4M67A

Crystal structure of the human mlkl kinase-like domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
278
structure length
264
Chain Sequence
QIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKDLTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Mixed lineage kinase domain-like protein
publication title Structural Insights into RIP3-Mediated Necroptotic Signaling
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 264
sequence length 278
ec nomenclature
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4m67A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4m67A01
4A06A 1ZARA 5IF1A 4IZ5A 5D1JA 5A3XA 4HPTE 3V6RA 3P79A 3TUBA 3Q53A 4CZTA 4JR3A 3E3BX 3HLLA 4RWKA 5HD4A 4FKJA 3QTZA 4H3PA 3QCYA 4F1MA 4DG2E 5KMJA 5GJDA 2ZB1A 2H6DA 3HGKA 4CMOA 5LWNA 5J87A 3NNXA 4DFNA 4Y5HA 1OL2A 1ERKA 4TYGA 1O9UA 2P2HA 4L3PA 4XCUA 4YJPA 3T8OA 2CKOA 3F3VA 3QRUA 3ODYX 4EQMA 2DWBA 3NX8A 1FPUA 2FSMX 4X3FB 2EB3A 1CDKA 3U8WA 1XBCA 4KNBA 2ITVA 4F65A 5D9HA 5HIDA 3E62A 5IEVA 4OBOA 3GC0A 1Y57A 3R8PA 4FGRA 4RA4A 4JLCA 5BVEA 5K0XA 4J52A 3NUUA 3W2RA 3KREA 1H1WA 2JDSA 2X4ZA 3TIYA 3M11A 4RJ3A 2F2CB 3MB7A 1IEPA 3CPCA 1XJDA 3UNJA 3BWJA 4I6BA 4C38A 1LP4A 3QHWA 2CGWA 3NGAA 4IAAA 2X8EA 3KN5A 4TT7A 5DN3A 4OTIA 5JEBA 1YWNA 4CGAA 2IWIA 1JKLA 2HELA 3E93A 4FV1A 2IZSA 5AFVA 4CZYB 2ZYBA 3OF0A 3CP9A 3VS0A 5K5NA 3BYVA 3HUBA 2ZV7A 1PKDA 2A2AA 4FICA 5JRSA 2EVAA 3DZQA 3CIKA 4L42A 5CANA 4IXPA 4RC4A 2IPXA 3QRJA 5IQGA 3K5UA 4QNAA 5LXMA 4E7WA 3RVGA 5E4HA 5JZNA 4B6LA 3DK6A 4K2RA 3PVBA 2B9FA 1WBPA 3EFJA 2X2LA 4XRLA 3SXRA 3VUTA 3WZEA 3WZJA 4FA2A 4O86A 3DV3A 4QP9A 3VULA 4F64A 4ZIMA 1M14A 4AT5A 3C4EA 3UIMA 4L3LA 1R1WA 3NW7A 5CI6A 4IM3A 4JJRA 4MF0A 3PPKA 5DR9A 4M14A 2YCQA 4G3FA 2EUFB 3VO3A 1PMVA 5CF6A 2EU9A 5DR6A 4GUEA 3LCTA 3FY0A 2BTRA 2WNTA 1CKIA 3KRWA 3PWDA 5D10A 3QXPA 3MI9A 5EYKA 3ZBFA 3SW4A 5CEQA 4ZY5A 4O2PA 4AZWA 3KQ7A 4BKJA 3VS1A 3PZEA 1H28A 5E8UA 1KE8A 3LAUA 1F0QA 4F6SA 4FZAB 3GU5A 1AGWA 2QNJA 3L8PA 5EI2A 4F0IA 1SVHA 1IA8A 2E9UA 2QO9A 1PXKA 4FC0A 4FEQA 3BU3A 4GEOA 5DNRA 2XIYA 3UO6A 3VUDA 4CCUA 3GEQA 4ZZOA 4EOOA 3RPOA 1M7NA 1YKRA 4BDDA 4UZDA 4KUJA 2OH4A 4GG5A 2ZV8A 1ZMUA 2XIZA 5E1SA 1K3AA 2OXYA 2E9OA 3M42A 3AG9A 4TWOA 4X2FA 2OGVA 4LV5A 4LUEA 4Y85A 5F4NA 4DGOA 1GIJA 3CLYA 5L2WA 2XVDA 4FTMA 3PVWA 3LFFA 2NPQA 2UV2A 4GK4A 4YJVA 3IOKA 3FLYA 4DT8A 4IW0A 5FBNC 4APPA 4CLJA 5HTIA 5H2UA 2PPQA 5ETAA 4PL4A 3VF9A 4BBMA 4EH7A 2IW9A 1WZYA 1WBTA 4AOIA 3O2MA 2OK1A 3QTSA 3TNIA 4EH8A 5AR8A 4Q2AA 4EK4A 2XK3A 4FKQA 4O7VA 2VTSA 1I44A 2JKKA 4EOQA 5BYYA 3R30A 4ACHA 3U6JA 1Q97A 3BV2A 5KMIA 4C59A 5AM7A 5JGAA 1GZOA 4YHJA 2QHMA 4CFNA 4AT3A 1Z5MA 2P3GX 4G17A 2YCFA 1PXPA 3HP2A 4BDAA 3GBZA 2YA9A 2ITXA 2A1AB 3FXXA 4CFXA 4YR8A 5LVPA 1AD5A 1PMNA 4KBAA 1BL6A 3U9CA 3BEAA 4EH4A 4KINA 3TZ9A 2OSCA 2QLQA 3ELJA 5ACBC 3QHRA 4FYOA 1JKKA 2X7FA 3F61A 3WZKA 3QQGA 4OW8A 5TR6A 2CGUA 4EOJA 5IA0A 4G6LA 4ZAUA 2J2IB 2EWAA 4NM0A 2JDTA 4I4EA 1QCFA 4NM7A 3OG7A 4APCA 5I9YA 4GK2A 3ZRKA 3UIBA 2WZJA 4J8NA 3QF9A 5AP4A 4DN5A 4IVCA 2OJFE 1UA2A 3LMHA 2C69A 3R1SA 4J8MA 2ZMCA 2DUVA 3ZXTA 3QXOA 3UE4A 4UV0A 2OFUA 4AACA 2HENA 4FV4A 4M8TA 4E6AA 3Q5ZA 4WHZA 5FTQA 3ZC5A 3FI8A 2BALA 2C3LA 2FVDA 3BE9A 1W83A 3NS9A 4F09A 5KO1A 5LMKA 1FBNA 3BRBA 2ETKA 3LJ0A 1E9HA 2W06A 2WMXA 1GOLA 2WMQA 3F7ZA 3IOPA 3U4UA 4KIQA 4K8AA 1UNGA 3R7IA 4FT3A 4DLIA 3ZFYA 3FI2A 4GW8A 4C36A 3R2BA 3S4QA 4K33A 5G1XA 2XNEA 3UC3A 4IACA 5ACKA 1Y91A 3QQJA 3BV3A 5JFVA 2VWXA 4PPBA 3PLAE 1ZYDA 4PL5A 4NUSA 5CAUA 4DYMA 5CF5A 1NT2A 4ZTHA 5FP6A 2C1AA 3MFUA 4R3CA 1T45A 3EKNA 4WUAA 3VBXA 4RQKA 4B9DA 4ZJJA 3KCFA 4O0UA 3LXKA 3EJ1A 3P23A 4ASZA 4HVGA 4O7TA 4PWNA 4RJ6A 4J97A 4DBXA 3PE1A 4BHZA 2W7XA 4FSQA 3LFAA 3CR0A 3ZH8A 3OT3A 4BCMA 4O84A 4F4PA 2WD1A 3ORXA 1FMKA 3OD6X 3BYSA 2RGPA 3LPBA 4BN1A 4CTCA 1Q62A 5HCZA 5LJJA 2C30A 4EC8A 2X8IA 2X8DA 3I60A 4FF8A 1M7QA 4IB5A 2PE2A 4GUBA 3O0GA 3UYSA 4IIRA 1PYXA 4WIHA 2FO0A 3KF4A 2OI4X 2WMBA 3Q6WA 3BKBA 5AV1A 4BYJA 3DQXA 5EOLA 1ZOGA 3HRFA 1UKIA 5J8IA 2JFLA 4DINA 4RVKA 3KFAA 4U7ZA 3FC1X 1Q8YA 2OXXA 2R3FA 3FLQA 4MBIA 5AM6A 4HW7A 1IAJA 1GIIA 1JSVA 2C5VA 1SVEA 5DG5A 4EKLA 3LFEA 1FGKA 4O0SA 4FIHA 4WG4A 4TNDA 4XUFA 4ZEGA 4EI4A 3WYYA 4GIHA 5A4CA 4MQ1A 2B55A 3RKBA 1F5QA 3FZPA 5IMXA 4U40A 3HUCA 4CMTA 4BICA 3H4JA 4FZFB 4XJ0A 3LW0A 4H58A 4F70A 3BQRA 4DGLC 2YHVA 3NUPA 4M69A 2PVRA 3G90X 3JXWA 3QLGA 1Z9XA 2ZM1A 4WNPA 3F3ZA 2A4LA 3B2TA 3U51A 5KZ0A 2CSNA 2C0OA 3TZMA 4G3GA 1JPAA 2A27A 3QD4A 3R02A 4O91A 3TNPC 3CTQA 3VS4A 3KXGA 2HOGA 4FKOA 4JBQA 2G2FA 4D2TA 2JKMA 1OGUA 3OXTA 1GAGA 3ZO2A 2RSVA 5AR4A 2PZYA 4HGEA 4QMYA 3UOLA 4GL9A 4ALVA 4Z9LA 5AADA 3BIZA 5HI2A 3COHA 4IHPA 1YHSA 1ZY4A 4RIWA 5JFXA 3FZRA 5IQIA 4IB1A 3GU8A 5HG9A 3QQLA 2R64A 3IDCA 4G6NA 4YJSA 2ITYA 5FBOA 4BGHA 2WQMA 4U81A 5LMKC 2WEIA 4NYEA 3MVMA 4QQTA 3GFEA 4YHFA 3LCSA 1TQMA 3UOJA 3HV3A 4I6QA 2GQSA 3POOA 2PMOX 3CEKA 4OTPA 3F3UA 1H1QA 3RMFA 5KHXA 4WNOA 4WG3A 3E5AA 3ITZA 2YIWA 3ZBXA 2JAVA 4CFUA 1ZYCA 5IDPA 3VW8A 3Q4UA 3MDYA 3DCVA 2ETMA 2ITPA 3DLZA 2QU5A 3R21A 4PL3A 4F9WA 5HCXA 5G6VA 2BTSA 4I93A 4E5AX 4FEVA 4AW0A 3ZS5A 3COMA 3W1FA 4YBJA 4I0TA 2OIBA 3IGOA 3PIZA 2YDJA 3R8UA 4FSZA 4L45A 3P7AA 4O1PA 2LAVA 3W8QA 2HWPA 2PE0A 3HA6A 4QPSA 4EK3A 5GHVA 3NSZA 2ACXA 3DNEA 2LGCA 3HV6A 3RCJA 3W55A 2I7QA 1DI9A 2W4KA 2BIYA 2BZKB 3CGOA 2VGPA 4XV3A 2VTPA 2QOQA 4L52A 5F1ZA 1JAMA 5HESA 3LFSA 4BFMA 1DS5A 3SKCA 3VRYA 2P4IA 3I0OA 4TYIA 4AAAA 3DAKA 3G9NA 4FTQA 5EW8A 2PVMA 4YTFA 5CTPA 4MD8E 4C4JA 4YPSA 1SM2A 1XHAA 5DE2A 3AC4A 4X21A 3TV6A 4IC8A 4NKSA 5ANDA 4CV8A 3DGKA 2XUUA 4KIPA 3W16A 4FEUA 3UMXA 3F82A 1YRPA 4Z55A 3P7BA 4YSJA 1Y6BA 2W5HA 3FQEA 4O0WA 2YACA 3SC1A 1J91A 4GRBA 3EQDA 4L67A 3ANRA 5KE0A 1U5RA 1V0BA 3NNUA 5EG3A 3VS5A 3WOWA 3S0OA 5KMOA 3EN6A 2VU3A 4ZTLA 1ZYLA 3NEWA 1SYKA 5IPJA 4TL0A 2W1IA 4E4MA 2JEDA 3OWKA 2BHHA 3R0TA 3QWKA 3FMHA 3OFMA 1LPUA 2X4FA 3BGPA 5DGZA 3OT8A 4Y73A 3S00A 4HCVA 3UIXA 5DYJA 3Q9ZA 4I23A 2XIRA 3PVUA 5DVRA 4CFFA 4JS8A 4F7SA 2QR7A 4O7RA 5JQ5A 4GJ3A 2WTVA 1E1XA 2HZIA 2WMTA 2XP2A 3DK7A 4FV8A 4LGHA 3TKIA 3K5VA 3ZHPC 4ZS0A 2YAKA 5CZIA 5HE0A 2XK6A 3QGWA 4PMSA 2B4SB 3EN9A 1FQ1B 3KN6A 4P5ZA 4IWDA 4A7CA 5A14A 1H26A 3MYGA 3AD6A 2PUNA 4AN3A 4RFMA 5HD7A 3WF9A 5HVKA 3MY0A 4OGRA 4DFYA 3EL7A 3NNVA 2CCHA 4Y5QA 4K9YA 4IZYA 4XEYA 4PDOA 3LFNA 4O83A 5M08A 4R77A 3A7FA 2EXCX 2J90A 2XYUA 2UUEA 4HYSA 2KULA 2HY0A 1OKVA 2YM3A 3ETAA 3VW6A 3EQIA 4FEWA 5A9UA 5M07A 4C2WA 1YDTE 4BTMA 3FMDA 3ID6C 2PZPA 3RAIA 2FYSA 2OZAA 3HECA 4D1XA 3TKUA 3SAYA 2Y4IC 3R8MA 2WU7A 3MVJA 3HA8A 3KRRA 4GV1A 3TJDA 3N4VA 4AE9A 2V22A 4C35A 4RVLA 1O6YA 4DFZE 3DS6A 4Y46A 4UY9A 2HYYA 4QP4A 3R7EA 1IAHA 2VTOA 4FG8A 3QRTA 3CKWA 3E7OA 3BLRA 3Q4ZA 4NFNA 4XYFA 4AA0A 3M2WA 3KA0A 4D2WA 1R3CA 4MD9E 2XK9A 1UKHA 1H00A 3ZC6A 3FMJA 5AIKA 1FVVA 3HZTA 4CYJA 3TG1A 5HNBA 3A4OX 3A7HA 2OIDA 2HIWA 4L7FA 4DH3A 3KRLA 1X8BA 2PK9A 4O96A 3SLSA 3MGYA 3TNHA 2UW6A 1JOWB 2DQ7X 3AMYA 5EM6A 4QQ5A 5J7HA 1NXKA 4HPUE 2C3JA 4JBOA 3LFCA 3LVPA 1M52A 1UV5A 3F2AA 4GKIA 4FKTA 3VJOA 4BCNA 1IASA 5M09A 3NUYA 4KIOA 3FZTA 3B8QA 4ITHA 3ZEPA 5H3QA 3I1AA 5AUVA 1CKJA 2BRBA 3MPTA 4Q5HA 5DI1A 3GCSA 5E92A 1OL6A 2YZAA 5CAQA 3ET7A 3IDBA 3EZRA 4FIIA 5FM3A 4H05A 2ZDUA 4PMPA 3R9HA 3EOCA 3DKFA 4FL2A 4OTFA 1JLUE 3PSDA 2WHBA 3KB7A 4O82A 3VQUA 4ERKA 3C0HA 4M84A 2IVTA 3II5A 3TEIA 5HKMA 2R3KA 3FQHA 4B4LA 2JKOA 4LL5A 5CU2A 3ZRMA 3LLAA 4RSSA 4IANA 1VZOA 3FY2A 3I81A 4QQCA 5EYCA 4QMXA 2VNWA 4II5A 1XQZA 2QCSA 2BAQA 5HX6A 4JAIA 4OUCA 4FI1A 2B0QA 1YXTA 3BYOA 4ZK5A 1KV1A 2CGVA 4HCUA 4BI1A 2WQEA 4PTCA 5J95A 4QPAA 4CNHA 4FNYA 4ZMEA 3PXRA 3IKAA 3OTUA 5J9LA 2ERZE 5CSPA 3H9FA 4IZ7A 2BAKA 2UZVA 4M3QA 4UXQA 4PPAA 1FGIA 4FKGA 2X6EA 4YZCA 5J5SA 3LXLA 2XNMA 1YOMA 4UMQA 3ZFXA 4JRVA 5E9EA 3H0YA 3GENA 5AX9A 5KCVA 4D5KA 4EYJA 4WT6A 4IWOA 4O27B 3OCBA 4DGMA 3E92A 4G9RA 5ANEA 4PF4A 3ZYAA 5IUGA 1ZOEA 3A8WA 2CN5A 3FUPA 4ZTNA 4V0GB 3Q5IA 5ANOA 3K3JA 3KXMA 3K54A 5A6NA 3C9WA 2X9FA 2Z7SA 1FOTA 4ANOA 5L8LA 3IW6A 3NAYA 4E6CA 2BILB 2IVSA 3RPRA 3IO7A 3T9IA 4ZJVA 2CMWA 3BPRA 3ZSGA 4PDYA 4J1RA 2C6MA 2RFSA 2RF9A 5CF4A 3GCVA 5CQWA 4RG0A 4BI0A 4OAVB 2XNGA 3P78A 4GG7A 3TTJA 5LMBA 3RNYA 1ZXEA 4PMMA 3QRIA 4CRLA 5EOBA 4CVAA 2IN6A 3WBLA 5EQEA 4QNYA 2GFSA 4RFZA 3UYTA 2GCDA 3NWWA 5L6WL 3VS6A 3VS3A 4YO4A 2G01A 3WARA 4QP6A 4QTBA 3B8RA 4GT5A 4BCFA 2ITQA 4KD1A 4O0RA 2GHGA 5DRBA 4F9YA 3WE8A 3DZOA 3IW7A 3EIDA 3ORPA 5T68A 2QKWB 4XOYA 5LQFA 3H0ZA 4C61A 3UODA 1VEBA 4TKSA 3O8UA 5AV3A 2WQOA 2FUMA 3R7GA 3PE2A 4K77A 5BX0A 4JQEA 4FTLA 3AC2A 1KE9A 2XIXA 4N6ZA 1YDRE 1WBSA 4GIIA 2X6DA 4JXFA 4WRGA 2UVXA 4HGSA 3RK7A 3SXFA 2BCJA 4C0TA 2B53A 2R7BA 2O65A 5DEYA 2O63A 4AFJA 1V0OA 4DEDA 3G33A 5HNIX 1BL7A 2B7AA 3FMEA 1WBNA 4OR5A 4OTQA 3TV7A 1ZMVA 3LFQA 1Q61A 5AA8A 4XBUA 4CLIA 5BYLA 3BBTB 5LVMA 3FAAA 4EBVA 3ERKA 1O6KA 1XBAA 1J1BA 3RZBA 4CKJA 3RHKA 3W2CA 5C4KA 4QYHA 4AG8A 2HAKA 2OO8X 4QPMA 1T46A 5DMZA 2CNVA 1LEZA 2PSQA 2VTJA 2YITA 2P0CA 4C57A 3MBLA 2UVZA 4I22A 1OUYA 3FPMA 3UVQA 4JNWA 4E5BA 3MA3A 3DT1A 2UZBA 2XM9A 4IADA 4MF1A 4YSMA 4CG8A 3KXXA 2BRHA 4ENYA 4WUNA 3MFTA 5CT0A 3LQ5A 3UNKA 3IECA 2E9NA 4C4IA 3FLWA 1MP8A 4J7BA 4AN2A 4FBXA 5B7VA 2VWBA 4G16A 5DRDA 4NWMA 4GMYA 4YHTA 1RE8A 2B52A 3VRZA 3MJ2A 2ITWA 5FGKA 2G15A 2UW3A 4BWKA 4R3RA 4BCJA 2WMRA 4E4NA 4J71A 3P5KA 4HVIA 4D58A 5CU4A 2PY3A 4EZ3A 4DBNA 3FXWA 2W1FA 4QYEA 3MS9A 4I5CA 4MWHA 2RFEA 2JC6A 3C13A 4RC2A 4E4LA 2QI8A 3WYXA 4GU9A 3SG9A 4U97A 3OTVA 4AWIA 2OKRA 5I9WA 2XB7A 4EOMA 4AA4A 4ANLA 3D0EA 3NCZA 3RM6A 2I0YA 4Y83A 2Y8OA 3G6GA 3NUXA 4J99A 4U41A 5LCJA 5HO6A 3F2NA 3SHEA 3RALA 3BLQA 3PWYA 4MWIA 2YM7A 3KEXA 2J0LA 3DLSA 5FEDA 4EOIA 2BRNA 5HQ0A 4EKKA 3NDMA 3OEFX 4Z3VA 2UW5A 3GC8A 2GPHA 3DK3A 3EFWA 3C0GA 3GGFA 1H1RA 3LCKA 4Y8DA 5AR7A 1B6CB 5HORA 2F7EE 5DPVA 2VWUA 2BAJA 3KC3A 2FH9A 2WELA 2XKFA 4BYIA 3KRJA 1QPCA 5M55A 5L2IA 1Q3WA 3BBWA 4N4SA 4DH7A 4HVHA 3RTPA 1H01A 1PXMA 3EQRA 3OUNB 4QT1A 3DFAA 4FSNA 4R8QA 1U59A 4BDEA 3FL4A 2V0DA 2W05A 3VUGA 4FOBA 1JBPE 4MQ2A 2RG5A 1GJOA 3F3TA 3CE3A 5BMMA 5EDQA 3UOHA 5IH6A 4ZTQA 1OPJA 2QR8A 3KK9A 4EQCA 1V1KA 4JAJA 1OPLA 2QU6A 5BVKA 4AF3A 4NFMA 3CSVA 3EYGA 1OZ1A 4BKZA 2VTHA 3RNIA 4CD0A 2VWWA 4CEGA 4YUQA 2KTYA 5K5XA 3RM7A 4IM2A 5KHWA 5F94A 3CKXA 1KE5A 4W9XA 1PF8A 5HG8A 4EOKA 2ZJWA 3E87A 2IVVA 1UU7A 4U9AA 4MD7E 1Q8WA 4V0GA 5TE0A 3R1NA 3UQGA 1DI8A 2W0JA 4PX6A 3G6HA 4C37A 1OKZA 4S32A 4IFGA 3L9LA 4YNOA 5EDRA 1WAKA 3NUSA 4GH2A 4FTRA 4AZVA 3WZDA 4EH6A 5C8MA 3AMBA 4QTEA 4FK3A 3FDNA 4IZAA 3IW4A 3QCQA 3OOGA 3GCUA 1R0PA 4GFOA 2R3GA 2PWLA 5BVNA 1HOWA 3NR9A 2XKDA 4RX7A 4YTHA 4PTGA 4OBPA 3MW1A 2PE1A 3TNQB 5HU9A 5A54A 1PHKA 5D11A 2EXMA 3KXHA 4GVAA 4EUUA 5ICPA 5LMAA 1CTPE 3DTCA 3UC4A 3HDMA 2GU8A 3QTUA 4DFUA 3AQVA 1H27A 2W1HA 1YHVA 5EW9A 2C6KA 1VYZA 2OICA 3JY0A 3EFLA 4L6QA 4YJOA 4EHEA 2V7AA 2VTLA 4DEIA 3SVVA 5IUIA 2CLQA 3TKHA 2VWVA 4BIBA 4CCBA 4IX3A 1CKPA 1KOAA 3AT3A 1YXVA 3C4XA 5FD2A 1XKKA 1Y8GA 5CU0A 2Z02A 4WSQA 4M69B 2C6IA 5CI7A 4D2SA 3FWQA 5ETFA 4ZSLA 5HLWA 3GU6A 4IDTA 5FTGA 4ZY4A 2JDVA 4YLKA 4O7ZA 4A9RA 3OROA 4O2ZA 4O0VA 4G3EA 4YC6A 1KUTA 1P14A 3PRIA 4R1VA 4ZLOA 1R0EA 4MBLA 5CNNA 3G9LX 2W5AA 3DJ7A 3MPAA 4KBCA 3R8ZA 3ZUUA 5LVOA 3ORNA 5I9ZA 5AR3A 3MB6A 4C4FA 3MSSA 3OS3A 2C3IB 4JIKA 3LMGA 1YVJA 3V6SA 5JRQA 1TQPA 3ZLSA 3ANQA 3O7LD 1BMKA 4QMMA 3GQLA 4RIWB 3UG1A 2YCRA 4DG3E 4KA3A 2UZNA 4F0FA 4UN0C 2VNYA 4MXYA 2C6DA 3IONA 4JDJA 3SD0A 4E8AA 1K9AA 2CNUA 5BPYA 5ANKA 4DCAA 2UZEA 4ERWA 4X2JA 4YZBA 5L6PA 3KXZA 4FUXA 5KNJA 3UTOA 3MTFA 4ITIA 3OMVA 2Y4IB 3GU4A 3ATSA 3FPQA 4DFXE 2WMWA 3O7LB 3TACA 3GU7A 2I0VA 3F5PA 2XNPA 2Y0AA 3CQEA 2XJ1A 3FYJX 4BDCA 3GOKA 5LWMA 2Z7RA 2XRUA 5ETIA 5JGBA 3C0IA 2F7XE 4O21A 3BHUA 4FIGA 3BE2A 4RFYA 1H8FA 2H9VA 2BUJA 2VAGA 4OLIA 5HNGA 3DKGA 3PA5A 4BTKA 4ZSAA 4L01A 5JT2A 2PL0A 4YNEA 4PDSA 2NP8A 3EFKA 2Z7LA 2VTRA 5GIPE 4JT3A 2ITZA 3NYOA 4F63A 3V5TA 4CV9A 2ZM3A 3LHJA 3TDVA 3W32A 5TKDA 2WOUA 3Q6UA 2YERA 1JSUA 3HMOA 4U44A 1M2PA 3OBJA 3PA3A 4QD6A 4KKHA 4O0XA 4I41A 4XV2A 2BFXA 4AW1A 3MESA 2CCIA 3L1SA 4XNEA 4DA5A 2ZV2A 4QOXA 1VJYA 3CQWA 4FSYA 1URCA 4X0MA 4X2GA 3QTRA 4RX5A 1SVGA 2PMLX 3VUKA 5JKGA 3R63A 1LUFA 5JN2A 3BHVA 3S1HA 4U8ZA 4W4XA 4DAWA 3UZTA 3EQGA 1XR1A 2WMUA 4MNEB 4D4SA 2J5EA 3Q96A 5L3AA 2UW0A 3LQ8A 4ZOGA 4NZWB 4I21A 2BROA 3GC9A 4LRMA 4MNFA 4ZJIA 4C62A 5IMEA 2ZDTA 3KGAA 2GHLA 2OBJA 3NNWA 5HVJA 3W10A 3ZLXA 2QOHA 3LCDA 1UU3A 4P4CA 4ZSGA 3DJ5A 2BZJA 5TO8A 3NVMB 1G3NA 1JVPP 1UU8A 4KAOA 3OCSA 4BBFA 2XEYA 4RLKA 3LIJA 2QOBA 3AC5A 1Q99A 5CVGA 1ZOHA 3SX9A 5J79A 4JDKA 1R39A 3R1YA 3QC9A 2C5YA 4Y95A 5CWZA 3U55A 3PTGA 4CKIA 3MH3A 4HGTA 4L43A 3D5VA 4A07A 2YM6A 5CENA 1JWHA 4DTKA 4D9UA 3JVSA 5CXHA 4O7LA 1XH6A 3GCPA 4O1OA 2J5FA 4YJNA 5C9CA 3FSFA 2YFXA 3DB8A 4FTCA 4XG2A 5CEMA 3ATTA 3R7UA 3D2KA 5CEOA 2OJJA 2QD9A 3E8NA 2V62A 4FKPA 4RJ8A 5HG5A 4FSUA 1RJBA 1RQQA 2IZTA 1B39A 1W98A 3ALNA 3FJQE 3EQCA 2ITUA 3QUEA 2GFCA 3HMNA 2XNBA 3RK5A 4B0GA 3FBVA 4F7LA 4R3PA 1MRYA 4NL0A 4R5SA 1F3MC 2WTCA 4EOPA 3UO5A 1AQ1A 2I6LA 3DNDA 4G5JA 4QMOA 3AC3A 3QWJA 4AT4A 5F9EA 1Q24A 4UYAA 4HZRA 2UW8A 4RJ4A 4NH1A 3THBA 3WF5A 4UWBA 4NJDA 4ENXA 4JDIA 3FQSA 4JG6A 1KV2A 3DOGA 3OXZA 4YP8A 3QTWA 4UZHA 3UVRA 3H9RA 2O8YA 5B2KA 4YJTA 3U6IA 4EBWA 3I79A 3OCGA 2PU8A 1YI3A 2OZAB 3S95A 3UBDA 2IJMA 3ZRLA 3UZRA 2PVKA 2QLUA 1BKXA 3RAWA 3A62A 3QX2A 4XRJA 5J9ZA 4TNBA 3OBGA 4KSPA 5CEIA 2HXLA 3DPKA 4FVPA 1QPEA 4WA9A 3R83A 3LFDA 4ASXA 4BY9E 2YIQA 5IDNA 2IG7A 2Y9QA 1SNXA 4FKRA 4GJ2A 3A7GA 3D5XA 3RP9A 3OXIA 5EQYA 1U46A 4BR3A 2O3PA 2CJMA 4ZTMA 3G2FA 4E26A 4QMPA 4EJNA 5AV4A 5E1EA 4QP1A 4R78A 2OJGA 3RBWA 1WVXA 4TN6A 4PRJA 4PTEA 4BI2A 3ALOA 3OY1A 5BVWA 5L2SA 5M4IA 4MX9A 3UZPA 4I3ZA 3D14A 4RGJA 4D5HA 3TUDA 5HVYA 2YIRA 2Y6OA 1WBVA 2B9HA 3KY2A 3KK8A 4EZ7A 4O7WA 2P55A 3ORKA 1OM1A 1W8CA 4TRLA 3WI6A 4RMZA 4YGAA 2NRUA 3PFQA 4QO9A 4MBJA 1HCLA 3QL8A 3ACJA 4QP2A 5BMSA 3PDTA 4WBOA 2RFDA 5E8SA 4USEA 4JQ8A 3C51A 1GY3A 3F69A 4DT9A 5EHYA 3DAEA 3KMWA 4LUDA 2DS1A 3KVXA 2OH0E 1YQJA 4QTAA 4TPTA 3E8EA 5LCKA 5FQDC 5HIEA 2GTMA 4FT5A 3Q4TA 2YWVA 2W99B 3NZ0A 3KL8A 2CHLA 3HRBA 2X39A 3BZ3A 3ORLA 2C1BA 4BCPA 3KU2A 4ACDA 2X1NA 4HNFA 4FT0A 4XX9A 2VUWA 2HZ4A 2UZUE 2VX1A 4IVAA 4ITJA 2XM8A 3P9JA 3C4WA 2G2IA 2W17A 3BGQA 2W1DA 5C1QB 1KWPA 5AUYA 4AP7A 3E8CA 2Z7QA 3PXYA 5AR5A 1GIHA 2WAJA 4TTHB 4ACGA 1ZWSA 3HDNA 4R7BA 2Y4PA 1XO2B 3EWHA 4ZSJA 4CXAA 2YM5A 2IVUA 4XP2A 3G5DA 4MEDA 4UMTA 2GNHA 5D7VA 4NCTA 4JG8A 3CPBA 3BEGA 2HY81 4J98A 5AP2A 5I9VA 4MNEA 2ZVAA 1OMWA 1DAWA 3GXLA 3FZSA 4JOAA 5M56A 4GKHA 5TOZA 3PJ2A 4NW5A 1SZMA 3T3UA 3O8TA 4EEVA 5DLSA 1BLXA 4PV0A 4DEAA 3R01A 4EOSA 5KBQA 1BI7A 4FTOA 5TF9A 4JL9A 4EHZA 1OIUA 5IQAA 5M4CA 4D2VA 2CNQA 2V5QA 1DAYA 2VGOA 3R7VA 1E1VA 3T9TA 2BRMA 5ANGA 4ZMFA 2GS7A 4RIXA 3SRVA 4R7IA 2BFYA 4BGGA 4RIYA 4F7JA 5A4LA 5HTBA 5IZFA 3BWFA 2YN8A 5AWMA 3NIZA 5M4UA 4PY1A 2HWOA 5KMNA 4WNMA 5HCYA 4OTHA 3A99A 4YC8A 2VO3A 3UQFA 4GT4A 4RVTA 1S9JA 3QC4A 2VO7A 2B54A 3VUIA 4CFWA 3ZMMA 2RG6A 4QMNA 1XBBA 4HVDA 4EHVA 2QOLA 1OUKA 1R78A 2C6LA 2VTIA 4QMTA 4ZLYA 2PUUA 2R3JA 3PJ1A 3QD3A 5FRIA 5M44A 4ANSA 4BTJA 1IR3A 1OPKA 5HX8A 5KKRB 4XOZA 1A48A 5IQEA 4IWQA 4EH3A 3GNIB 2VTAA 2QG7A 5CEPA 2QQ7A 4R5YA 2W5BA 1S9IA 5CZHA 5E8ZA 3W8LA 4H36A 3BYUA 2I0HA 1PXIA 3DY7A 4RLLA 1U5QA 2PULA 4D4VA 5BVFA 3R7YA 3PIXA 5M4FA 4G3DA 2J51A 2WKMA 2PVFA 3OWJA 1L8TA 4FV0A 5M06A 2XNNA 1VR2A 4AN9A 4IMYA 5HTCA 4IX6A 2ESMA 1WVWA 3IK3A 4FVQA 3C7QA 4FKIA 4ACCA 5GJFA 3JS2A 4X6QC 4LV8A 4CFVA 4IEBA 5H8BA 2OF2A 1Y6AA 2C6OA 3QYWA 2W1CA 3ENMA 3SXSA 2GSFA 2JDRA 3FSKA 4WNKA 1Y8YA 4IAFA 4QMZA 2QOOA 1ZYSA 4OTRA 4FTNA 2X0GA 1L3RE 3MFSA 3UQCA 1YOLA 1IG1A 4DGNA 3PY3A 4TWPA 4BDFA 1IA9A 4EH9A 2UZDA 3L8SA 3VBYA 5M57A 3OWLA 2GMXA 5J1WA 5IEXA 4HJOA 4UWYA 4PPCA 4TW9A 1A06A 2SRCA 5EYMA 3ZO4A 4LFIA 4R1YA 3BQCA 3FMKA 3R8LA 2ITOA 5EW3A 5CY3A 4I24A 5K4IA 2WB8A 3MJ1A 2NO3A 3PG3A 1WMKA 3PXFA 1ZMWA 5HOAA 4DGGA 3H3CA 3QQKA 3WZUA 3RWQA 1JSTA 3QTIA 3PJCA 3Q52A 4U80A 4I4FA 2H8HA 4HOKA 2VWYA 4FODA 4JX7A 3SGCA 1LEWA 4FX3A 3PIYA 4RX9A 4IAIA 4D55A 4F6UA 4JI9A 5E8YA 4TXCA 1OKWA 4RIOA 4W4WA 4ZSEA 5IG1A 5DT3A 5J9YA 2VTQA 5CYIA 3SOAA 3HV5A 3R00A 4C34A 4MKCA 3FKNA 4L68A 4HZSA 2XKEA 3VUMA 2WOTA 5IEYA 3K2LA 4OTGA 5E8XA 2XEZA 4DEBA 2HW7A 4DH1A 5GZAA 1GZNA 3TN8A 4DLJA 4PNKA 4M0YA 3OUKA 4MH7A 4O6EA 3K3IA 5IH5A 4X3JA 1OIQA 4E3CA 5FDPA 3PJ3A 4OAUC 4MXCA 3D94A 4KBKA 4DF3A 3R2YA 2G2HA 3GB2A 4FUYA 4C3FA 3HMIA 2ERKA 4FIEA 5I9XA 4O7NA 3AOXA 3ORZA 4XLVA 3PA4A 2O5KA 2R3QA 5DFPA 4C8BA 3A2CA 2QO2A 2PMNX 2WQNA 3DBFA 2ZMDA 4P5QA 3UMWA 5CAOA 3UP2A 3RPSA 3EN7A 1KE6A 2PVHA 2Z2WA 3PZHA 2BRGA 3ZZEA 3V8TA 4YLJA 4ZLZA 4S34A 3IDPA 4JBVA 2WIPA 1JKSA 3EN4A 4OTDA 4LOPA 4NJ3A 4NIFA 4USDA 1OIRA 2HZ0A 4FSWA 5B0XA 3HP5A 3AGLA 2XIKA 3V5PA 3D7ZA 5J5TA 2RL5A 3MA6A 3V8SA 2I40A 4KKEA 4CQGA 3ORIA 3I7BA 3FMNA 5IH4A 3PJ8A 4EL9A 1YOJA 2F4JA 4QP3A 4MTAA 5BUJA 3F6XA 5CLPA 4FK6A 4L00A 5DWRA 3ROYA 4YJUA 3QBNA 3R73A 3PY1A 4GVJA 2FSTX 4XBRA 3QFVA 2UW9A 2C0TA 2CKPA 5JMSA 2BDFA 4LGGA 5I3RA 4BCHA 5LOHA 4C4EA 2GS6A 2CKEA 4CYIA 2PVLA 5BVDA 4U42A 4ANQA 4FKVA 5KMKA 1TVOA 3R71A 1FINA 5CU3A 3FI4A 3KVWA 4ZY6A 3QQFA 2W1GA 3FKOA 4ZZMA 4AS0A 3QCXA 4C3PA 2O0UA 2VTMA 3LMIA 4E1ZA 3RI1A 2CDZA 3DA6A 3OZ6A 4BWPA 3WE4A 4CRSA 3IS5A 3PPZA 3GVUA 4TYEA 5EM8A 3NLBA 1PXNA 1OITA 3QD2B 4G3CA 4JQ7A 4QYGA 4WKQA 4ZZNA 4IB0A 5K3YA 4XG8A 3D7TB 3QKLA 3H30A 4WSYA 3QKMA 3G51A 3QYZA 4BZOA 1ZLTA 1PJKA 5BUEA 1MQBA 4KS8A 4AXAA 3Q9WA 5E91A 2J0MB 3S2PA 4RWLA 4FL3A 4H39A 3EQFA 3VF8A 5A4TA 5EK7A 2YISA 3GCQA 3O51A 3QKKA 1BX6A 4K0YA 1Q5KA 3D5WA 3GOPA 4M68A 4D2RA 1WBWA 3F5UA 2OWBA 3BU5A 5L6OA 2VZ6A 1PKGA 4OBQA 4XG9A 2WQBA 3RHXA 4EWQA 3R9DA 4ID7A 3BELA 3A7JA 2R0UA 3EQBA 3DBCA 2V55A 4K18A 5C8NA 5CS6A 2PVJA 3AC1A 3QTQA 4U79A 3QA0A 5D7AA 4PUZA 2W9ZB 4FL1A 2UW7A 5EI8A 1HCKA 3RAHA 3V8WA 4DTAA 4P7EA 3CGFA 2CGXA 5EKOA 4F1TA 2F57A 3CTHA 4RJ7A 5KMLA 4JVGA 3FMLA 3MWUA 4XP0A 3P7CA 4V04A 3QALE 4QYFA 1BI8A 2V7OA 5C27A 4DITA 2PZIA 4JBPA 2BIKB 2AUHA 3TI1A 4DFLA 5A4QA 3RPYA 1RDQE 1IRKA 3AMAA 1RW8A 2GNLA 3L9NA 5KMMA 4FEXA 2J50A 3C1XA 3WIGA 3HKOA 4L44A 3KXNA 3G0FA 2WO6A 4YZDA 1XWSA 4A9TA 3Q2JA 2WPAA 4I1ZA 4O7SA 4JG7A 2XYNA 4PMTA 4EH5A 3DB6A 2R3RA 3ENHA 4BF2A 3PLSA 4AZFA 4UWCA 4G2FA 3R9RA 5AP1A 3VBVA 1QPJA 2ZM4A 3NPCA 3CXWA 4QYYA 3TNWA 3E3PA 4NM3A 4K11A 3A7IA 3SV0A 1PRYA 1H24A 3MIAA 4L46A 5CAPA 3NMUF 3PG1A 1YXUA 2ONLA 3LJ1A 3PY0A 3VBQA 5H8GA 2WMVA 4TY1A 3BYMA 3WF8A 3VS7A 3D83A 4FTTA 2Z60A 1P4OA 3DBDA 3F5XA 1CSNA 1FVRA 4PP9A 4DEGA 3AD4A 3R28A 4W8EA 3NIEA 4JDHA 4OT6A 5EFQA 4B8LA 3ZOSA 4YC3A 3ROCA 4BCIA 1H07A 2GNGA 4KWPA 3CBLA 1URWA 4ASEA 3QD0A 4BDHA 4LI5A 2XS0A 3DXQA 2YJRA 5GNKA 3ZXZA 2OG8A 3DKOA 4EC9A 1PW2A 1YXSA 5CX9A 4GFMA 5CQUA 4RZWA 3LKMA 5I3OA 3BX5A 5CSWA 3MH0A 1FVTA 3SG8A 3FZ1A 5IA5A 2YDKA 2XF0A 3ORTA 2W9FB 4TYHA 2WMSA 4GYGA 1KOBA 2OJ9A 4QTCA 5C03A 4ARKA 4UYNA 2REIA 2C6EA 2JBOA 2PVYA 4XP3A 4A9UA 4IAYA 5HEZA 4ALWA 3DQWA 3NAXA 5DT4A 4CQEA 3QZHA 4E73A 3W2SA 3ZO1A 2QOKA 4NM5A 1JNKA 4XH6A 2WTDA 5IA3A 4G5PA 5HHWA 4MXZA 2IW6A 3P4KA 2HZNA 3DKCA 2VRXA 3I4BA 3D2IA 3L9MA 3MFRA 4X2NA 3VN9A 1GNGA 1ZAOA 4FG9A 2W4OA 3NYNA 5KKRC 3AGMA 4LRJA 5CF8A 4FV7A 2PZ5A 1OL5A 3JPVA 1NW1A 4F6WA 1ZRZA 2RIOA 3V3VA 3DDPA 2Q0BA 4O38A 3I5ZA 4M0ZA 4PNIA 3DDQA 3NUAA 2YM8A 4BTFA 4WRSA 1U54A 1NA7A 1OI9A 5EM7A 5IQBA 3Q2MA 1NVSA 2E9VA 2QO7A 4JRNA 4WBBB 4AX8A 4RT7A 5K9IA 3HX4A 5IQFA 5FG8A 2W96B 2XBAA 3TCPA 1Q8UA 4B99A 2C0IA 4C4HA 4H1JA 3WIKA 5AEPA 5DOSA 4KB8A 4BRXA 4FV6A 3UVPA 2EB2A 5AUTA 4DH8A 3EMGA 4RA5A 4D28A 5CASA 2ZV9A 2X2MA 5AR2A 4RX8A 2JGZA 5DT0A 3FE3A 4IAZA 2OFVA 2UVYA 3D7TA 2I1MA 2C3KA 4BBEA 3M1SA 2PUIA 3QZIA 4LOOA 5HE3A 5HICA 4AW2A 4D0XA 3AT2A 3ZLWA 2BVAA 5KBRA 3QQHA 1H0WA 3VBWA 3JYAA 4P90A 2WTJA 4LOQA 2XH5A 2BR1A 4NW6A 5AV0A 4KIKB 5LARA 4BWXA 5DH3A 5GJGA 2YJSA 2J0KA 4FV9A 5AP3A 3TUCA 4C02A 2XK4A 1PMUA 4XS2A 2PVNA 1OKYA 4QMSA 2WTWA 3MPMA 3VC4A 4UB7A 3V04A 5IA2A 3G0EA 1PXOA 2R3OA 5AP7A 4BDBA 4CMUA 5EHOA 3U54A 4L53A 3TIZA 4EQUA 2R3IA 2VN9A 4IVBA 5L2TA 3L9PA 4YO6A 3E64A 4ORKA 4Q9SA 2J7TA 4IM0A 2BKZA 3QU0A 1YHWA 3UNZA 2ONLC 1H08A 3PUPA 3EKKA 4FKUA 4I5PA 4F7NA 2WFYA 3ZU7A 5DBXA 3R7OA 2X81A 3GT8A 1Z57A 4U6RA 1PYEA 2VO6A 2YABA 2X7GA 2JLDA 5A4EA 3TJCA 4BDGA 1CMKE 4FZ7A 3P1AA 3HV4A 2QC6A 4PP7A 2BMCA 3QTXA 1BUHA 3IPHA 2B9IA 4IC7A 4FT9A 1Q8ZA 3OOMA 4QP8A 4BDIA 3FXZA 4L8MA 4RZVA 2X7OA 5C01A 3RINA 2BDWA 2WTKC 3VNTA 3V5WA 4B8MA 4TZRA 2XMYA 4AGDA 1YXXA 3N4UA 4D9TA 5AAGA 5HE2A 4DHFA 5F95A 2J4ZA 3FV8A 3OVVA 4Q9ZA 3CS9A 2E9PA 2PUPA 4R6VA 3KULB 5IQDA 2F49A 3JR1A 3PYYA 3LXPA 4FT7A 4J95A 4AUAA 5JK3A 5FXSA 2VD5A 4FNXA 4M97A 3V01A 3RGFA 3G15A 1M17A 2B1PA 2WU6A 2YEXA 3D15A 3R04A 3O8PA 4FNZA 3A61A 4GSBA 1W0XC 4U43A 5AX3A 4LMUA 3LJ2A 3O50A 5ANIA 4NKAA 3EL8A 4I0SA 5H9BA 2JIVA 3LCOA 3QCSA 3MV5A 4FV5A 2RFNA 3MIYA 4BGQA 2XKCA 1ZYJA 5T3QA 5ITAA 5JH6A 3U87A 3PSBA 4WO5A 5JQ8A 2FSLX 3BHYA 3LQ3A 2ZB0A 2BPMA 1UNHA 3EH9A 4FSTA 4IDVA 4TWCA 2QVSE 2BKKA 4XHKB 4EYMA 5IQHA 3QQUA 4DH5A 4LYNA 4ZTRA 5BNJA 4GS6A 1XH8A 1TQIA 2A19B 2IO6A 4EOLA 4U5JA 3TV4A 1WCCA 2YZLA 2YM4A 3MVLA 5HG7A 1Q3DA 2OIQA 2XCHA 4M15A 4W4YA 4ANMA 4EK8A 3KMUA 4X3FA 1H1SA 4AQCA 5GIOE 4D0WA 3U4WA 2UZTA 3ZTXA 3A60A 5CU6A 1PXLA 5D12A 3DAJA 4UMPA 5AIRA 4LG4A 4FGBA 1JQHA 3HRCA 4KRDA 3R6XA 3ZONA 2HCKA 4XV9A 1YI4A 5IA4A 3B2WA 5AAEA 5KUPA 3UOKA 3MY5A 2GNFA 4QMLA 4QMQA 3OY3A 5AP5A 3SDJA 2YIYA 3PXZA 2JITA 2C5XA 3RCDA 3LE6A 4RIXB 5EYDA 3SRVB 2C5OA 3KMMA 4RIYB 4KS7A 5FEEA 5AUZA 3PP0A 5JGDA 4IVDA 4IBMA 4DCEA 2P33A 4YLLA 3I6WA 4FTJA 4YBKA 5I4NA 2JIIA 4YTIA 4E4XA 3W2PA 2JD5A 3U6HA 1J1CA 4WG5A 5I5ZA 4AGWA 3PXKA 2QODA 2W1EA 5EH0A 1MRUA 5E8WA 4Y72A 2GDOA 3I0QA 3COIA 3DBEA 2UZOA 4MXOA 5FDXA 2JDOA 5T6KA 3R1QA 4DEEA 5E8VA 1J3HA 4D2PA 4DEHA 1W84A 3BHHA 3QGYA 3BHTA 4O7YA 3CJGA 3KCKA 2UZLA 3FL5A 2XRWA 3LLTA 2C47A 3HVCA 3Q60A 5DIAA 3TWJA 4U3YA 3QUDA 4KIKA 5FP5A 3VIDA 2BZHB 5KX8A 2I0EA 3RZFA 3NW6A 4GU6A 5FXRA 2BHEA 2PMIA 3C4CA 1CM8A 4ONAA 3TXOA 3F9NA 3TT0A 3NCGA 4QRCA 4ASDA 5CEKA 4FIJA 2PHKA 3ZUVA 4LQMA 4HCTA 1SNUA 2H34A 1MUOA 4KKGA 5IKWA 3UPXA 4I6FA 4CTBA 5LVLA 1ATPE 3BCEA 4EONA 1OECA 3S3IA 3P86A 5E90A 5L8JA 4RBLA 5CVHA 3C5IA 3I7CA 3O71A 3LZBA 3C50A 5C8KA 4F0GA 4GYIA 4AE6A 4A4LA 4FKWA 4IE9A 4BZNA 1ND4A 3ULIA 4BCQA 5E7RA 2VX3A 4C58A 5AV2A 4PQNA 2CPKE 5FEQA 3Q4CA 3I6UA 3PXQA 1YWRA 3F66A 2XCKA 3EZVA 3P0MA 3ZLYA 5HGIA 2GTNA 4S33A 1UNLA 3PSCA 4ANNA 3JUHA 1REJA 2W1ZA 2YLEA 3FLNC 5CSHA 3WF7A 1UVRA 4WD5A 4V01A 3NW5A 5GZ9A 5I0BA 2PZRA 3MN3A 4NTSA 5EDPA 3QUPA 3HMMA 4EJ7A 3FI3A 4F99A 5IA1A 4YMJA 2DYLA 2BZIB 3OHTA 3GUBA 3QZFA 4XG3A 4E6QA 1V0PA 4QMVA 5M53A 1WFCA 3FKLA 3KULA 3QZGA 3FHRA 1APME 2R3NA 3EYHA 2A0CX 4NK9A 4X3FC 3AC8A 3VQHA 3E88A 4IAKA 4RWJA 3VUHA 4AGCA 2J6MA 4CT1A 5BQ0A 1SMHA 2C6TA 2JFMA 1P5EA 3BU6A 4QP7A 3RWPA 4BZDA 2HK5A 1DM2A 2R0IA 3IG7A 2GHMA 3W2OA 5I9UA 1A9UA 4PDPA 3R9OA 4OTWA 3TZ7A 1J7IA 3GI3A 1YI6A 4FIFA 3HV7A 2R2PA 5CALA 3NUNA 5CAVA 4X7QA 4FSRA 5FUTA 1KE7A 3F7WA 5HBHA 4C2VA 3LOKA 3NYVA 4UX9A 4O0YA 4O22A 4FYNA 4KRCA 4C4GA 5AUWA 4F9AA 5AJQA 4FR4A 4FTIA 2FSOX 3QRKA 2CLXA 3RAKA 2VTNA 5IQCA 1P4FA 4ZXTA 3R8VA 4A9SA 4I20A 3HL7A 3T3VA 3GFWA 2YWPA 3ZM4A 3AXWA 4NIFB 3ZSHA 3F2RA 3V5JA 3C4FA 4FTAA 1STCE 3CJFA 1KSWA 2IZUA 4EZ5A 3EHAA 2JBPA 2G9XA 3LM0A 4UMRA 4TYJA 3FMMA 5H8EA 4ACMA 4BIEA 1BYGA 4IFCA 1P2AA 4YJQA 1J7LA 4IJ9A 5EHLA 2OU7A 3E63A 3PVGA 4M12A 3A4PA 3IW5A 3UG2A 4FTKA 3ZM9A 3DBQA 4UXLA 2IW8A 4EHGA 4IB3A 3FC2A 2X2KA 1H1PA 4I92A 3ZEWA 3DJ6A 3O96A 3WF6A 2GS2A 5K0KA 4Z7HA 4V05A 2NRYA 5BUIA 2Q0NA 4H3BA 4O0TA 4FZDB 5IISA 5AUXA 2VWZA 1NY3A 3OCTA 5HZNA 4J53A 2Z8CA 5CSVA 5CVFA 5HLPA 5HO8A 4F1OA 2PTKA 3PP1A 2Q83A 4GT3A 1QL6A 4AOTA 4AFEA 3OW4A 4E6DA 3JVRA 4XG7A 4BHNA 3CC6A 4YURA 5DR2A 4E5WA 2QG5A 2XK8A 4AZEA 3DFCB 3Q9XA 1G8AA 1UWHA 4M67A 5C4LA 2BDJA 2R3PA 4ZTSA 4H1MA 4CG9A 5FXQA 3R22A 5FWKK 4BIDA 4QTDA 1YW2A 4XLIA 3H9OA 3P08A 3ZSIA 4QMWA 2AYPA 4RJ5A 2QOIA 5M51A 4LRKA 4AOJA 3N51A 1H0VA 4U0IA 4D4YA 3CY2A 1J7UA 2P2IA 1MRVA 3UPZA 3FHIA 1MQ4A 2ETRA 3N9XA 1PMEA 4WOVA 4P2KA 2PYWA 3W2QA 2IZRA 3CTJA 3D5UA 3E8DA 4HGLA 4FSMA 5AP6A 1PY5A 4IJPA 3VAPA 3BGZA 2OLCA 5J7BA 3MTLA 4O6LA 2YDIA 2B9JA 3DXNA 3F88A 2R7IA 3PRFA 4G34A 3UDBA 5FM2A 3CD3A 3CCNA 4IX4A 5L4QA 4FKLA 2EXEA 2JKQA 4UALA 5CXZA 3SQQA 4BCGA 1ZZ2A 2RKUA 4M13A 2XZSA 4C7TA 3BI6A 3UGCA 3HAVA 5HE1A 4MK0A 2X9EA 4W4VA 4CZUA 4UEUA 5J1VA 2XJ2A 3RPVA 4CSVA 3COKA 4DC2A 3EB0A 5A46A 4BCKA 3VVHA 5D41A 1FMOE 2H96A 4JR7A 2OW3A 2VX0A 4EK5A 3QAME 3VHEA 2J0IA 3QLFA 3SOCA 3V51A 4EORA 4GK3A 3VWAA 1VYWA 5EI6A 3VBTA 3V5LA 3EN5A 4RC3A 2OJIA 4FE2A 2CN8A 5JFWA 2WMAA 4I0RA 4W9WA 2WGJA 3U9NA 1ZZLA 2YCSA 3HYHA 4AGUA 3SA0A 3N4TA 1JKTA 4L9IA 3MH1A 2WIHA 3C5UA 4RWIA 3W18A 3HMPA 4KABA 4NCTC 4ALUA 1OL1A 3GQIA 2F9GA 4MVFA 4JX3A 5HBEA 1GZ8A 5ANJA 3NVKI 1GZKA 4FZ6A 4U3ZA 4Q5EA 4MXXA 4NEUA 4MAOA 3LM5A 4JIAA 4YU2A 3GP0A 2O2UA 3HEGA 3IGGA 2GNIA 1PXJA 1W7HA 2NNWB 1ZY5A 4ANBA 1UU9A 2HW6A 3KF7A 2GQGA 3H10A 3HNGA 3ULZA 2R3HA 4YTCA 5HU3A 1OBGA 2VTTA 3L8VA 3V5QA 1QPDA 4EK6A 2J9MA 2R9SA 2C5NA 4GCJA 1OBDA 3TL8A 4BB4A 5B2MA 4RRVA 4IX5A 2WTKB 4MYGA 3REPA 2C4GA 1OIYA 2FGIA 4TYHB 4X6RA 3POZA 3TTIA 2R3MA 4XG6A 4BDJA 5DEWA 2YIXA 4BVUA 2VWIA 4YJRA 5EM5A 5FLFA 4BC6A 3L8XA 3FZOA 4BL1A 2FB8A 4D4RA 4DFBA 3DU8A 1XH4A 4BKYA 4KSQA 4N57A 5LVNA 4DTBA 5EQPA 5ETCA 5DA3A 4I5HA 4XMOA 4L7SA 4LGDA 5FTOA 2GQRA 3D4QA 4EWHA 3E7VA 3OWPA 2FA2A 4LM5A 3ZDUA 2XA4A 5DHJA 3W33A 4AU8A 2WXVA 2VV9A 4U45A 3RJCA 4NSTA 3OP5A 4F9BA 5GZ8A 4H3QA 5JSMA 2HXQA 5F20A 1H4LA 2YLFA 5L2QA 5HBJA 5KZIA 4FG7A 4B7TA 4AW5A 2R4BA 4HYHA 5CT7A 2AC3A 4D1ZA 3NYXA 4ZS4A 1U54B 3FEGA 4HVSA 4AA5A 4C33A 5AUUA 1NVQA 3CY3A 2J0JA 3EQPA 3AD5A 4F08A 1G8SA 4NT4A 4AZTA 5AP0A 3TM0A 4QQJA 2G1TA 2QOCA 4FV3A 4IH8A 4MXAA 3MY1A 2CKQA 3C4ZA 4FVRA 2O64A 3Q04A 3FYKX 5A6OA 1G5SA 1U4DA 3OC1A 4Z16A 4G1WA 2QOFA 3UJGA 2JIUA 2QKRA 2Y6MA 1K2PA 1I09A 3Q9YA 3BLHA 4N6YA 2QONA 3LXNA 1WVYA 1UWJA 4S2ZA 4FKSA 5E8TA 5GINE 5BYZA 4FOCA 1LR4A 4NU1A 3ZDIA 4MCVA 3NRMA 4C3RA 4USFA 2JAMA 1W82A 1EH4A 3OEZA 3QX4A 4S31A 1O6LA 2XK7A 4CKRA 4EUTA 4MHAA 4RPVA 3O17A 4F9CA 3AT4A 3ZFMA 5JZJA 4TWNA 4FV2A 5CSXA 3ZO3A 1OVEA 4XG4A 4FMQA 2GNJA 3UIUA 1OB3A 2VO0A 3ZCLA 4A4OA 3D9VA 3ODZX 4YPDA 5L8KA 5K4JA 3I5NA 2C68A 3KRXA 4YZ9A 4BDKA 1NVRA 1XH7A 4G9CA 3MVHA 5C26A 3VJNA 4EH2A 5IU2A 4QMUA 2Y7JA 4K1BA 4RQVA 2OZOA 3DXPA 3F3WA 4HYUA 4UMUA 1TKIA 4K6ZA 3IW8A 1QMZA 4DG0E 4YZNA 3QA8A 4IWPA 4D1SA 4XV1A 4L3JA 4FNWA 4DE4A 1Q41A 2WTIA 2W4JA 3F5GA 3GC7A 3CQUA 5B2LA 3CD8A 3SW7A 3JY9A 2QHNA 5HLNA 1M2RA 4E93A 3UP7A 3FLZA 2XJ0A 3O23A 2QURA 1H25A 2R5TA 1XH9A 4G6OA 4X2KA 5EKNA 3EQHA 4BCOA 4I5MA 5AMNA 4HNIA 4CFMA 3R9NA 4RVMA 1YDSE 2XNOA 4ZP5A 5BVOA 5HO7A 1Q4LA 2UW4A 5JFSA 4I94A 2WEVA 4OT5A 4UBAA 2R3LA 4HYIA 3WILA 1REKA 4M7IA 4AZSA 3OW3A 3ACKA 5AA9A 2ITNA 2YAAA 4I6HA 2UZWE 3Q32A 4Z7GA 4O81A 5CNOA 3ORMA 1OL7A 1YWVA 2F2UA 4GFGA 2ZAZA 5TT7A 3TDWA 3LFBA 3DTWA 2ZOQA 3A8XA 4J96A 1Q8TA 3IQ7A 4S30A 4YZMA 3TZ8A 3MH2A 4IQ6A 5IUHA 3HAMA 3ZZWA 4LMNA 4CT2A 3ZUTA 3PPJA 3VHKA 3FLSA 4A4XA 4A9YA 2F7ZE 2OXDA 5HIBA 2E2BA 2AC5A 2ITTA 4E20A 1XH5A 4FTUA 4LL0A 3VS2A 4M66A 4N0SA 2OF4A 3Q3BA 4N70A 5AAFA 4G31A 2XBJA 3RK9A 3UO4A 3KKVA 1WBOA 4W8DA 4R7HA 1M2QA 1B38A 4NTTA
chains in the Genus database with same CATH superfamily
4A06A 1ZARA 1XMMA 5IF1A 4IZ5A 5D1JA 5A3XA 4HPTE 3V6RA 3P79A 3TUBA 3Q53A 4CZTA 4JR3A 3E3BX 3HLLA 4RWKA 5HD4A 2X0PA 4FKJA 3QTZA 4DHIB 4H3PA 3QCYA 4F1MA 4DG2E 5KMJA 5GJDA 2ZB1A 2H6DA 3HGKA 4CMOA 5LWNA 5J87A 3NNXA 4DFNA 4Y5HA 1OL2A 1ERKA 4TYGA 1O9UA 2P2HA 4L3PA 4XCUA 4YJPA 3T8OA 2CKOA 3F3VA 3QRUA 3ODYX 4EQMA 2DWBA 3NX8A 1FPUA 2FSMX 4X3FB 2EB3A 1CDKA 3U8WA 1XBCA 4KNBA 2ITVA 4F65A 5D9HA 5HIDA 3E62A 5IEVA 4OBOA 3GC0A 1Y57A 3R8PA 4FGRA 4RA4A 4JLCA 5BVEA 5K0XA 4J52A 3NUUA 3W2RA 3KREA 1H1WA 2JDSA 2X4ZA 3TIYA 3M11A 4RJ3A 2F2CB 3MB7A 1IEPA 3CPCA 1XJDA 3UNJA 3BWJA 4I6BA 4C38A 4DE4A 1LP4A 3QHWA 2CGWA 3NGAA 4IAAA 2X8EA 3KN5A 4TT7A 5DN3A 4OTIA 5JEBA 1YWNA 4CGAA 2IWIA 1JKLA 2HELA 3E93A 4FV1A 2IZSA 5AFVA 4CZYB 2ZYBA 3OF0A 3CP9A 3VS0A 5K5NA 3BYVA 3HUBA 2ZV7A 1PKDA 2A2AA 4FICA 5JRSA 2EVAA 3DZQA 3CIKA 4L42A 5CANA 4IXPA 4RC4A 2IPXA 3QRJA 5IQGA 3K5UA 4QNAA 5LXMA 4E7WA 3RVGA 5E4HA 5JZNA 4B6LA 3DK6A 4K2RA 3PVBA 3W0MA 2B9FA 1WBPA 3EFJA 2X2LA 4XRLA 3SXRA 3VUTA 3WZEA 3WZJA 4FA2A 4O86A 3DV3A 4QP9A 3VULA 4F64A 4ZIMA 1M14A 4AT5A 3C4EA 3UIMA 4L3LA 1R1WA 3NW7A 5CI6A 3NFGB 4IM3A 4JJRA 4MF0A 3PPKA 5DR9A 4M14A 2YCQA 4G3FA 2EUFB 3VO3A 1PMVA 5CF6A 2EU9A 5DR6A 4GUEA 3LCTA 3FY0A 2BTRA 2WNTA 1CKIA 3KRWA 3PWDA 5D10A 3QXPA 3MI9A 5EYKA 3ZBFA 3SW4A 5CEQA 4ZY5A 4O2PA 4AZWA 3KQ7A 4BKJA 3VS1A 3PZEA 3P5JC 1H28A 5E8UA 1KE8A 3LAUA 1F0QA 4F6SA 4FZAB 3GU5A 1AGWA 2QNJA 3L8PA 5EI2A 4F0IA 1SVHA 1IA8A 2E9UA 2QO9A 1PXKA 4FC0A 4FEQA 3BU3A 4GEOA 5DNRA 2XIYA 3UO6A 3VUDA 4CCUA 3GEQA 4ZZOA 4EOOA 3RPOA 1M7NA 1YKRA 4BDDA 4UZDA 4KUJA 2OH4A 4GG5A 2ZV8A 1ZMUA 2XIZA 5E1SA 1K3AA 2OXYA 2E9OA 3M42A 3AG9A 4TWOA 4X2FA 2OGVA 4LV5A 4LUEA 4Y85A 5F4NA 4DGOA 1GIJA 3CLYA 5L2WA 2XVDA 4FTMA 3PVWA 3LFFA 2NPQA 2UV2A 4GK4A 4YJVA 3IOKA 3FLYA 4DT8A 4IW0A 5FBNC 4APPA 4CLJA 5HTIA 5H2UA 2PPQA 5ETAA 4PL4A 3VF9A 4BBMA 4EH7A 2IW9A 1WZYA 1WBTA 4AOIA 3O2MA 2OK1A 3QTSA 3TNIA 4EH8A 5AR8A 4Q2AA 4EK4A 2XK3A 4FKQA 4O7VA 2VTSA 1I44A 2JKKA 4EOQA 5BYYA 3R30A 4ACHA 3U6JA 1Q97A 3BV2A 5KMIA 4C59A 5AM7A 5JGAA 1GZOA 4YHJA 2QHMA 4BJJB 4CFNA 4AT3A 1Z5MA 2P3GX 4G17A 2YCFA 1PXPA 3HP2A 4BDAA 3GBZA 2YA9A 2ITXA 2A1AB 3FXXA 4CFXA 4YR8A 5LVPA 1AD5A 1PMNA 4KBAA 1BL6A 3U9CA 3BEAA 4EH4A 4KINA 3TZ9A 2OSCA 2AEGA 2QLQA 3ELJA 5ACBC 3QHRA 4FYOA 3W0SA 1JKKA 2X7FA 3F61A 3WZKA 3QQGA 4OW8A 5TR6A 2CGUA 4EOJA 5IA0A 4G6LA 4ZAUA 2J2IB 2EWAA 4NM0A 2JDTA 4I4EA 1QCFA 4NM7A 3OG7A 4APCA 5I9YA 4GK2A 3ZRKA 3UIBA 2WZJA 4J8NA 3QF9A 5AP4A 4DN5A 4IVCA 2OJFE 1UA2A 3LMHA 2C69A 3R1SA 4J8MA 2ZMCA 2DUVA 3ZXTA 3QXOA 3UE4A 4UV0A 2OFUA 4AACA 2HENA 4FV4A 4M8TA 4E6AA 3Q5ZA 4WHZA 5FTQA 3ZC5A 3FI8A 2BALA 2C3LA 2FVDA 3BE9A 1W83A 3NS9A 4F09A 5KO1A 5LMKA 1FBNA 3BRBA 2ETKA 3LJ0A 1E9HA 2W06A 2WMXA 1GOLA 2WMQA 3F7ZA 3IOPA 3U4UA 4KIQA 4K8AA 1UNGA 3R7IA 4FT3A 2XAOA 4DLIA 3ZFYA 2X0OA 3FI2A 4GW8A 3R2BA 4C36A 3S4QA 4K33A 5G1XA 2XNEA 3UC3A 4IACA 5ACKA 1Y91A 3QQJA 3BV3A 5JFVA 2VWXA 4PPBA 3PLAE 1ZYDA 4PL5A 4NUSA 5CAUA 4DYMA 5CF5A 1NT2A 4ZTHA 5FP6A 2C1AA 3MFUA 4R3CA 1T45A 3EKNA 4WUAA 3VBXA 4RQKA 4B9DA 4ZJJA 3KCFA 4O0UA 3LXKA 3EJ1A 3P23A 4ASZA 4HVGA 4O7TA 4DDIA 4PWNA 4RJ6A 4J97A 3PUFC 4DBXA 3PE1A 4BHZA 2W7XA 4FSQA 3LFAA 3CR0A 3ZH8A 3OT3A 4BCMA 4O84A 4F4PA 2WD1A 3ORXA 1FMKA 3OD6X 3BYSA 2RGPA 3LPBA 4BN1A 4CTCA 1Q62A 5HCZA 5LJJA 2C30A 4EC8A 2X8IA 2X8DA 3I60A 4FF8A 3PFYA 1M7QA 4IB5A 2PE2A 3W0NA 4GUBA 3O0GA 3UYSA 4IIRA 1PYXA 4WIHA 2FO0A 3KF4A 2OI4X 2WMBA 3Q6WA 3BKBA 5AV1A 4BYJA 3DQXA 5EOLA 1ZOGA 3HRFA 1UKIA 5J8IA 2JFLA 4DINA 4RVKA 3KFAA 4U7ZA 3FC1X 1Q8YA 2OXXA 2R3FA 3FLQA 4MBIA 5AM6A 4HW7A 1IAJA 1GIIA 1JSVA 1TFFA 2ZFYA 2C5VA 1SVEA 5DG5A 4EKLA 3LFEA 1FGKA 4O0SA 4FIHA 4WG4A 4TNDA 4XUFA 4ZEGA 4EI4A 3WYYA 4GIHA 5A4CA 4MQ1A 2B55A 3RKBA 1F5QA 3FZPA 5IMXA 4U40A 3HUCA 4CMTA 4BICA 3H4JA 4FZFB 4XJ0A 3LW0A 4H58A 4F70A 3BQRA 4DGLC 2YHVA 3NUPA 4M69A 2PVRA 3G90X 3JXWA 3QLGA 1Z9XA 2ZM1A 4WNPA 3F3ZA 2A4LA 3B2TA 1TZDA 3U51A 5KZ0A 2CSNA 2C0OA 3TZMA 4G3GA 1JPAA 2A27A 3QD4A 3R02A 4O91A 3TNPC 3CTQA 3VS4A 3KXGA 2HOGA 4FKOA 4JBQA 2G2FA 4D2TA 2JKMA 1OGUA 3OXTA 1GAGA 3ZO2A 2RSVA 5AR4A 2PZYA 4HGEA 4QMYA 3UOLA 4GL9A 4ALVA 4Z9LA 5AADA 3BIZA 5HI2A 1G8KA 3COHA 4IHPA 1YHSA 1ZY4A 4RIWA 5JFXA 3FZRA 5IQIA 4IB1A 3GU8A 5HG9A 3QQLA 2R64A 3IDCA 4G6NA 4YJSA 2ITYA 5FBOA 4BGHA 2WQMA 4U81A 5LMKC 2WEIA 4NYEA 3MVMA 4QQTA 3GFEA 4YHFA 3LCSA 1TQMA 3UOJA 3HV3A 4I6QA 2GQSA 3POOA 2PMOX 3CEKA 4OTPA 3F3UA 1H1QA 3RMFA 5KHXA 4WNOA 4WG3A 3E5AA 3ITZA 2YIWA 3ZBXA 2JAVA 4CFUA 1ZYCA 5IDPA 3VW8A 3Q4UA 3MDYA 3DCVA 2ETMA 2ITPA 3DLZA 2QU5A 3R21A 4PL3A 4F9WA 5HCXA 5G6VA 2BTSA 4I93A 4E5AX 4FEVA 4AW0A 3ZS5A 3COMA 3W1FA 4YBJA 4I0TA 2OIBA 3IGOA 3PIZA 2YDJA 3R8UA 4FSZA 4L45A 3P7AA 4O1PA 2LAVA 3W8QA 2HWPA 2PE0A 3HA6A 4QPSA 4EK3A 5GHVA 3NSZA 2ACXA 3DNEA 2LGCA 3HV6A 3RCJA 3W55A 2I7QA 1DI9A 2W4KA 2BIYA 2BZKB 3CGOA 2VGPA 4XV3A 2VTPA 2QOQA 4L52A 5F1ZA 1JAMA 5HESA 3LFSA 4BFMA 1DS5A 3SKCA 3VRYA 2P4IA 3I0OA 4O4DA 4TYIA 4AAAA 3DAKA 3G9NA 4FTQA 5EW8A 2PVMA 4YTFA 5CTPA 4MD8E 4C4JA 4YPSA 1SM2A 1XHAA 5DE2A 3AC4A 4X21A 3TV6A 4IC8A 4NKSA 5ANDA 4CV8A 3DGKA 2XUUA 4KIPA 3W16A 4FEUA 3UMXA 3F82A 1YRPA 4Z55A 3P7BA 4YSJA 1Y6BA 2W5HA 3FQEA 4AQKA 4O0WA 2YACA 3SC1A 1J91A 4GRBA 3EQDA 4L67A 3ANRA 5KE0A 1U5RA 1V0BA 3NNUA 5EG3A 3VS5A 3WOWA 3S0OA 5KMOA 3EN6A 2VU3A 4ZTLA 1ZYLA 3NEWA 1SYKA 5IPJA 4TL0A 2W1IA 4E4MA 2JEDA 3OWKA 2BHHA 3R0TA 3QWKA 3FMHA 2XARA 3OFMA 1LPUA 2X4FA 3BGPA 5DGZA 3OT8A 4Y73A 3S00A 4HCVA 3UIXA 5DYJA 3Q9ZA 4I23A 2XIRA 3PVUA 5DVRA 4CFFA 4JS8A 4F7SA 2QR7A 4O7RA 5JQ5A 4GJ3A 2WTVA 1E1XA 2HZIA 2WMTA 2XP2A 2AQXA 3DK7A 4FV8A 4LGHA 3TKIA 3K5VA 3ZHPC 4ZS0A 2YAKA 5CZIA 5HE0A 2XK6A 4LV7A 3QGWA 4PMSA 2B4SB 3EN9A 1FQ1B 3KN6A 4P5ZA 4IWDA 4A7CA 5A14A 1H26A 3MYGA 3AD6A 2PUNA 4AN3A 4RFMA 5HD7A 3WF9A 5HVKA 3MY0A 4OGRA 4DFYA 3EL7A 3NNVA 2CCHA 4Y5QA 4K9YA 4IZYA 4XEYA 4PDOA 3LFNA 4O83A 5M08A 4R77A 3A7FA 2EXCX 2J90A 2XYUA 2UUEA 4HYSA 2KULA 2HY0A 1OKVA 2YM3A 3ETAA 3VW6A 3EQIA 4FEWA 5A9UA 5M07A 2A98A 4C2WA 1YDTE 4BTMA 3FMDA 3ID6C 2PZPA 3RAIA 2FYSA 2OZAA 3HECA 4D1XA 3TKUA 3SAYA 2Y4IC 3R8MA 2WU7A 3MVJA 3HA8A 3KRRA 4GV1A 3TJDA 3N4VA 4AE9A 2V22A 4C35A 4RVLA 1O6YA 4DFZE 3DS6A 4Y46A 4UY9A 2HYYA 4QP4A 3R7EA 4AXEA 1IAHA 2VTOA 4FG8A 3QRTA 3CKWA 3E7OA 3BLRA 3Q4ZA 4NFNA 4XYFA 4AA0A 3M2WA 3KA0A 4D2WA 1R3CA 4MD9E 2XK9A 1UKHA 1H00A 3ZC6A 3FMJA 5AIKA 1FVVA 3HZTA 4CYJA 3TG1A 5HNBA 3A4OX 3A7HA 2OIDA 2HIWA 4L7FA 4DH3A 3KRLA 1X8BA 2PK9A 4O4EA 4O96A 3MGYA 3SLSA 3TNHA 2UW6A 1JOWB 2DQ7X 3AMYA 5EM6A 4QQ5A 5J7HA 1NXKA 4HPUE 2C3JA 4JBOA 3LFCA 3LVPA 1M52A 1UV5A 3F2AA 4GKIA 4FKTA 3VJOA 4BCNA 1IASA 5M09A 3NUYA 4KIOA 3FZTA 3B8QA 4ITHA 3ZEPA 5H3QA 3I1AA 5AUVA 1CKJA 2BRBA 3MPTA 4Q5HA 5DI1A 3GCSA 5E92A 1OL6A 2YZAA 5CAQA 3ET7A 3IDBA 3EZRA 4FIIA 5FM3A 4H05A 2ZDUA 4PMPA 3R9HA 3EOCA 3DKFA 4FL2A 4OTFA 1JLUE 3PSDA 3AKLA 2WHBA 3KB7A 4O82A 3VQUA 4ERKA 3C0HA 4M84A 2IVTA 3II5A 3TEIA 5HKMA 2R3KA 3FQHA 4B4LA 2JKOA 4LL5A 5CU2A 3ZRMA 3LLAA 4RSSA 4IANA 1VZOA 3FY2A 3I81A 4QQCA 5EYCA 4QMXA 2VNWA 4II5A 1XQZA 2QCSA 2BAQA 5HX6A 4JAIA 4OUCA 4FI1A 2B0QA 1YXTA 3BYOA 4ZK5A 1KV1A 3NFFB 2CGVA 4HCUA 4BI1A 2WQEA 4PTCA 5J95A 4QPAA 4CNHA 4FNYA 4ZMEA 3PXRA 3IKAA 3OTUA 5J9LA 2ERZE 5CSPA 3H9FA 4IZ7A 2BAKA 2UZVA 4M3QA 2IF8A 4UXQA 4PPAA 1FGIA 4FKGA 2X6EA 4YZCA 5J5SA 3LXLA 2XNMA 1YOMA 4UMQA 3ZFXA 4JRVA 5E9EA 3H0YA 3GENA 5AX9A 5KCVA 4D5KA 4EYJA 4WT6A 4IWOA 4O27B 3OCBA 4DGMA 2NYAA 3E92A 4G9RA 5ANEA 4PF4A 3ZYAA 5IUGA 1ZOEA 3A8WA 2CN5A 3FUPA 4ZTNA 4V0GB 3Q5IA 5ANOA 3K3JA 3KXMA 3K54A 5A6NA 3C9WA 2X9FA 2Z7SA 1FOTA 4ANOA 5L8LA 3IW6A 3NAYA 4E6CA 2BILB 2IVSA 3RPRA 3IO7A 3T9IA 4ZJVA 2CMWA 3BPRA 3ZSGA 4PDYA 4J1RA 2C6MA 2RFSA 2RF9A 5CF4A 3GCVA 5CQWA 4RG0A 4BI0A 4OAVB 2XNGA 3P78A 4GG7A 3TTJA 5LMBA 3RNYA 1ZXEA 4PMMA 3QRIA 4CRLA 5EOBA 4CVAA 2IN6A 3WBLA 5EQEA 4QNYA 2GFSA 4RFZA 3UYTA 2GCDA 3NWWA 5L6WL 3VS6A 3VS3A 4YO4A 2G01A 3W0RA 3WARA 4QP6A 4QTBA 3B8RA 4GT5A 4BCFA 2ITQA 4KD1A 4O0RA 2GHGA 5DRBA 4F9YA 3WE8A 3DZOA 3IW7A 3EIDA 3ORPA 5T68A 2QKWB 4XOYA 5LQFA 3H0ZA 4C61A 3UODA 1VEBA 4TKSA 3O8UA 5AV3A 2WQOA 2FUMA 3R7GA 3PE2A 4K77A 5BX0A 4JQEA 4FTLA 3AC2A 1KE9A 2XIXA 4N6ZA 1YDRE 1WBSA 4GIIA 2X6DA 4JXFA 4WRGA 2UVXA 4HGSA 3RK7A 3SXFA 2BCJA 3BLAA 4C0TA 2B53A 2R7BA 2O65A 5DEYA 2O63A 4AFJA 1V0OA 4DEDA 3G33A 5HNIX 1BL7A 2B7AA 3FMEA 1WBNA 4OR5A 4OTQA 3TV7A 1ZMVA 3LFQA 1Q61A 5AA8A 4XBUA 4CLIA 5BYLA 3BBTB 5LVMA 3FAAA 4EBVA 3ERKA 1O6KA 1XBAA 1J1BA 3RZBA 4CKJA 3RHKA 3W2CA 5C4KA 4QYHA 4AG8A 2HAKA 2OO8X 4QPMA 1T46A 5DMZA 2CNVA 1LEZA 2PSQA 2VTJA 2YITA 2P0CA 4C57A 3MBLA 1ST4A 2UVZA 4I22A 1OUYA 3FPMA 3UVQA 4JNWA 4E5BA 3MA3A 3DT1A 2UZBA 2XM9A 4IADA 4MF1A 4YSMA 4CG8A 3KXXA 2BRHA 4ENYA 4WUNA 3MFTA 5CT0A 3LQ5A 3UNKA 3IECA 2E9NA 4C4IA 3FLWA 1MP8A 4J7BA 4AN2A 4FBXA 5B7VA 2VWBA 4G16A 5DRDA 4NWMA 4GMYA 4YHTA 1RE8A 2B52A 3VRZA 3MJ2A 2ITWA 5FGKA 2G15A 2UW3A 4BWKA 4R3RA 4BCJA 2WMRA 4E4NA 4J71A 3P5KA 4HVIA 4D58A 5CU4A 2PY3A 4EZ3A 4DBNA 3FXWA 2W1FA 4QYEA 3MS9A 4I5CA 4MWHA 2RFEA 2JC6A 3C13A 4RC2A 4E4LA 2QI8A 3WYXA 4GU9A 3SG9A 4U97A 3OTVA 4AWIA 2OKRA 5I9WA 2XB7A 4EOMA 4AA4A 4ANLA 3D0EA 3NCZA 3RM6A 2I0YA 4Y83A 2Y8OA 3G6GA 3NUXA 4J99A 4U41A 5LCJA 5HO6A 3F2NA 3SHEA 3RALA 3BLQA 3PWYA 4MWIA 2YM7A 3KEXA 2J0LA 3DLSA 5FEDA 4EOIA 2BRNA 5HQ0A 4EKKA 3NDMA 3OEFX 4Z3VA 2UW5A 3GC8A 2GPHA 3DK3A 3EFWA 3C0GA 3GGFA 1H1RA 3LCKA 4Y8DA 5AR7A 1B6CB 5HORA 2F7EE 5DPVA 2VWUA 2BAJA 3KC3A 2FH9A 2WELA 2XKFA 4BYIA 3KRJA 4LDTA 1QPCA 5M55A 5L2IA 1Q3WA 3BBWA 4N4SA 4DH7A 4HVHA 3RTPA 1H01A 1PXMA 3EQRA 3OUNB 4QT1A 3DFAA 4FSNA 4R8QA 1U59A 4BDEA 3FL4A 2V0DA 2W05A 3VUGA 4FOBA 1JBPE 4MQ2A 2RG5A 1GJOA 3F3TA 3CE3A 5BMMA 5EDQA 3UOHA 5IH6A 4ZTQA 1OPJA 2QR8A 3KK9A 4EQCA 1V1KA 4JAJA 1OPLA 2QU6A 5BVKA 4AF3A 4NFMA 3CSVA 3EYGA 1OZ1A 4BKZA 2VTHA 3RNIA 4CD0A 3ML1A 2VWWA 4CEGA 4YUQA 3TYKA 2KTYA 5K5XA 3RM7A 4IM2A 5KHWA 3VONA 5F94A 3CKXA 1KE5A 4W9XA 1PF8A 5HG8A 4EOKA 2ZJWA 3E87A 2IVVA 1UU7A 4U9AA 4MD7E 1Q8WA 4V0GA 5TE0A 3R1NA 3UQGA 1DI8A 2W0JA 4PX6A 3G6HA 4C37A 1OKZA 4S32A 4IFGA 3L9LA 4YNOA 5EDRA 1WAKA 3NUSA 4GH2A 4FTRA 4AZVA 4FJVA 3WZDA 4EH6A 5C8MA 3AMBA 4QTEA 4FK3A 3FDNA 4IZAA 3IW4A 3QCQA 3OOGA 3GCUA 1R0PA 4GFOA 3BL9A 2R3GA 2PWLA 5BVNA 1HOWA 3NR9A 2XKDA 4RX7A 4YTHA 4PTGA 4OBPA 3MW1A 2PE1A 3TNQB 5HU9A 5A54A 1PHKA 5D11A 2EXMA 3KXHA 4GVAA 4EUUA 5ICPA 5LMAA 1CTPE 3DTCA 3UC4A 3HDMA 2GU8A 3QTUA 4DFUA 3AQVA 1H27A 2W1HA 1YHVA 5EW9A 2C6KA 1VYZA 2OICA 3JY0A 3EFLA 4L6QA 4YJOA 4EHEA 2V7AA 2VTLA 4DEIA 3SVVA 5IUIA 2CLQA 3TKHA 2VWVA 4BIBA 4CCBA 4IX3A 1CKPA 1W2DA 1KOAA 3AT3A 1YXVA 1ST0A 3C4XA 5FD2A 1XKKA 1Y8GA 5CU0A 2Z02A 4WSQA 4M69B 2C6IA 5CI7A 4D2SA 3FWQA 5ETFA 4ZSLA 5HLWA 3GU6A 4IDTA 5FTGA 4ZY4A 2JDVA 4YLKA 4O7ZA 4A9RA 3OROA 4O2ZA 4O0VA 4G3EA 4YC6A 1KUTA 1P14A 3PRIA 4R1VA 4ZLOA 1R0EA 4MBLA 5CNNA 3G9LX 2W5AA 3DJ7A 3MPAA 4KBCA 3R8ZA 3ZUUA 5LVOA 3ORNA 5I9ZA 5AR3A 3MB6A 4C4FA 3MSSA 3OS3A 2C3IB 4JIKA 3LMGA 1YVJA 3V6SA 5JRQA 1TQPA 3ZLSA 3ANQA 3O7LD 1BMKA 4QMMA 3GQLA 4RIWB 3UG1A 2YCRA 4DG3E 4KA3A 2UZNA 4F0FA 4UN0C 2VNYA 4MXYA 2C6DA 3IONA 4JDJA 3SD0A 4E8AA 1K9AA 2CNUA 5BPYA 5ANKA 4DCAA 2UZEA 4ERWA 4X2JA 4YZBA 5L6PA 3KXZA 4FUXA 5KNJA 3UTOA 3MTFA 4ITIA 3OMVA 2Y4IB 3GU4A 3ATSA 3FPQA 4DFXE 2WMWA 3O7LB 3TACA 3GU7A 3UDZA 2I0VA 3F5PA 2XNPA 2Y0AA 3CQEA 2XJ1A 3FYJX 4BDCA 3GOKA 5LWMA 2Z7RA 2XRUA 5ETIA 5JGBA 3C0IA 2F7XE 4O21A 3BHUA 4FIGA 3BE2A 4RFYA 1H8FA 2H9VA 2BUJA 2VAGA 4OLIA 5HNGA 3DKGA 3PA5A 4BTKA 4ZSAA 4L01A 5JT2A 2PL0A 4YNEA 4PDSA 2NP8A 3EFKA 2Z7LA 2VTRA 5GIPE 4JT3A 2ITZA 3NYOA 4F63A 3V5TA 4CV9A 2ZM3A 3LHJA 3TDVA 3W32A 5TKDA 2WOUA 3Q6UA 2YERA 1JSUA 3HMOA 4U44A 1M2PA 3OBJA 4AAYA 3PA3A 4QD6A 4KKHA 4O0XA 4I41A 4XV2A 2BFXA 4AW1A 3MESA 2CCIA 3L1SA 4XNEA 4DA5A 2ZV2A 4QOXA 1VJYA 3CQWA 4FSYA 1URCA 4X0MA 4X2GA 3QTRA 4RX5A 1SVGA 2PMLX 3VUKA 5JKGA 3R63A 1LUFA 5JN2A 3BHVA 3S1HA 4U8ZA 4W4XA 4DAWA 3UZTA 3EQGA 1XR1A 2WMUA 4MNEB 4D4SA 2J5EA 3Q96A 5L3AA 2UW0A 3LQ8A 4ZOGA 4NZWB 4I21A 2BROA 3GC9A 4LRMA 4MNFA 4ZJIA 4C62A 5IMEA 2ZDTA 3KGAA 2GHLA 2OBJA 3NNWA 5HVJA 3W10A 3ZLXA 2QOHA 3LCDA 1UU3A 4P4CA 4ZSGA 3DJ5A 2BZJA 5TO8A 3NVMB 4O4CA 1G3NA 1JVPP 1UU8A 4KAOA 3OCSA 4BBFA 2XEYA 4RLKA 3LIJA 2QOBA 3AC5A 1Q99A 5CVGA 1ZOHA 3SX9A 5J79A 4JDKA 1R39A 3R1YA 3QC9A 2C5YA 4Y95A 5CWZA 3U55A 3PTGA 4CKIA 3MH3A 4HGTA 4L43A 3D5VA 4A07A 2YM6A 5CENA 1JWHA 4DTKA 4D9UA 3JVSA 5CXHA 4O7LA 1XH6A 3GCPA 4O1OA 2J5FA 4YJNA 5C9CA 3FSFA 2YFXA 3DB8A 4FTCA 4XG2A 5CEMA 3ATTA 3R7UA 3D2KA 5CEOA 2OJJA 2QD9A 3E8NA 2V62A 4FKPA 4RJ8A 5HG5A 4FSUA 1RJBA 1RQQA 2IZTA 1B39A 1W98A 3ALNA 3FJQE 3EQCA 2ITUA 3QUEA 2GFCA 3HMNA 3KIOC 2XNBA 3RK5A 4B0GA 3FBVA 4F7LA 4R3PA 1MRYA 4NL0A 4R5SA 1F3MC 2WTCA 4EOPA 3UO5A 1AQ1A 2I6LA 3DNDA 4G5JA 4QMOA 3AC3A 3QWJA 4AT4A 5F9EA 1Q24A 4UYAA 4HZRA 2UW8A 4RJ4A 4NH1A 3THBA 3WF5A 4UWBA 4NJDA 4ENXA 4JDIA 3FQSA 4JG6A 1KV2A 3DOGA 3OXZA 4YP8A 3QTWA 4UZHA 3UVRA 3H9RA 2O8YA 5B2KA 3AKKA 4YJTA 3U6IA 4EBWA 3I79A 3OCGA 2PU8A 1YI3A 2OZAB 3S95A 3UBDA 2IJMA 3ZRLA 3UZRA 2PVKA 2QLUA 1BKXA 3RAWA 3A62A 3QX2A 4XRJA 5J9ZA 4TNBA 3OBGA 4KSPA 5CEIA 2HXLA 3DPKA 4FVPA 1QPEA 4WA9A 3R83A 3LFDA 4ASXA 4BY9E 2YIQA 5IDNA 2IG7A 2Y9QA 1SNXA 4FKRA 4GJ2A 3A7GA 3D5XA 3RP9A 3OXIA 5EQYA 1U46A 4BR3A 2O3PA 2CJMA 4ZTMA 3G2FA 4E26A 4QMPA 4EJNA 5AV4A 5E1EA 4QP1A 4R78A 2OJGA 3RBWA 1WVXA 4TN6A 4PRJA 4FRFA 4PTEA 4BI2A 3ALOA 3OY1A 5BVWA 5L2SA 5M4IA 4MX9A 3UZPA 4I3ZA 3D14A 4RGJA 4D5HA 3TUDA 5HVYA 2YIRA 2Y6OA 1WBVA 2B9HA 3KY2A 3KK8A 4EZ7A 4O7WA 2P55A 3ORKA 1OM1A 1W8CA 4TRLA 3WI6A 4RMZA 4YGAA 2NRUA 3PFQA 4QO9A 4MBJA 1HCLA 3QL8A 3ACJA 4QP2A 5BMSA 3PDTA 4WBOA 2RFDA 5E8SA 4USEA 4JQ8A 3C51A 1GY3A 3F69A 4DT9A 5EHYA 3DAEA 3KMWA 4LUDA 2DS1A 3KVXA 2OH0E 1YQJA 4QTAA 4TPTA 3E8EA 5LCKA 5FQDC 5HIEA 2GTMA 4FT5A 3Q4TA 2YWVA 2W99B 3NZ0A 3KL8A 2CHLA 3HRBA 2X39A 3BZ3A 3ORLA 2C1BA 4BCPA 3KU2A 4ACDA 2X1NA