4M67A

Crystal structure of the human mlkl kinase-like domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
278
structure length
264
Chain Sequence
QIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKDLTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mixed lineage kinase domain-like protein
publication title Structural Insights into RIP3-Mediated Necroptotic Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 85
structure length 264
sequence length 278
ec nomenclature
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4m67A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4m67A01
1SNXA 4XHKB 2A19B 3R2BA 5AV1A 2I40A 5E8ZA 4HW7A 3VUMA 1WVXA 2UZVA 3IW4A 4J1RA 3KN6A 4X2KA 3ROCA 4AT4A 5LCJA 5FTGA 2A1AB 3I81A 4CEGA 4N57A 2CN8A 4FV9A 4FKOA 5M56A 5B2KA 4GK2A 4QTCA 5L6WL 1M2RA 1WBPA 2ONLA 1MUOA 2CLXA 2ITUA 1OL5A 2WQNA 2XNOA 3OC1A 4ID7A 4YJNA 4JBPA 4BGHA 4HGSA 4O82A 4YPSA 3QTZA 4UWYA 2PHKA 3VS2A 3ZO3A 4QP8A 5J9ZA 2BFYA 2ZVAA 3HRFA 4I5PA 3PTGA 3TTJA 4USEA 4NCTC 4OBQA 2HAKA 4RVMA 4JR7A 3I0OA 3FI3A 3ET7A 3GU8A 4IAKA 4O0TA 1ERKA 2XZSA 3I5NA 2HZNA 1YOJA 2JD5A 2NRYA 4YLJA 5L2SA 1XKKA 2B55A 1YQJA 5JH6A 4QPSA 4EH5A 1JBPE 2Z02A 4BFMA 2R0IA 4YJVA 3V5TA 3QQGA 3G2FA 1GIJA 2VD5A 2XIRA 3Q6WA 1S9IA 2F4JA 3O8UA 3IK3A 5CAOA 5TR6A 3GI3A 1WBNA 4FC0A 4KNBA 5EM6A 1STCE 4AOJA 3RMFA 3B2TA 4O0XA 5CXHA 4I3ZA 2W5HA 4F9YA 5JT2A 4G6NA 4O7RA 3TG1A 5CNOA 3R1NA 2V5QA 3LIJA 5FDPA 4U81A 2UZOA 2R3FA 4FNWA 2CGVA 4TYHB 3UMWA 3ZCLA 4AW0A 4C4EA 1IA9A 2Z2WA 3ZLXA 4YZDA 4QMWA 3U55A 4DC2A 2JKMA 4WUAA 2B9FA 3R30A 3LZBA 2VWZA 4BIDA 4HCTA 4RX7A 1Y8GA 5CANA 3CIKA 4FTLA 4BDCA 2J0KA 4IXPA 4EBWA 2UZWE 3DK3A 3EL8A 5CF8A 3NMUF 5HHWA 5K5NA 1BKXA 4Y5HA 3QQFA 2PVYA 2C6OA 5CAUA 3ZC5A 4DFUA 5AAGA 2EVAA 1Y6AA 1YXVA 2Y4IC 3S0OA 1Q8TA 3T8OA 4S30A 4YPDA 2BZKB 2NRUA 4USDA 5HVKA 4A06A 4NW6A 5KZ0A 2CNQA 1XH8A 4K2RA 4HCUA 4XYFA 5AWMA 3ID6C 3LXPA 2ITYA 5M4IA 2HWOA 1O6LA 5FBOA 1ZARA 3FZSA 1NT2A 2RGPA 4IB0A 3E8NA 4A9SA 3LCSA 4AS0A 2BUJA 2XF0A 1UVRA 3G5DA 3TXOA 3QWKA 3IO7A 3DZOA 5HLWA 4U9AA 3BHHA 2R7BA 2WTCA 4BTJA 4U42A 3KMWA 4LYNA 3ZZEA 4ALVA 4Z9LA 3U6IA 3VW6A 4JIKA 4YBKA 3TJCA 3IKAA 1TKIA 5DI1A 5TF9A 4BKJA 4BZNA 5IISA 2VUWA 3R8VA 3QUDA 4WRSA 2JFLA 3FI2A 3SW7A 3VN9A 3DBEA 2XRWA 2XNEA 2P2IA 3LFQA 3S2PA 2VWVA 3D9VA 3MFTA 3HMMA 3PXFA 5DT4A 3UC3A 3U4UA 2GS7A 2IVSA 5A4LA 3KULA 4FTNA 2C5VA 2BALA 2WOTA 4BDGA 5IQCA 3PSDA 1IEPA 4GSBA 4KABA 4JJRA 4EORA 4H58A 3EH9A 5HG8A 1ZYCA 4IC7A 2YIWA 3FBVA 3IGOA 3SOAA 2IW9A 3DY7A 4A9RA 1GZ8A 4D4SA 3TUBA 1G8AA 2R3QA 5KNJA 3R02A 4JI9A 5D41A 3TNHA 4WNPA 5CT0A 3TKUA 4J53A 3DS6A 3QX2A 1JOWB 2F7ZE 4IEBA 4RIXA 1H1WA 1M17A 1ZOHA 5AP1A 3PDTA 4QTDA 2FH9A 3L9MA 3TKIA 2WMRA 4MXXA 4QNYA 3DDQA 2CGUA 4G9RA 4J97A 3ETAA 2VV9A 5C1QB 3NEWA 5EQEA 3T3VA 3PWYA 3V5PA 4DEEA 4I5MA 3MI9A 3LXLA 4L6QA 3LM0A 3RCDA 5IQHA 2CMWA 1R0EA 2EUFB 5J7BA 4RFMA 4UMTA 4ZMFA 2E9PA 3Q3BA 3QWJA 4IAAA 4YMJA 4DA5A 2W05A 4ZZOA 5AUVA 1YWVA 3ROYA 4O83A 4HYHA 2C5NA 3F3ZA 4G3GA 5GINE 3EN4A 4LQMA 4QQTA 2J6MA 3FKOA 3UVPA 1H28A 4MK0A 3VF9A 4BBEA 2QO7A 1A06A 2UZTA 4P2KA 4AE6A 3FXWA 3NCGA 3BELA 5FWKK 4QYYA 3TUDA 4F1MA 5AM6A 3WZKA 1H1QA 4EH3A 2O8YA 3Q52A 1QCFA 3P7AA 4L44A 3BU5A 5BYZA 3SXFA 2XKFA 2JDVA 2PMIA 3G0EA 4ERKA 3EZRA 4RVKA 4IFCA 2YWPA 4RFZA 2P3GX 4M3QA 4ANQA 3RAIA 4EK8A 4F1OA 3D2KA 1RE8A 2BIYA 4H39A 1H01A 4MKCA 1YI4A 4O38A 3DDPA 4G3FA 4BICA 3R9DA 4C57A 3B8RA 5EKOA 3W33A 5KX8A 3IPHA 3QLGA 4EOJA 4HVSA 3ERKA 1OKYA 3GNIB 4LI5A 4KBAA 4OTRA 1O6KA 4YBJA 4AA5A 3IOKA 5BVDA 1YWNA 2UVXA 5IQDA 3OWLA 5FEQA 2J5EA 4TTHB 3MB6A 2VTOA 2OW3A 4CFUA 5E8YA 1KE9A 3UG2A 2PWLA 3ORIA 4PL5A 2P4IA 3ELJA 3IW8A 5DR6A 3OUNB 4ENXA 4LL5A 2XBAA 1REJA 3EQBA 3R73A 4FSMA 4YTHA 3SC1A 4F6UA 1OGUA 4HYSA 5JRSA 3MPAA 4ACMA 4YTIA 2P55A 2RIOA 2HWPA 2ETKA 4UV0A 4J8NA 3O17A 3MH0A 3AC1A 4JRNA 2XKCA 4XP0A 2BTRA 3CQEA 3D5WA 3EQDA 4FF8A 1UNHA 2XH5A 4H36A 4KIKB 4E4MA 2OSCA 4EHGA 4HGLA 4F7NA 3IOPA 3LCOA 5T3QA 4IZ5A 3BLQA 4G5PA 3H9OA 2X9FA 3MGYA 5J79A 4IWQA 3QD2B 2R3GA 3DK7A 4O91A 1H1SA 4JIAA 1M52A 2Y7JA 3F3UA 2Y8OA 4Y73A 4RJ6A 5AUWA 3LQ3A 1SNUA 1OL7A 2BZHB 3F88A 4J98A 3PXRA 2F2UA 3RAWA 1YVJA 4GG5A 3HUCA 1LEWA 3N9XA 3O71A 4A4XA 1ND4A 4YJUA 4AU8A 3OZ6A 5KMJA 4U3YA 4JNWA 3R63A 4IM2A 3E8CA 3DPKA 3ZZWA 4BY9E 2C6KA 3EFWA 3K2LA 2PE2A 5AJQA 1OI9A 2HYYA 5J9YA 3V5LA 1OKWA 2ZV9A 2WIPA 4IVDA 4FIJA 3PPKA 4CYJA 4F6WA 3SVVA 5EQPA 4PNKA 4CT1A 3ZRKA 2OZAB 3NVMB 5H8GA 2C6EA 4NU1A 3Q53A 4RFYA 3NNWA 4DTBA 2OIDA 4FKUA 2YFXA 4F7LA 1H0WA 5DLSA 4BBFA 2C68A 5I9ZA 5AUZA 3DAEA 3VBTA 2CHLA 2OGVA 4U7ZA 2X2KA 4G17A 1UKHA 3B2WA 4XOYA 1U4DA 3HDMA 5AR5A 5HIDA 4PMPA 4KIOA 5A6NA 4AT3A 4WNMA 2O0UA 3W2RA 3DFAA 4QMQA 3C50A 5A4TA 3SHEA 4U6RA 4GK4A 4I1ZA 4RG0A 3R8MA 3V5QA 3VUHA 4E5AX 2DQ7X 4QMMA 3NAYA 3FPMA 4YJRA 3DB8A 1B6CB 4EHEA 4J71A 2IG7A 2XP2A 5KBQA 1OECA 1M7QA 2HZ0A 2IN6A 5CSXA 2XK7A 3KXZA 4EH2A 2IVTA 3P86A 2V7AA 5HD7A 4H1JA 4L01A 1O6YA 5LOHA 1Q61A 3A2CA 4NKSA 2Q83A 4PNIA 5EW9A 4CD0A 3NYOA 5BMSA 1B38A 3RWQA 3VS7A 5BUJA 4RPVA 2X0GA 3GENA 3VW8A 1DI9A 3R9HA 3IW6A 1F3MC 3HV3A 3MIYA 5LVLA 2PE0A 3KCKA 1GNGA 1U54A 2GQGA 2WMSA 4QMUA 5CI7A 1S9JA 2QKWB 1H4LA 2BDFA 1NXKA 3QKMA 2O5KA 4G3CA 2JDOA 3F69A 1G8SA 4ZP5A 1V0BA 5BVKA 3MFUA 4YLKA 4DFZE 3AT3A 3HDNA 4EH8A 1ZOEA 4HOKA 2YEXA 4KD1A 3UODA 2OWBA 3VJNA 2GNIA 1H27A 4ZZMA 4EZ3A 5BPYA 2C0IA 2J51A 4WHZA 3A60A 4B0GA 2Z7SA 5AR2A 4K1BA 1URCA 3BIZA 4K77A 3QF9A 4FIHA 5HTBA 2XRUA 2YM7A 1XWSA 1F0QA 4FSWA 3L8VA 3QTIA 2OH0E 4HPUE 5CT7A 3S1HA 1R1WA 2IW6A 2X8DA 5IZFA 2ZYBA 4S32A 5I9WA 4BCJA 5ACKA 5JGAA 4BDHA 5HG7A 1A9UA 2ONLC 3WE4A 4KS7A 4D2SA 3FMHA 4MWHA 4A07A 3RK9A 5DGZA 3R1SA 3D7TB 3Q5ZA 3NIEA 4HGTA 1PMNA 4F70A 1CKJA 4O7TA 4O0SA 1ZWSA 3H4JA 3GQIA 3VBYA 2W9FB 4AW5A 2QU6A 4V05A 2Z7RA 4JBQA 4NKAA 1YDSE 3BV3A 3ZO2A 2GHGA 2YCFA 5EM7A 4AWIA 2C6MA 1HCKA 4O0VA 3DKFA 4QYGA 3VVHA 2VTPA 2QVSE 4K33A 1IAHA 2OFVA 2QOBA 3UNKA 4NM5A 3OW3A 3ZFXA 3BBWA 4H3QA 2PVHA 2RG5A 2PULA 3E63A 1JPAA 1TQMA 5T68A 3WF7A 4D4VA 3GC8A 4L53A 2X9EA 1W98A 2X8EA 3GBZA 3Q9XA 3QX4A 4O6EA 4BCHA 2XS0A 3A7FA 3HYHA 3LCKA 1OITA 1Z9XA 4J99A 2HW7A 2W5AA 2RFNA 4ZTQA 3FJQE 4L67A 3RVGA 4JT3A 3L8XA 2ITZA 2ZDTA 3O0GA 4ARKA 4WRGA 3RJCA 4R7BA 5CSWA 3DBQA 2UZNA 4A7CA 1NA7A 4FL2A 5L8JA 5AV4A 1JKLA 4H3BA 5AIKA 1JVPP 4CLJA 2IZRA 3Q6UA 4O27B 4CFVA 4RWIA 5DH3A 2E9OA 4IBMA 4EOKA 2QURA 3L1SA 2WKMA 3ENMA 3DFCB 2G2FA 4EH9A 5KO1A 2B7AA 2UW6A 3FMEA 2B52A 1KWPA 5AADA 4ANLA 4EI4A 3PVGA 3OHTA 4WT6A 3PVBA 3R6XA 2FSLX 2ITTA 3L9NA 1Y57A 4HYUA 4KKGA 3KVWA 5ETFA 4FEVA 2X7GA 2BDWA 3NZ0A 4IH8A 2LGCA 4RMZA 2BROA 4BB4A 2XK9A 5CENA 4DT8A 3HMPA 3R8PA 4C4JA 5FQDC 3A7GA 4L7FA 5I3RA 4J95A 2IVUA 5TE0A 3D94A 5KCVA 3BV2A 1VZOA 2CGXA 4EOOA 3BQRA 5K4IA 3EQGA 3W2CA 4GRBA 3QHRA 1MRVA 2C0TA 3RPYA 4Q9ZA 5L3AA 4FTJA 3A99A 4LOQA 4UB7A 2XNPA 1L8TA 2QONA 4DG2E 4EJ7A 2YJSA 3SQQA 5A9UA 3COIA 5E1EA 4DN5A 1QPJA 5C9CA 2O64A 4KINA 3PXQA 3HEGA 3R1YA 3NR9A 1U46A 2ETRA 1SVHA 4GV1A 3TI1A 3O7LB 4FYOA 5DA3A 4YHTA 2I0EA 3ORPA 4L3PA 5HESA 5ANDA 2XNNA 3M2WA 4OTPA 2QOQA 2WMWA 3E92A 2XM9A 3H9FA 2QR7A 3BRBA 3R22A 4ZJVA 3FLZA 3PE2A 4G16A 4D9UA 2FSMX 2XYUA 4Q5HA 2XKDA 2JBOA 3OWKA 4I6FA 5JZNA 3LJ1A 3SRVB 1DAYA 2X8IA 3CTHA 4EWQA 4IJ9A 4FGBA 3CJGA 5CY3A 3TTIA 3R04A 3SG9A 1IRKA 3QQUA 1CTPE 1AD5A 3UNJA 2UW8A 4GS6A 2DWBA 1BX6A 3G6HA 3V5WA 4HCVA 3AD6A 1KOBA 4I5CA 5T6KA 5EDPA 3WZEA 4M97A 3O23A 4L42A 4W9WA 1FOTA 4WIHA 3PG1A 4DBXA 1MQBA 2W1CA 3T3UA 3UIXA 5KKRB 3WI6A 3C4WA 4XS2A 3Q96A 2YM4A 5GIOE 4QYHA 3KF7A 4LGHA 3UIUA 4IAFA 5FDXA 4RVLA 2BKKA 1PXIA 2XMYA 3MIAA 5C4KA 2J0IA 4DF3A 3KL8A 3U6JA 5JZJA 4JRVA 5CVHA 1Q99A 5DR2A 4HZRA 2OZOA 3RM7A 1BL7A 3W8QA 5HE0A 3QUPA 2W06A 4BHNA 3F61A 1JSUA 3NLBA 4RIWB 3BHVA 4YZNA 4F9AA 4U0IA 3FMMA 3K3IA 4IX5A 4X6QC 1MP8A 3MH2A 5AEPA 5KHXA 4RIYA 4PDOA 3V5JA 5CEKA 4FT9A 1BL6A 4UXQA 5HIBA 2I0VA 4MBIA 4FTIA 2C5OA 2IWIA 2JKKA 4B8LA 2JDRA 4XP2A 5EQYA 3BX5A 3Q9ZA 4FKRA 4MBJA 2FVDA 4NK9A 4X3JA 2BCJA 5AMNA 3HP2A 4BI1A 2PVRA 2IW8A 4FEWA 3EB0A 1WBVA 4LGGA 3V8WA 3A7IA 3PJ1A 4DEDA 5KMMA 4UXLA 4X2FA 1CKPA 3CLYA 5H8EA 5EI8A 3ZBFA 4QMZA 2EB2A 5LCKA 2PZ5A 3OCGA 1NY3A 2YABA 3F66A 4R6VA 5FBNC 5GZ9A 4AE9A 1OPKA 3OD6X 3GC7A 4ASXA 3JYAA 3FSFA 1YXTA 2XB7A 2WMUA 3OFMA 5C8KA 1OKZA 1UU3A 5EOBA 5EHOA 2V55A 4X2GA 4DITA 1IR3A 3F7WA 3PJ8A 4L52A 2JAMA 3QZIA 4RVTA 4TKSA 2HK5A 3R01A 4O7SA 2VTRA 3HV5A 5I9UA 4BDAA 3C9WA 2I6LA 1YHWA 2HZIA 3EFKA 3EQHA 4EOLA 4M14A 1B39A 3G51A 4J7BA 4ZTHA 3EWHA 4MXOA 4BTMA 4ALUA 5E8XA 4CT2A 1A48A 5AUXA 3QTXA 3FI8A 4AZFA 3C0GA 1H8FA 1J1BA 4DEIA 3COHA 4FTUA 3FLYA 4TXCA 1IG1A 1Q62A 4C02A 3CSVA 1YXSA 3V3VA 1ZMWA 3HV7A 3ODYX 5E91A 4AAAA 5K9IA 4JQ8A 3NNVA 5CQUA 5C8NA 4MXYA 4QMYA 2YERA 3MY0A 4M66A 5CSPA 1KOAA 5DHJA 4DLJA 3E7OA 5CX9A 3ALOA 4UWCA 4KSPA 4DEGA 5D7AA 5M06A 4M12A 3KRJA 3VUGA 3IDBA 2QD9A 2E2BA 4U97A 4AX8A 5LVNA 5AP0A 5HO8A 3LJ0A 5AP6A 4ACHA 2WNTA 5CZIA 4FZ6A 3NNUA 4LV8A 4BGQA 2NO3A 4R7HA 4FNXA 5KE0A 3REPA 2BAKA 3LW0A 4YJTA 1GY3A 4GUBA 4EJNA 4IWOA 3OG7A 4LOOA 1J3HA 3UO5A 3D5XA 5GJGA 4MF1A 2CKQA 5BQ0A 3OS3A 3NUNA 3DNDA 4DE4A 3H0ZA 4ZOGA 3NIZA 4XG9A 2J7TA 3VS1A 5CF5A 2JIUA 3QTQA 3MESA 3ALNA 2WQMA 2XIKA 1H25A 4FKVA 4I23A 3HKOA 3BE2A 4M8TA 2QLUA 3UMXA 1OZ1A 3FE3A 2BILB 1W0XC 4TW9A 5IQIA 4MH7A 4PP7A 2C6DA 3KRLA 4FKJA 3OOMA 4AW1A 3CS9A 3ZSIA 3A61A 3P78A 3MFSA 2C69A 4WSYA 2PSQA 5IDPA 3BYOA 4L7SA 3NUPA 3RCJA 5CASA 3SAYA 2BRMA 4XMOA 3SA0A 2FSOX 2ITNA 4FE2A 4IZ7A 4RX9A 3PLAE 2FGIA 4EKLA 1ZY4A 3ORMA 3CP9A 4PQNA 5K4JA 3ATTA 4B99A 3R00A 2VX1A 5D11A 3PG3A 4DTKA 5ITAA 2G1TA 4FBXA 5EYKA 2CKEA 3RNYA 2VU3A 2Z7LA 3FUPA 4LRKA 5IG1A 3ANRA 3DKOA 5AV3A 4GT5A 2G9XA 4J52A 3VQHA 3W8LA 1XBAA 2CJMA 3CQWA 1VEBA 4FT0A 2ITXA 1UWJA 2GU8A 4FIGA 3MA3A 3TT0A 1XH6A 1H26A 1CDKA 3KQ7A 4IB3A 3BWJA 1XH5A 3AQVA 3F3VA 4EQMA 2XBJA 4DT9A 1KE8A 2HZ4A 4FUXA 2OJIA 4MHAA 4FV8A 4YJOA 4ITHA 3CJFA 3OCTA 5ETCA 4AZSA 1G5SA 3AD5A 3AC3A 4JL9A 4K6ZA 4C37A 4CLIA 4NEUA 5K0KA 3L8SA 4YUQA 4CRSA 1Y6BA 4PF4A 4YNEA 3QGYA 3P79A 2F9GA 1GIHA 3DTWA 4KAOA 5H2UA 5M53A 2UW5A 4HGEA 5FG8A 5JGBA 4TYHA 5LWMA 1FPUA 5ANJA 3OT3A 3DB6A 3QA0A 4QTBA 3ZSGA 4CTBA 3NUAA 4RWLA 3OVVA 3F6XA 5L2TA 2BHEA 4UZDA 2OFUA 1H07A 4O96A 2P33A 3IGGA 3HV6A 2I0YA 3G9LX 3PRIA 4EK6A 2WTKC 4YTCA 5KMOA 4FT5A 2WU6A 1O9UA 2XCHA 3FWQA 2W9ZB 5DYJA 3FL4A 3QQHA 3PZEA 2PMLX 3WF8A 5BX0A 3LFBA 4O1PA 4QYEA 5H8BA 4O7VA 3PSCA 5AAEA 4HVHA 3C5UA 3VBWA 5A14A 4FOCA 4KWPA 5DT3A 3TWJA 3EJ1A 4FSNA 4QMXA 4UALA 5LARA 4W4XA 5J5SA 4N4SA 3UNZA 1KUTA 4PMSA 3FC2A 2XJ2A 1FGKA 2Z60A 5DMZA 1Q3DA 3FYKX 4LM5A 3UTOA 1KE7A 2J5FA 4U45A 2CSNA 1YKRA 2WU7A 3HAVA 1JSTA 2Q0BA 4XEYA 5L4QA 1OVEA 4Y85A 1FINA 3AMBA 5BUIA 3MDYA 3ZUVA 4MF0A 1GJOA 4JDJA 2V0DA 5J87A 3LMIA 1T45A 4XV1A 3QQLA 1PF8A 4FV2A 1KE6A 1IA8A 4RGJA 3VIDA 5ETIA 4EH7A 4ZY4A 4Y95A 3F5UA 3EQPA 2UVYA 2PMOX 3GOKA 4Y46A 5KBRA 4G34A 3I6WA 2PUIA 3O96A 3LFFA 2V62A 5HG5A 2R3PA 4V04A 2VRXA 3RPRA 2JDTA 3U87A 4UEUA 3OP5A 3OBJA 3GCUA 4F9CA 3OXZA 5DNRA 3CPCA 2XK6A 4F6SA 4EONA 2HW6A 3G33A 3UG1A 3A7JA 4QQCA 3C4ZA 3K5UA 4N6ZA 3Q9WA 4LRMA 3K5VA 3MSSA 5I9YA 4GCJA 2G2HA 3BE9A 4AFJA 3HNGA 4C0TA 5LWNA 3TNQB 3CPBA 4IX3A 4CKRA 1VYWA 2YM5A 2FA2A 2F7EE 2XUUA 4HNIA 5F4NA 4IWPA 3RAHA 3QL8A 3DKGA 3A7HA 2QOFA 4FVPA 4F4PA 3EHAA 5AR3A 3ZMMA 5M08A 4ZZNA 3U6HA 5EH0A 4OLIA 3O2MA 3FC1X 3UYTA 3EQFA 4YC3A 1L3RE 4ZTNA 3OEFX 3R7VA 5HZNA 4W4VA 2SRCA 2UW3A 2WMBA 1SMHA 1HOWA 3GC9A 3PJ3A 4NTSA 5EHYA 3P1AA 4KA3A 3F5XA 4BN1A 4C38A 5GJFA 2H9VA 3ENHA 5FXQA 1PXMA 4RZWA 2O2UA 5HG9A 4D58A 3LMGA 3W2SA 4R77A 4K11A 1UU7A 3PA3A 4BCFA 3JR1A 2X6DA 3OCSA 5GNKA 2DUVA 1M2QA 4D0XA 4L46A 5M51A 4NIFA 2QC6A 4QMPA 4FKSA 3KRXA 3KXHA 4AZVA 3OUKA 4ANNA 3EMGA 3AT2A 3FQHA 4I0SA 5EDQA 2HOGA 2I7QA 5JMSA 2WQBA 2R3MA 5HI2A 1U5QA 5CU3A 3WBLA 3UE4A 4TRLA 3ZRLA 2X39A 4G6LA 4FNYA 4RIXB 5LMBA 4FG9A 3ZRMA 3HA6A 4OTGA 2GQSA 3QFVA 5IMEA 3QZFA 4FG8A 1CKIA 4O21A 1BI7A 3ZDUA 2RSVA 1WBSA 3LQ5A 4PL4A 3FMJA 4JOAA 4ITJA 3KXGA 5K5XA 2VTLA 2B4SB 4E26A 1MRUA 5M44A 4P5ZA 3C4XA 1JKKA 3PY3A 4K9YA 5DEWA 1GZKA 2PZRA 3KY2A 3C4FA 3OF0A 5JQ8A 4XV3A 1YWRA 4L45A 1Q3WA 4NWMA 3P7CA 4W4WA 5CQWA 3IW5A 3THBA 4CVAA 4TY1A 1PXNA 4D4RA 4RQVA 2VGPA 2JFMA 4QP2A 2WMVA 3FKNA 3ZFYA 4XV2A 4GMYA 4DFNA 5ANEA 1LUFA 2QHMA 2ZM1A 1P5EA 5DR9A 1JQHA 2XYNA 4PWNA 4M0YA 3TZ9A 5E8UA 3CTJA 5CEQA 4UMUA 5LQFA 5AR8A 4JLCA 3IQ7A 4QP1A 2OKRA 3PYYA 3WARA 5BVWA 4GT4A 3CTQA 3L9PA 5HEZA 2PU8A 4KIKA 2F49A 3P5KA 2VWUA 5EM8A 3UP7A 3PPJA 3WF9A 3U9CA 2QNJA 4N6YA 1WVWA 3PY0A 3FL5A 2X7FA 4F99A 2J4ZA 2UUEA 4MEDA 4ZTMA 5CU0A 3PP1A 3TIYA 2PVMA 2QCSA 5IH5A 3QCYA 5FLFA 2OJGA 3R0TA 4I41A 4MNFA 2QHNA 4L68A 1ATPE 3DQXA 1YW2A 5J9LA 2UW4A 1OIQA 3BEAA 3DNEA 4ZXTA 4ZEGA 4EK3A 3QC4A 2JLDA 3CXWA 4LG4A 1ZMUA 4ITIA 2G15A 3AC8A 5M4CA 3SGCA 3FSKA 1V0OA 2C1BA 5HTIA 4EEVA 4BCQA 4F9BA 2CNVA 4MTAA 3QCSA 3QUEA 3C1XA 3OEZA 2C30A 4MD9E 4YZBA 2WTIA 3S00A 2JIIA 3AC4A 4JDKA 4BGGA 2PZYA 4WNOA 3H3CA 2WB8A 4U8ZA 3ZS5A 4AW2A 4FZ7A 4B6LA 2QO9A 4M68A 5F1ZA 3TZ8A 1XH7A 4RJ5A 3EFJA 3ZFMA 4GKHA 2B9HA 2PVJA 3E3BX 3HRBA 3OXTA 4GU6A 3CD8A 4W9XA 4O2PA 2VO3A 1UU8A 4MAOA 3FLSA 4EWHA 3E64A 4AA4A 4AFEA 2QQ7A 3BHUA 2PE1A 4BC6A 5JRQA 3V01A 5EK7A 3UDBA 4LMUA 4UY9A 3DT1A 1W84A 5D1JA 3I6UA 5JFVA 3TCPA 4IHPA 3HV4A 4S34A 1YDTE 3PJCA 3W18A 2PUPA 3UIBA 3RBWA 3RGFA 4F09A 3Q2JA 2XJ0A 3FDNA 2WFYA 5B7VA 1OM1A 4LUDA 1R3CA 1YI6A 3M1SA 4B4LA 4BRXA 5F20A 2O65A 4O22A 2WTJA 2OXDA 2BAJA 4IDTA 4MXZA 3ATSA 3UQCA 3BHTA 4WUNA 2X7OA 3FKLA 4DTAA 3JPVA 3F2AA 2J0JA 2R5TA 2B53A 5CVGA 4ACGA 5AV2A 3FPQA 2H6DA 2AYPA 3I5ZA 4JX3A 1J7IA 5EYCA 4ZTSA 4DH3A 4X3FC 4BL1A 5AAFA 4ASDA 3LQ8A 2I0HA 3POOA 3OMVA 4UYAA 5A4EA 5JK3A 2BAQA 4NT4A 2ZAZA 1H1PA 5HNGA 3F5GA 3QKLA 3L9LA 1E1XA 4KSQA 1QPEA 3ZXTA 3N4UA 1FMOE 3JY9A 3MW1A 4AQCA 5H3QA 4DAWA 3QRKA 3TNWA 2RKUA 4R78A 3DBDA 3NUUA 5CNNA 4TYIA 4ANBA 3DTCA 5IUIA 2YIXA 2QKRA 3R2YA 2PMNX 5I9XA 1YXUA 3VS3A 4ZSGA 1OIRA 2X2LA 2XNGA 4L00A 4FGRA 1P14A 4PTGA 1YI3A 5TOZA 3TJDA 3VBXA 5KMKA 2YAAA 4IM0A 4D5KA 4MCVA 4DG3E 4USFA 3NYVA 4PL3A 5EYDA 3G6GA 3PSBA 3HRCA 3AC2A 3BLHA 4QP4A 5JEBA 4EYJA 2AC3A 1OBGA 5A4QA 3FV8A 4QP9A 4C36A 3AC5A 3DQWA 1ZLTA 3RHKA 4C2VA 1U54B 4UX9A 5CALA 2CNUA 2YITA 2W1EA 3D7TA 4OBOA 5FP6A 3ZEPA 5IMXA 1X8BA 5DPVA 4UBAA 4KB8A 1QMZA 4AXAA 4JDIA 5G6VA 4DFLA 1GZOA 2W1IA 4R3CA 1MRYA 3HZTA 5TO8A 2WMAA 5IA5A 4L3JA 1P4OA 4AZTA 3VWAA 4D28A 4R5YA 3FMLA 1SYKA 3NNXA 3LHJA 5DVRA 3Q4CA 4C59A 1P2AA 2XM8A 2C0OA 2YIYA 5BMMA 3ULZA 5C4LA 5L2WA 3VAPA 2EU9A 4ZIMA 3BYSA 3PIXA 2GS6A 4OR5A 3QRUA 3RZFA 2GHLA 4QD6A 3MVJA 3TM0A 3EQRA 1QL6A 1NW1A 3LFCA 3N4VA 2WMXA 3LLAA 3BHYA 1GIIA 3GFEA 2JKQA 2YISA 3PLSA 2R3OA 5IEXA 3WZUA 2C3LA 3T9IA 3EFLA 4EK4A 3LJ2A 3WIGA 2F7XE 3W10A 2EB3A 3VS6A 4D9TA 4RIOA 4CYIA 3LCDA 4FSRA 4BCGA 2ZJWA 5ETAA 4FVQA 2H8HA 4FNZA 3DLZA 3HMNA 4JX7A 3VO3A 2IPXA 5IQEA 5AP7A 2PK9A 4TYJA 4PDPA 4XG6A 2GS2A 1URWA 3HVCA 3MFRA 4IADA 3PA5A 2PVKA 2J90A 2Z7QA 2XK4A 3IW7A 1SVEA 2OJ9A 4LRJA 3LCTA 4CFWA 5E8SA 4ZMEA 2Y4IB 4YO6A 4Y83A 4BVUA 3RM6A 1KV1A 3DLSA 2B0QA 3MVMA 4RLLA 3HP5A 5IA0A 3DU8A 4R1VA 5FD2A 2ZDUA 3ZU7A 5KHWA 3GFWA 3C4CA 5BYYA 2WELA 4ZK5A 4G3EA 1NVQA 4LFIA 1PJKA 2LAVA 1Q8WA 3ZLWA 4I6QA 5J95A 3ZO1A 2OU7A 3FHRA 3ZO4A 3E87A 4E6CA 5B2LA 1SZMA 5IQGA 3A62A 2WQOA 2QU5A 3FY0A 5CSHA 4TL0A 5FXRA 3V51A 4GYIA 2GQRA 3KXMA 3Q9YA 4C3RA 3I0QA 4XX9A 3FXXA 3AMYA 4IANA 4C3PA 2Y0AA 2RFEA 3R7IA 3QCXA 4KIQA 4F1TA 2ZB1A 1UA2A 4HVDA 5KUPA 5CYIA 4GIIA 4G9CA 3KU2A 4IJPA 2VTTA 2X4ZA 3L8PA 2YN8A 4NH1A 4APCA 5CF6A 4UYNA 4H05A 4YJPA 4W4YA 4FSTA 4FV5A 5FP5A 3CBLA 4BCIA 4JG8A 1NVRA 4TT7A 4F7JA 4M15A 2CLQA 4O0WA 4AZWA 4F7SA 3EKNA 4AGWA 4WG3A 2PUNA 3HLLA 3PPZA 3QHWA 3BZ3A 4RA4A 3R7YA 5AA9A 3UYSA 3WILA 1YDRE 1GAGA 2VTNA 3WOWA 1H08A 5C03A 2CCIA 2YZAA 3AT4A 2GFCA 3UQGA 3SRVA 4RBLA 1R78A 3N51A 4D0WA 5L8KA 3MPMA 1GOLA 5GHVA 3MTLA 3QKKA 2NPQA 3PY1A 2BMCA 4YR8A 1I44A 3UZRA 2BHHA 3OTVA 4IQ6A 4C2WA 4BKZA 2BPMA 1W83A 3FZRA 4RX5A 3VBQA 3NW5A 3VNTA 3EQCA 4QMVA 2BKZA 4DYMA 2C6IA 3H10A 2B9IA 2DYLA 3Q2MA 2WTWA 3R7GA 2QOKA 3QALE 4QO9A 2UZBA 3IS5A 3FY2A 5CSVA 1JLUE 2F57A 2FUMA 4IFGA 5LMAA 2YAKA 4NM7A 1J7UA 3W2PA 3DXNA 3TZMA 5GZAA 3QRJA 2JKOA 3KXNA 5ANKA 4DCEA 3BEGA 2CPKE 2QOHA 3DJ5A 3NUYA 4FIFA 4DBNA 4O84A 3QCQA 4HNFA 4RLKA 2X1NA 2IVVA 4D2TA 4PV0A 4FTMA 4RRVA 3G0FA 5A54A 3ORZA 4JVGA 2UZEA 3F9NA 4FMQA 4ORKA 5A46A 3S95A 4CQGA 3WZDA 3JY0A 4FSUA 1UV5A 3PFQA 2GDOA 4XH6A 1W7HA 1YRPA 5FXSA 2WTDA 2PZIA 3GVUA 4EUTA 3ZONA 3AGLA 4ZLOA 5BVFA 5JFWA 3FHIA 2J0LA 3FMNA 3GB2A 3QBNA 2ETMA 2ITWA 1WFCA 3WYYA 5M57A 4ZSLA 4DH5A 3OBGA 5HBEA 5AR7A 4C3FA 2GNLA 2WQEA 2OK1A 5J5TA 1PXKA 4TN6A 3R71A 4XV9A 1OKVA 4M84A 1U5RA 4UZHA 1E9HA 3DAKA 5M4UA 2XK3A 5EI6A 5AX9A 2PVLA 3B8QA 3F5PA 2BZIB 4IVCA 4PMMA 5M55A 2QOLA 3RALA 4BTKA 4CFFA 1JWHA 3WE8A 1I09A 3TV4A 1UNGA 1J1CA 5FTOA 1OL2A 4FA2A 4FV6A 5CTPA 4KBKA 2JDSA 3NUSA 3PJ2A 5CAQA 2W99B 4JBOA 2BVAA 4G6OA 1K2PA 3BGZA 3DOGA 4O6LA 4KRDA 5LMKC 1OPLA 4C7TA 3LFSA 5DN3A 2OIBA 2OI4X 2ZMCA 3VBVA 2WPAA 3RI1A 3FQSA 2W96B 1WZYA 2BIKB 4I4FA 3SOCA 4E8AA 4XP3A 1PMVA 3VRYA 2A2AA 4AGUA 1FVTA 3FZPA 4AT5A 4BBMA 4EOSA 3TDWA 3FAAA 5DFPA 2HIWA 4YNOA 3MTFA 2R4BA 1Q41A 5FGKA 4C61A 2OJFE 5BVEA 5IQAA 3R8LA 4JQEA 3LXNA 3P9JA 4CMTA 4BWKA 2OF4A 5HORA 4ALWA 4XBRA 3AOXA 4YLLA 5CVFA 2VTAA 4WNKA 5CU2A 2W1GA 4M69B 3ZHPC 3RKBA 4BIBA 4V0GB 4D1XA 4G31A 2UW0A 5CEIA 1MQ4A 3UOHA 3F3WA 2WGJA 2W1DA 3HGKA 4FSZA 2XK8A 2OXYA 3I60A 5HE3A 2YIQA 3DGKA 4KIPA 4CNHA 4YHJA 4ONAA 2R3JA 4FTKA 4P4CA 2JEDA 4KS8A 4MNEB 4WOVA 5TKDA 2P0CA 3C0HA 4ANSA 3QA8A 4QTEA 5EFQA 3AMAA 3FLQA 2XIZA 4YSJA 2BDJA 3NUXA 5CLPA 4ANMA 4DFXE 4WA9A 4EH4A 4FV3A 3ZEWA 2GTNA 3PP0A 3WIKA 4R3RA 3PUPA 4BDFA 4BZOA 5HNIX 5IDNA 5FEEA 4ZJIA 3R9RA 3VUKA 3DCVA 4IZAA 3WF6A 3TN8A 4GUEA 5AFVA 4C35A 4X3FA 5DRBA 4Y5QA 2QOCA 4B7TA 3QC9A 3VS4A 4BDEA 4BKYA 4FKTA 4FUYA 5ACBC 2R7IA 1CSNA 3O51A 1WVYA 4XLIA 3O7LD 2PZPA 3SV0A 4CV8A 5AUYA 3R28A 3V6SA 2CN5A 4B9DA 3V6RA 3OROA 3KN5A 4QQ5A 5TT7A 2GNGA 4PDYA 3R7EA 1M7NA 2IZUA 4DGLC 3D15A 3LPBA 2VNYA 3PVWA 4FKGA 5HICA 3OOGA 5C27A 4EUUA 4S2ZA 3O50A 4ZS4A 1UWHA 3I7BA 4CMUA 2VWXA 4AZEA 5F9EA 1Z57A 2W7XA 3NWWA 5J1WA 2E9UA 1PKDA 4PX6A 3KCFA 2W1HA 4Z7HA 4PPAA 3HAMA 4ACCA 4RQKA 1BI8A 5IA1A 2Q0NA 3VQUA 4F0FA 5HCXA 4L43A 2VNWA 4E4LA 1AGWA 2FSTX 3DZQA 4RJ4A 5HKMA 5F95A 4ACDA 3FZOA 4FL1A 4FTTA 4I0RA 2WMTA 3NGAA 4BTFA 1APME 2BRNA 4CTCA 2VWIA 4IB5A 2A0CX 5BVNA 2IZSA 3RWPA 4W8EA 5DWRA 2CCHA 3F82A 4BWXA 4DEHA 5AM7A 1PYEA 3KRRA 3TV6A 1RW8A 4BI2A 4GK3A 4DGOA 3ITZA 3TL8A 4K0YA 1Q8ZA 4PPCA 2C6TA 4L9IA 4RC3A 1ZXEA 2YDJA 4X2NA 1V1KA 3HX4A 2C3IB 3TKHA 5BUEA 4EK5A 2PYWA 2YWVA 4OW8A 3NDMA 5DT0A 1IASA 2ZM3A 1DS5A 4IX6A 5L6OA 3ZLSA 4E5WA 2R2PA 3C13A 1YHVA 3RK7A 4GL9A 3QTWA 3VS5A 4O86A 2C5XA 2OG8A 4IZYA 3BPRA 3MYGA 3RTPA 2IO6A 3D2IA 4GG7A 2FB8A 4D55A 3KGAA 4GKIA 3LMHA 4QMNA 4YZ9A 3FMKA 4JXFA 3H0YA 4LL0A 5I3OA 4YURA 3C4EA 4II5A 5HTCA 5CF4A 3UC4A 2R0UA 5LXMA 2YCSA 3COKA 4MBLA 3ZXZA 3P23A 4QP6A 3A4OX 3FLNC 2YM8A 5D7VA 2QOIA 4CV9A 3KKVA 2AUHA 1Q4LA 2NNWB 2XJ1A 2WO6A 3NRMA 4IIRA 4P90A 5CEOA 5E4HA 4UN0C 3QGWA 5DRDA 4QP3A 3BBTB 3PWDA 4RC2A 2G2IA 2Y6MA 1EH4A 3EKKA 3MN3A 3P08A 3P0MA 4J96A 5EYMA 4W8DA 5B0XA 2HXQA 4TWOA 3FXZA 4AP7A 5AUUA 5CEMA 5GZ8A 4OAUC 3DJ6A 5CU6A 4HVGA 3KA0A 3SLSA 3M11A 4APPA 3POZA 5DE2A 5M07A 3UO6A 1KV2A 3LFAA 4FVRA 3IONA 1PXJA 5K3YA 3KRWA 4YP8A 4C58A 4EC8A 2ZV7A 4E3CA 3NAXA 1WMKA 4FODA 4GJ2A 4FZFB 3AXWA 4PRJA 3NX8A 3FMDA 4DGMA 5HE2A 3LOKA 1FVRA 2WMQA 1WBOA 3RPVA 2CKPA 3TDVA 4ANOA 3VUDA 1BYGA 5FEDA 5L6PA 4G3DA 5AV0A 2C3JA 3O8PA 5DBXA 4DFYA 1Y8YA 1BMKA 2VO6A 5EOLA 3UOKA 1Y91A 4Q5EA 3LE6A 1XR1A 1H1RA 3MY5A 2WEIA 4KUJA 3QZHA 4NM0A 4YU2A 1XO2B 4DINA 3BCEA 3OW4A 1LP4A 4D1SA 2PVNA 2QG5A 2FYSA 2HXLA 2GSFA 2GNJA 4O7ZA 2YLFA 2ZV8A 3I4BA 3SW4A 3KREA 4FK6A 3ZUTA 4I20A 3CE3A 4FSQA 4F9WA 4WSQA 3DA6A 4RX8A 5HNBA 1R39A 4GFGA 4RWJA 2YLEA 3PIZA 3U4WA 2VTQA 4DH8A 2CGWA 2NP8A 2A27A 3EYHA 3HECA 2UVZA 4OT5A 3V8TA 4Z7GA 4O81A 2QOOA 3SG8A 4D2RA 5HQ0A 4FR4A 3H30A 3Q4TA 3IDCA 2VTMA 5E8WA 2RFDA 4OTHA 4KRCA 3MA6A 4IVAA 5IQBA 4QMOA 3G90X 4KKEA 2Y9QA 5HU3A 4KBCA 1VJYA 5D9HA 1QPDA 4JR3A 1OUYA 4QRCA 3TZ7A 4O0YA 2C47A 5HO6A 4Y72A 2CKOA 4C4FA 4YJSA 3UPZA 2J2IB 4F0IA 3AD4A 3OWPA 2X2MA 4ZTLA 3UQFA 4E4NA 4FYNA 4ZLZA 4XJ0A 4IACA 3ZTXA 3UZTA 4I21A 4WBOA 4DLIA 2C5YA 4FICA 4O7YA 3D7ZA 4O7WA 1SM2A 2XEYA 3RPOA 2R3RA 3KVXA 3KULB 4BR3A 4IB1A 2ESMA 3JVSA 4CCBA 1OIUA 3LVPA 5E8VA 1IAJA 3C7QA 5EI2A 3EZVA 3VJOA 4CXAA 2H34A 5IKWA 1CM8A 4C4IA 2UZDA 3ODZX 4UMRA 4JAJA 5AA8A 3LAUA 2VAGA 3E3PA 2XVDA 3D0EA 4FI1A 3MWUA 3ULIA 3UIMA 3GCQA 3D5UA 3MPTA 3Q5IA 3R8UA 4L3LA 3UO4A 4XLVA 4GVAA 2YZLA 5IA3A 3U9NA 2W1ZA 4XG7A 4PTEA 2X6EA 5ICPA 3VRZA 2XKEA 4CZUA 5KKRC 4ZSJA 2CDZA 4D2PA 3W55A 5H9BA 5LVPA 3COMA 4CKIA 1JKTA 3E8DA 4GH2A 1PHKA 4NIFB 4WD5A 2BR1A 5L2IA 4D2VA 1LR4A 2RL5A 3ACKA 4X7QA 4IW0A 1Q8UA 3K54A 4MQ2A 3VUIA 5BYLA 1ZZ2A 2I1MA 2VTJA 2ERKA 4OT6A 2PVFA 4AN2A 4DEAA 4U43A 4ZSEA 1HCLA 2GPHA 4WKQA 3BI6A 4XOZA 3DBFA 4LV5A 1PMEA 2GHMA 3GCVA 5A3XA 5JSMA 4I0TA 2BZJA 4GEOA 4CG8A 3QXOA 5IU2A 4O7LA 3F3TA 5LMKA 5IF1A 4CRLA 1XH4A 2VTIA 3BKBA 4P7EA 3W2QA 5JQ5A 3G9NA 5EHLA 3GCSA 4MXAA 3DK6A 5AUTA 5J7HA 4MWIA 4BHZA 3R21A 4IWDA 3FLWA 4FSYA 2C4GA 1W8CA 2W4JA 2WIHA 5AP2A 4EQUA 4Z55A 3GOPA 1JNKA 3PXZA 1PXOA 2YCRA 4BI0A 1FVVA 4I93A 1ZYLA 1PRYA 3CGOA 2YJRA 2VWWA 2EXCX 4FK3A 3ORXA 4AG8A 3LFEA 4RZVA 3MH1A 4YSMA 4IE9A 3SXRA 4ENYA 1K3AA 2UW9A 1PW2A 4FIEA 4H3PA 4K18A 4PPBA 4U79A 3ZM4A 4C8BA 3CR0A 3UPXA 4OTIA 2RF9A 4AN9A 4EHZA 4LUEA 2XIYA 3UGCA 3EL7A 4A4OA 2OBJA 3QTSA 3RHXA 4O0UA 3ORKA 2KTYA 2ZOQA 2OLCA 2R3HA 4FTRA 4RA5A 1OIYA 2X4FA 5E9EA 5FUTA 3R7UA 4BDKA 3HMIA 5KMIA 4MXCA 4FIIA 3CKXA 3PXYA 2OZAA 2ACXA 4QMLA 3II5A 2AC5A 4CFXA 5ANOA 3IDPA 4TPTA 3BYMA 2WZJA 4XG3A 5CZHA 4IMYA 4DFBA 4TZRA 3OTUA 1PKGA 5HVYA 2IJMA 4G2FA 3SD0A 5EDRA 4F08A 2X81A 2QODA 5BNJA 3OCBA 3MJ1A 2ITOA 2W4OA 4BDIA 4F64A 2W17A 2Y4PA 3CY3A 3EYGA 3KK9A 3BGQA 3QD0A 5DOSA 2YACA 3NYXA 3ZSHA 3GU6A 5J8IA 3HMOA 4FTQA 5JFXA 4GJ3A 4UWBA 3PRFA 3EN9A 5LVOA 4PY1A 5C26A 4XG8A 4RT7A 4YJQA 3NCZA 3EN5A 3QZGA 4E5BA 2BRHA 3PZHA 4WG4A 4NJDA 3U51A 4RC4A 4A9YA 4HPTE 4DH7A 4NYEA 3TACA 4M7IA 4S31A 3KMUA 2VN9A 4PMTA 2QR8A 4EOQA 4I94A 4YGAA 2P2HA 3F7ZA 4BIEA 4FKWA 4O1OA 3M42A 5HBHA 4BCNA 5CXZA 5HX6A 3TNPC 4AOTA 3R7OA 5FTQA 4EKKA 1TQIA 4X6RA 4IX4A 1KE5A 1ZY5A 4V01A 3OY3A 4ASZA 2UZLA 3OWJA 4YC6A 3RAKA 4TWNA 4TYGA 3IECA 5HCZA 3LXKA 4EL9A 3DJ7A 2GNFA 4BCOA 3Q4UA 4FT7A 4ZS0A 5J1VA 3VHEA 3QYZA 4FV4A 2OICA 1UKIA 2B54A 3UVRA 3VULA 3BU6A 1PXLA 1R0PA 2HY0A 4OGRA 4QQJA 2YA9A 2ZM4A 3OT8A 5AX3A 3GT8A 3V04A 5HBJA 2RFSA 4EZ7A 3Q4ZA 5IPJA 1OPJA 3C0IA 1ZYJA 4XG2A 4EOPA 4FEUA 4PTCA 4XCUA 4XUFA 3ZM9A 5JFSA 2W1FA 3D83A 3V8SA 3NVKI 1PXPA 3RPSA 4JBVA 5AP4A 1UU9A 3AGMA 4BYJA 2VZ6A 3PA4A 1J7LA 5CI6A 1XBCA 2V7OA 2PPQA 3Q04A 2B1PA 3LFNA 4O0RA 4XBUA 4E20A 4QNAA 2YM6A 4FOBA 3KC3A 3QRTA 3BGPA 1KSWA 1WBWA 4NCTA 3BWFA 4BDBA 5C01A 2EWAA 4IAIA 4E1ZA 3QU0A 5HVJA 2ZMDA 4RJ3A 2W4KA 4IDVA 4R5SA 4MX9A 5HLNA 2FO0A 5E92A 3QD3A 4EOMA 2YM3A 3P7BA 4DG0E 3FQEA 4EQCA 2VTHA 4XRLA 4FV0A 3CD3A 4D2WA 4E73A 4MD8E 5HX8A 5IEVA 4JS8A 3VF8A 5E7RA 1SVGA 1M14A 4BDDA 1G3NA 4F0GA 4IVBA 4R7IA 1Z5MA 2R64A 1Q5KA 2C1AA 4I4EA 4XG4A 3E5AA 5GJDA 2R3KA 4DEBA 5I5ZA 1VYZA 2JAVA 3SX9A 3FYJX 3D5VA 5DIAA 3VS0A 3IG7A 2GMXA 3U8WA 2W0JA 1W82A 3Q32A 4FZDB 1K9AA 1XH9A 2WD1A 4J8MA 3NW6A 4GFOA 3SKCA 4E4XA 4CG9A 4EHVA 1ZOGA 2EXMA 3MVHA 4QOXA 4JQ7A 3NPCA 4YC8A 2R3NA 1FMKA 4Q9SA 1J91A 3ORLA 5EW8A 3G15A 4GU9A 4R8QA 2WTKB 1OL6A 2VTSA 3EOCA 3I7CA 2PL0A 2WOUA 1OBDA 3I1AA 3JUHA 4I6HA 5CWZA 4GYGA 3NYNA 5FM2A 4RJ7A 4IAZA 4YTFA 5GIPE 4OBPA 4FTOA 3MB7A 3N4TA 3WYXA 1LEZA 1OB3A 1F5QA 3E62A 4QYFA 1T46A 2VO0A 2XCKA 5C8MA 4C62A 3DKCA 2UV2A 4Z16A 5IH6A 3D4QA 4I24A 4R1YA 3DXPA 4D5HA 1OUKA 3GXLA 1ZYDA 2EXEA 2DS1A 1JKSA 1CMKE 3K3JA 4ZY5A 1PMUA 5IUGA 2GFSA 4NUSA 4CKJA 2WTVA 3FZTA 4OTWA 4NW5A 4EZ5A 1FGIA 1FQ1B 1YXXA 4F63A 4XRJA 1PYXA 1ZAOA 3KB7A 2QO2A 3GEQA 4FT3A 4GIHA 4NJ3A 4NTTA 3UJGA 3WF5A 3C5IA 3F2RA 3PIYA 4LMNA 4RSSA 5E8TA 5FM3A 4A9TA 2HY81 4JG7A 1XHAA 5I9VA 5BVOA 3ZYAA 4YHFA 3BYVA 2WEVA 1TVOA 5L2QA 2JGZA 3MBLA 1M2PA 4XNEA 1GZNA 5CU4A 3S3IA 4FV1A 3NW7A 4RJ8A 4CFNA 5LJJA 4NM3A 3LM5A 2BFXA 3E88A 3QD4A 3QTRA 4ZJJA 3S4QA 3UVQA 3CGFA 5JN2A 3ZBXA 3JS2A 5E90A 4AUAA 4OUCA 2GNHA 3KXXA 4YZMA 4C34A 1V0PA 4AGCA 3QXPA 3R1QA 4GW8A 2VWBA 1QPCA 1WAKA 3R9NA 3SDJA 4Z3VA 2JC6A 5IA4A 3ORTA 5E1SA 3EIDA 3HL7A 5G1XA 3UP2A 5HD4A 5CAVA 4OTFA 4U3ZA 4WG5A 5KZIA 4FKPA 4ZTRA 4BCKA 4E6AA 3JVRA 4ZAUA 3KF4A 2H96A 4NL0A 3RINA 3DAJA 1P4FA 1REKA 4M0ZA 5L8LA 4JAIA 5A4CA 3P4KA 3Q60A 4U41A 2C3KA 3A8XA 4QMTA 2XA4A 5DG5A 5KMLA 3HA8A 4NSTA 4QT1A 4LOPA 2ERZE 2REIA 4NFNA 2ITQA 3CKWA 4OTDA 4B8MA 5IUHA 3U54A 4U5JA 4MD7E 5ANIA 2XIXA 4MVFA 3E8EA 3MS9A 1AQ1A 3SXSA 4CZYB 2VGOA 3F2NA 3TUCA 3UOJA 1DM2A 2BRBA 2OIQA 3CY2A 3W32A 2XNBA 3CQUA 4PDSA 1JSVA 3UZPA 3HUBA 5HCYA 5ANGA 2Z8CA 2OO8X 2YIRA 1UNLA 4QPMA 3DV3A 3ZLYA 1WBTA 1ZMVA 2JITA 3D14A 4I92A 3W16A 5AP5A 1OMWA 3A8WA 4M13A 2OF2A 3O8TA 4X0MA 3CCNA 1TQPA 4OAVB 5B2MA 1RQQA 2JBPA 4FZAB 4YO4A 4IC8A 2HCKA 3RNIA 4ZLYA 3EN7A 5JGDA 4AOIA 1FBNA 3OXIA 4BCMA 2ITPA 4MQ1A 2QI8A 3CC6A 4D1ZA 1XQZA 1ZYSA 4RIWA 2HELA 3GGFA 3T9TA 2ITVA 4EC9A 1YHSA 4ASEA 3BU3A 4K8AA 4UMPA 3JXWA 4MYGA 4QMSA 4AN3A 3FEGA 1PY5A 1H00A 2UZUE 2PUUA 2B9JA 4GFMA 1XJDA 4U40A 3PXKA 4X21A 3R9OA 2R3LA 4IM3A 3TIZA 5D12A 1LPUA 4AA0A 4CFMA 3TNIA 5HLPA 4N70A 4JG6A 5JKGA 4DHFA 1BLXA 3BLRA 2F2CB 2YDKA 4EOIA 4NFMA 1RJBA 4TYEA 3TEIA 3W1FA 4NZWB 3PVUA 3NSZA 2YCQA 4FEXA 4HVIA 1YOMA 5HIEA 1VR2A 2G01A 4Q2AA 3RK5A 3ZH8A 4E6QA 4EH6A 2A4LA 4DGGA 1BUHA 4LGDA 4ERWA 3AG9A 3ANQA 4HZSA 4GT3A 4TWPA 4BYIA 4CQEA 4BDJA 3RZBA 2PY3A 3QRIA 3GU7A 3GU5A 3I79A 3FZ1A 3TV7A 3VUTA 5HO7A 3GU4A 4A9UA 3GUBA 1DI8A 4O2ZA 3W2OA 4E93A 3LLTA 4RIYB 4YZCA 4BZDA 3MY1A 5KMNA 4AACA 4CGAA 3C51A 4FKLA 2RG6A 3MVLA 1ZZLA 5M09A 4HYIA 4BF2A 4FTAA 1XBBA 4FTCA 4IAYA 3QAME 4M69A 5EM5A 4V0GA 4EYMA 4FKIA 5HGIA 4L8MA 3UBDA 4D4YA 5K0XA 5M4FA 3ZUUA 3E7VA 5A6OA 2Y6OA 3ACJA 2VWYA 3A4PA 4WBBB 5D10A 2QLQA 3EQIA 2JIVA 2J50A 4F65A 5IQFA 4MNEA 1H0VA 5IH4A 3R8ZA 4M67A 4OTQA 4TNDA 4AF3A 4FEQA 4S33A 3ZOSA 4UMQA 4BCPA 4CSVA 4CZTA 4EBVA 4E6DA 3KK8A 2W5BA 4H1MA 3LKMA 3NS9A 5AR4A 4CMOA 2E9NA 3MV5A 2V22A 1Q8YA 2BRGA 2XNMA 2OXXA 3H9RA 4G5JA 3EN6A 4QPAA 2ZB0A 4DH1A 3QQKA 3BYUA 2XEZA 4DGNA 5DEYA 1WCCA 3E93A 4ZSAA 4TNBA 1NVSA 4X2JA 3R83A 4QTAA 3KFAA 1OL1A 2E9VA 4I5HA 4PUZA 4A4LA 4FL3A 2OJJA 4N0SA 5LVMA 2J9MA 3KMMA 5HOAA 5HE1A 2WHBA 3QLFA 3QTUA 5IA2A 4FG7A 3FI4A 5EG3A 3VHKA 2VO7A 3GQLA 1RDQE 2OH4A 2UW7A 4ZY6A 5CAPA 3BQCA 3QQJA 5AIRA 1YOLA 2WXVA 5CEPA 1JAMA 1E1VA 4R3PA 4KKHA 5AP3A 5F94A 3MH3A 4GVJA 3DBCA 5FRIA 4E7WA 2J0MB 3ZC6A 3MJ2A 4BWPA 3ORNA 5EKNA 3GP0A 4DCAA 5I0BA 1U59A 4AGDA 4FKQA 2VX3A 2O3PA 5CS6A 3WZJA 2C6LA 1Q24A 1ZRZA 2VX0A 4X3FB 4C4HA 2GTMA 4U44A 2O63A 5EW3A 2GCDA 3OY1A 4P5QA 2PTKA 2QG7A 3PE1A 3CEKA 3QYWA 5HU9A 3KEXA 4C33A 4FX3A 3LFDA 4RWKA 3RP9A 4PP9A 3UOLA 3VC4A 4G1WA 4TWCA 4CCUA 4QP7A 3DXQA 4O7NA 4HJOA 3GCPA 5IEYA 2YHVA 5I4NA 1Q97A 2BTSA 4U80A 4JDHA 2YDIA 3ZDIA 3GC0A 4WO5A 2HENA 2R3IA 2KULA 1H24A 2WAJA 4I6BA 4Y8DA 2ZV2A 4I22A 4FV7A 2IZTA 1DAWA 2R9SA 4C4GA
chains in the Genus database with same CATH superfamily
1SNXA 4XHKB 2A19B 3R2BA 5AV1A 2I40A 5E8ZA 4HW7A 3VUMA 1WVXA 2UZVA 3IW4A 4J1RA 3KN6A 4X2KA 3ROCA 4AT4A 5LCJA 5FTGA 2A1AB 3I81A 4CEGA 4N57A 2CN8A 4FV9A 4FKOA 5M56A 5B2KA 4GK2A 4QTCA 5L6WL 1M2RA 1WBPA 2ONLA 1MUOA 2CLXA 2ITUA 1OL5A 2WQNA 2XNOA 3OC1A 4ID7A 4YJNA 4JBPA 4BGHA 4HGSA 4O82A 4YPSA 3QTZA 4UWYA 2PHKA 3VS2A 3ZO3A 4QP8A 5J9ZA 2BFYA 2ZVAA 3HRFA 4I5PA 3PTGA 3TTJA 4USEA 4NCTC 4OBQA 2HAKA 4RVMA 4JR7A 3I0OA 3FI3A 3ET7A 3GU8A 4IAKA 4O0TA 1ERKA 2XZSA 3I5NA 2HZNA 1YOJA 2JD5A 2NRYA 4YLJA 5L2SA 1XKKA 2B55A 1YQJA 5JH6A 4QPSA 4EH5A 1JBPE 2Z02A 4BFMA 2R0IA 4YJVA 3V5TA 3QQGA 3G2FA 1GIJA 2VD5A 2XIRA 3Q6WA 1S9IA 2F4JA 3O8UA 3IK3A 5CAOA 5TR6A 3GI3A 1WBNA 4FC0A 4KNBA 5EM6A 1STCE 4AOJA 3RMFA 3B2TA 4O0XA 5CXHA 4I3ZA 2W5HA 4F9YA 5JT2A 4G6NA 4O7RA 3TG1A 5CNOA 3R1NA 2V5QA 3LIJA 5FDPA 4U81A 2UZOA 2R3FA 4FNWA 2CGVA 4TYHB 3UMWA 3ZCLA 4AW0A 4C4EA 1IA9A 2Z2WA 3ZLXA 4YZDA 4QMWA 3U55A 4DC2A 2JKMA 4WUAA 2B9FA 3R30A 3LZBA 2VWZA 4BIDA 4HCTA 4RX7A 1Y8GA 5CANA 3CIKA 4FTLA 4BDCA 2J0KA 4IXPA 4EBWA 2UZWE 3DK3A 3EL8A 5CF8A 3NMUF 5HHWA 5K5NA 1BKXA 4Y5HA 3QQFA 2PVYA 2C6OA 5CAUA 3ZC5A 4DFUA 5AAGA 2EVAA 1Y6AA 1YXVA 2Y4IC 3S0OA 1Q8TA 3T8OA 4S30A 4YPDA 2BZKB 2NRUA 4USDA 5HVKA 4A06A 4NW6A 5KZ0A 2CNQA 1XH8A 4K2RA 4HCUA 4XYFA 1XMLA 5AWMA 3ID6C 3LXPA 2ITYA 5M4IA 2HWOA 1O6LA 5FBOA 1ZARA 3FZSA 1NT2A 2RGPA 4IB0A 3E8NA 4A9SA 3LCSA 4AS0A 2BUJA 2XF0A 1UVRA 3G5DA 3TXOA 3QWKA 3IO7A 3DZOA 5HLWA 4U9AA 3BHHA 2R7BA 2WTCA 4BTJA 4U42A 3KMWA 4LYNA 3ZZEA 4ALVA 4Z9LA 3U6IA 3VW6A 4JIKA 4YBKA 3TJCA 3IKAA 1TKIA 5DI1A 5TF9A 4BKJA 4BZNA 5IISA 2VUWA 3R8VA 4MUQA 3QUDA 4WRSA 2JFLA 3FI2A 3SW7A 2XAMA 4DHIB 3VN9A 3DBEA 2XRWA 2XNEA 2P2IA 3LFQA 3S2PA 2VWVA 3D9VA 3MFTA 4AXEA 3HMMA 4DDGA 3PXFA 5DT4A 3UC3A 3U4UA 2GS7A 2IVSA 5A4LA 3KULA 4FTNA 2C5VA 2BALA 2WOTA 4BDGA 5IQCA 3PSDA 1IEPA 4GSBA 4KABA 4JJRA 4EORA 4H58A 3EH9A 5HG8A 1ZYCA 4IC7A 2YIWA 3FBVA 3IGOA 3SOAA 2IW9A 3DY7A 2IEWA 1GZ8A 4A9RA 4D4SA 1G8AA 2R3QA 5KNJA 3R02A 4JI9A 5D41A 3TNHA 4WNPA 5CT0A 3TKUA 4J53A 3DS6A 3QX2A 1JOWB 2F7ZE 4IEBA 4RIXA 1H1WA 1M17A 1ZOHA 5AP1A 3PDTA 4QTDA 2FH9A 3L9MA 3TKIA 2WMRA 4MXXA 4QNYA 3DDQA 2CGUA 4G9RA 4J97A 3ETAA 2VV9A 5C1QB 3NEWA 5EQEA 3T3VA 3PWYA 3V5PA 4DEEA 4I5MA 3MI9A 3LXLA 4BJJB 4L6QA 3LM0A 3RCDA 5IQHA 2CMWA 1R0EA 2EUFB 5J7BA 4RFMA 4UMTA 4ZMFA 2E9PA 3Q3BA 3QWJA 4IAAA 4YMJA 4DA5A 2W05A 4ZZOA 5AUVA 1YWVA 3ROYA 4O83A 4HYHA 2C5NA 3F3ZA 4G3GA 5GINE 3EN4A 4LQMA 4QQTA 2J6MA 3FKOA 3UVPA 1H28A 4MK0A 3VF9A 4BBEA 2QO7A 1A06A 2UZTA 4P2KA 4AE6A 3FXWA 3NCGA 3BELA 5FWKK 4QYYA 3TUDA 4F1MA 5AM6A 3WZKA 1H1QA 4EH3A 2O8YA 3Q52A 1QCFA 3P7AA 4L44A 3BU5A 5BYZA 3SXFA 2XKFA 2JDVA 2PMIA 3G0EA 4ERKA 3EZRA 4RVKA 4IFCA 2YWPA 4RFZA 2P3GX 4M3QA 4ANQA 3RAIA 4EK8A 4F1OA 3D2KA 1RE8A 2BIYA 4H39A 1H01A 4MKCA 1YI4A 4O38A 3DDPA 4G3FA 4BICA 3R9DA 4C57A 3B8RA 5EKOA 3W33A 5KX8A 3IPHA 3QLGA 4EOJA 4HVSA 3ERKA 1OKYA 3GNIB 4LI5A 4KBAA 4OTRA 1O6KA 4YBJA 4AA5A 3IOKA 5BVDA 1YWNA 2UVXA 5IQDA 3OWLA 5FEQA 2J5EA 4TTHB 3MB6A 2VTOA 2OW3A 4CFUA 5E8YA 1KE9A 3UG2A 2PWLA 3ORIA 4PL5A 2P4IA 3ELJA 3IW8A 5DR6A 3OUNB 4ENXA 4LL5A 2XBAA 1REJA 3EQBA 3R73A 4FSMA 4YTHA 3SC1A 4F6UA 1OGUA 4HYSA 5JRSA 3MPAA 4ACMA 4YTIA 2P55A 2RIOA 2HWPA 2ETKA 4UV0A 4J8NA 3O17A 3MH0A 3AC1A 4JRNA 2XKCA 4XP0A 2BTRA 3CQEA 3D5WA 3EQDA 4FF8A 1UNHA 2XH5A 4H36A 4KIKB 4E4MA 2OSCA 4EHGA 4HGLA 4F7NA 3IOPA 3LCOA 5T3QA 4IZ5A 3BLQA 4G5PA 3H9OA 2X9FA 3MGYA 5J79A 4IWQA 3QD2B 2R3GA 3DK7A 1ST4A 4O91A 1H1SA 4JIAA 1M52A 2Y7JA 3F3UA 2Y8OA 4Y73A 4RJ6A 5AUWA 3LQ3A 1SNUA 1OL7A 2BZHB 3F88A 4J98A 3PXRA 2F2UA 4AQKA 3RAWA 1YVJA 4GG5A 3HUCA 1LEWA 3N9XA 3O71A 4A4XA 1ND4A 4YJUA 4AU8A 3OZ6A 5KMJA 4U3YA 4JNWA 3R63A 4IM2A 3E8CA 3DPKA 3ZZWA 4BY9E 2C6KA 3EFWA 3K2LA 2PE2A 5AJQA 1OI9A 2HYYA 5J9YA 3V5LA 1OKWA 2ZV9A 2WIPA 4IVDA 4FIJA 3PPKA 4CYJA 4F6WA 3SVVA 5EQPA 4PNKA 4CT1A 3ZRKA 2OZAB 3NVMB 5H8GA 2C6EA 4NU1A 3Q53A 4RFYA 3NNWA 4DTBA 2OIDA 4FKUA 2YFXA 4F7LA 1H0WA 5DLSA 4BBFA 2C68A 5I9ZA 5AUZA 3DAEA 3VBTA 2CHLA 2OGVA 4U7ZA 2X2KA 4G17A 1UKHA 3B2WA 4XOYA 1U4DA 3HDMA 5AR5A 5HIDA 4PMPA 4KIOA 5A6NA 4AT3A 4WNMA 2O0UA 3W2RA 3DFAA 4QMQA 3C50A 5A4TA 3SHEA 4U6RA 4GK4A 4I1ZA 4RG0A 3R8MA 3V5QA 3VUHA 4E5AX 2DQ7X 4QMMA 3NAYA 3FPMA 4YJRA 3DB8A 1B6CB 4EHEA 4J71A 2IG7A 2XP2A 5KBQA 1OECA 1M7QA 2HZ0A 2IN6A 5CSXA 2XK7A 3KXZA 4EH2A 2IVTA 3P86A 2V7AA 5HD7A 3W0SA 4H1JA 4L01A 1O6YA 5LOHA 1Q61A 3A2CA 4NKSA 2Q83A 4PNIA 5EW9A 4CD0A 3NYOA 5BMSA 1B38A 3RWQA 3VS7A 5BUJA 3W0OA 4RPVA 2X0GA 3GENA 3VW8A 1DI9A 3R9HA 3IW6A 1F3MC 3HV3A 3MIYA 5LVLA 2PE0A 3KCKA 1GNGA 1U54A 2GQGA 2WMSA 4QMUA 5CI7A 1S9JA 2QKWB 1H4LA 2BDFA 4AXFA 1NXKA 3QKMA 2O5KA 4G3CA 2JDOA 3F69A 1G8SA 3O5AA 4ZP5A 1V0BA 5BVKA 3MFUA 4YLKA 4DFZE 3AT3A 3HDNA 4EH8A 1ZOEA 4HOKA 2YEXA 4KD1A 3UODA 2OWBA 3VJNA 2GNIA 1H27A 4ZZMA 4EZ3A 5BPYA 2C0IA 2J51A 4O4CA 4WHZA 3A60A 4B0GA 2Z7SA 5AR2A 4K1BA 1URCA 3BIZA 4K77A 3QF9A 3W0RA 4FIHA 5HTBA 2XRUA 2YM7A 1XWSA 1F0QA 4FSWA 3L8VA 3QTIA 2OH0E 4HPUE 5CT7A 3S1HA 1R1WA 2IW6A 2X8DA 5IZFA 2ZYBA 4S32A 5I9WA 4BCJA 5ACKA 5JGAA 4BDHA 5HG7A 1A9UA 2ONLC 3WE4A 4KS7A 4D2SA 3AKJA 3FMHA 4MWHA 4A07A 3RK9A 5DGZA 3R1SA 3D7TB 3Q5ZA 3NIEA 4HGTA 1PMNA 4F70A 1CKJA 4O7TA 4O0SA 4DHJA 1ZWSA 3H4JA 3GQIA 3VBYA 2W9FB 4AW5A 2QU6A 4V05A 2Z7RA 4JBQA 4NKAA 1YDSE 3BV3A 3ZO2A 2GHGA 2YCFA 5EM7A 2AEGA 4AWIA 2C6MA 1HCKA 4O0VA 3DKFA 4QYGA 3VVHA 2VTPA 2QVSE 4K33A 1IAHA 2OFVA 2QOBA 3UNKA 4NM5A 3OW3A 3ZFXA 3BBWA 4H3QA 2PVHA 2RG5A 2PULA 3E63A 1JPAA 1TQMA 5T68A 3WF7A 4D4VA 3GC8A 4L53A 2X9EA 1W98A 2X8EA 3GBZA 3Q9XA 3QX4A 4O6EA 4BCHA 2XS0A 3A7FA 3HYHA 3LCKA 1OITA 2X0OA 1Z9XA 4J99A 2HW7A 2W5AA 2RFNA 4ZTQA 3FJQE 4L67A 3RVGA 4JT3A 3L8XA 2ITZA 2ZDTA 3O0GA 4ARKA 4WRGA 3RJCA 4R7BA 5CSWA 3DBQA 2UZNA 4A7CA 1NA7A 4FL2A 5L8JA 5AV4A 1JKLA 4H3BA 5AIKA 1JVPP 4CLJA 2IZRA 3Q6UA 4O27B 4CFVA 4RWIA 5DH3A 2E9OA 4IBMA 4EOKA 2QURA 3L1SA 2WKMA 3ENMA 3DFCB 2G2FA 4EH9A 5KO1A 2B7AA 2UW6A 3FMEA 2B52A 1KWPA 5AADA 4ANLA 4EI4A 3PVGA 3OHTA 4WT6A 3PVBA 3R6XA 2FSLX 2ITTA 3L9NA 1Y57A 4HYUA 4KKGA 3KVWA 5ETFA 4FEVA 2X7GA 2BDWA 3NZ0A 4IH8A 2LGCA 4RMZA 2BROA 4BB4A 2XK9A 5CENA 4DT8A 3HMPA 3R8PA 4C4JA 5FQDC 3A7GA 4L7FA 5I3RA 4J95A 2IVUA 5TE0A 3D94A 5KCVA 3BV2A 1VZOA 2CGXA 4EOOA 3BQRA 5K4IA 3EQGA 3W2CA 4GRBA 3QHRA 1MRVA 2C0TA 3RPYA 4Q9ZA 5L3AA 4FTJA 3A99A 4LOQA 4UB7A 2XNPA 1L8TA 2QONA 4DG2E 4EJ7A 2YJSA 3SQQA 5A9UA 3COIA 5E1EA 4DN5A 1QPJA 5C9CA 2O64A 4KINA 3PXQA 3HEGA 3BLAA 3R1YA 3UDTA 3NR9A 1U46A 2ETRA 1SVHA 4GV1A 3TI1A 3O7LB 4FYOA 5DA3A 4YHTA 2I0EA 3ORPA 4L3PA 5HESA 5ANDA 2XNNA 3M2WA 4OTPA 2QOQA 2WMWA 3E92A 2XM9A 3H9FA 2QR7A 3BRBA 3R22A 4ZJVA 3FLZA 3PE2A 4G16A 4D9UA 2FSMX 2XYUA 4Q5HA 2XKDA 2JBOA 3OWKA 4I6FA 5JZNA 3LJ1A 3SRVB 1DAYA 2X8IA 3CTHA 4EWQA 4IJ9A 4FGBA 3CJGA 5CY3A 3TTIA 3R04A 3SG9A 1IRKA 3QQUA 1CTPE 1AD5A 3UNJA 2UW8A 4GS6A 2DWBA 1BX6A 3G6HA 3V5WA 4HCVA 3AD6A 1KOBA 4I5CA 5T6KA 5EDPA 3WZEA 4M97A 3O23A 4L42A 4W9WA 1FOTA 4WIHA 3PG1A 4DBXA 1MQBA 2W1CA 3T3UA 3UIXA 5KKRB 3WI6A 3C4WA 4XS2A 3Q96A 2YM4A 5GIOE 4QYHA 3KF7A 4LGHA 3UIUA 4IAFA 5FDXA 4RVLA 2BKKA 1PXIA 2XMYA 3MIAA 5C4KA 2J0IA 4DF3A 3KL8A 3U6JA 5JZJA 4JRVA 5CVHA 1Q99A 5DR2A 4HZRA 2OZOA 3RM7A 1BL7A 3W8QA 5HE0A 3QUPA 2W06A 4BHNA 3F61A 1JSUA 3NLBA 4RIWB 3BHVA 4YZNA 4F9AA 4U0IA 3FMMA 3K3IA 4IX5A 4X6QC 1MP8A 3MH2A 5AEPA 5KHXA 4RIYA 4PDOA 3V5JA 5CEKA 4FT9A 1BL6A 4UXQA 5HIBA 2I0VA 4MBIA 4FTIA 2C5OA 2IWIA 2JKKA 4B8LA 2JDRA 4XP2A 5EQYA 3BX5A 3Q9ZA 4FKRA 4MBJA 2FVDA 4NK9A 4X3JA 2BCJA 5AMNA 3HP2A 4BI1A 2PVRA 2IW8A 4FEWA 3EB0A 1WBVA 4LGGA 3V8WA 3A7IA 3PJ1A 4DEDA 5KMMA 4UXLA 4X2FA 1CKPA 3CLYA 5H8EA 5EI8A 3ZBFA 4QMZA 2EB2A 5LCKA 2PZ5A 3OCGA 1NY3A 2YABA 3F66A 4R6VA 5FBNC 5GZ9A 4AE9A 1OPKA 2X0PA 3OD6X 3GC7A 4ASXA 3JYAA 3FSFA 1YXTA 2XB7A 2WMUA 3OFMA 5C8KA 1OKZA 1UU3A 5EOBA 5EHOA 2V55A 4X2GA 4DITA 1IR3A 3F7WA 3PJ8A 4L52A 2JAMA 3QZIA 4RVTA 4TKSA 2HK5A 3R01A 4O7SA 2VTRA 3HV5A 5I9UA 4BDAA 3C9WA 2I6LA 1YHWA 2HZIA 3EFKA 3EQHA 4EOLA 4M14A 1B39A 3G51A 4J7BA 4ZTHA 3EWHA 4MXOA 4BTMA 4ALUA 5E8XA 4CT2A 1A48A 5AUXA 3QTXA 3FI8A 4AZFA 3C0GA 1H8FA 1J1BA 4DEIA 3KIOC 3COHA 4FTUA 3FLYA 4TXCA 1IG1A 1Q62A 4C02A 3CSVA 1YXSA 3V3VA 1ZMWA 3HV7A 3ODYX 5E91A 4AAAA 5K9IA 4JQ8A 3NNVA 5CQUA 5C8NA 4MXYA 4QMYA 2YERA 3MY0A 4M66A 5CSPA 1KOAA 5DHJA 4DLJA 3E7OA 5CX9A 3ALOA 4UWCA 4JMQA 4KSPA 4DEGA 5D7AA 5M06A 4M12A 3KRJA 3VUGA 3IDBA 2QD9A 2E2BA 4U97A 4AX8A 5LVNA 5AP0A 5HO8A 3LJ0A 5AP6A 4ACHA 2WNTA 5CZIA 4FZ6A 3NNUA 4LV8A 4BGQA 2NO3A 4R7HA 4FNXA 5KE0A 3REPA 2BAKA 3LW0A 4YJTA 1GY3A 4GUBA 4EJNA 4IWOA 3OG7A 4LOOA 1J3HA 3UO5A 3D5XA 5GJGA 4MF1A 2CKQA 5BQ0A 3OS3A 3NUNA 3DNDA 4DE4A 3H0ZA 4ZOGA 3NIZA 4XG9A 2J7TA 3VS1A 5CF5A 2JIUA 3QTQA 3MESA 3ALNA 2WQMA 2XIKA 1H25A 4FKVA 4I23A 3HKOA 3BE2A 4M8TA 2QLUA 3UMXA 1OZ1A 3FE3A 2BILB 1W0XC 4TW9A 5IQIA 4MH7A 4PP7A 2C6DA 3KRLA 4FKJA 3OOMA 4AW1A 3CS9A 3ZSIA 3A61A 3P78A 3MFSA 2C69A 4WSYA 2PSQA 5IDPA 3BYOA 4L7SA 3NUPA 3RCJA 5CASA 3SAYA 2BRMA 4XMOA 3SA0A 2FSOX 2ITNA 4AAYA 4FE2A 4IZ7A 4RX9A 3PLAE 2FGIA 4EKLA 1ZY4A 3ORMA 3CP9A 4PQNA 5K4JA 3ATTA 4B99A 3R00A 2VX1A 5D11A 3PG3A 4DTKA 5ITAA 2G1TA 4FBXA 5EYKA 2CKEA 3RNYA 2VU3A 2Z7LA 3FUPA 4LRKA 5IG1A 3ANRA 3DKOA 5AV3A 4GT5A 2G9XA 4J52A 3VQHA 3W8LA 1XBAA 2CJMA 3CQWA 1VEBA 4FT0A 2ITXA 1UWJA 2GU8A 4FIGA 3MA3A 3TT0A 1XH6A 1H26A 4LV7A 1CDKA 3KQ7A 4IB3A 3BWJA 1XH5A 3AQVA 3F3VA 4EQMA 2XBJA 4DT9A 1KE8A 2HZ4A 4FUXA 2OJIA 4MHAA 4FV8A 4YJOA 4ITHA 3CJFA 3OCTA 5ETCA 4AZSA 1G5SA 3AD5A 3AC3A 4JL9A 4K6ZA 4C37A 4CLIA 4NEUA 5K0KA 3L8SA 4YUQA 4CRSA 1Y6BA 4PF4A 4YNEA 3QGYA 3P79A 2F9GA 1GIHA 3DTWA 4KAOA 5H2UA 5M53A 2UW5A 4HGEA 5FG8A 5JGBA 4TYHA 5LWMA 1FPUA 5ANJA 3OT3A 3DB6A 3QA0A 4QTBA 3ZSGA 4CTBA 3NUAA 4RWLA 3OVVA 3F6XA 5L2TA 2BHEA 3AKLA 4UZDA 2OFUA 1H07A 4O96A 2P33A 3IGGA 3HV6A 2I0YA 3G9LX 3PRIA 4EK6A 2WTKC 4YTCA 5KMOA 4FT5A 2WU6A 1O9UA 2XCHA 3FWQA 2W9ZB 5DYJA 3FL4A 3QQHA 3PZEA 2PMLX 3WF8A 5BX0A 3LFBA 4O1PA 4QYEA 5H8BA 4O7VA 3PSCA 5AAEA 4HVHA 3C5UA 3VBWA 5A14A 4FOCA 4KWPA 5DT3A 3TWJA 3EJ1A 4FSNA 4QMXA 4UALA 5LARA 4W4XA 5J5SA 4N4SA 3UNZA 1KUTA 4PMSA 3FC2A 2XJ2A 1FGKA 2Z60A 5DMZA 1Q3DA 3FYKX 4LM5A 3UTOA 1KE7A 2J5FA 4U45A 2CSNA 1YKRA 2WU7A 3HAVA 1JSTA 2Q0BA 4XEYA 5L4QA 1OVEA 4Y85A 1FINA 3AMBA 5BUIA 3MDYA 3ZUVA 4MF0A 1GJOA 4JDJA 2V0DA 5J87A 3LMIA 1T45A 4XV1A 3QQLA 1PF8A 4FV2A 1KE6A 1IA8A 4RGJA 3VIDA 5ETIA 4EH7A 4ZY4A 4Y95A 3F5UA 3EQPA 2UVYA 2PMOX 3GOKA 4Y46A 5KBRA 4G34A 3I6WA 2PUIA 3O96A 3LFFA 2V62A 5HG5A 2XARA 2R3PA 4V04A 2VRXA 3RPRA 2JDTA 3U87A 4UEUA 3OP5A 3OBJA 3GCUA 4F9CA 3OXZA 5DNRA 3CPCA 2XK6A 4F6SA 4EONA 2HW6A 3G33A 3UG1A 3A7JA 4QQCA 3C4ZA 3K5UA 4N6ZA 3Q9WA 4LRMA 3K5VA 3MSSA 5I9YA 4GCJA 4FJVA 2G2HA 3BE9A 4AFJA 3HNGA 4C0TA 5LWNA 3TNQB 3CPBA 4IX3A 4CKRA 1VYWA 2YM5A 2FA2A 2F7EE 2XUUA 4HNIA 5F4NA 2XALA 4IWPA 3RAHA 3QL8A 3DKGA 3A7HA 2QOFA 4FVPA 4F4PA 3EHAA 5AR3A 3ZMMA 5M08A 4ZZNA 3U6HA 5EH0A 4OLIA 3O2MA 3FC1X 3UYTA 3EQFA 4YC3A 1L3RE 4ZTNA 3OEFX 3R7VA 5HZNA 4W4VA 2SRCA 2UW3A 2WMBA 1SMHA 4BJJA 1HOWA 3GC9A 3PJ3A 4NTSA 5EHYA 3P1AA 4KA3A 3F5XA 4BN1A 4C38A 5GJFA 2H9VA 3ENHA 5FXQA 1PXMA 4RZWA 2O2UA 5HG9A 4D58A 3LMGA 3W2SA 4R77A 4K11A 1UU7A 3PA3A 4BCFA 3JR1A 2X6DA 3OCSA 5GNKA 2DUVA 1M2QA 4D0XA 4L46A 5M51A 4NIFA 2QC6A 4QMPA 4FKSA 3KRXA 3KXHA 4AZVA 3OUKA 4ANNA 3EMGA 3AT2A 3FQHA 4I0SA 5EDQA 2HOGA 2I7QA 5JMSA 2WQBA 2R3MA 5HI2A 1U5QA 5CU3A 3WBLA 3UE4A 4TRLA 3ZRLA 2X39A 4G6LA 4FNYA 4RIXB 5LMBA 4FG9A 3ZRMA 3HA6A 4OTGA 2GQSA 3QFVA 5IMEA 3QZFA 4FG8A 1CKIA 4O21A 1BI7A 3ZDUA 2RSVA 1WBSA 3LQ5A 4PL4A 3FMJA 4JOAA 4ITJA 3KXGA 5K5XA 2VTLA 2B4SB 4E26A 1MRUA 5M44A 4P5ZA 3C4XA 1JKKA 3PY3A 4K9YA 5DEWA 1GZKA 2PZRA 3TUBA 3KY2A 3C4FA 3OF0A 5JQ8A 4XV3A 1YWRA 4L45A 1Q3WA 4NWMA 3P7CA 4W4WA 5CQWA 3IW5A 3THBA 4CVAA 4TY1A 1PXNA 4D4RA 4RQVA 2VGPA 2JFMA 4QP2A 2WMVA 3FKNA 3ZFYA 4XV2A 4GMYA 4DFNA 5ANEA 1LUFA 2QHMA 2ZM1A 1P5EA 5DR9A 1JQHA 2XYNA 4O4DA 4M0YA 4PWNA 3TZ9A 5E8UA 3CTJA 5CEQA 4UMUA 5LQFA 5AR8A 4JLCA 3IQ7A 4QP1A 2OKRA 3PYYA 3WARA 5BVWA 4GT4A 3CTQA 3L9PA 5HEZA 2PU8A 4KIKA 2F49A 3P5KA 2VWUA 5EM8A 3UP7A 3PPJA 3WF9A 3U9CA 2QNJA 4N6YA 1WVWA 3PY0A 3FL5A 2X7FA 4F99A 2J4ZA 2UUEA 4MEDA 4ZTMA 5CU0A 3PP1A 3TIYA 2PVMA 2QCSA 5IH5A 3QCYA 5FLFA 2OJGA 3R0TA 4I41A 4MNFA 2QHNA 4L68A 1ATPE 3DQXA 1YW2A 5J9LA 2UW4A 1OIQA 3BEAA 3DNEA 4ZXTA 4ZEGA 4EK3A 3QC4A 2JLDA 3CXWA 4LG4A 1ZMUA 4ITIA 2G15A 3AC8A 5M4CA 3SGCA 3FSKA 1V0OA 2C1BA 5HTIA 4EEVA 4BCQA 4F9BA 2CNVA 4MTAA 3QCSA 3QUEA 3C1XA 3OEZA 2C30A 4MD9E 4YZBA 2WTIA 3S00A 2JIIA 3AC4A 4JDKA 4BGGA 2PZYA 4WNOA 3H3CA 2WB8A 4U8ZA 3ZS5A 4AW2A 4FZ7A 4B6LA 2QO9A 4M68A 5F1ZA 3TZ8A 1XH7A 4RJ5A 3EFJA 3ZFMA 4GKHA 2B9HA 2PVJA 3E3BX 3HRBA 3OXTA 4GU6A 3CD8A 4W9XA 4O2PA 2VO3A 1UU8A 4MAOA 3FLSA 4EWHA 3E64A 4AA4A 4AFEA 2QQ7A 3BHUA 2PE1A 4BC6A 5JRQA 3V01A 5EK7A 3UDBA 4LMUA 4UY9A 3DT1A 1W84A 5D1JA 3I6UA 5JFVA 3TCPA 4IHPA 3HV4A 4S34A 1YDTE 3PJCA 3W18A 2PUPA 3UIBA 3RBWA 3RGFA 4F09A 3Q2JA 2XJ0A 3FDNA 2WFYA 5B7VA 1OM1A 4LUDA 1R3CA 1YI6A 3M1SA 4B4LA 4BRXA 5F20A 2O65A 4O22A 2WTJA 2OXDA 2BAJA 4IDTA 4MXZA 3ATSA 3UQCA 3BHTA 4WUNA 2X7OA 3FKLA 4DTAA 3JPVA 3F2AA 2J0JA 2R5TA 2B53A 5CVGA 4ACGA 5AV2A 3FPQA 2H6DA 2AYPA 3I5ZA 4JX3A 1J7IA 5EYCA 4ZTSA 4DH3A 4X3FC 4BL1A 5AAFA 4ASDA 3LQ8A 2I0HA 3POOA 3OMVA 4UYAA 5A4EA 5JK3A 2BAQA 1G8KA 4NT4A 2ZAZA 1H1PA 5HNGA 3F5GA 3QKLA 3L9LA 1E1XA 4KSQA 1QPEA 3ZXTA 3N4UA 1FMOE 3JY9A 3MW1A 4AQCA 2AQXA 5H3QA 4DAWA 3QRKA 3TNWA 2RKUA 4R78A 3TMOA 3W0NA 3DBDA 3NUUA 1TZDA 5CNNA 4TYIA 4ANBA 3DTCA 5IUIA 2YIXA 2QKRA 3R2YA 2PMNX 5I9XA 1YXUA 3VS3A 4ZSGA 1OIRA 2X2LA 2XNGA 4L00A 4FGRA 1P14A 4PTGA 1YI3A 5TOZA 3TJDA 3VBXA 5KMKA 2YAAA 4IM0A 4D5KA 4MCVA 4DG3E 4USFA 3NYVA 4PL3A 5EYDA 3G6GA 3PSBA 3HRCA 3AC2A 3BLHA 4QP4A 5JEBA 4EYJA 2AC3A 1OBGA 5A4QA 3FV8A 4QP9A 4C36A 3AC5A 3DQWA 1ZLTA 3RHKA 4C2VA 1U54B 4UX9A 5CALA 2CNUA 2YITA 2W1EA 3D7TA 4OBOA 5FP6A