5HX8A 4JOAA 2C6EA 2QOKA 2OW3A 3EHAA 2OJIA 2V7OA 2XK6A 3FI4A 3R9DA 2J5EA 2JDOA 2QLUA 4FSYA 3E92A 1URWA 3HX4A 3POZA 4FL3A 4FI1A 4ENXA 5HD4A 3R7UA 3TN8A 3MN3A 5AP4A 4FKIA 4L01A 3ANRA 2BRNA 3KREA 5GINE 2XK9A 3I6UA 4G3EA 3S3IA 2IVUA 1GZOA 2OFUA 5E91A 4ZY5A 2ZV8A 5TF9A 5KMIA 3H30A 3VVHA 1U54A 2ZV2A 3NAYA 5JGDA 1RJBA 2GNLA 2YIXA 4GYGA 3HVCA 2JD5A 1XH5A 3ZCLA 3PJ3A 5A9UA 4FZDB 4XV2A 1CMKE 4FA2A 4QDVA