3OUNB

Crystal structure of the fhaa fha domain complexed with the intracellular domain of rv3910
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
257
structure length
256
Chain Sequence
QLVPGARIANGRYRLLIFHGGVPPLQFWQALDTALDRQVALTFVDPQGVLPDDVLQETLSRTLRLSRIDKPGVARVLDVVHTRAGGLVVAEWIRGGSLQEVADTSPSPVGAIRAMQSLAAAADAAHRAGVALSIDHPSRVRVSIDGDVVLAYPATMPDANPQDDIRGIGASLYALLVNRWPLPEAGVRSGLAPAERDTAGQPIEPADIDRDIPFQISAVAARSVQGDGGIRSASTLLNLMQQATAVADREVLGPID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/transferase
molecule keywords Putative uncharacterized protein TB39.8
publication title A phosphorylated pseudokinase complex controls cell wall synthesis in mycobacteria
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 69
structure length 256
sequence length 257
ec nomenclature
pdb deposition date 2010-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ounB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ounB01
3RINA 3QU0A 4BZDA 3WI6A 5EW9A 4MEDA 5HG9A 4XOYA 3CS9A 4BL1A 4E1ZA 5HVYA 4U0IA 1YKRA 4FOBA 4JQEA 2ZV9A 2ZMCA 4KABA 4RIYA 4AE6A 2ONLA 5AA8A 2R3RA 4O2ZA 3HMPA 4B8LA 2W0JA 3VS6A 4WRGA 3SQQA 4RJ6A 3RZBA 4LL5A 1O6LA 2G01A 4LV5A 4WD5A 3UC4A 3BWFA 4J71A 3AG9A 4MD8E 2YACA 1JKSA 2EWAA 3RBWA 1YWRA 2RKUA 4I92A 3Q53A 4A06A 3ALNA 3UMXA 3FKOA 2YDKA 4YC8A 1M7NA 5K3YA 3LE6A 3TTIA 2WTKC 2VTOA 3KFAA 4M68A 4RLKA 4ERWA 1Q24A 3EMGA 4S30A 4IQ6A 3KK8A 3R7IA 3TG1A 5JRSA 4MTAA 3E8EA 1R1WA 3MVLA 2WMSA 3PJ8A 2R3QA 3PSCA 3QALE 4C62A 3L1SA 2W1DA 2XEZA 2PPQA 3W2SA 5B0XA 2HZIA 3F82A 4FNWA 3R8PA 4BZNA 3L8XA 3JUHA 4F4PA 4F9WA 3PJ3A 3W10A 2WMUA 4FIGA 3TKIA 3H10A 3F5UA 4QMXA 5CU4A 2W96B 3WIKA 5CTPA 1DS5A 3BYVA 3O50A 4PTEA 5EKOA 2CKEA 3QX2A 4DHFA 4USEA 4O2PA 1YXVA 4DGLC 5BNJA 3R83A 4DG0E 4ZLZA 3ZS5A 4GYIA 1URCA 4MF0A 4XG6A 3VC4A 3T3VA 5CAOA 3U8WA 4PTCA 4WNMA 2W4KA 2J5FA 4ZIMA 3IQ7A 4JG6A 1DM2A 4F1OA 4BWKA 4KIKA 5KO1A 5IUGA 3V8TA 3BPRA 4TYEA 3T9TA 1FMKA 2VWZA 1H01A 4FBXA 5IA3A 1QPEA 1MP8A 3O7LD 4YO4A 3GGFA 2BZHB 2PMOX 3DQXA 2E2BA 1G8SA 3GU7A 4NUSA 3BGZA 4N70A 5AAEA 2V22A 3PVGA 5AUXA 3KRXA 2ZB1A 3CEKA 3EFKA 3MFTA 2IVTA 3WF7A 1X8BA 4KD1A 4RIXA 2WEVA 3BLHA 3FXZA 3C50A 4DGNA 2B1PA 3HAMA 3VS5A 4OBPA 2VU3A 3A8WA 2CGUA 5DNRA 2JDRA 2PZYA 5EM7A 2GS2A 2YIYA 3EZRA 4FIEA 3GU4A 2X9EA 4GT4A 4OTIA 4ANNA 4C37A 3LCSA 3QQFA 3K2LA 4PMSA 3UMWA 3DAJA 5ANGA 4BGHA 2BRHA 3NDMA 4UMPA 4YJPA 4D2TA 4MXZA 3OWKA 1GZOA 4BDFA 4U7ZA 2ERZE 3VS1A 5AP1A 3KN5A 2CGWA 5IZFA 2VGOA 1J1BA 3HX4A 4RZVA 5IDNA 5M09A 3PPZA 4G1WA 4ZJJA 3QBNA 3TV4A 4BI0A 3BBTB 4V0GB 4QMVA 4I0TA 2YHVA 1TQPA 4FT0A 1OPLA 4DEDA 2VUWA 5DEYA 2H9VA 2WTIA 2Y4IB 3ACJA 4IX5A 4O0XA 3CP9A 1ZARA 4O0VA 4WUAA 5TE0A 5TT7A 1KV1A 4IM2A 3ZLXA 3O8TA 4ANSA 1ZY4A 1PXKA 2R0UA 2GNLA 4JBOA 2YM5A 1GZNA 3F61A 4ZZOA 5LMAA 1ZAOA 5CZHA 5BQ0A 4DA5A 4QRCA 2O2UA 3UOJA 3CQWA 1JSTA 4WG4A 3ZRLA 5IPJA 1NXKA 1FGKA 2XNNA 3PJ1A 3OS3A 2CCHA 3C4FA 3RJCA 1ZYJA 4HGTA 4LOPA 2B0QA 4DF3A 1IEPA 2ACXA 5AUWA 2W1HA 3VHKA 2VTIA 3W2RA 2ITQA 4CFXA 3JY9A 3EN7A 2WEIA 3F3VA 4X7QA 2P4IA 2ETMA 3NYXA 3OF0A 5BVEA 5AJQA 3N4UA 3G2FA 1QPCA 1P2AA 3I6UA 5IUHA 2YJSA 2R3GA 3QAME 4CMTA 4G2FA 1PKDA 3IKAA 5KKRC 2XA4A 4A9SA 4AE9A 1H8FA 4ZZNA 4IAFA 3G9NA 2QR8A 3GVUA 4FR4A 3TM0A 4HGEA 2IZRA 1UU8A 4IX4A 4I4FA 5FBNC 2W1FA 2Y9QA 3ZXTA 2X6EA 1YXUA 4C4EA 5LVMA 1UWHA 4MKCA 1W8CA 4Y5QA 4EOIA 4RMZA 2C0TA 3KRRA 4EH6A 1H26A 3PJCA 3R30A 2JDTA 5KUPA 3N9XA 1W7HA 4BDHA 4BIEA 2YLFA 4FKPA 4OTQA 1M7QA 1NT2A 4LMUA 3WZUA 1JKKA 4A4XA 3V5PA 4YNOA 2QONA 1WBSA 5GZAA 5LJJA 1OUKA 2Y0AA 3FMJA 4IVDA 2R3OA 2J4ZA 4UB7A 4D0WA 3A99A 4YZCA 2NPQA 5DT0A 2NRUA 3KC3A 3ORIA 1OUYA 3ZZEA 2R3FA 4C4JA 5IEXA 3FKLA 4BFMA 3FMNA 2E9UA 2P55A 4QMTA 2ITNA 1JNKA 2R64A 3QRUA 3UZTA 4UXQA 4NT4A 5LWMA 3ORLA 2G1TA 4FNZA 4ITHA 4RIYB 3DBQA 2XUUA 5AP7A 4TNBA 5FM2A 1UNHA 3PWYA 4L42A 4DCEA 5IMEA 1XH9A 3PYYA 5H2UA 4MCVA 3WOWA 2FSTX 3TJDA 5M4IA 2W05A 2CKQA 4EH9A 4ASDA 4L00A 5CI7A 4YC6A 2YJRA 1JAMA 3GC9A 2A27A 3EYHA 5B2KA 3HVCA 4EH8A 3DGKA 5BVFA 5KMLA 3LW0A 4IX3A 3F2AA 4QYFA 2G9XA 4RRVA 4TL0A 4ANMA 2G2HA 2UZBA 2WMQA 4XYFA 5IU2A 4HNIA 3Q6UA 3QZFA 5C03A 3SRVA 2VNYA 2VTTA 4FG9A 4KS7A 5KZ0A 4O7NA 4XLVA 2B52A 5J1VA 5HIEA 5C8KA 2QOHA 3DXNA 3LM0A 2BPMA 4FE2A 3UYSA 4UX9A 3KXNA 5HIDA 1OL5A 2X1NA 3OXIA 4KAOA 4EQMA 3UG1A 2XJ0A 3FZSA 4R77A 1U5RA 2H6DA 3T9IA 1YI6A 2QR7A 4EKLA 4NFNA 4O0RA 4YGAA 3QKKA 5IA5A 3KXHA 5M4FA 4GMYA 4KINA 2HK5A 3MY0A 5AM7A 3Q9WA 1ZMVA 2WTCA 4GH2A 4EC8A 4YJTA 2IW8A 3DBDA 2FO0A 3EOCA 4YBKA 2QKWB 3NSZA 3KF4A 4RC4A 4BCGA 2C6DA 5JFWA 3EB0A 1KE7A 3OP5A 5GZ9A 4W8DA 4CD0A 2JIUA 3NLBA 3ZC6A 4QTDA 4B9DA 3SX9A 3KVXA 3EN6A 4BYJA 4JAJA 4GW8A 4E5WA 2GTMA 4GRBA 2XZSA 4P4CA 2KTYA 4X6RA 5HEZA 5T3QA 2C4GA 5HVKA 5FTQA 3U55A 5DG5A 2KULA 3UVPA 4NW6A 4G9CA 3OCGA 4XG3A 4QQJA 3II5A 4H3QA 4RIXB 3VBWA 4A9YA 4ZTLA 3W8LA 2XH5A 3SHEA 3NVKI 4KKHA 2QLQA 3OXTA 4NM0A 4D5KA 3RP9A 4J8MA 3FSKA 3LFSA 2GTNA 5CNOA 4ZAUA 4HYHA 3A8XA 5AWMA 4DE4A 2RFNA 3PXYA 4J95A 4DC2A 2XVDA 3FZOA 4BN1A 5HLNA 1JOWB 3GNIB 2R2PA 2Y8OA 3GOPA 4FTRA 5K9IA 3UVQA 3MH2A 2IVSA 2BIKB 4BICA 2WU6A 3ZRMA 4Q9ZA 1REKA 2RFDA 3DKGA 1H25A 3F88A 4I0RA 5TOZA 3QD0A 3QZHA 3ZO1A 4NTSA 4U6RA 1XH5A 5ANKA 2OKRA 4K8AA 3OXZA 4IMYA 5CVFA 3ELJA 4IX6A 4DN5A 1IG1A 3U9NA 2IZUA 3LFAA 1U46A 3F2RA 2ZVAA 4GCJA 2C0IA 4UZDA 3BYSA 4LYNA 3KK9A 4X3FA 4X0MA 4AW5A 2R7BA 4D4VA 4EZ5A 4F0IA 2QOOA 3HV4A 5HX6A 2OXDA 3O96A 2WQNA 2I0EA 2YCFA 4D1XA 5L8LA 1Y57A 3NYVA 3Q4CA 1MRYA 3EQPA 4CFVA 4XRJA 2XNPA 3NUXA 3VUDA 3VJNA 3EQGA 3CQEA 4PL4A 3QC9A 4YJRA 4KWPA 3LIJA 4FV2A 4DH1A 4U5JA 5BMMA 2XIKA 4FSTA 4KSQA 4PDPA 1NVQA 4QP2A 3FC1X 1WBNA 2BDFA 4J52A 3EFWA 4LGDA 3ZUVA 2O5KA 3EKKA 3EN4A 1ND4A 1OKZA 2B9IA 5DVRA 1Q3WA 3R9HA 4IANA 4ZTSA 1H08A 4QTBA 2BALA 1RDQE 3C51A 4FKTA 5F4NA 5D12A 5JRQA 3BBWA 3DTWA 3FMKA 3A62A 3I7CA 2F9GA 2QO9A 3D7TB 4MK0A 4HVGA 1Z9XA 2WIHA 3PY3A 3IK3A 4I22A 4CFWA 3MVJA 2V55A 4NM3A 1OITA 4QQ5A 3NUYA 2WTDA 5EI8A 2Z7LA 4QMSA 4IXPA 3WIGA 3VHEA 5LVLA 4KB8A 4I6FA 5EYKA 4WG5A 3QTXA 4JDHA 3RWQA 3ZUUA 3VUIA 4QMUA 4FV4A 4TYHA 3I60A 2DYLA 3AOXA 1OL2A 2YZAA 4QNAA 3MBLA 1WBWA 3CJFA 4N6ZA 3OWLA 2WAJA 4RVKA 5AP0A 4Z7HA 4U79A 2OJ9A 1LP4A 5CENA 5F20A 3FZ1A 4FV7A 4JG8A 4R6VA 4GFGA 3FC2A 4FIJA 4IWQA 3VBXA 4PV0A 4XP0A 2WMBA 2WMXA 3C4CA 4DFYA 1J7LA 2RSVA 3P0MA 4JDJA 5FXSA 3ZSIA 3D5XA 3LCTA 4XLIA 3PIXA 3TIZA 4C2VA 3UPXA 2CGVA 1CKJA 4FT7A 4DEGA 2O3PA 4FTMA 3PFQA 3W2QA 1OL6A 2BCJA 4YHTA 3QUEA 3TV6A 1BI7A 4EK5A 1ZYSA 2YDIA 4IZ5A 3R7YA 1V0PA 3AMYA 4LQMA 4FTUA 4LRMA 2XRUA 4GK3A 4CZTA 4D2RA 4IWPA 5AP5A 2PMIA 4DFNA 3R9RA 1GZKA 5EDRA 4DINA 2YWVA 3VIDA 3FQSA 3SRVB 5LWNA 5E92A 3O71A 4FGRA 4PTGA 3QTZA 4R3RA 5LXMA 3RK9A 4K2RA 4E5AX 2CGXA 3ZDUA 3O0GA 2WQEA 5FTOA 5CEIA 3MY1A 2YZLA 5DEWA 4MBIA 1Q3DA 3EN9A 4O91A 3DKFA 1BL7A 3TIYA 4D28A 4E4LA 3I6WA 3R01A 4PF4A 4W8EA 3QHRA 4XV1A 3ZRKA 4O7ZA 3E3BX 2PVYA 3PLSA 3AQVA 4G5JA 5HORA 4QMZA 3Q9YA 4CSVA 5HU9A 4R3PA 1ZOEA 5EW8A 4FEWA 3KF7A 5AV2A 4AOTA 3IW6A 3L8VA 1IR3A 2YN8A 3LLTA 1GJOA 2F4JA 4FVPA 1UKIA 4NTTA 5TR6A 4MQ2A 2XK7A 3O2MA 5HCZA 3KMWA 3ULIA 2YM7A 2X8EA 1QCFA 2JBOA 3BHTA 3NYNA 3R2BA 4AZFA 5AMNA 5HZNA 4FK6A 1Q8WA 3PG3A 2ZDUA 2XKEA 3ZSGA 4GFMA 3DAKA 1L3RE 2DQ7X 3PIZA 4YSMA 4DEHA 3VBTA 3EZVA 3CGOA 3VUGA 4XMOA 4WRSA 5HE2A 3UIMA 1PHKA 5ACBC 2R9SA 3FZPA 3ZFXA 5K4IA 4GU9A 4P5QA 2CNUA 3MA6A 4QQCA 4E4NA 2QHMA 4AWIA 2W17A 5HLPA 1H0WA 3LXKA 3HDMA 3Q96A 4E8AA 5EQPA 2W9ZB 4S32A 2YCQA 4II5A 2ESMA 4EONA 2QVSE 2XYNA 2IO6A 3DKCA 4WNPA 4O6LA 4BCNA 2CKOA 5IQCA 4FSWA 3MESA 5L8JA 2WTWA 1YWNA 4LUDA 3FPQA 2OJJA 4M66A 4FKOA 3Q5ZA 4CGAA 4ASZA 2ZB0A 2GHGA 1VZOA 4O6EA 4Z3VA 5CQWA 2NRYA 5BUIA 4XH6A 3OY3A 3LMIA 5IEYA 3OBJA 2BDJA 3R22A 3M11A 3QD3A 2YIWA 2QG7A 1PYEA 2IW6A 5KHWA 4O38A 4QPMA 4N0SA 5E8YA 3LXLA 4O0TA 4FICA 3RKBA 4F0GA 1PMVA 5A4CA 4IH8A 2ITVA 3S3IA 3ZZWA 3UIXA 5AEPA 4FKQA 4X3FB 5DR6A 5IQFA 2VWWA 3DK6A 3ORPA 4NJDA 4NKAA 4BCKA 4EOSA 1RE8A 4PUZA 4FZFB 1CSNA 5BVWA 3DB6A 4FOCA 4FVRA 3SC1A 4QO9A 4DYMA 3S00A 1PXIA 1H1QA 1ZMUA 1J1CA 2VWIA 3NUUA 5JSMA 3CKWA 3K5UA 4CG8A 4M12A 2OZAA 3H3CA 2ZV8A 1B38A 3LJ0A 4M0YA 2XMYA 3NS9A 4FZ6A 2XK9A 4RGJA 4CG9A 4X2NA 5CEMA 4DTAA 3QGWA 3UOKA 1JSVA 1HCLA 4L45A 1FINA 3DU8A 4PP7A 4XBUA 3GU5A 4CTCA 4RIWB 3PTGA 1Q8ZA 4R7IA 2C6MA 5EFQA 3LXPA 5A4LA 4H39A 4X2GA 5E90A 3FMMA 4FYOA 4YTCA 1Q61A 3P79A 4IWDA 3RVGA 2OICA 4ZY6A 2JDOA 2ZM3A 3I79A 1PXNA 3KXMA 5H8EA 3HL7A 4TY1A 3W2OA 5HESA 3D14A 3DB8A 3LQ8A 3SGCA 4YU2A 3BV3A 2C6LA 3EN5A 3DOGA 2XNOA 4I94A 2VO6A 3A61A 3NRMA 4FTNA 3HMOA 4MNEB 3QCQA 3DFCB 1QL6A 1K3AA 4OTPA 4BDIA 4U80A 4CCBA 1AD5A 3BEGA 2BRNA 4Z9LA 5HVJA 3VNTA 4BHZA 3BKBA 1PXMA 4H1MA 4AXAA 5CSVA 3OUNB 4TTHB 4D1SA 4CZYB 4EOOA 4ZY4A 5HBHA 3DS6A 3BQCA 4RX8A 4QP8A 4IZYA 2GPHA 3F7WA 3ZFMA 1MQ4A 5AAGA 5L2WA 3QTQA 2WD1A 3L9LA 3UYTA 5AV1A 3QUPA 4P5ZA 5T68A 3CTJA 4QTEA 4AF3A 3KU2A 5C8NA 4BTFA 1S9IA 2GNIA 3H9FA 4TN6A 5LVOA 2R3LA 5M4CA 5D7VA 4BDKA 4LG4A 4OTDA 4I20A 4R1VA 3F5GA 3HKOA 3EL7A 4PWNA 5ANEA 3RM6A 4R7HA 5B7VA 1SVEA 3CSVA 4BYIA 4UWCA 3MB6A 5CAPA 1WVYA 2ITUA 1YXTA 4Y83A 3ENHA 4I24A 4MHAA 3PP1A 4GFOA 5AIKA 2XK4A 2UVZA 2CN5A 4KIOA 2PUNA 4GEOA 3ZLYA 3F7ZA 3G6GA 3GP0A 4RFZA 3H0ZA 3WE4A 4DG3E 3AD4A 2NNWB 2UW6A 4U97A 3V8SA 2QHNA 5J1WA 4ALWA 3IGOA 1P5EA 4RA4A 2GNGA 4ASXA 4I6HA 3N4VA 4QTAA 4ANLA 1V1KA 1J7UA 1OPJA 2UZWE 4CZUA 1YVJA 3LZBA 4GT3A 4Y5HA 2ZJWA 3Q60A 4EQCA 4AT3A 1XH6A 4J53A 5BYYA 5C1QB 3ZO3A 4DTBA 1REJA 3IW5A 5GNKA 3V04A 4F9YA 4Z16A 5M55A 4YZBA 4JRVA 5F1ZA 4D2PA 4H1JA 4D9TA 3ZEWA 4HGLA 2UVXA 3SXFA 4E5BA 3NVMB 2UZNA 4RVLA 4FZDB 4B99A 5BVOA 3AD6A 4AA0A 1TQIA 3P9JA 4EUTA 5CANA 1UU3A 5CF4A 2CPKE 2VWUA 3QD2B 3S4QA 5LQFA 3U6JA 3TACA 2I1MA 5CAQA 2R3HA 4F9BA 4BR3A 3FI8A 2B54A 1H1RA 4BHNA 4S33A 4M3QA 4XJ0A 4UMUA 5GJGA 1JKTA 2CCIA 3F5XA 5CT0A 3BYOA 3SV0A 3U87A 3ZUTA 1APME 2HWOA 4HVIA 2GHMA 5ANOA 1M2RA 1RW8A 5EYCA 2J7TA 5I3RA 2QO7A 4O7WA 3SOCA 3OW4A 5EM8A 2QODA 4GSBA 3UO4A 5DPVA 5A54A 3O17A 3AC4A 3QYWA 5F9EA 1SNXA 2F7XE 5H8GA 3BE2A 1F5QA 3V6SA 4FT9A 1XHAA 3TT0A 4WA9A 2VTLA 4AFJA 3NWWA 3QXPA 4JIKA 2I7QA 3UE4A 2FUMA 3VUHA 2X8IA 4FT5A 4IFCA 5ETCA 1YDSE 2VO3A 4P90A 3U51A 5BVDA 4TKSA 2ITWA 1JSUA 2ZYBA 5HO8A 4WUNA 1W82A 2IW9A 3C7QA 3S95A 1VEBA 2XF0A 4OTWA 4ZTRA 3NNUA 2W99B 4EWHA 3COKA 4DT9A 3ZM4A 2Z60A 3QZGA 4KBKA 4OT5A 5M08A 4IVBA 1FVTA 4FG8A 2OBJA 2W1CA 4BRXA 4GJ2A 5A46A 1Q8UA 1OIUA 3MDYA 4ACHA 5LOHA 2YABA 3OWPA 4NCTA 5TKDA 4FSQA 3V8WA 4QNYA 2J50A 1V0BA 4W9WA 3ZTXA 4FA2A 2PMLX 3HMMA 4FZAB 3W1FA 3HV5A 3W2CA 3ZOSA 3ZSHA 5IA0A 5KHXA 4IB0A 4MBJA 3QCXA 4K9YA 4JXFA 4MYGA 3EQCA 4FV1A 1SNUA 3CE3A 4H58A 1URWA 4O83A 4ZMFA 2I0VA 2HW6A 2IPXA 4RJ8A 3FLZA 4BDDA 5FUTA 2YCRA 2X2KA 5HE3A 3E8CA 3ZC5A 4C34A 4C4GA 2XM9A 3E87A 3GEQA 4TXCA 3TXOA 5JZNA 2OI4X 4BDAA 4AZWA 4QMPA 3AGLA 2B4SB 1M2QA 4FYNA 5J9ZA 3CCNA 4BCPA 3V6RA 4XCUA 2YIQA 4WBBB 5JMSA 4G3CA 4FEVA 1R0EA 4AAAA 3F2NA 5KZIA 1Q8TA 1YWVA 3KXXA 4PY1A 3M42A 1M17A 2OZAB 4CLJA 4EHZA 3Q2JA 4FTJA 2PE2A 5JFXA 3EYGA 1H1SA 4GK4A 3FLQA 4BTKA 5CF5A 4NL0A 3QWKA 4G3EA 3BEAA 4FIHA 4WO5A 2QLUA 2Y4PA 1OKVA 5LMBA 3TNIA 4FKWA 4K1BA 2VAGA 3C4EA 4DG2E 5B2MA 1W84A 3DQWA 4KRDA 1MRUA 4YHFA 1QMZA 4CKJA 5HHWA 1LEWA 3DTCA 3QQHA 5AUYA 4O82A 4IDVA 4AGWA 2OK1A 4G31A 4C58A 5IA2A 2JIIA 4FUXA 5CY3A 2FH9A 2UW7A 1CM8A 1E9HA 3AC5A 3E8NA 3POOA 2FA2A 4C7TA 3NCGA 3LJ2A 3NAYA 4DEIA 5EKNA 1R3CA 4FV9A 3I81A 3DBFA 3OUKA 4LFIA 4TWNA 5JKGA 3KXZA 2XK6A 3IW4A 3R7GA 4UZHA 5C27A 4U45A 3F5PA 3F3ZA 4EHVA 3QTSA 1XH7A 4GVJA 4PMMA 3VS3A 2XJ1A 3MA3A 2BUJA 1J7IA 2BROA 3LFFA 4UXLA 2WMRA 3W55A 4OTRA 3B8RA 4I5MA 3UNZA 4K0YA 5AP4A 4FNYA 4F6SA 4S31A 1MUOA 4ID7A 5HKMA 2WNTA 3FXWA 3GFWA 3L9NA 3QTWA 1ZYLA 5EYDA 1SVGA 2HZNA 4N57A 1GNGA 4E6QA 1U59A 3A7JA 3DLSA 5J9YA 3WILA 3EQRA 4B6LA 3RNYA 3TV7A 4Q5EA 3MFSA 4EZ3A 1XBBA 4BF2A 4EEVA 3TUCA 3RCJA 1SM2A 1WBTA 3TDWA 5M06A 4F09A 4O7TA 1PY5A 4FTAA 4I93A 3G9LX 2H34A 4F7NA 4U44A 3RPRA 3LMGA 4L43A 4RLLA 3DZOA 5EI2A 4JDKA 3H30A 3LFDA 4JR7A 4QTCA 5IA1A 2J51A 5FM3A 4A4LA 5BVNA 1YHSA 3LCOA 3BGQA 3RCDA 3BHYA 2YAKA 1WCCA 2JAVA 2OF4A 5JFVA 4L3JA 3ANRA 2GSFA 5C9CA 4PDSA 2NO3A 4XG2A 1A48A 2UVYA 3POZA 3CGFA 2OIBA 4FUYA 2X4ZA 4FL1A 3FY0A 4RJ5A 4D58A 1OPKA 1XBAA 3VQUA 3UZRA 3ACKA 2XKFA 3UTOA 1PXJA 4IFGA 3UNJA 4L6QA 3G5DA 5D10A 5CU3A 5HO6A 4AT5A 3EHAA 5JN2A 1FVVA 3DLZA 1YI3A 2PVJA 3R8ZA 3DFAA 3NUPA 2XCHA 3DJ7A 4G5PA 3V5JA 5CAVA 3FQEA 3LAUA 1H0VA 4MAOA 3DY7A 3HP5A 5CNNA 2YIXA 4XV9A 3ITZA 1Y6BA 3D0EA 1KE9A 4OGRA 1UU7A 3A7GA 3QLFA 3W18A 4HCVA 1YOLA 2PMNX 4ITIA 4WG3A 3OWJA 5KE0A 4AZSA 4EOJA 2HYYA 3LPBA 3PXRA 5CXZA 2JAMA 3NGAA 4F9CA 4CKRA 4UBAA 1H1PA 5DA3A 3V5TA 3BLQA 3Q32A 1W83A 3KVWA 3CY2A 4EUUA 5E91A 2W7XA 4J7BA 2A4LA 3OTUA 3VS2A 2C6OA 3UVRA 4EK3A 3CKXA 2CN8A 3HA6A 3P86A 2XIRA 4FEQA 5L2QA 3EL8A 4D2SA 3SW7A 1UVRA 3HEGA 5AR2A 3GU8A 3H4JA 3TUDA 4NZWB 5CI6A 4BCOA 4YJQA 3ORNA 4ACDA 3PRFA 5A14A 5I9XA 2FSMX 2UZLA 1UKHA 4FV3A 2BIYA 3SXRA 4A4OA 1UNLA 4IVAA 4I1ZA 3BRBA 2XM8A 4PL5A 4CV8A 3OCSA 3ZXZA 3MV5A 3IS5A 3NIZA 3MTLA 3N4TA 3ZO4A 5CASA 3A4PA 2WKMA 3GB2A 5HCYA 4U42A 4BGQA 1JPAA 3NR9A 4JQ8A 3UP2A 1LUFA 4QMWA 2VX3A 3ATTA 5K0KA 4L46A 3MFUA 4KIKB 3EKNA 3BHHA 3BGPA 3Q3BA 3RGFA 4FKUA 4WSYA 3TCPA 1ZOHA 5LCJA 1ZXEA 2Z7QA 4FKLA 4FTKA 3IDCA 3MJ1A 4L7SA 5AIRA 4AN9A 4D1ZA 3MIYA 4A9UA 2XBJA 4LUEA 1OL7A 3OHTA 4XG7A 4FSUA 5DN3A 3SAYA 3VWAA 5ITAA 4XG9A 4X2KA 2VO0A 4JQ7A 4W4YA 2A2AA 3PVBA 1Q97A 4H3BA 5DH3A 4C4IA 3IOPA 3E88A 5FRIA 2X81A 3DK3A 3NW5A 4Y73A 1STCE 3QKLA 3ZYAA 4ZSGA 3U6HA 4DBXA 4AN2A 5EH0A 4G9RA 3ZDIA 3IDBA 2W1GA 3LCDA 4YJUA 2OXYA 3AMAA 1XO2B 2R0IA 1DAWA 2JD5A 4M13A 4YHJA 4AACA 5BYZA 4E26A 4FKJA 2PVFA 3VW8A 4BY9E 4MF1A 2C5OA 4HW7A 4ZS4A 3LQ3A 1F0QA 2CLQA 3CD8A 3F6XA 4IVCA 4ZSLA 5IQGA 2BKKA 1HCKA 4NJ3A 2JKMA 2ZV7A 5FWKK 5GZ8A 2LAVA 3C1XA 4E7WA 1OZ1A 2VX0A 1GIHA 2ZM1A 4IE9A 4Q9SA 3RZFA 2WMVA 4IIRA 1KOAA 1YHWA 4MH7A 2R3IA 4G6LA 4F7SA 4KBAA 4UWYA 3GQLA 4NSTA 3D15A 5I0BA 1YDRE 2WHBA 3DAEA 3LOKA 2J0LA 4EBVA 3UQFA 3HV6A 4NIFA 4YLKA 1H24A 3FKNA 4AGCA 1OBGA 1YXSA 2YERA 4G17A 1OIRA 4O1OA 4UN0C 1WBVA 5KMNA 3TNHA 3AC3A 3NYOA 2EUFB 3U9CA 4QMMA 2EXMA 4CFFA 3QL8A 5TF9A 3TI1A 3UQGA 3OCTA 1H07A 3R04A 4RWIA 3BE9A 4GYGA 4X6QC 3HDNA 1PMEA 4EH7A 4XV3A 2BAKA 2JKKA 4DEAA 2X7FA 3OBGA 4BCHA 5EW3A 2AYPA 4MXAA 2XB7A 3DA6A 5A6NA 1P4FA 2PULA 3FEGA 3TN8A 1ZYCA 5HG8A 4F65A 5J7BA 4C2WA 4CKIA 1G5SA 4C3PA 3S1HA 2C6IA 4CFMA 3R6XA 3D7ZA 4FMQA 1P14A 3Q5IA 3WZKA 2XKCA 5DR9A 5EDPA 3B2WA 4PP9A 5CS6A 4FKSA 3I0QA 4IACA 4JT3A 5HICA 2J0MB 3QKMA 4TWOA 3FAAA 2C3LA 3U54A 1G8AA 2BRBA 3FYKX 3WYYA 4C36A 2OXXA 3QQUA 2WMAA 1ERKA 3HRBA 4YLLA 1OIYA 1JKLA 4EH3A 3E62A 4GK2A 2H8HA 3PPJA 4E4MA 2PVHA 5ETIA 4WNKA 3O23A 3E7VA 4V05A 3VQHA 1FGIA 3TWJA 4NH1A 1XJDA 3JXWA 4IAZA 4DT8A 4ARKA 3H0YA 4WBOA 3SA0A 5CSXA 4I0SA 4AFEA 3MPTA 2VTQA 2GNJA 4RC3A 5EI6A 5KMKA 5BUEA 2WTKB 3FDNA 3OZ6A 4XRLA 4JAIA 5LCKA 2C30A 4R3CA 1VJYA 1U4DA 2XK8A 1ATPE 2OO8X 1FPUA 4JBQA 5A4QA 5K0XA 1ZMWA 3GU6A 3ERKA 4AX8A 4NYEA 4U43A 2A1AB 2V7AA 1DI9A 4N6YA 3KRJA 4OLIA 3PDTA 3SOAA 3R2YA 3UPZA 5T6KA 4RA5A 4RBLA 2JGZA 3COIA 4C38A 1KUTA 1IASA 4BKYA 3E5AA 2YWPA 5EDQA 4YTHA 5EM6A 3O51A 5JZJA 2UZOA 4ERKA 3UO5A 4C4HA 2GU8A 2B55A 3FLNC 2OLCA 4LI5A 2OGVA 4MD9E 4G3FA 3ORKA 4FV5A 5EHLA 4YUQA 3CQUA 2IVVA 3IDPA 2CDZA 2PVKA 5A9UA 3PE2A 3QRJA 4FV6A 3TTJA 4IAIA 4AZTA 3BIZA 3HNGA 4IB5A 2Y4IC 3ORMA 2OFVA 2HIWA 1WMKA 3LFQA 4Z55A 4PDOA 3BHUA 3MW1A 4IZ7A 5E8TA 3QX4A 3R63A 4CQGA 4FV8A 3S0OA 4CCUA 5HO7A 4CMOA 2YA9A 4GJ3A 2JDSA 4BBFA 2EXCX 5FEEA 2ERKA 2BHHA 4QP4A 4FSYA 3KULA 3QHWA 4JX7A 5HCXA 4EI4A 4M15A 1B6CB 5E8WA 3TEIA 2VWYA 3OTVA 5IF1A 5C26A 4C57A 1AGWA 3RTPA 4KIPA 4QP6A 3G6HA 4AW0A 3DBEA 4QYYA 2BFXA 2OF2A 3G33A 2HCKA 3QA0A 4W4WA 4M69A 3GQIA 2JFLA 3W16A 3Q4ZA 2UW4A 3W2PA 4CEGA 4EH4A 3UOLA 4YR8A 3VUKA 4O86A 4RT7A 5CQUA 2X0GA 3TJCA 3GBZA 5ANDA 3BWJA 3FMLA 3VBQA 3EQHA 1BYGA 2W5AA 1U54A 4YZMA 4ACCA 3D2KA 5EHOA 3QTIA 2WO6A 4XOZA 3K3IA 3DT1A 4D9UA 2J9MA 2C47A 2F57A 3BCEA 4QP3A 4F99A 3LKMA 4HZSA 3CPBA 3DDPA 3VUMA 4QOXA 4HJOA 4ZJIA 4ANOA 3RWPA 2GS6A 2B7AA 4CRSA 3MN3A 2VTHA 4DEBA 2BAQA 2XYUA 5FDXA 4S2ZA 3Q4UA 3QWJA 4Y72A 2PVMA 5ETFA 3RALA 3ZM9A 3Q04A 1GAGA 5CAUA 2R3PA 2REIA 3IOKA 1U5QA 3TZ7A 4KNBA 2XK3A 5CF6A 3LHJA 4I5PA 3LFNA 3SDJA 2JEDA 4YBJA 2OW3A 5I9UA 3AGMA 3WF9A 5LMKC 2OIQA 4HCUA 4AT4A 5CEKA 3RHKA 5L2TA 2PVNA 3D2IA 2W1EA 1KWPA 2W5BA 1FVRA 1JVPP 2BRGA 2HXLA 1FOTA 1CKPA 2OJFE 2W06A 3PSDA 5HI2A 2C6EA 3HUCA 3HV7A 4DH5A 4W9XA 5J7HA 3SG9A 3EQDA 3E64A 5FEQA 3RPVA 3EIDA 3DZQA 5BPYA 2JFMA 3DNDA 3H9RA 5IDPA 3OVVA 5C4LA 4MXCA 4J8NA 4BCIA 1VR2A 3QGYA 2ONLC 2UW5A 3MPAA 2PZRA 4QP1A 4YPSA 5HTBA 4FTIA 2R5TA 3PY1A 2BTSA 4NIFB 2HAKA 3Q52A 4RC2A 3TKHA 5M44A 1F3MC 2BZJA 5KKRB 3BELA 3HUBA 3FLWA 3EQIA 4O81A 3C4WA 4O0YA 1YW2A 4NKSA 4JNWA 2VZ6A 4C4FA 3TNQB 3ZU7A 4TWCA 3IW7A 3JYAA 3DCVA 1SYKA 2QOKA 5HNGA 3FY2A 2GCDA 3HLLA 3PSBA 4HNFA 4BZOA 3LJ1A 4ACGA 3F69A 1UA2A 2JITA 4U41A 5CU2A 4ZJVA 4LMNA 4HYIA 5FEDA 4K77A 2R3KA 4CFUA 2QOCA 4M97A 3TZ8A 3LFBA 5HBEA 4ZTHA 3U4WA 5KBRA 3B8QA 3ZBFA 1WBPA 2PVRA 3RM7A 4BBEA 3UOHA 4O0WA 4QMNA 2FYSA 2F49A 2C69A 2F2CB 4UYNA 4ZSJA 3FL4A 2E9OA 3QRIA 4RWJA 2I6LA 2BAJA 2GHLA 2ITYA 3SLSA 2O65A 3K5VA 4DH3A 2QOBA 4JG7A 4DGGA 2AUHA 5FP5A 4EJNA 5K4JA 5EQEA 3Q2MA 4GKHA 2Z2WA 3A4OX 3NUAA 5L6WL 4PPAA 4OR5A 1KE5A 3L8PA 5FQDC 1ZY5A 2HOGA 5EG3A 4Z7GA 3FJQE 4H3PA 2XKDA 5IG1A 1H00A 2HZ0A 2QG5A 3B2TA 2YCSA 3UODA 4E6AA 4HYUA 2R7IA 5DOSA 3OCBA 3R8VA 3TNPC 4KUJA 1LR4A 1O6KA 2VO7A 4QPSA 2P0CA 4BBMA 3FL5A 3FI4A 3UNKA 4EYMA 4LL0A 2O8YA 5CXHA 4D2WA 4BDEA 4UALA 3GT8A 5FG8A 5IUIA 3QZIA 3GUBA 4FTCA 4IJ9A 4EH5A 5EHYA 1PRYA 3VBVA 4OTFA 2CLXA 2OFUA 2PE1A 4RVMA 3DKOA 4EOKA 1RJBA 4C33A 2WOTA 5CVHA 5CU6A 4F7JA 1ZOGA 1BX6A 5CWZA 3NW6A 5ANJA 5J9LA 2LGCA 4I5HA 4IAKA 4TYHB 3UIBA 3V51A 4FTQA 2V62A 3WARA 3KMMA 5IMXA 2NP8A 2F2UA 3TUBA 2C3IB 5I9YA 4KBCA 4C59A 3O8PA 1H1WA 1OB3A 5ICPA 2XRWA 2OG8A 3DDQA 4GUBA 4RG0A 5HE0A 4PQNA 3CLYA 2PY3A 4AOIA 3E3PA 5A3XA 3OFMA 1XH8A 3QQKA 3EQBA 4WKQA 4YZ9A 2JIVA 3LFEA 3AMBA 4JI9A 5GINE 2J0IA 4HYSA 4A9TA 4K6ZA 2PVLA 3C0IA 2I40A 3T3UA 4DLJA 3QFVA 5B2LA 4MXYA 4FIFA 2JLDA 5J79A 1A9UA 5E9EA 4FODA 3MS9A 2H96A 5DR2A 4L67A 5J8IA 3R1QA 3R1NA 1BKXA 3OW3A 3A60A 4FKIA 4AG8A 1YOMA 3D5WA 4ZS0A 2G15A 3BU3A 4RJ7A 2UZVA 5ANIA 5E8UA 4GS6A 4B8MA 4YTFA 2HXQA 4FSNA 5I9ZA 2UW9A 4O21A 5TO8A 2QI8A 4EC9A 1H4LA 2V0DA 5I5ZA 5IQEA 4D5HA 3A7HA 2O63A 4FC0A 4EOPA 4IADA 3MVHA 3KULB 3PWDA 5LVPA 4Y85A 2BTRA 1R39A 3KA0A 1AQ1A 3VF8A 1SZMA 3BU6A 4GL9A 2QNJA 3FMHA 5HBJA 1BLXA 5H3QA 4CVAA 3U6IA 4DITA 5JK3A 5M07A 1UWJA 4M69B 3GC7A 3G51A 4I6QA 4RJ4A 4FTOA 3M2WA 3RAKA 5LMKA 3MFRA 3TKUA 4PPBA 4XNEA 1PF8A 2X7GA 5CX9A 4CV9A 4RSSA 4RQKA 3QA8A 1PJKA 3HGKA 4G6OA 4TRLA 4V01A 2P3GX 4BTJA 3KB7A 2A0CX 5HE1A 4WT6A 3G15A 3E63A 4I4EA 4ZTQA 4MWHA 4QYEA 4FL2A 2FVDA 1M2PA 3GOKA 4OAUC 1E1VA 2R4BA 3EQFA 4CYIA 2PSQA 4AOJA 4ONAA 4F6UA 5KMOA 4O7RA 2OIDA 3CPCA 3PXQA 4MWIA 3IONA 5IH6A 5FLFA 3C5IA 3BQRA 5BX0A 3FZTA 4A07A 2BILB 3MWUA 4M84A 2BZKB 4X21A 4YNEA 5FGKA 1BL6A 2VTPA 2X4FA 3BU5A 1KE6A 2F7ZE 4JIAA 5AR3A 3WE8A 1KOBA 2OH4A 4R1YA 3U4UA 5E1SA 4HVSA 4U8ZA 4EOLA 5DMZA 2B9FA 4EHEA 2RF9A 3GCQA 2OJIA 4IM0A 2W1ZA 5DLSA 4EH2A 2XCKA 2Z8CA 3L9MA 4UYAA 4FSRA 2VWXA 4MVFA 2IWIA 4L7FA 4EOQA 3DXPA 5HOAA 2WFYA 4EZ7A 2E9VA 4U3ZA 3PVWA 3VJOA 4QMYA 3SXSA 4FTTA 4IZAA 1YXXA 3ZLWA 4CT2A 2WQBA 3ZLSA 4O84A 5D9HA 2HELA 5JQ5A 3W32A 4PMPA 4NM5A 3CBLA 4EK8A 3UQCA 3ORXA 4CTBA 5LVNA 3CTHA 3GC0A 4Q2AA 5AR7A 3D5UA 3I7BA 3Q9XA 3JPVA 3H9OA 3NNWA 3OG7A 4KA3A 2XNEA 4BCFA 4WSQA 3R73A 4HGSA 3T8OA 4U40A 4L3PA 2Z02A 4MBLA 1JBPE 2QOFA 3E7OA 5AV3A 3WF5A 3VF9A 3MPMA 4C61A 3IW8A 4FNXA 4QP9A 4F6WA 3M1SA 3V5QA 3MI9A 4QQTA 2PU8A 1UNGA 2VTSA 4LRJA 3HMIA 3FLSA 3JY0A 4AGDA 4USFA 5CF8A 4EWQA 4GG5A 3REPA 3GFEA 1T45A 3FQHA 3GC8A 1K2PA 3KEXA 5C01A 1TQMA 2P2IA 2B9HA 3BHVA 1UV5A 4IB3A 4D4RA 4JS8A 3ROYA 5IQDA 3ANQA 4FTLA 4FVQA 2CSNA 3NUSA 3ZHPC 1M52A 4G16A 1L8TA 3LVPA 3DV3A 4YTIA 5AAFA 1ZZ2A 5IQHA 3OC1A 4YZNA 4WOVA 2UZDA 3R8UA 4OTHA 5L3AA 3NW7A 5GJFA 3IO7A 4F63A 3LMHA 5L2IA 2SRCA 2WOUA 2ITZA 4KKEA 4AQCA 1QPDA 3PG1A 3GCPA 4J98A 1WAKA 4YPDA 5I3OA 4CMUA 3P1AA 2X8DA 1NY3A 3G90X 4WIHA 3BI6A 5AUVA 1OKWA 2V7OA 3C0GA 4PX6A 5JQ8A 4TNDA 3K54A 1NVRA 2CJMA 5DE2A 4APCA 2VTNA 5FXQA 2VGPA 3W8QA 3GI3A 1GIIA 4RZWA 2BR1A 5D41A 3TZ9A 3WF8A 3ETAA 1ZZLA 4C8BA 1W0XC 4O0UA 2Z7SA 3PVUA 3DPKA 5F95A 1KE8A 2R3NA 2PZ5A 1VYWA 1JLUE 3QCYA 3RAWA 1JWHA 5AA9A 3VN9A 4MQ1A 3DJ6A 3PLAE 3RPOA 4XEYA 4O7YA 4XX9A 3CJGA 2P33A 3CC6A 2BKZA 3VO3A 4UWBA 4Y8DA 1PMUA 4MNFA 4RX5A 5JGAA 4LV8A 2JDVA 5K5XA 2YM4A 3ODZX 2WPAA 1G3NA 5IQAA 2RL5A 2VX1A 3V5LA 2AC5A 4XS2A 3C4ZA 4ANQA 4FEXA 4OW8A 3R9DA 3EFLA 3SKCA 4I23A 3PXKA 5AP2A 5J87A 5D1JA 3LM5A 2FSOX 4GU6A 4EYJA 4Y46A 3FHRA 2QURA 2UZTA 2C5YA 1GZ8A 2C0OA 3OEZA 4FEUA 5E8ZA 3MH3A 4TPTA 5I4NA 4DCAA 4F1MA 3I1AA 4F0FA 4BI2A 5DT3A 3IG7A 4QYHA 1OMWA 3SVVA 4BI1A 1GY3A 3N51A 4P7EA 2GQSA 4HVDA 3PA3A 4RQVA 2ZM4A 2PUUA 5IH5A 2OJGA 3ZBXA 4P2KA 3UZPA 4EK6A 4FV0A 4BGGA 1WBOA 2WGJA 3PZHA 5AX3A 5HNBA 4IM3A 4DFZE 4ZP5A 4K18A 4NFMA 2G2IA 2IN6A 4YJVA 4YJSA 4DBNA 1V0OA 2B9JA 4YC3A 3HA8A 4DFLA 3A7IA 4KKGA 4X3FC 4HZRA 5L2SA 3COHA 3D7TA 4HOKA 2WB8A 3EH9A 2BDWA 3FI3A 1YI4A 1SMHA 2UZUE 2RG6A 2VWBA 3CIKA 3OROA 3R00A 3THBA 3FBVA 4DH8A 4ENXA 2QOQA 3UBDA 5HLWA 1Q4LA 3TL8A 5GJDA 2W5HA 4JL9A 4Q5HA 2J0JA 4K11A 4UMTA 1WVXA 1Z5MA 4X2FA 5H9BA 4J1RA 4EOMA 4YP8A 2XJ2A 5E1EA 4BB4A 4CT1A 4ZK5A 2EXEA 5FXRA 4RX7A 4YSJA 5KMJA 4J99A 4XG4A 2Z7RA 3AD5A 5AUUA 4RFYA 4G3DA 1XKKA 3DNEA 4HPTE 3MY5A 3OY1A 4L8MA 3UG2A 5BUJA 2IJMA 5CEOA 2VRXA 3ZONA 5E8VA 3QC4A 5AX9A 1ZWSA 3FZRA 2WMWA 1CDKA 5IEVA 4F08A 4MXOA 2XNMA 3E8DA 2VNWA 2C5XA 2PUPA 3NCZA 1Y91A 2WMTA 2OU7A 3OT3A 3P08A 2EB3A 4I41A 5HGIA 3RK7A 5A4TA 4CYJA 1OGUA 4BCMA 5DYJA 4OBQA 2R3MA 4HVHA 5JT2A 2QKRA 2X39A 4KIQA 5L8KA 3FMEA 5AFVA 3JR1A 4CQEA 4YMJA 4TYGA 4ZOGA 5IH4A 2GQGA 4N4SA 2UW8A 5CSPA 4ORKA 1YOJA 4R78A 5M53A 3WZDA 2RGPA 4U3YA 3TNWA 2IZTA 4I21A 1RQQA 4FZ7A 4NWMA 1XWSA 4KS8A 2QCSA 4ZEGA 2F7EE 4BDCA 1PXOA 3HP2A 3ZMMA 5JH6A 3NUNA 4QPAA 3R7VA 3BLRA 3I0OA 5GHVA 5HD7A 2PYWA 3UP7A 4TYIA 5J95A 4JR3A 4KRCA 1OIQA 4XHKB 5E8SA 4USDA 3KQ7A 4DFXE 2OH0E 2OSCA 5BMSA 2Q0NA 2PZPA 3FMDA 4FSZA 3R0TA 5AR4A 3AC8A 3MH1A 4FX3A 4L01A 4O27B 3IGGA 4D0XA 3CD3A 3NPCA 4Y95A 4S34A 4W4XA 3UGCA 3PE1A 4GG7A 5DT4A 4JX3A 4W4VA 3RPSA 4OAVB 3QQLA 4X3JA 1Q8YA 3WYXA 5HTCA 3FV8A 3EWHA 3KGAA 5AR8A 5M56A 4AA5A 3I4BA 4FKRA 2J0KA 1NA7A 4XP2A 3R7EA 3RAHA 3VRYA 1IA9A 5DRDA 4E73A 4ZSEA 4BCQA 4E6CA 4J97A 4JDIA 4JBVA 5M4UA 4TYJA 2C6KA 4ACMA 2AC3A 2YITA 3PY0A 4XBRA 1K9AA 3PA5A 5CU0A 2QOIA 5JGBA 5AP3A 3QRKA 3QCSA 4DLIA 2X2LA 3G0FA 2JKQA 4I5CA 1HOWA 3NNVA 4G34A 3PRIA 5E8XA 3R21A 1LEZA 1OECA 4YLJA 5KMMA 4IHPA 1CKIA 3VAPA 4EL9A 2IZSA 3AT3A 5BYLA 3NMUF 4CLIA 3OEFX 4DEEA 3QQJA 1B39A 2IG7A 2QQ7A 3V01A 2YISA 3MVMA 1R0PA 2WQOA 2X6DA 1PKGA 3DK7A 4WHZA 5BVKA 3R9NA 2I0YA 3S2PA 2GQRA 3NX8A 4ZMEA 5DI1A 3QLGA 3NIEA 3QXOA 4O1PA 4IEBA 4F1TA 3MGYA 5H8BA 3COMA 3KCKA 1Y8YA 2GS7A 3HZTA 3R02A 1XR1A 2PUIA 5DIAA 2XEYA 4GKIA 2BHEA 2V5QA 5HD4A 2CNQA 4GIHA 2O0UA 4AGUA 3NNXA 5E4HA 2GNHA 2BZIB 1FQ1B 2HWPA 5D11A 3R8LA 3RI1A 4JLCA 4F64A 2QO2A 2ETKA 5ETAA 3ULZA 1A06A 4M8TA 2OZOA 2PZIA 4RX9A 5EK7A 5FD2A 3A2CA 4ALVA 5KCVA 4IC7A 1ZLTA 4CRLA 4GV1A 4MX9A 5EOLA 2ZDTA 3HRFA 2EU9A 3BX5A 4M67A 2J5EA 2XNBA 4TT7A 2PWLA 4TZRA 3OT8A 3GENA 1GIJA 2DWBA 4B0GA 1DI8A 3ZEPA 4LRKA 4LOQA 1P4OA 4QYGA 5CVGA 1CMKE 2VN9A 2YEXA 3PPKA 4LOOA 5L6OA 5IQBA 5HQ0A 5DGZA 3D9VA 2W4JA 3ZO2A 2WZJA 2HW7A 3LQ5A 5AADA 2VTJA 1XQZA 1WFCA 2J6MA 4AZVA 4YJOA 2VTMA 4FSMA 1Q5KA 3UC3A 1I44A 4BC6A 2A19B 4PPCA 3PZEA 4J96A 4NM7A 3V5WA 3FWQA 4E20A 3GCVA 4AUAA 5DRBA 3R9OA 2G2FA 4EORA 1IAJA 3CXWA 3R1YA 2DUVA 1LPUA 4RIWA 2Y6OA 2QD9A 3V3VA 4DAWA 2ZAZA 4DTKA 2FB8A 3RK5A 2OWBA 4BIDA 4ITJA 5DWRA 4XP3A 3K3JA 3ID6C 5EYMA 3NAXA 5J5TA 4BIBA 2QOLA 3KREA 4LGHA 4V04A 5KNJA 2ITPA 3P78A 1VYZA 2UV2A 4I6BA 4MNEA 3QD4A 2W1IA 3GCSA 4FKVA 5GIPE 3AT4A 4H36A 1O9UA 1YQJA 4IJPA 3ORZA 1QPJA 4EKKA 4BKJA 5CEPA 2WELA 1TVOA 2ZV2A 1H28A 4UMQA 2B53A 2O64A 2VV9A 2XNGA 3CTQA 3QRTA 1DAYA 4HPUE 3VS7A 4IBMA 3RHXA 2VTRA 3FPMA 3KRWA 4CXAA 5JFSA 3KN6A 4BDBA 4DGOA 4TW9A 4DFBA 2RG5A 4GT5A 4C35A 4O0SA 3UDBA 5DHJA 4O22A 4DGMA 1EH4A 4R5SA 5CLPA 1PXLA 2FSLX 4QMLA 2HY81 1PYXA 3EFJA 2HY0A 3JVRA 3AT2A 2WTVA 3R7OA 5HX8A 3DJ5A 4FF8A 4ZZMA 4BWXA 4ZLYA 3DBCA 3Q6WA 3JS2A 2VTAA 3ZH8A 3PJ2A 2GFSA 4M14A 2DS1A 2BRMA 4XG8A 2C6TA 2HENA 1H27A 2C1AA 4H05A 4WNOA 1BI8A 2E9PA 2BFYA 2ITTA 2UZEA 4TWPA 4E93A 4K33A 4L44A 4RFMA 3PP0A 5AUZA 5AP6A 3EJ1A 4U9AA 5FTGA 5IQIA 3SW4A 4QP7A 2J2IB 2C3JA 4BVUA 4F70A 1S9JA 3GXLA 3P4KA 4FKGA 3ALOA 2PHKA 5F94A 1IA8A 3KRLA 5E7RA 5EM5A 3R7UA 3RAIA 4BTMA 2ZMDA 3R71A 4O7SA 2ETRA 4C3FA 5A6OA 1WZYA 3G0EA 4PRJA 1R78A 3FE3A 1I09A 2Y6MA 5HTIA 1PMNA 2C5NA 3VS0A 3WZJA 4PDYA 3KXGA 3F3TA 2CKPA 1Q99A 4QD6A 4IW0A 2YAAA 2GNFA 2YIRA 5CSWA 1JQHA 4BDJA 3VBYA 4EHGA 3UIUA 3HAVA 1YDTE 1ZRZA 2YDJA 3O8UA 4NU1A 3WF6A 3HECA 4BDGA 4JJRA 4YJNA 4I3ZA 3A7FA 2Y7JA 2YM6A 2WTJA 5AV0A 3DXQA 3Q9ZA 4APPA 5D7AA 5CYIA 4OUCA 4IB1A 4OT6A 3MIAA 4C02A 5CSHA 4LGGA 4RJ3A 4DFUA 2GMXA 5L6PA 4XUFA 3WZEA 2FGIA 4YURA 1XH4A 4B7TA 4E4XA 3FHIA 4LM5A 2XIYA 5JEBA 4R7BA 1GOLA 4ZTMA 1CTPE 5HG7A 5I9VA 2UW0A 4AN3A 3RPYA 2C68A 3ET7A 3PIYA 2ZOQA 3LLAA 1ZYDA 3MYGA 3FUPA 3ODYX 4F7LA 1M14A 2C5VA 1SVHA 1IRKA 3AC2A 2XIXA 5FBOA 3VUTA 4OTGA 3E93A 2UW3A 4IC8A 4M0ZA 3HRCA 3KKVA 3HYHA 3ROCA 5C4KA 4ZY5A 4RWKA 1E1XA 2JKOA 2PL0A 2X7OA 4GUEA 4BWPA 4E3CA 2XBAA 1T46A 2QC6A 5KX8A 2XIZA 4FT3A 5GIOE 3QF9A 5IKWA 2CHLA 2CMWA 3BV2A 1J3HA 2EB2A 2X9FA 3O7LB 5ACKA 1Y6AA 2YM3A 4ZSAA 3PXFA 1FBNA 3GCUA 4NEUA 3QTUA 4IAYA 3IPHA 2VWVA 4ASEA 5HIBA 2E9NA 3D4QA 3D94A 3I5ZA 4UMRA 2UUEA 3NEWA 4C0TA 4CFNA 2BVAA 1J91A 3C13A 2Q0BA 4CNHA 3P23A 4JRNA 3L8SA 2P2HA 2WQMA 1MRVA 4YZDA 3VRZA 4ENYA 5CZIA 2Q83A 4RPVA 4M7IA 3VW6A 4ZXTA 3LFCA 4NW5A 2WXVA 4PNKA 3ZFYA 3ATSA 2PK9A 5IA4A 4G3GA 5HNIX 4U81A 1OI9A 1KV2A 4HCTA 1OBDA 3D5VA 2WU7A 4D4SA 4D55A 5AUTA 3MB7A 3MTFA 4PL3A 3RMFA 4AW1A 2JC6A 3OOGA 3HV3A 3BZ3A 4NK9A 4UEUA 3JVSA 3C5UA 3PA4A 4FGBA 4A9RA 3SG8A 2PTKA 3R8MA 2X2MA 3C0HA 4NCTC 4RVTA 3OMVA 4L68A 4KSPA 3Q4TA 5CALA 1OL1A 1XBCA 2GDOA 1Q41A 5CEQA 5I9WA 5EQYA 1Y8GA 4XV2A 3OOMA 4ALUA 5AV4A 3QUDA 3VULA 5G1XA 1PW2A 3E92A 5IISA 4FK3A 1Q62A 3AXWA 4ZLOA 1OKYA 4V0GA 4PMTA 3UO6A 3TDVA 5HU3A 4IWOA 3P7CA 3ZCLA 3C9WA 3FYJX 4UY9A 4EQUA 3NZ0A 3ORTA 5KBQA 3LXNA 5M51A 1NW1A 1OVEA 1FMOE 3IECA 4D2VA 1MQBA 3D83A 4D4YA 3UJGA 2R3JA 1YRPA 3P7BA 3QYZA 1IAHA 4IDTA 3VS4A 2XP2A 4QT1A 4L53A 4L9IA 3C4XA 5EOBA 3PUPA 5A4EA 4MD7E 5CT7A 1NVSA 2I0HA 4X2JA 3FI2A 3LCKA 5HG5A 2YM8A 5DBXA 4EK4A 4BCJA 4C3RA 3KL8A 2J90A 5FDPA 4O7LA 1Z57A 4GIIA 2YLEA 4GVAA 1KSWA 3MJ2A 3R28A 2W9FB 2VD5A 3RNIA 2ITXA 3HMNA 3MSSA 1OM1A 3PXZA 4R5YA 4E6DA 3TZMA 3KY2A 4ANBA 3P7AA 2RFSA 3BYMA 4FIIA 4R8QA 4JBPA 3W33A 4ZTNA 4QMQA 2HZ4A 3F3WA 3L9PA 4L3LA 5AM6A 4IAAA 4O7VA 5LARA 2EVAA 4PNIA 2C1BA 4RIOA 3R1SA 4B4LA 5JGDA 2YFXA 2JBPA 3FLYA 4O96A 4AU8A 5J5SA 3AC1A 4L52A 3KMUA 5DFPA 4AA4A 3I5NA 1TKIA 5FP6A 5KMIA 2WIPA 2QU5A 1W98A 3FSFA 4JVGA 4UV0A 4DH7A 3ENMA 3P5KA 5M57A 3FXXA 4MXXA 5C8MA 5G6VA 5L4QA 1BMKA 3QTRA 4AS0A 1WVWA 4BKZA 2ITOA 2XS0A 4FL3A 4EJ7A 1O6YA 4RWLA 3SD0A 3KCFA 2QU6A 4EBWA 4AZEA 3OD6X 3QQGA 3MH0A 4YO6A 4F9AA 2CNVA 4FG7A 3CY3A 5AR5A 2BMCA 1BUHA 2C3KA 4AP7A 2IVUA 1YHVA 3F66A 5K5NA 3F9NA 1UU9A 4OBOA 3VVHA 4A7CA 2PE0A 2GFCA 4QMOA 2W4OA 4JOAA 3WBLA 4AW2A 2RIOA 4G6NA 1U54B 1PXPA 3F3UA 4FI1A 3CR0A 3BYUA 2RFEA
chains in the Genus database with same CATH superfamily
3RINA 3QU0A 4BZDA 3WI6A 5EW9A 4MEDA 5HG9A 4XOYA 3CS9A 4BL1A 4E1ZA 5HVYA 4U0IA 1YKRA 4FOBA 4JQEA 2ZV9A 2ZMCA 4KABA 4RIYA 4AE6A 2ONLA 5AA8A 2R3RA 4O2ZA 3HMPA 4B8LA 2W0JA 3VS6A 4WRGA 3SQQA 4RJ6A 3RZBA 4DHJA 4LL5A 1O6LA 2G01A 4LV5A 4WD5A 3UC4A 3BWFA 4J71A 3AG9A 4MD8E 2YACA 1JKSA 2EWAA 3RBWA 1YWRA 2RKUA 4I92A 3Q53A 4A06A 3ALNA 3UMXA 3FKOA 2YDKA 4YC8A 1M7NA 5K3YA 3LE6A 3TTIA 2WTKC 2VTOA 3KFAA 4M68A 4RLKA 4ERWA 1Q24A 3EMGA 4S30A 4IQ6A 3KK8A 3R7IA 3TG1A 5JRSA 4MTAA 3E8EA 1R1WA 3MVLA 2WMSA 3PJ8A 2R3QA 2XALA 3PSCA 3QALE 4C62A 3L1SA 2W1DA 2XEZA 2PPQA 3W2SA 5B0XA 2HZIA 3F82A 4FNWA 3R8PA 4BZNA 3L8XA 3JUHA 4F4PA 4F9WA 3PJ3A 3W10A 2WMUA 4FIGA 3TKIA 3H10A 3F5UA 4QMXA 5CU4A 2W96B 3WIKA 5CTPA 1DS5A 3BYVA 3O50A 4PTEA 5EKOA 2CKEA 3QX2A 4DHFA 4USEA 4O2PA 1YXVA 4DGLC 5BNJA 3R83A 4DG0E 4ZLZA 3ZS5A 4GYIA 1URCA 4MF0A 4O4BB 4XG6A 3T3VA 3VC4A 5CAOA 3U8WA 4PTCA 4WNMA 2W4KA 2J5FA 4ZIMA 3IQ7A 4JG6A 1DM2A 4F1OA 4BWKA 4KIKA 5KO1A 5IUGA 3V8TA 3BPRA 4TYEA 3T9TA 1FMKA 2VWZA 1H01A 4FBXA 5IA3A 1QPEA 1MP8A 3O7LD 4YO4A 3GGFA 2BZHB 2PMOX 3DQXA 2E2BA 1G8SA 3GU7A 4NUSA 3BGZA 4N70A 5AAEA 2V22A 3PVGA 5AUXA 3KRXA 2ZB1A 3CEKA 3EFKA 3MFTA 2IVTA 3WF7A 1X8BA 4KD1A 4RIXA 2WEVA 3BLHA 3FXZA 4I6LA 3C50A 4DGNA 2B1PA 3HAMA 3VS5A 4OBPA 2VU3A 3A8WA 2CGUA 5DNRA 2JDRA 2PZYA 5EM7A 2GS2A 2YIYA 3EZRA 4FIEA 3GU4A 2X9EA 4GT4A 4OTIA 4ANNA 4C37A 3LCSA 3QQFA 3K2LA 4PMSA 3UMWA 3DAJA 5ANGA 4BGHA 2BRHA 3NDMA 4UMPA 4YJPA 4D2TA 4MXZA 3OWKA 1GZOA 4BDFA 4U7ZA 2ERZE 3VS1A 5AP1A 3KN5A 2CGWA 5IZFA 2VGOA 1J1BA 3HX4A 4RZVA 5IDNA 5M09A 3PPZA 4G1WA 4ZJJA 3QBNA 3TV4A 4BI0A 3BBTB 4V0GB 4QMVA 4I0TA 2YHVA 1TQPA 4FT0A 1OPLA 4DEDA 2VUWA 5DEYA 2H9VA 2WTIA 2Y4IB 3ACJA 4IX5A 4O0XA 3CP9A 1ZARA 4O0VA 4WUAA 5TE0A 5TT7A 1KV1A 4IM2A 3ZLXA 3O8TA 4ANSA 1ZY4A 1PXKA 2R0UA 2GNLA 4JBOA 2YM5A 1GZNA 3F61A 4ZZOA 5LMAA 1ZAOA 5CZHA 5BQ0A 4DA5A 4QRCA 2O2UA 3UOJA 3W0MA 3CQWA 1JSTA 4WG4A 3ZRLA 5IPJA 1NXKA 1FGKA 2XNNA 3PJ1A 3OS3A 2CCHA 3C4FA 3RJCA 1ZYJA 4HGTA 4DDIA 4LOPA 2B0QA 4DF3A 1IEPA 2ACXA 5AUWA 2W1HA 3VHKA 2VTIA 3W2RA 2ITQA 4CFXA 3JY9A 3EN7A 2WEIA 3F3VA 4X7QA 2P4IA 2ETMA 3NYXA 3OF0A 5BVEA 5AJQA 3N4UA 3G2FA 1QPCA 1P2AA 3I6UA 5IUHA 2YJSA 3UDSA 2R3GA 3QAME 4CMTA 4G2FA 1PKDA 3IKAA 5KKRC 2XA4A 4A9SA 4AE9A 1H8FA 4ZZNA 4IAFA 3G9NA 2QR8A 3GVUA 4FR4A 3TM0A 4HGEA 2IZRA 1UU8A 4IX4A 4I4FA 5FBNC 2W1FA 2Y9QA 3ZXTA 2X6EA 1YXUA 4C4EA 5LVMA 1UWHA 4MKCA 1W8CA 4Y5QA 4EOIA 4RMZA 2C0TA 3KRRA 4EH6A 1H26A 3PJCA 3R30A 2JDTA 5KUPA 3N9XA 1W7HA 4BDHA 4BIEA 2YLFA 4FKPA 4OTQA 1M7QA 1NT2A 4LMUA 3WZUA 1JKKA 4A4XA 3V5PA 4YNOA 2QONA 1WBSA 5GZAA 5LJJA 1OUKA 2Y0AA 3FMJA 4IVDA 2R3OA 2J4ZA 4UB7A 4D0WA 3A99A 4YZCA 2NPQA 5DT0A 2NRUA 3KC3A 3ORIA 1OUYA 3ZZEA 2R3FA 4C4JA 5IEXA 3FKLA 4BFMA 3FMNA 2E9UA 2P55A 4QMTA 2ITNA 1JNKA 2R64A 3QRUA 3UZTA 4UXQA 3NFGB 4NT4A 5LWMA 3ORLA 2G1TA 4FNZA 4ITHA 4RIYB 3DBQA 2XUUA 5AP7A 4TNBA 5FM2A 1UNHA 3PWYA 4L42A 4DCEA 5IMEA 1XH9A 3PYYA 5H2UA 4MCVA 2XAMA 3WOWA 2FSTX 3TJDA 5M4IA 2W05A 2CKQA 4EH9A 4ASDA 4L00A 5CI7A 4YC6A 2YJRA 1JAMA 3GC9A 2A27A 3EYHA 5B2KA 3HVCA 4EH8A 3DGKA 5BVFA 5KMLA 3LW0A 4IX3A 3F2AA 4QYFA 2G9XA 4RRVA 4TL0A 4ANMA 2G2HA 2UZBA 2WMQA 1ST4A 4XYFA 5IU2A 4HNIA 3Q6UA 3QZFA 5C03A 3SRVA 2VNYA 2VTTA 4FG9A 4KS7A 5KZ0A 4O7NA 4XLVA 2B52A 5J1VA 5HIEA 5C8KA 2QOHA 3DXNA 3LM0A 2BPMA 4FE2A 3UYSA 4UX9A 3KXNA 5HIDA 1OL5A 2X1NA 3OXIA 4KAOA 4EQMA 3UG1A 2XJ0A 3FZSA 4R77A 1U5RA 2H6DA 3T9IA 1YI6A 2QR7A 4EKLA 4NFNA 4O0RA 4YGAA 3QKKA 5IA5A 3KXHA 5M4FA 4GMYA 4KINA 2HK5A 3MY0A 5AM7A 3Q9WA 1ZMVA 2WTCA 4GH2A 4EC8A 4YJTA 2IW8A 3DBDA 2FO0A 3EOCA 4YBKA 2QKWB 3NSZA 3KF4A 4RC4A 4BCGA 2C6DA 1XMLA 5JFWA 3EB0A 1KE7A 3OP5A 5GZ9A 4W8DA 4CD0A 2JIUA 3NLBA 3ZC6A 4QTDA 4B9DA 3SX9A 3KVXA 3EN6A 4BYJA 4JAJA 4GW8A 4E5WA 3W0OA 2GTMA 4GRBA 2XZSA 4P4CA 2KTYA 4X6RA 5HEZA 5T3QA 2C4GA 5HVKA 5FTQA 3U55A 5DG5A 2KULA 3UVPA 4NW6A 4G9CA 3OCGA 4XG3A 4QQJA 3II5A 4H3QA 4RIXB 3VBWA 4A9YA 4ZTLA 3W8LA 2XH5A 3SHEA 3NVKI 4KKHA 2QLQA 3OXTA 4NM0A 4D5KA 3RP9A 4J8MA 3FSKA 3LFSA 2GTNA 5CNOA 4ZAUA 4HYHA 3A8XA 5AWMA 4DE4A 2RFNA 3PXYA 4J95A 4DC2A 2XVDA 3FZOA 4BN1A 5HLNA 1JOWB 3GNIB 2R2PA 2Y8OA 3GOPA 4FTRA 5K9IA 3UVQA 3MH2A 2IVSA 2BIKB 4BICA 2WU6A 3ZRMA 4Q9ZA 1REKA 2RFDA 3DKGA 1H25A 3F88A 4I0RA 5TOZA 3QD0A 3QZHA 3ZO1A 4NTSA 4U6RA 1XH5A 5ANKA 2OKRA 4K8AA 3OXZA 4IMYA 5CVFA 3ELJA 4IX6A 4DN5A 1IG1A 3U9NA 2IZUA 3LFAA 1U46A 3F2RA 2ZVAA 4GCJA 2C0IA 4UZDA 3BYSA 3KIOC 4LYNA 3KK9A 4X3FA 4X0MA 4AW5A 2R7BA 4D4VA 4EZ5A 4F0IA 2QOOA 3HV4A 5HX6A 2OXDA 3O96A 2WQNA 2I0EA 2YCFA 4D1XA 5L8LA 1Y57A 3NYVA 3Q4CA 1MRYA 3EQPA 4CFVA 4XRJA 2XNPA 3NUXA 3VUDA 3VJNA 3EQGA 3CQEA 4PL4A 3QC9A 4YJRA 4KWPA 3LIJA 4QDVA 4FV2A 4DH1A 4U5JA 5BMMA 2XIKA 4FSTA 4KSQA 4PDPA 1NVQA 4QP2A 3FC1X 1WBNA 2BDFA 4J52A 3EFWA 4LGDA 3ZUVA 2O5KA 3EKKA 3EN4A 1ND4A 1OKZA 2B9IA 5DVRA 1Q3WA 3R9HA 4IANA 4ZTSA 1H08A 4QTBA 2BALA 1RDQE 3C51A 4FKTA 5F4NA 5D12A 5JRQA 3BBWA 3DTWA 3FMKA 3A62A 3I7CA 2F9GA 2QO9A 3D7TB 4MK0A 4HVGA 1Z9XA 2WIHA 3PY3A 3IK3A 4I22A 4CFWA 3MVJA 2V55A 4NM3A 1OITA 4QQ5A 3NUYA 2WTDA 1VLRA 1TZDA 5EI8A 2Z7LA 4QMSA 4IXPA 3WIGA 3VHEA 3ML1A 5LVLA 4KB8A 4I6FA 5EYKA 4WG5A 3QTXA 4JDHA 3RWQA 3ZUUA 3VUIA 4QMUA 4FV4A 4TYHA 3I60A 2DYLA 3AOXA 1OL2A 2YZAA 4QEBA 4QNAA 3MBLA 1WBWA 3CJFA 4N6ZA 3OWLA 2WAJA 4RVKA 5AP0A 4Z7HA 4U79A 3AKLA 2OJ9A 1LP4A 5CENA 5F20A 3FZ1A 4FV7A 4JG8A 4R6VA 4GFGA 3FC2A 4FIJA 4IWQA 3VBXA 4PV0A 4XP0A 2WMBA 2WMXA 3C4CA 4DFYA 1J7LA 2RSVA 3P0MA 4JDJA 5FXSA 3ZSIA 3D5XA 3LCTA 4XLIA 3PIXA 3TIZA 4C2VA 3UPXA 2CGVA 1CKJA 4FT7A 4DEGA 2O3PA 4FTMA 3PFQA 3W2QA 1OL6A 2BCJA 4YHTA 3QUEA 3TV6A 1BI7A 4EK5A 1ZYSA 2YDIA 4IZ5A 3R7YA 1V0PA 3AMYA 4LQMA 4FTUA 4LRMA 2XRUA 4GK3A 4CZTA 4D2RA 4IWPA 5AP5A 2PMIA 4DFNA 3R9RA 1GZKA 5EDRA 4DINA 2YWVA 3VIDA 3FQSA 3SRVB 5LWNA 5E92A 3O71A 4FGRA 4PTGA 3QTZA 4R3RA 5LXMA 3RK9A 4K2RA 4E5AX 2CGXA 3ZDUA 3O0GA 2WQEA 5FTOA 5CEIA 3MY1A 2YZLA 5DEWA 4MBIA 1Q3DA 3EN9A 4O91A 3DKFA 1BL7A 3TIYA 4D28A 4E4LA 3I6WA 3R01A 4PF4A 4W8EA 3QHRA 4XV1A 3ZRKA 4O7ZA 3E3BX 2PVYA 3PLSA 3AQVA 4G5JA 5HORA 4QMZA 3Q9YA 4CSVA 5HU9A 4R3PA 1ZOEA 5EW8A 4FEWA 3KF7A 5AV2A 4AOTA 3IW6A 3PFYA 3L8VA 1IR3A 2YN8A 3LLTA 1GJOA 2F4JA 4FVPA 1UKIA 4NTTA 5TR6A 4MQ2A 2XK7A 3O2MA 5HCZA 3KMWA 3ULIA 2YM7A 2X8EA 1QCFA 2JBOA 3BHTA 3NYNA 3R2BA 4AZFA 5AMNA 5HZNA 4FK6A 1Q8WA 3PG3A 2ZDUA 2XKEA 3ZSGA 4GFMA 3DAKA 1L3RE 2DQ7X 3PIZA 4YSMA 4DEHA 3VBTA 3EZVA 3CGOA 3VUGA 4XMOA 4WRSA 5HE2A 3UIMA 1PHKA 5ACBC 2R9SA 3FZPA 3ZFXA 5K4IA 4GU9A 4P5QA 2CNUA 3MA6A 4QQCA 4E4NA 2QHMA 4AWIA 2W17A 5HLPA 1H0WA 3LXKA 3HDMA 3Q96A 4E8AA 5EQPA 2W9ZB 4S32A 2YCQA 4II5A 2ESMA 4EONA 2QVSE 2XYNA 2IO6A 3DKCA 4WNPA 4O6LA 4BCNA 2CKOA 5IQCA 4FSWA 3MESA 5L8JA 2WTWA 1YWNA 4LUDA 3FPQA 2OJJA 4M66A 4FKOA 3Q5ZA 4CGAA 4ASZA 2ZB0A 2GHGA 1VZOA 4O6EA 4Z3VA 5CQWA 2NRYA 5BUIA 4XH6A 3OY3A 3LMIA 5IEYA 3OBJA 2BDJA 3R22A 3M11A 3QD3A 2YIWA 2QG7A 1PYEA 2IW6A 5KHWA 4O38A 4QPMA 4N0SA 5E8YA 3LXLA 4O0TA 4FICA 3RKBA 4F0GA 1PMVA 5A4CA 4IH8A 2ITVA 3S3IA 3ZZWA 3UIXA 5AEPA 4FKQA 4AQKA 4X3FB 5DR6A 5IQFA 2VWWA 3DK6A 3ORPA 4NJDA 4NKAA 4BCKA 4EOSA 1RE8A 4PUZA 4FZFB 1CSNA 5BVWA 3DB6A 4FOCA 4FVRA 3SC1A 4QO9A 4DYMA 3S00A 1PXIA 1H1QA 1ZMUA 1J1CA 2VWIA 3NUUA 5JSMA 3CKWA 3K5UA 4CG8A 4M12A 2OZAA 3H3CA 2ZV8A 1B38A 3LJ0A 4M0YA 2XMYA 3NS9A 4FZ6A 2XK9A 4RGJA 4CG9A 4X2NA 5CEMA 3BL7A 4DTAA 2X0QA 3QGWA 3UOKA 1JSVA 1HCLA 4L45A 1FINA 3DU8A 4PP7A 4XBUA 3GU5A 4CTCA 4RIWB 3PTGA 1Q8ZA 4R7IA 2C6MA 5EFQA 3LXPA 5A4LA 4H39A 4X2GA 5E90A 3FMMA 4FYOA 4YTCA 1Q61A 3P79A 4IWDA 3RVGA 2OICA 4ZY6A 2JDOA 2ZM3A 2A98A 3I79A 1PXNA 3KXMA 5H8EA 3HL7A 4TY1A 3W2OA 5HESA 3D14A 3DB8A 3LQ8A 3SGCA 4YU2A 3BV3A 2C6LA 3EN5A 3DOGA 2XNOA 4I94A 2VO6A 3A61A 3NRMA 4FTNA 3HMOA 4MNEB 3QCQA 3DFCB 1QL6A 1K3AA 4OTPA 4BDIA 4U80A 4CCBA 1AD5A 3BEGA 2BRNA 4Z9LA 5HVJA 3VNTA 4BHZA 3BKBA 1PXMA 4H1MA 4AXAA 5CSVA 3OUNB 4TTHB 4D1SA 4CZYB 4EOOA 4ZY4A 5HBHA 3DS6A 3BQCA 4RX8A 4QP8A 4IZYA 2GPHA 3F7WA 3ZFMA 1MQ4A 5AAGA 5L2WA 3QTQA 2WD1A 3L9LA 3UYTA 5AV1A 3QUPA 4P5ZA 5T68A 3CTJA 4QTEA 4AF3A 3KU2A 5C8NA 4BTFA 1S9IA 2GNIA 3H9FA 4TN6A 5LVOA 2R3LA 5M4CA 5D7VA 4BDKA 4LG4A 4OTDA 4I20A 4R1VA 3F5GA 3HKOA 3EL7A 4PWNA 5ANEA 3RM6A 4R7HA 5B7VA 1SVEA 3CSVA 4BYIA 4UWCA 3MB6A 5CAPA 1WVYA 2ITUA 1YXTA 4Y83A 3ENHA 4I24A 4MHAA 3PP1A 4GFOA 2IEWA 5AIKA 2XK4A 2UVZA 2CN5A 4KIOA 2PUNA 4GEOA 3ZLYA 3F7ZA 3G6GA 3GP0A 4RFZA 3H0ZA 3WE4A 4DG3E 3AD4A 2NNWB 2UW6A 4U97A 3V8SA 2QHNA 5J1WA 4ALWA 3IGOA 1P5EA 4RA4A 2GNGA 4ASXA 4I6HA 3N4VA 4QTAA 4ANLA 1V1KA 1J7UA 1OPJA 2UZWE 4CZUA 1YVJA 3LZBA 4GT3A 4Y5HA 2ZJWA 3Q60A 4EQCA 4AT3A 1XH6A 4J53A 5BYYA 5C1QB 3ZO3A 4DTBA 1REJA 3IW5A 5GNKA 3V04A 4F9YA 4Z16A 5M55A 4YZBA 4JRVA 5F1ZA 4D2PA 4H1JA 4D9TA 3ZEWA 4HGLA 2UVXA 3SXFA 4E5BA 3NVMB 2UZNA 4RVLA 4FZDB 4B99A 5BVOA 3AD6A 4AA0A 1TQIA 3P9JA 4EUTA 5CANA 1UU3A 5CF4A 2CPKE 2VWUA 3QD2B 3S4QA 5LQFA 3U6JA 3TACA 2I1MA 5CAQA 2R3HA 4F9BA 4BR3A 3FI8A 2B54A 1H1RA 4BHNA 4S33A 4M3QA 4XJ0A 4UMUA 5GJGA 1JKTA 2CCIA 3F5XA 5CT0A 3BYOA 3SV0A 3U87A 3ZUTA 1APME 2HWOA 3VONA 4HVIA 2GHMA 5ANOA 1M2RA 1RW8A 5EYCA 2J7TA 5I3RA 3AKKA 2QO7A 4O7WA 3SOCA 3OW4A 5EM8A 2QODA 4GSBA 3UO4A 5DPVA 5A54A 3O17A 3AC4A 3QYWA 5F9EA 1SNXA 2F7XE 5H8GA 3BE2A 1F5QA 3V6SA 4FT9A 1XHAA 3TT0A 4WA9A 2VTLA 4AFJA 3NWWA 3QXPA 4JIKA 2I7QA 3UE4A 2FUMA 3VUHA 2X8IA 4FT5A 4IFCA 5ETCA 1YDSE 2VO3A 4P90A 3U51A 5BVDA 4TKSA 2ITWA 1JSUA 2ZYBA 5HO8A 4LDTA 4WUNA 1W82A 2IW9A 3C7QA 3S95A 1VEBA 2XF0A 4OTWA 4ZTRA 3NNUA 2W99B 4EWHA 3COKA 4DT9A 3ZM4A 2Z60A 3QZGA 4KBKA 4OT5A 5M08A 4IVBA 1FVTA 4FG8A 2OBJA 2W1CA 4BRXA 4GJ2A 5A46A 1Q8UA 1OIUA 3MDYA 4ACHA 5LOHA 2YABA 3OWPA 4NCTA 5TKDA 4FSQA 3V8WA 4QNYA 2J50A 1V0BA 4W9WA 3ZTXA 4FA2A 2PMLX 3HMMA 4FZAB 3W1FA 3HV5A 3W2CA 3ZOSA 3ZSHA 5IA0A 5KHXA 4IB0A 4MBJA 3QCXA 4K9YA 4JXFA 4MYGA 3EQCA 4FV1A 1SNUA 3CE3A 4H58A 1URWA 4O83A 4ZMFA 2I0VA 2HW6A 2IPXA 4RJ8A 3FLZA 4BDDA 5FUTA 2YCRA 2X2KA 5HE3A 3E8CA 3ZC5A 4C34A 4C4GA 2XM9A 3E87A 3GEQA 4TXCA 3TXOA 5JZNA 2OI4X 4BDAA 4AZWA 4QMPA 3AGLA 2B4SB 1M2QA 4FYNA 5J9ZA 3CCNA 4BCPA 3V6RA 4XCUA 2YIQA 4WBBB 5JMSA 4G3CA 4FEVA 1R0EA 4AAAA 3F2NA 5KZIA 1Q8TA 1YWVA 3KXXA 4PY1A 3M42A 1M17A 2OZAB 4CLJA 4EHZA 3Q2JA 4FTJA 2PE2A 5JFXA 3EYGA 1H1SA 4GK4A 3FLQA 4BTKA 5CF5A 4NL0A 3QWKA 4G3EA 3BEAA 3TYKA 4FIHA 4WO5A 2QLUA 2Y4PA 1OKVA 5LMBA 3TNIA 4FKWA 4K1BA 2VAGA 3C4EA 4DG2E 5B2MA 1W84A 3DQWA 4KRDA 1MRUA 4YHFA 1QMZA 4CKJA 5BV3A 5HHWA 1LEWA 3DTCA 3QQHA 5AUYA 4O82A 4IDVA 4AGWA 2OK1A 4G31A 4C58A 5IA2A 2JIIA 4FUXA 5CY3A 1W2CA 2FH9A 1CM8A 1E9HA 2UW7A 3AC5A 3E8NA 3POOA 2FA2A 4C7TA 3NCGA 3LJ2A 3NAYA 4DEIA 4LV7A 5EKNA 1R3CA 4FV9A 3I81A 3DBFA 3OUKA 4LFIA 4TWNA 5JKGA 3KXZA 2XK6A 3IW4A 3R7GA 4UZHA 5C27A 4U45A 3F5PA 3F3ZA 4EHVA 3QTSA 1XH7A 4GVJA 4PMMA 3VS3A 2XJ1A 3MA3A 2BUJA 1J7IA 2BROA 3LFFA 4UXLA 2WMRA 3W55A 4OTRA 3B8RA 4I5MA 3UNZA 4K0YA 5AP4A 4FNYA 4F6SA 4S31A 1MUOA 4ID7A 5HKMA 2WNTA 3FXWA 3GFWA 3AKJA 3L9NA 3QTWA 1ZYLA 5EYDA 1SVGA 2HZNA 4N57A 1GNGA 4E6QA 1U59A 3A7JA 3DLSA 5J9YA 3WILA 3EQRA 4B6LA 3RNYA 3TV7A 4Q5EA 3MFSA 4EZ3A 1XBBA 4BF2A 4EEVA 3TUCA 3RCJA 1SM2A 1WBTA 3TDWA 5M06A 4F09A 4O7TA 1PY5A 4FTAA 4I93A 2ZFYA 3G9LX 2H34A 4F7NA 4U44A 3RPRA 3LMGA 2AQXA 4L43A 3DZOA 4RLLA 5EI2A 4JDKA 1G8JA 3H30A 3LFDA 4JR7A 4QTCA 5IA1A 2J51A 5FM3A 4A4LA 5BVNA 1YHSA 3LCOA 3BGQA 3RCDA 3BHYA 2YAKA 1WCCA 2JAVA 2OF4A 5JFVA 4L3JA 3ANRA 2GSFA 5C9CA 4PDSA 2NO3A 4XG2A 1A48A 2UVYA 3POZA 3CGFA 2OIBA 4FUYA 2X4ZA 4FL1A 3FY0A 4RJ5A 4D58A 1OPKA 1XBAA 3VQUA 3UZRA 3ACKA 2XKFA 3UTOA 1PXJA 4IFGA 2XAOA 3UNJA 4L6QA 3G5DA 5D10A 5CU3A 5HO6A 4AT5A 3EHAA 5JN2A 1FVVA 3DLZA 1YI3A 2PVJA 3R8ZA 3DFAA 3NUPA 2XCHA 3DJ7A 4G5PA 3V5JA 5CAVA 3FQEA 3LAUA 1H0VA 4MAOA 3DY7A 3HP5A 5CNNA 2YIXA 4XV9A 3ITZA 1Y6BA 3D0EA 1KE9A 4OGRA 1UU7A 3A7GA 3QLFA 3W18A 4HCVA 1YOLA 2PMNX 4ITIA 4WG3A 3OWJA 5KE0A 4AZSA 4EOJA 2XARA 2HYYA 3LPBA 3PXRA 5CXZA 2JAMA 3NGAA 4F9CA 4CKRA 4UBAA 1H1PA 5DA3A 3V5TA 3BLQA 3Q32A 1W83A 3KVWA 3CY2A 4EUUA 5E91A 2W7XA 4J7BA 2A4LA 3OTUA 3VS2A 2C6OA 3UVRA 4EK3A 3CKXA 2CN8A 3HA6A 3P86A 2XIRA 4FEQA 5L2QA 3EL8A 4D2SA 3SW7A 1UVRA 3HEGA 5AR2A 3GU8A 3H4JA 3TUDA 4NZWB 5CI6A 4BCOA 4YJQA 3ORNA 4ACDA 3PRFA 5A14A 5I9XA 2FSMX 2UZLA 1UKHA 4FV3A 2BIYA 3SXRA 4A4OA 1UNLA 4IVAA 4I1ZA 3BRBA 2XM8A 4PL5A 4CV8A 3OCSA 3ZXZA 3MV5A 3IS5A 3NIZA 3MTLA 3N4TA 3ZO4A 5CASA 3A4PA 2AEGA 2WKMA 3GB2A 5HCYA 4U42A 4BGQA 1JPAA 3NR9A 4JQ8A 3UP2A 1LUFA 4QMWA 2VX3A 3ATTA 3BL9A 5K0KA 4L46A 3MFUA 4KIKB 3EKNA 3BHHA 3BGPA 3Q3BA 3RGFA 4FKUA 4WSYA 3TCPA 1ZOHA 5LCJA 1ZXEA 2Z7QA 4FKLA 4FTKA 3IDCA 3MJ1A 4L7SA 5AIRA 4AN9A 4D1ZA 3MIYA 4A9UA 2XBJA 4LUEA 1OL7A 3OHTA 4XG7A 4FSUA 5DN3A 3SAYA 3VWAA 5ITAA 3PUFC 4XG9A 4X2KA 2VO0A 4JQ7A 4W4YA 2A2AA 3PVBA 1Q97A 4H3BA 5DH3A 4C4IA 3IOPA 3E88A 5FRIA 2X81A 3DK3A 3NW5A 4Y73A 1STCE 3QKLA 3ZYAA 4ZSGA 3U6HA 4DBXA 4AN2A 5EH0A 4G9RA 3ZDIA 3IDBA 2W1GA 3LCDA 4YJUA 2OXYA 3AMAA 1XO2B 2R0IA 1DAWA 2JD5A 4M13A 4YHJA 4AACA 5BYZA 4E26A 4FKJA 2PVFA 3VW8A 4BY9E 4MF1A 2C5OA 4HW7A 4ZS4A 3LQ3A 1F0QA 2CLQA 3CD8A 3F6XA 4IVCA 4ZSLA 5IQGA 2BKKA 1HCKA 4NJ3A 2JKMA 2ZV7A 5FWKK 5GZ8A 2LAVA 3C1XA 4E7WA 1OZ1A 2VX0A 1GIHA 2ZM1A 4IE9A 4Q9SA 3RZFA 2WMVA 4IIRA 1KOAA 1YHWA 4MH7A 2R3IA 4G6LA 4F7SA 4KBAA 4UWYA 3GQLA 4NSTA 3D15A 5I0BA 1YDRE 3BLAA 2WHBA 3DAEA 3LOKA 2J0LA 4EBVA 3UQFA 3HV6A 4NIFA 4YLKA 1H24A 3FKNA 4AGCA 1OBGA 1YXSA 2YERA 4G17A 1OIRA 4O1OA 4UN0C 1WBVA 5KMNA 3TNHA 3AC3A 3NYOA 2EUFB 3U9CA 4QMMA 2EXMA 4CFFA 3QL8A 5TF9A 3TI1A 3UQGA 3OCTA 1H07A 3R04A 4RWIA 3BE9A 4GYGA 4X6QC 3HDNA 1PMEA 4EH7A 4XV3A 2BAKA 2JKKA 4DEAA 2X7FA 3OBGA 4BCHA 5EW3A 2AYPA 4MXAA 2XB7A 3DA6A 5A6NA 1P4FA 2PULA 3FEGA 3TN8A 1ZYCA 5HG8A 4F65A 5J7BA 4C2WA 4CKIA 1G5SA 4C3PA 3S1HA 2C6IA 4CFMA 3R6XA 3D7ZA 4FMQA 1P14A 3Q5IA 3WZKA 2XKCA 5DR9A 5EDPA 3B2WA 4PP9A 5CS6A 4FKSA 3I0QA 4IACA 4JT3A 5HICA 2J0MB 3QKMA 4TWOA 3FAAA 2C3LA 3U54A 1G8AA 2BRBA 3FYKX 3WYYA </