3OUNB

Crystal structure of the fhaa fha domain complexed with the intracellular domain of rv3910
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
257
structure length
256
Chain Sequence
QLVPGARIANGRYRLLIFHGGVPPLQFWQALDTALDRQVALTFVDPQGVLPDDVLQETLSRTLRLSRIDKPGVARVLDVVHTRAGGLVVAEWIRGGSLQEVADTSPSPVGAIRAMQSLAAAADAAHRAGVALSIDHPSRVRVSIDGDVVLAYPATMPDANPQDDIRGIGASLYALLVNRWPLPEAGVRSGLAPAERDTAGQPIEPADIDRDIPFQISAVAARSVQGDGGIRSASTLLNLMQQATAVADREVLGPID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TB39.8
publication title A phosphorylated pseudokinase complex controls cell wall synthesis in mycobacteria
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein binding/transferase
total genus 69
structure length 256
sequence length 257
ec nomenclature
pdb deposition date 2010-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ounB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ounB01
3CD3A 3VVHA 5A4QA 2R3RA 3LQ5A 3LLTA 3LOKA 3TNIA 1XH9A 2GCDA 2HIWA 5K4IA 1WAKA 5IZFA 2YWVA 3FSFA 4BC6A 1OUYA 2CN5A 4FSYA 4EC8A 1KV2A 4Z55A 3RZFA 2FA2A 2HK5A 4FTQA 5L2WA 4GFMA 5L2IA 4O0RA 2CNUA 4O7YA 2A2AA 2XM9A 3NCZA 2PZPA 2F7XE 2VO0A 4GSBA 4CTCA 3FI2A 2XK4A 4JQ8A 5CU0A 5IF1A 4EZ7A 4O7NA 3VRZA 4MBIA 3RZBA 3OY3A 3C9WA 4G6LA 2O65A 4NSTA 5KZIA 3WIKA 3ZLYA 4GUEA 3QQJA 4XG7A 5BVNA 2XK9A 2P4IA 3GFEA 5HO6A 5IQCA 4E4NA 4W4YA 4QQTA 5IU2A 3HV7A 4C37A 2HXQA 2ZYBA 3UVQA 4UXLA 5AV1A 4CLJA 3LJ2A 2PZIA 3VS7A 3MBLA 4O0YA 5EYKA 2VTQA 4DGMA 1Q8UA 4GK3A 4AA0A 1J1CA 3WIGA 4DEEA 3F88A 4YC3A 4EOLA 5HX8A 5HU3A 3RAWA 2XEYA 3ZONA 1YI3A 2W5BA 5J7HA 2OW3A 3NUUA 2X4ZA 3ERKA 4BB4A 3LMHA 1VEBA 3NR9A 2GNJA 2P3GX 3WF9A 3CQUA 4OT6A 4QNAA 1QL6A 2PVYA 5H8EA 1GNGA 3DNDA 1FMOE 2BHHA 3IW7A 3PZHA 5HICA 4YBJA 4BCMA 4C35A 3FDNA 3Q3BA 4GU6A 2NRUA 3LXPA 4HZSA 3ZO1A 4AUAA 4EOOA 4C3RA 5C8KA 1QCFA 4X6QC 4S33A 2WMVA 2JIVA 5AAFA 4AGWA 2WNTA 4K18A 2X1NA 4DAWA 4J8NA 3W18A 3P23A 4DYMA 4E6QA 4ASZA 3GT8A 5KMIA 4L9IA 4YZCA 3Q5IA 3KU2A 3MFTA 4IB1A 5A6OA 2W4OA 1O9UA 4YSMA 5BMSA 1QPJA 4OR5A 2PE0A 3Q2MA 3LXNA 4JG8A 4A4XA 4D4YA 1Q5KA 3FPMA 3FYJX 3RVGA 4AW1A 3QRUA 5BMMA 2EWAA 3T3UA 3MN3A 4F7JA 4J95A 5HHWA 4FR4A 3CIKA 3VRYA 3DJ6A 3AC1A 5F4NA 3DK7A 3OWKA 3BBTB 2OSCA 2A4LA 4IAYA 2FUMA 4BDGA 3RPVA 4C58A 2PVKA 3UQGA 3RMFA 3OT8A 3NNUA 3MTLA 4D9TA 3ZCLA 4CVAA 1CDKA 2HZIA 1YXUA 4G34A 3R8PA 1H01A 1SYKA 5JRQA 4FNWA 2BIKB 4CYIA 1IASA 5CF8A 4CG9A 3TTIA 5DMZA 4B0GA 3MYGA 4TKSA 2X6DA 1Y6BA 3RALA 3C4EA 2WTCA 1E1XA 3GCPA 2PVNA 2XJ2A 2A27A 4KIOA 4YTHA 3ALNA 1Q61A 4M14A 3OCGA 4EI4A 2CCHA 3QXPA 4UX9A 2H34A 3OY1A 3PE1A 3R2BA 4FUXA 5H8GA 4FT7A 3UP2A 5IA1A 4X0MA 2XJ0A 2W9ZB 2ONLA 3BPRA 5DRBA 3WBLA 4HGSA 4FTIA 3UC4A 5JT2A 3MTFA 4JQ7A 5LMKC 3EQIA 4ZY6A 3SDJA 4V01A 2PZ5A 5D41A 5M08A 1V0PA 3R8UA 4QOXA 3ZC5A 5I3OA 3CTHA 5CI6A 4YHFA 2PUPA 5LVNA 4L01A 2JEDA 3GC9A 3PG3A 2C5YA 4FV7A 2ESMA 2JC6A 3P86A 4XMOA 5DHJA 5EOLA 3FLZA 4RWKA 4F0IA 3DB6A 3QWKA 3RM7A 4ANLA 5FM2A 2YZAA 2BPMA 3JXWA 2WO6A 3U87A 2QLQA 4Q9ZA 4TW9A 5IQFA 4R7IA 3L8PA 4DG0E 3R63A 3VUHA 5DA3A 3ORIA 5E1SA 2ITTA 3GC8A 4EBVA 3HMMA 3EL8A 5KE0A 1ZZLA 1OPJA 4IX5A 3AT2A 2VGPA 4NM7A 3DT1A 2BRBA 3PY0A 2EXMA 3IO7A 4YJNA 2OF2A 3R8LA 3A60A 1S9IA 2JDVA 3EH9A 4BDKA 1H4LA 3EKNA 4DTBA 2C6OA 2F49A 3AGLA 3U55A 5ANEA 4CLIA 4BVUA 1GJOA 3K3JA 4G1WA 1GAGA 4JJRA 5EKNA 2BFYA 4DH5A 4FEUA 3KK9A 4M12A 4V0GB 2VAGA 4FZFB 3ODZX 4PTEA 5M07A 5LVMA 4AOIA 3Q4ZA 2W99B 3NW6A 1V0BA 5B0XA 2BALA 3UYTA 5IH4A 3MB7A 2BRNA 3TDWA 1J1BA 2A0CX 4ZTRA 3N4VA 3AGMA 3G0EA 4H3PA 4S31A 4TYIA 4BCOA 4C0TA 3R8VA 4EH7A 5K3YA 3KMUA 3UTOA 5CT7A 3EN7A 3EQDA 1Q3WA 4IC7A 4NCTA 3LMIA 3CS9A 4IB3A 4LV5A 2J9MA 4I0RA 2RFSA 1KE9A 3BYMA 4Y85A 3BLHA 1JOWB 4KSPA 4NJDA 4CMUA 3MESA 3MWUA 2HYYA 3LFSA 4PV0A 5D11A 4WA9A 4O2PA 5EH0A 4EH9A 3BU3A 2Z02A 3THBA 5CWZA 2C6EA 3KVXA 4JAJA 4BGQA 4UEUA 3ZXTA 2J0KA 4HVGA 4EK4A 5HORA 4GT4A 4EOSA 5H2UA 1WBSA 4YMJA 4RFZA 4BZDA 4NW5A 5CAOA 3HRBA 4UMPA 3NEWA 3ANRA 2JKMA 3SG8A 4FV6A 2YA9A 1OL1A 3FJQE 3LM5A 4EH4A 3QTIA 5JK3A 2PULA 3POZA 3HECA 1OZ1A 2QHNA 4NKSA 3VF8A 5JQ5A 5J7BA 2ZMCA 4O7VA 1VR2A 1JQHA 3DPKA 1TQIA 4ANQA 2OU7A 4ZSLA 3RK5A 3H9OA 4U43A 2EXEA 3FLSA 3LFAA 1J91A 4UMUA 4FVRA 4ZS4A 4CFMA 4WG5A 5AUWA 1VJYA 4A06A 1SNXA 3A99A 5JQ8A 4FVPA 3IKAA 4XOZA 5AUTA 3NUXA 2KULA 4C38A 4C34A 1VYWA 4ZY5A 3BEGA 3GI3A 5IH6A 2VTJA 3PIZA 3QKLA 3TNWA 3FLWA 4F99A 4O1PA 2JIUA 1JSUA 1UU7A 4F08A 3EYHA 4F6WA 2C6LA 2WTJA 3OUNB 2W1ZA 2HZNA 4PMTA 5CY3A 5EM6A 4I21A 4NIFA 4BKYA 3M1SA 2X6EA 3ZM9A 4LUDA 2HENA 4FKTA 3GOPA 3TZ7A 2I6LA 2XK8A 1RW8A 4ZTQA 5GINE 5D9HA 4RLKA 4EL9A 4O0SA 4IFGA 4ZMEA 3TKUA 5IA3A 2G01A 3BWFA 2YM5A 5C27A 4A4LA 4W4VA 3DU8A 4ASDA 4P90A 4MVFA 4NTSA 5DPVA 3ZDUA 2XKEA 1AQ1A 2BZJA 3PTGA 3FPQA 4BHZA 1PRYA 4RBLA 2OJIA 3EQGA 1M2PA 2G9XA 4RJ8A 4QMMA 4M15A 1KE8A 4D4SA 4PNIA 2Q0NA 3FZRA 4LI5A 5DGZA 4A9TA 2BAKA 1H00A 4WSQA 3UPXA 3IGOA 4IX4A 5BVWA 3FUPA 5HLPA 3W2RA 4EOQA 4BTJA 2R3GA 3UODA 3BHHA 4CQGA 2R2PA 4NT4A 4AS0A 2DQ7X 5LWNA 2PVRA 1KE7A 1ZZ2A 5I0BA 4I23A 1DI8A 2YIRA 3F3ZA 3QRJA 2CGXA 2W4JA 4QYGA 3VHKA 4EHEA 5IPJA 3TKHA 3LLAA 3IECA 2C0IA 4FKIA 4IB0A 1T46A 4YJTA 5A4LA 4CEGA 3QZFA 3RI1A 3DBFA 2YM4A 3NW7A 2PUUA 4OTQA 2A19B 2WQBA 2R3QA 2B9IA 3WF8A 2YM7A 4Y8DA 3VQHA 5HBHA 4QP6A 1JLUE 2B1PA 3EFJA 3NZ0A 4M8TA 3O2MA 4O7ZA 2UW7A 2QKRA 4WBOA 4DEAA 3R83A 4UXQA 3VS5A 1TQPA 4DE4A 4NUSA 3VJOA 3Q4UA 5L2SA 4TRLA 3ID6C 4OTRA 1IA9A 3LCTA 5CENA 4EJNA 4MQ1A 3D5UA 2V55A 1Q8WA 4J71A 5CEQA 3W16A 3EFLA 4ZK5A 3FWQA 1W98A 2OIQA 3BBWA 3FLQA 3NW5A 3D7ZA 4FVQA 4I20A 2F2UA 4ITJA 3DXQA 1RQQA 1H1WA 3QUEA 4OTWA 5AR3A 4BCFA 4I1ZA 3PY3A 4XRLA 2R3IA 2C5NA 4XP0A 4ALWA 3JVRA 4K77A 4B8MA 3KXMA 4D0XA 5DN3A 5AP0A 5CF6A 3COMA 1BI8A 2WGJA 3WE8A 2YIQA 5AEPA 4ACMA 4IVCA 4APPA 3E87A 2QOLA 4HYIA 5I5ZA 4XG8A 3DAEA 5CEMA 2XH5A 3ZRLA 1ND4A 2JKKA 2OH0E 4DFBA 2W1EA 4QTBA 2OGVA 2XUUA 2VTPA 2ONLC 4IAIA 3CGFA 4JT3A 4NM5A 1U54B 2YABA 3CKWA 5KBRA 3SA0A 3TV4A 5HG8A 1PHKA 5K4JA 1S9JA 5HE0A 3PVWA 4RA5A 4UWYA 1BI7A 3L8XA 4D2RA 4EH6A 1VZOA 2PVFA 1JSVA 2VWWA 5CU6A 2NO3A 4R8QA 5JGDA 3QKKA 4JG7A 2C6DA 3ROCA 4U41A 4NZWB 5FP6A 4X2KA 4R3CA 4X21A 4RC4A 3RPRA 4BTMA 3FI8A 4RX9A 4E4XA 3KMWA 2OXDA 2X8EA 3FMJA 2GQRA 3GU8A 4JBPA 4AZWA 5A46A 5HE1A 5TE0A 4TN6A 4F9BA 5BYZA 4YTIA 3C5IA 5IISA 3IW6A 4L7SA 4YZDA 4Q9SA 2WTKB 4D5KA 2VWXA 3V5TA 2EVAA 5J1VA 2V22A 3PP0A 2UW5A 2PE1A 3R7EA 2J0IA 4TYJA 4BBFA 5LMBA 2VWVA 2UW4A 4CQEA 2PWLA 3CCNA 4W9WA 5EM5A 1MUOA 3TN8A 3R8MA 5AM7A 4FKRA 4DA5A 4QMUA 4II5A 1Q24A 4QNYA 4D2WA 5HIBA 2C3LA 4XG6A 2WQNA 4HYSA 1T45A 3D83A 3HP5A 4U40A 4F7SA 1OPKA 1OKVA 3UC3A 3S1HA 1LUFA 3D7TA 5E91A 4AGDA 3P5KA 5EFQA 2BDWA 2HOGA 5CF4A 3EN6A 4S34A 4E6DA 3V6RA 4N0SA 4XG4A 3ZO3A 4FEXA 4OLIA 2XBJA 1H1SA 5B2MA 3QZIA 3PY1A 5ANDA 3C50A 3KCKA 1YI4A 4ASXA 1U5RA 4X3JA 4XYFA 3FC2A 1STCE 3VAPA 4EWQA 3O7LD 4L53A 2VGOA 3FZSA 4L45A 3VBWA 4AN3A 2I1MA 2J4ZA 4QYYA 4D2SA 3UG1A 3KXNA 3FY2A 2FH9A 3R01A 5AP6A 3V5LA 4G3FA 3F2RA 4LMUA 4BDHA 2RSVA 2DS1A 5LMAA 4IHPA 5DT0A 3BHYA 3VUIA 5FUTA 2JLDA 1UWHA 3PRFA 5A9UA 4M97A 2P2IA 4FG7A 3RAKA 4EUTA 4MD7E 1LPUA 1IAJA 5ITAA 2QI8A 2VX3A 2PZYA 3D14A 3KVWA 3NUNA 2EB2A 1WMKA 1ZAOA 4E93A 5LCJA 3MW1A 3F9NA 2CNQA 4N6ZA 3W10A 4RRVA 4MH7A 4PPAA 3VBYA 4CRLA 3FKNA 3WZDA 4IMYA 1WBTA 5A4CA 2QO2A 4FIFA 4I5MA 1SM2A 1GZKA 3DAJA 3C51A 1XR1A 4E6CA 4E3CA 5BVDA 4M67A 4ZLZA 5EQEA 4BR3A 4BY9E 2XYUA 4IANA 1NW1A 5AUUA 3WI6A 3DQXA 4N4SA 3BE9A 3DCVA 4GIHA 2C3KA 3CY2A 3NUPA 3U9CA 3NYVA 4MXAA 5AX3A 5HNGA 2R3LA 2BFXA 1Q41A 3REPA 3QRKA 5ANOA 4AGUA 3TNPC 4HVSA 1UWJA 3HZTA 4CKJA 5I9ZA 2W1IA 3R0TA 2C0OA 3CLYA 3FMNA 3G51A 2IW6A 3QLGA 1URCA 5L8KA 4GV1A 3FV8A 2VTLA 2CMWA 4G2FA 5AIRA 3W55A 4A9SA 4JLCA 2OI4X 3WZJA 2Y6OA 3RGFA 3ENHA 4QD6A 1PYEA 5TR6A 2UZUE 3TV6A 2DUVA 3M11A 4GMYA 3TZ9A 3KF4A 2W1CA 4FSUA 1PF8A 5HKMA 2H9VA 4NM3A 2JITA 4OT5A 3F5XA 3MS9A 4GG5A 3R6XA 4S2ZA 4BCPA 1NA7A 3SRVB 4FSZA 2B7AA 3KULA 3E3PA 4FODA 3VIDA 2OZAA 1LP4A 3HDMA 4L43A 3FQEA 1OUKA 3RM6A 3WZEA 4WNPA 3FAAA 3TWJA 3ZLWA 3GC0A 1H8FA 2WIHA 3DB8A 3R7VA 5DOSA 5HNIX 1M14A 3KULB 4E4LA 5BVEA 4B8LA 5IMEA 3VUDA 3CR0A 4O83A 4LRMA 4Q2AA 4CRSA 3EQBA 1UA2A 2AC3A 4GJ3A 3L9LA 3OW3A 5ANGA 5TF9A 1H26A 3B2WA 2JD5A 3CQEA 3GCSA 3HP2A 5EKOA 4BDAA 2R64A 4BGHA 2OH4A 3PIYA 1A06A 1MQ4A 4ENXA 3ZZWA 4DLJA 2Y0AA 2VU3A 3EQRA 4NFMA 3QKMA 4PNKA 5C4KA 1LR4A 3OCTA 4YR8A 2GU8A 3ZHPC 2YLFA 4DFLA 4CCBA 5JZJA 3SG9A 4MQ2A 2BKKA 3H4JA 4UZHA 4WT6A 5GJFA 3LFEA 4IWDA 3T9IA 3QRIA 4PL3A 3ATTA 4QMVA 3HKOA 3CTJA 4FV0A 5J79A 1O6LA 3E7VA 3QALE 3A7IA 2UV2A 2J7TA 2ZAZA 4XUFA 5JMSA 5GZ8A 2PYWA 1ZY4A 1U4DA 3M2WA 4R1YA 2PVJA 3KN6A 4RVMA 3U4WA 3NUYA 4FTJA 1Q8YA 1J7LA 3MY0A 4OTDA 4RVTA 2BDFA 4CKIA 3GC7A 2NNWB 3LQ3A 3PE2A 3MI9A 3DJ5A 1OECA 5JZNA 3FMMA 4OTPA 3MY5A 3H30A 3PXYA 4ANMA 1JPAA 3ENMA 4WNKA 4JDKA 4EOMA 1OBDA 4X2GA 1U5QA 4EONA 3I7CA 3JS2A 2IVVA 2IZTA 3FY0A 2ITVA 3Q9ZA 3TI1A 2JBOA 4P2KA 5FWKK 1NVSA 2W1GA 4TPTA 3A2CA 5ANKA 4MXXA 1PY5A 1ZYJA 3BI6A 3LFFA 4PDSA 1Y8YA 3TXOA 5HX6A 1KOBA 2NPQA 4V05A 2CKOA 3HMPA 4D2TA 2YDIA 3A7GA 2UZTA 2XP2A 3OG7A 5EOBA 2P33A 3R7OA 2V7AA 2J51A 2OFVA 4KRCA 3SQQA 5JH6A 4GCJA 4KBKA 3U54A 4DTKA 5L2TA 4C57A 3ET7A 3G90X 4TYEA 3D5WA 2WTKC 3VS6A 3R1YA 3QD0A 3NVKI 1O6YA 2RFEA 1XH4A 5CQWA 4EH5A 5BUJA 2YZLA 3LCSA 3GP0A 4WRSA 3C4WA 5HBEA 3UPZA 3D94A 4ITIA 2UZOA 2VRXA 3BLRA 3QX2A 4UMTA 3SXSA 4FBXA 4BWXA 5AUYA 5CSWA 5CF5A 3BQCA 4U6RA 4J52A 4D5HA 4RX5A 3UJGA 2B9JA 5CSPA 3LIJA 5HU9A 4RIOA 4FOCA 5CYIA 2UZNA 5JGBA 3II5A 3Q2JA 3C0IA 2B54A 4EJ7A 3L1SA 3POOA 1W83A 3ORXA 5E8WA 4E7WA 2HCKA 2DYLA 2IPXA 3G15A 4RQVA 3ZMMA 4I92A 1R1WA 5LVLA 3QXOA 3RBWA 1UKHA 1H25A 2E9NA 5IQHA 3R9HA 4O7RA 3E92A 1PMVA 2OXXA 4G31A 4R1VA 4WRGA 3KRLA 4F0FA 1YWRA 4PDPA 3DKOA 2XCHA 2WAJA 2LGCA 5F94A 2PPQA 4XCUA 5HIEA 3KA0A 3R9DA 3QHRA 4MHAA 4HZRA 4Z16A 3QBNA 3SVVA 1QPEA 2NP8A 4IAFA 1JWHA 4FTCA 4QRCA 5K5XA 5I3RA 4EEVA 2PY3A 1GIIA 5K0KA 2GSFA 4F70A 1OIRA 1OVEA 1RE8A 3AD4A 1NVRA 4HYHA 1OGUA 4M69A 1APME 4QPAA 3F6XA 4I6BA 5JN2A 5HLWA 4ORKA 2GNLA 4TWPA 4QMTA 4EC9A 1GIJA 4PMSA 2X0GA 5D10A 4AGCA 4K0YA 3ORLA 1KSWA 4PUZA 5CAVA 2OLCA 4M66A 4I24A 2QONA 4IDVA 2UW3A 4FYOA 2J50A 4C4FA 1IRKA 3S3IA 4FKWA 4M69B 5AADA 4LGHA 3W2OA 4EK5A 1M17A 3NS9A 3VW6A 5KCVA 2ZV9A 3JY0A 3QC9A 3V8SA 5L8LA 5JRSA 4MD8E 2IZRA 1TQMA 5T6KA 3MH2A 1DM2A 4HPTE 5ETCA 4DEIA 2R9SA 2V5QA 2OWBA 2W5AA 3B8RA 3NYNA 2RF9A 4IWOA 5D7VA 4YTCA 5I9WA 5KMJA 3BRBA 3DBEA 3PDTA 4AZEA 2C5XA 5FGKA 3DDPA 4F0GA 1I44A 3P7AA 2UW8A 3V5PA 5H3QA 1FGKA 1BYGA 3H3CA 3IPHA 4I41A 3RK9A 5CXZA 3KF7A 4ZS0A 1W7HA 3QQLA 4QPSA 4W8DA 4WD5A 2BKZA 3AOXA 3SHEA 1REJA 1K3AA 3HVCA 1YHVA 3OP5A 4U9AA 3LJ0A 4UYAA 1YDRE 2XKDA 4FE2A 3BYVA 4JNWA 2ITOA 2OF4A 4TY1A 1YWVA 3KY2A 3ORPA 4M7IA 3DLZA 3ZFMA 5IG1A 3C4XA 4BDEA 3LFCA 3UQCA 4J98A 4QMPA 4F64A 3C0GA 1XKKA 1YOLA 2YHVA 1G3NA 1JKLA 3BHTA 5EHLA 5L3AA 5EK7A 3UZPA 4O7LA 3BLQA 3VC4A 1TVOA 1FOTA 2C5VA 3FE3A 4BI0A 4XRJA 3PA4A 4LMNA 2RIOA 2W05A 5AV4A 1ZYDA 3LM0A 4U80A 1PXKA 4O84A 4I4FA 2J90A 4DT9A 3Q53A 4C4IA 3R7GA 3I5NA 4RIXA 3DTWA 4FTLA 2XIZA 4X2JA 4LGDA 3ORMA 1ZOHA 4NK9A 3ZOSA 5IMXA 4AFJA 3QUPA 1XBBA 3AQVA 2RG6A 2QD9A 3K5VA 5DEYA 3SAYA 3UOHA 4DFXE 1AD5A 4IJPA 2BROA 2YM3A 3E7OA 5E4HA 3QC4A 4GVJA 5AR2A 4DG3E 1UU9A 4YLLA 3F5UA 2R3HA 4CG8A 4ENYA 4BFMA 3EN4A 2W9FB 4QMLA 3FMEA 3AC8A 2BZIB 2YISA 4GRBA 4FEVA 2GNIA 2VTRA 3MGYA 5DE2A 3ORKA 2GPHA 5KBQA 3COHA 5EW9A 2HW7A 3OXTA 5IUGA 3MFRA 1QPDA 4P7EA 4KD1A 3HYHA 2NRYA 4JRNA 3Q5ZA 5KHWA 5M4UA 1OPLA 1IR3A 2G1TA 4CT2A 5FG8A 4QP9A 5HLNA 3GBZA 3KRJA 3MFUA 3TNHA 5FTGA 3F2AA 4XH6A 3T3VA 2A1AB 4RPVA 1ZMUA 4GKIA 3WARA 1ZYSA 3C13A 1CTPE 3HV5A 4EK3A 2FSLX 4YLKA 4XV2A 4QYFA 1WBVA 3NNXA 4I0SA 3MSSA 3OROA 2C6MA 4XBRA 4ANBA 1PJKA 3F69A 3WOWA 3TEIA 5DT3A 3CJFA 3HMNA 4JQEA 4R5SA 4U8ZA 4YUQA 2IWIA 3UMXA 1UNHA 1KE5A 3P1AA 1PYXA 4X2NA 1WBWA 1P14A 3G5DA 4I5HA 4RIWA 4E1ZA 5EI2A 2F2CB 3QD3A 1Z5MA 3DKFA 1JAMA 4JDJA 4UBAA 1OKWA 3E8EA 4I6QA 1REKA 3K54A 3KRRA 4C2WA 4YJPA 5AP5A 2ITXA 4IFCA 5IA0A 5HG9A 2WQMA 4MBLA 5IKWA 2VWIA 2FSMX 4YC6A 5GHVA 2CLXA 3QZHA 2R3FA 4HOKA 3HAMA 5IUHA 3I4BA 2BZKB 2Z60A 3C1XA 5E92A 5AP4A 5ETFA 3W2CA 2X9EA 2PU8A 4JX7A 3PG1A 3VS1A 3VUTA 1YVJA 4C36A 4WNMA 2I0EA 5J1WA 4EZ5A 3JPVA 3PJ2A 5AR7A 4TXCA 4ACGA 3LCKA 2WMUA 1SNUA 4M3QA 4BKJA 3AT4A 4ZTLA 3R30A 4IX6A 4TZRA 4RZWA 3LMGA 3QFVA 3Q4CA 4TYHA 3TNQB 5KHXA 4X7QA 4W8EA 5AJQA 4DH1A 4JG6A 4EHGA 4FTAA 4I5CA 5AV3A 2E9OA 1R39A 2BR1A 2VX1A 4OTFA 1EH4A 3QRTA 3RPOA 2J0JA 4NH1A 2OICA 3TDVA 2W1FA 2UVXA 2ITPA 3LCOA 3UMWA 1MRVA 3ZRMA 3ZS5A 2OK1A 4U7ZA 3VJNA 3P79A 5KUPA 4D1ZA 1IA8A 2J6MA 3FZTA 3MVJA 4LQMA 4E26A 1BMKA 5A6NA 3KCFA 4QMSA 3BQRA 4RJ3A 3SW7A 2HZ4A 4FSRA 4KRDA 3QCXA 2FGIA 4QQJA 4RJ7A 4OBOA 4YHTA 3U9NA 3DQWA 2Z7RA 3ORNA 5F20A 3RTPA 2W1HA 2FB8A 4NM0A 3PXRA 4U44A 3ACKA 5E7RA 4HJOA 2WTVA 4O96A 4IQ6A 3BZ3A 2C1AA 3D4QA 3R2YA 4G9RA 3PYYA 3OOGA 4JOAA 4HW7A 2YN8A 3P08A 4L3JA 4ACCA 3LW0A 3PA5A 2W06A 3P0MA 3PPKA 2WOTA 3R1QA 2YJSA 4C3FA 5ETAA 4WHZA 2OG8A 1I09A 2O0UA 3G2FA 2WTDA 3U51A 4BZNA 4U97A 2BRHA 2ZM4A 4CZYB 2XRUA 4WKQA 3UNZA 4IAKA 5HD4A 2XNPA 3GU6A 2WXVA 3IDCA 4GG7A 4YO4A 3TUBA 4ANOA 4NIFB 5K0XA 2WQEA 3QTXA 2JAVA 4QMWA 4AXAA 3QGYA 4F4PA 3Q9YA 5L2QA 3UIUA 4IZ5A 4BCGA 4DEDA 3NPCA 2Q0BA 5KKRB 3B8QA 4G16A 3MY1A 4HYUA 2FYSA 5F9EA 3CXWA 3E88A 3OF0A 4BN1A 3KC3A 4NKAA 4IVAA 1A9UA 3L9NA 4L3LA 2Y4IB 3MJ2A 4IADA 4U81A 2YCRA 3HV3A 2BTSA 2C5OA 2LAVA 5A4EA 4QPMA 3ATSA 3CD8A 1FVTA 2CDZA 3O96A 4FV1A 4NW6A 3BV2A 3DY7A 4A9UA 5CAPA 3PLAE 4R3RA 5HBJA 1WBNA 4ZOGA 2KTYA 3UIMA 4ANSA 3E8NA 5J95A 5IQBA 3QTUA 4L7FA 4O7SA 5LQFA 3IDPA 2CCIA 2Z7LA 1CMKE 1XH8A 2X39A 2YERA 3E8DA 4HVHA 2G2FA 2WTWA 4M84A 5DR9A 2OJJA 3OD6X 3E93A 2XNNA 1GZNA 1PW2A 4AF3A 2FSOX 4UY9A 4U3YA 4F1OA 3R1NA 4GFOA 3R7UA 4QTEA 4ERKA 3DAKA 4FZ7A 5M4FA 5M4CA 2H8HA 2WEIA 4GU9A 2PVLA 5AA9A 3R04A 4MWIA 3WF7A 4OTGA 3I60A 3VO3A 4F6UA 2R5TA 3HA8A 3BKBA 4L46A 5AV0A 1SVGA 2WZJA 5GIPE 3BV3A 2X7FA 3HEGA 5L6WL 2GFCA 4ONAA 1Z9XA 3IGGA 4LOOA 1XBCA 5G1XA 3COKA 4DEBA 2XVDA 2WKMA 3MIYA 5H9BA 3TKIA 4F9AA 5TKDA 1NVQA 2X9FA 4YJOA 4ZP5A 5CAQA 2CKQA 2GS6A 4FNZA 5AX9A 4D4VA 4EH2A 5HCYA 4ZJIA 5LVPA 3UZTA 5FBNC 2OJ9A 2Z7SA 3IOKA 3NLBA 4RJ5A 3OW4A 3SOCA 1PXMA 2OJFE 3FXXA 4GH2A 3OWPA 4JVGA 5E90A 4XG9A 4FYNA 3UVRA 4DHFA 2PE2A 2XIYA 2B53A 3NIZA 3RHKA 2R3KA 3FZPA 4H36A 4KBCA 4YP8A 5HO8A 2C6KA 1E1VA 1H24A 3D5XA 3VW8A 3NUSA 3A7JA 4ZTMA 4XP3A 4FL2A 3KRXA 2QQ7A 1XQZA 1Q4LA 4ITHA 2YIYA 3IG7A 3V6SA 3ZH8A 1XBAA 3HV6A 4AWIA 4FKLA 1OBGA 4IVBA 1Z57A 3Q96A 4FKGA 4J96A 2XCKA 5EI8A 1Q97A 2GMXA 3SKCA 3WZUA 2IVTA 3TZMA 1WBOA 2Y4PA 4Y95A 1YDSE 1R78A 4C33A 5HZNA 2Z7QA 2I0HA 3O0GA 3QA0A 2XNEA 2XNGA 4YJSA 1H27A 2XNMA 4I94A 5DFPA 5BYYA 4P4CA 2QLUA 3RNYA 4B9DA 4AW0A 3MVMA 4PX6A 5AFVA 3OXZA 4K1BA 2OXYA 4CKRA 1DAWA 2AYPA 2ERZE 3EQCA 4G6OA 5CSXA 4FKPA 3HA6A 3UO4A 1OL7A 4AAAA 1YXSA 3IW8A 4IIRA 4U3ZA 4OAVB 2ITYA 3N9XA 1YQJA 2P55A 1UKIA 3TIZA 5CEOA 3AT3A 4FG8A 5IUIA 4N6YA 3MVHA 3O51A 3I81A 4YJQA 2ZVAA 4RQKA 4TWNA 5HIDA 5IQAA 3FSKA 2VWYA 2O63A 3LPBA 2QO7A 2P2HA 4XJ0A 3ZUUA 3SGCA 2FVDA 4EH3A 2IN6A 4FX3A 4KS8A 5A14A 4BYJA 4FL1A 1PXLA 3DZOA 1IG1A 4HCUA 3SXFA 2CN8A 4FT5A 5GIOE 5FBOA 2HAKA 3W8QA 3TCPA 4AE9A 1ERKA 2UVZA 3CQWA 3AD6A 3DBDA 3ZRKA 3S00A 2ZV2A 3D0EA 3Q32A 4FZDB 4O0XA 4PP7A 5CTPA 3KFAA 4O0TA 3TJDA 1AGWA 3FQHA 4AN2A 3NRMA 2JDOA 1OIQA 3ZBFA 1G8SA 4RFMA 2ERKA 2WU6A 4IJ9A 4FT0A 4UWCA 4B4LA 3L9MA 4AZTA 1YHWA 5HTIA 2WQOA 1OL6A 4H39A 2GHLA 1H07A 3D5VA 3HMOA 2JGZA 4FKJA 4RX8A 4BDBA 4FMQA 5CEKA 3FZOA 2EXCX 3W2QA 4E8AA 1YWNA 3GXLA 4TNDA 3WF5A 3GU5A 4BGGA 4QT1A 4M68A 5JFWA 2OIDA 5C8NA 5J8IA 5I9VA 4NCTC 5HVYA 3V5WA 3D7TB 5FQDC 3KREA 4AZFA 4QMNA 2PVMA 5CSHA 5LXMA 2BRGA 2RL5A 3OCSA 1ATPE 4AA4A 2YCSA 3CJGA 4PY1A 2OKRA 2C6TA 4MNFA 4XV9A 5AP2A 3I7BA 4XLIA 3OCBA 2PUNA 3PSBA 5FLFA 4D28A 3FKOA 4RMZA 3AG9A 1PKDA 3PUPA 3WYYA 4MNEA 5D7AA 5J9YA 1J7IA 2W1DA 3H10A 3OWJA 4F09A 4AU8A 4BKZA 4ZTHA 5AV2A 2VX0A 5M44A 4OTHA 5GZAA 3TUCA 1ZMVA 4DLIA 2X4FA 4UYNA 4XLVA 3UZRA 2ETKA 5HGIA 3QL8A 4H58A 4JDIA 4MCVA 2VWZA 1U46A 3VWAA 3EWHA 3RP9A 2X2LA 4YPSA 3E63A 3HMIA 3DXPA 5AIKA 4ZY4A 4R78A 3EZRA 4OAUC 2ACXA 3OOMA 2F4JA 1Y91A 1M7QA 3ZO2A 5EYDA 1URWA 2Y7JA 5TO8A 3TG1A 5BPYA 4OUCA 4IXPA 4KKHA 3QWJA 2QOHA 5DEWA 3HAVA 4FEWA 4FIJA 4J53A 2DWBA 4YLJA 2YEXA 5I9UA 4OTIA 4O81A 2QO9A 4NYEA 4AW5A 2UVYA 1PXNA 5HCXA 2XA4A 2O3PA 3K3IA 3OTVA 4YU2A 4Y72A 4KB8A 4RSSA 4AA5A 4YO6A 5J5TA 2IG7A 5ANIA 3MA3A 4RX7A 1YXXA 3VUMA 4DFUA 4RLLA 3LFDA 4OBQA 4RIYA 5CNOA 1B39A 4FT9A 4RVLA 4GYGA 4EOIA 4FKSA 5DNRA 2XK6A 3P7CA 2XJ1A 4GK4A 3MPTA 2QG7A 4PTGA 3HRCA 5KKRC 4ZEGA 4I3ZA 4IWPA 4ZSJA 3Q6WA 3AC2A 3QCYA 3ROYA 2O8YA 2QNJA 5AUVA 4UMRA 4R7BA 3I5ZA 2Y4IC 4EKLA 4EOKA 2BAQA 2PMNX 3UO5A 4QP3A 4XV3A 3VBQA 4C4EA 4QTAA 2QU5A 2YDKA 4CFFA 3LXLA 4H05A 5C4LA 3OEZA 2ITNA 1QMZA 1UNLA 1HOWA 1M52A 3K5UA 1PXPA 4FICA 4O21A 4BDJA 4M0ZA 3Q4TA 2FO0A 4BI1A 5I4NA 3GB2A 1KOAA 3EN5A 3LAUA 3VS3A 3A8WA 3CC6A 2UZWE 2W17A 4JXFA 3OMVA 5GJGA 3R73A 4KIKA 2GS7A 3OFMA 1PXJA 4I22A 4QP2A 5BNJA 3HV4A 3NUAA 2EUFB 1H1PA 2UUEA 3R71A 4CFVA 3NAXA 2VTTA 2OBJA 2OZAB 3RWQA 3F61A 4F65A 4C8BA 4EK8A 5JSMA 3QCSA 4V04A 3EIDA 5IDNA 1Y8GA 1OI9A 1ZRZA 3ZYAA 2J2IB 2VTAA 1JSTA 3C4FA 5HI2A 5LVOA 3P78A 4ANNA 3LZBA 3NYXA 5B7VA 2IZUA 2ZDUA 3DXNA 4WG4A 5BVFA 3G0FA 4FTKA 5CANA 4O7TA 3W2SA 3KXXA 5AUXA 1FVRA 3LVPA 5CZHA 3I6WA 4D2VA 2RG5A 3ZZEA 4FK3A 4EHVA 4JRVA 5LMKA 4DF3A 1V0OA 3DFAA 3Q6UA 2H96A 2G2HA 3HDNA 3HGKA 4JDHA 2FSTX 4R6VA 1ZYCA 2VWUA 2CJMA 3EQHA 3RWPA 2WMAA 5CEIA 4YTFA 1IEPA 4G3CA 1OMWA 4KWPA 1GIHA 4JBVA 1WVWA 3E3BX 3ODYX 5HCZA 4J99A 2X7GA 5C1QB 1M2QA 4E5BA 4EUUA 3I0OA 3LKMA 4AW2A 2IO6A 4IB5A 2VUWA 3IW5A 5E8ZA 3FMLA 3QTRA 4FZ6A 4O0UA 2VWBA 5BVKA 5ACBC 4DINA 2B52A 3IW4A 5CSVA 3KKVA 2O64A 4XG2A 1YXVA 4LGGA 3AC3A 3UDBA 4JR7A 4GJ2A 1UVRA 2YM8A 4FIGA 4JAIA 2WFYA 4IBMA 3D9VA 3EOCA 5LJJA 4F9WA 3V8TA 4GEOA 4D1XA 4G3EA 4CFXA 1OKYA 4Z7HA 3OVVA 2GDOA 3RPYA 4DBNA 5IQIA 3NWWA 2PMLX 5CVFA 2EU9A 2XYNA 3G6HA 3KL8A 3NDMA 2B4SB 4D4RA 3R9RA 2ZMDA 4BCIA 3TV7A 2ZV7A 3BIZA 3AC4A 2QCSA 2RFDA 4FI1A 4YNEA 4EWHA 3FLNC 4RWLA 2ZJWA 4L67A 2Y6MA 2GFSA 4O91A 3U8WA 1CKIA 3DGKA 5EDQA 3NSZA 5D12A 4AFEA 2IVUA 1MRUA 2E9PA 4XX9A 2R3PA 4U45A 3A7HA 1U59A 4RG0A 4YBKA 2X2KA 3QYWA 2QR7A 4QMYA 5CZIA 2VTHA 3BYSA 4O38A 3FMKA 3UBDA 4PP9A 4F1MA 1FGIA 4R77A 5CAUA 2E9UA 2R0UA 1ZYLA 4ID7A 2VD5A 1KE6A 4LL0A 4BWPA 2CHLA 5K9IA 5AAGA 3MH3A 3PJ3A 4FOBA 5FEEA 1ZXEA 4I6HA 4NJ3A 4IX3A 4RC2A 2O2UA 3SC1A 2XM8A 4MXYA 3DK3A 3DBQA 4MBJA 2UZBA 3QQGA 4BI2A 2F9GA 3GENA 4K33A 2UZVA 2XKFA 4AT5A 5M06A 3HL7A 4K9YA 4HCVA 2CSNA 3NVMB 2VTIA 4M13A 3RHXA 3FQSA 4WNOA 2VNYA 3ZC6A 3IONA 3PPZA 4FIHA 4LRKA 4O6LA 4WOVA 3FL4A 5FD2A 4A4OA 3UYSA 5JFXA 3M42A 2HELA 2UZEA 4USDA 3ZLSA 1PKGA 1Q8ZA 3WYXA 5ICPA 3F3TA 5KMLA 4FTNA 4DFNA 4O86A 2WMSA 1P4OA 1RDQE 2OIBA 5EI6A 2QOIA 2VTMA 3BGPA 4QMXA 5AM6A 4R7HA 3RJCA 4CFWA 3ELJA 4YZNA 5KO1A 4NU1A 3FI4A 4BBMA 2HY0A 4WUNA 4A9RA 4A9YA 4AP7A 4X3FA 5JFSA 5TOZA 1GY3A 2WHBA 3SD0A 2PMOX 2O5KA 2R7BA 4UV0A 4UN0C 4YNOA 3U6IA 1BL7A 3FKLA 1Y6AA 3OEFX 5AA8A 3BGZA 2JKOA 4AG8A 2Z2WA 2B9FA 3I79A 3KQ7A 3OWLA 3DOGA 4GIIA 4IM0A 4FSMA 3RPSA 3VBTA 4APCA 4Q5HA 2R3NA 2VO3A 4X3FB 2CGWA 5AR4A 3RKBA 3ITZA 3LFBA 2V62A 4BHNA 4MEDA 3BYOA 4FSWA 4CZTA 1E9HA 1M2RA 2C30A 4DGOA 4QMQA 3SLSA 2JFLA 2WD1A 4L42A 4YJUA 4MKCA 4U0IA 3BWJA 4WUAA 3TUDA 5DR6A 5L6PA 2RGPA 3GCVA 3BE2A 5AUZA 4B99A 2GNFA 2ZM1A 4FTOA 3AMYA 5EHOA 4BDFA 2VN9A 4RWJA 4EZ3A 3VBXA 3K2LA 3IS5A 3LXKA 4AZSA 1H1RA 3O23A 5M09A 3QD4A 4MXZA 1UV5A 4J97A 2AC5A 3TJCA 3VHEA 3VS4A 4CFUA 4F9YA 3UG2A 4DGNA 5I9XA 3GFWA 3R02A 4QP4A 4TNBA 3VUGA 3L8SA 3WF6A 5EW8A 1YI6A 3EQPA 4MTAA 4WSYA 5IEXA 1BUHA 1NY3A 4CZUA 3TACA 2PK9A 4JL9A 2XBAA 4KSQA 3ZSIA 4GYIA 1W84A 2CPKE 4IEBA 2J5EA 5FTQA 3V8WA 2VTNA 4FKUA 2Y8OA 2YJRA 3D2IA 2VO6A 4FEQA 3SOAA 3JVSA 4IZAA 3S2PA 1Q3DA 5EHYA 4L6QA 4JS8A 3UIXA 2YWPA 2OO8X 3DKGA 3VF9A 4EBWA 3C4ZA 4AOJA 5CQUA 4G3DA 2YACA 3LQ8A 4QP8A 2WTIA 5ANJA 3AMAA 4BL1A 4FNXA 1OIUA 2ITQA 2QR8A 4I0TA 2YAKA 3BEAA 5J5SA 3DLSA 3O71A 3HLLA 2QOKA 2XIRA 5EDRA 2PUIA 1O6KA 1FQ1B 4K8AA 3FXWA 3D15A 3PFQA 4G9CA 5LOHA 3PRIA 1F3MC 5B2LA 2I0YA 1BLXA 2VTOA 2B55A 3W8LA 5KMKA 3UP7A 1WCCA 4AACA 4RIXB 3OTUA 4ZSAA 2I7QA 2G15A 2YM6A 3L8VA 3ZEPA 5HESA 1KUTA 2XNBA 5L8JA 3A4OX 3G6GA 3UOJA 2J0LA 2C68A 3F7ZA 3FMHA 3HRFA 3FZ1A 1ZOEA 2JKQA 5EYMA 4FL3A 3OT3A 1SMHA 1L3RE 3NMUF 2HZ0A 5KMOA 3Q9WA 2YIXA 1YXTA 5BYLA 4IZ7A 4RVKA 5E8YA 1OIYA 4ALUA 3A4PA 4HNIA 4KNBA 5HQ0A 1GZ8A 4S32A 3R9OA 5E1EA 3ZU7A 2CLQA 3BHVA 3DA6A 4P5QA 4PDOA 3QYZA 5CX9A 3ETAA 5E8UA 4BICA 5FXQA 3RCDA 4KINA 3FBVA 3V51A 1H0WA 2OJGA 1ZLTA 4XP2A 3W33A 1OITA 2HW6A 2IVSA 2X2MA 3EFWA 4CTBA 4EYMA 4C7TA 3G9LX 3N51A 2V7OA 4IAZA 4JI9A 4LG4A 3PJ8A 5CLPA 2XKCA 3ZBXA 4J8MA 4C4GA 1UU3A 5JFVA 3CP9A 5CEPA 5JEBA 3PLSA 3VS2A 2BIYA 4YZ9A 3PJCA 4IACA 4BZOA 4FKVA 4E5WA 3ZDIA 4ACDA 3R00A 1H08A 2QOBA 1JKKA 1FBNA 5DWRA 2X8IA 1DS5A 3R21A 3R22A 3TT0A 1J7UA 4KUJA 3C5UA 4XBUA 3GU7A 4USEA 4PDYA 2VZ6A 1FVVA 2CKEA 2P0CA 1MRYA 3DBCA 4PL4A 2IW8A 3R7YA 2BRMA 4V0GA 3PZEA 3JR1A 2ZV8A 4RIWB 2ZDTA 1X8BA 2BTRA 4PQNA 5DT4A 2W0JA 2W4KA 2YAAA 3AD5A 3R8ZA 1MQBA 4B7TA 5HG5A 4NFNA 1B6CB 3FL5A 1H28A 3EYGA 3QQHA 2JDSA 4G6NA 4BIDA 3N4TA 4ZSEA 3KXZA 4GKHA 5IA4A 4K6ZA 4BF2A 3MPAA 3QUDA 2Q83A 1SVEA 1WVXA 5BX0A 4D1SA 2ETMA 1XHAA 3H9RA 3GEQA 1P2AA 1YOJA 2UW9A 3NCGA 4W4XA 3PA3A 3SW4A 4YC8A 3S4QA 2WMBA 5EYCA 3E62A 3EB0A 3P7BA 1KV1A 3PJ1A 1W8CA 4N70A 4BCHA 4ZLYA 4QQCA 1JBPE 3QQKA 1NXKA 3FXZA 5FDPA 2E2BA 5BQ0A 2YITA 4WO5A 4I93A 5EM7A 4DITA 2EB3A 4PL5A 1MP8A 1SVHA 4GK2A 2XRWA 4DBXA 4TTHB 4CCUA 4AX8A 4TYHB 4HNFA 3UVPA 3QCQA 1R0EA 2HXLA 4GT5A 2C6IA 3GU4A 4J7BA 4GT3A 1DAYA 3CSVA 1W0XC 2HWPA 4CXAA 3WZKA 3TIYA 3ZFYA 3BHUA 3PXFA 1XWSA 5C01A 5EW3A 3TM0A 4DT8A 1IAHA 2C4GA 2VTSA 3C4CA 4FTMA 2UW6A 4U79A 5HVJA 4BDDA 3QHWA 4QTDA 4XEYA 5KZ0A 3C7QA 1B38A 5C8MA 4PMPA 4GL9A 4FT3A 3FC1X 2BZHB 4PPBA 4BDIA 4AN9A 3IDBA 3EQFA 5CS6A 4DTAA 3DKCA 5HE2A 3F2NA 3R7IA 4X2FA 1VYZA 4EYJA 1LEWA 4FG9A 4KA3A 5F1ZA 5A54A 4BBEA 3A7FA 4E6AA 3MVLA 4HCTA 1XH7A 3ZLXA 5L4QA 3GCQA 4I4EA 3MIAA 3I0QA 5DG5A 3PWYA 4WBBB 4C4JA 3ZUTA 4EHZA 3UOLA 3UQFA 2REIA 4JIAA 5GJDA 2RFNA 3VS0A 4FV3A 3BYUA 4TL0A 2QC6A 4X3FC 4E20A 4UWBA 5C26A 4XHKB 5T3QA 3U6JA 4ZJVA 3LHJA 4WIHA 4MAOA 5J87A 3UOKA 4BYIA 3UNKA 3BGQA 4CFNA 4RJ4A 4YURA 2GQSA 4FZAB 1LEZA 2XNOA 2F7ZE 3F3VA 3ZUVA 3QX4A 3NAYA 4GUBA 4DCEA 3MDYA 2ZM3A 1OM1A 2F7EE 3KRWA 4MF1A 4NEUA 4DFYA 3JYAA 4IC8A 1YRPA 2I0VA 4CMTA 2G2IA 4O82A 5AR8A 3F66A 3UE4A 3HUBA 1PMEA 4EORA 3U4UA 3KXHA 3R28A 5B2KA 1CSNA 3PSCA 2HY81 4PRJA 5FEQA 4AOTA 4HVDA 4KABA 2WOUA 5L6OA 4H3BA 2X7OA 2VO7A 4WG3A 4O7WA 1YW2A 2YLEA 3PIXA 3T9TA 3A61A 2C1BA 4FNYA 5HNBA 1Q62A 4EQUA 3NNWA 2XIKA 1WFCA 3EMGA 4M0YA 5GNKA 4ZZMA 4FA2A 4W4WA 3ORTA 2YIWA 3MPMA 3GVUA 2WPAA 2H6DA 3F82A 5AR5A 1ZMWA 1ZWSA 3H0ZA 5G6VA 4FIEA 5FP5A 2BILB 4L3PA 3UIBA 2B0QA 3PXZA 2WELA 3KGAA 1WZYA 5HD7A 3RINA 2QODA 2R7IA 3GUBA 5E8VA 5HTCA 4HGLA 2ITZA 3V5JA 1J3HA 3ALOA 4JBQA 2ETRA 2BHEA 4QQ5A 4ASEA 1A48A 3RNIA 3ORZA 2XIXA 3E64A 4RT7A 5E9EA 4IWQA 2B9HA 2JDTA 3FMDA 3OBGA 4ALVA 4L00A 3R1SA 4EKKA 2VNWA 3O17A 4FV2A 4D0WA 3EKKA 5IEYA 3KXGA 4KS7A 3IOPA 1ZY5A 4QMZA 3KN5A 3A62A 5CXHA 2I40A 4EQMA 4ZTSA 3GOKA 3V3VA 2SRCA 4FV5A 2YFXA 4Y73A 4ZIMA 3NYOA 2QVSE 4LYNA 2J5FA 5HVKA 5J9ZA 3BELA 4FIIA 3FEGA 3FLYA 4RWIA 4IM2A 4X6RA 2WU7A 2QOFA 4LUEA 4CV8A 5BUIA 3LFQA 3MH0A 1R0PA 1ZARA 4GW8A 4KKGA 4OGRA 4FTUA 3QTWA 4PPCA 1K9AA 2F57A 4FTTA 1YOMA 4Q5EA 2XEZA 4XG3A 3QU0A 3A8XA 4Y5HA 4JX3A 3R9NA 4F7LA 2WMRA 5KX8A 4QYEA 4XV1A 2XF0A 5CNNA 4USFA 4LOPA 3ZXZA 3QTZA 4RFYA 4TWCA 4FKOA 1U54A 4BIEA 1V1KA 1OL2A 4C2VA 3MV5A 2WMTA 4YZBA 2V0DA 3KB7A 2PL0A 4O0WA 4DEGA 5TT7A 3HX4A 4HGTA 4MXOA 5ETIA 4QO9A 4G17A 3RCJA 4C02A 4DFZE 4NTTA 4EOPA 3ULZA 3CGOA 5M4IA 4G5PA 3NGAA 1PMUA 3KMMA 1BX6A 1PXIA 2ZB0A 4IZYA 4RGJA 3BU5A 2R3JA 4IDTA 5C9CA 4L8MA 1UNGA 4XOYA 4YGAA 4F1TA 4LRJA 1HCKA 4BIBA 3O8UA 2XK7A 4S30A 1M7NA 4UALA 2XK3A 3EZVA 3ZFXA 2JIIA 3MA6A 3O50A 5LARA 4I6FA 3VQUA 2WMWA 5EDPA 5ACKA 5CI7A 3VNTA 3CTQA 3E5AA 5CU3A 5E8XA 3PWDA 3V01A 3PVGA 2ITUA 1Q8TA 3D2KA 1WBPA 3GGFA 4FC0A 4O2ZA 1KWPA 3DK6A 4GVAA 5FTOA 1PMNA 3QGWA 4MD9E 5HE3A 2W96B 3V5QA 4D2PA 5DBXA 2R0IA 4ZJJA 1FPUA 5IDPA 4GFGA 5JKGA 4MK0A 3F3UA 4YJRA 3GCUA 5D1JA 4DN5A 4C3PA 5KNJA 4N57A 1G5SA 3B2TA 4AZVA 4JR3A 2IZSA 4HPUE 5FEDA 1YHSA 2XMYA 1JKTA 3EHAA 3ANQA 3FHIA 4GS6A 3OC1A 3HUCA 5E8TA 4ZZNA 4NL0A 1HCLA 4R3PA 3PP1A 4LOQA 3O8PA 3CEKA 4IH8A 2E9VA 4F63A 3KEXA 4LFIA 3CY3A 1L8TA 2PSQA 1XJDA 4DH7A 4P5ZA 4CMOA 5M56A 2XB7A 3QD2B 3FI3A 4ZMFA 1ZOGA 4DGGA 4FSTA 3OZ6A 5M51A 3Q9XA 4FF8A 4G5JA 4L52A 3AXWA 2W5HA 3DJ7A 3Q52A 1H1QA 2JFMA 5J9LA 2JBPA 4K11A 4YPDA 3DNEA 3G33A 4PWNA 4RJ6A 4BCQA 5DLSA 4ZXTA 5M53A 3I6UA 4TWOA 3LE6A 5FDXA 2IJMA 4W9XA 5FM3A 2CKPA 4E4MA 1BKXA 3WILA 2R4BA 5IH5A 3LJ1A 4KIQA 4MNEB 4LM5A 2WMXA 4BCKA 5M57A 1Q99A 3MH1A 3QZGA 4HGEA 2WEVA 4O22A 3WE4A 2QG5A 4L68A 4K2RA 4LL5A 2BDJA 2QU6A 4QMOA 1K2PA 4IVDA 2VV9A 4CYJA 3NIEA 3EFKA 4QP1A 3DTCA 3V04A 3G9NA 3S95A 4EOJA 3ZO4A 4Y46A 5EM8A 3BCEA 3F5PA 4QP7A 5LWMA 2QURA 4A7CA 3W1FA 3UNJA 4ERWA 4XNEA 4IAAA 2XS0A 4Z3VA 4PTCA 2CGUA 3TL8A 2UW0A 4ZTNA 5I9YA 4DEHA 3DDQA 2JAMA 3MFSA 4B6LA 2QOOA 3PXKA 3PVUA 2OZOA 5K5NA 1R3CA 5E8SA 5JGAA 3T8OA 1F0QA 3ZSGA 3MB6A 4E73A 5EQPA 4DH3A 3OUKA 4O0VA 4ZSGA 5IA2A 4NWMA 5CT0A 5HOAA 3DZQA 3OXIA 4RIYB 5GZ9A 4O1OA 4ZAUA 3NX8A 3P9JA 4BTKA 3ULIA 4TT7A 5HEZA 3DV3A 3VBVA 4EH8A 3W32A 4OBPA 2QOCA 4Z9LA 2GNGA 5CVHA 1RJBA 4H3QA 4YSJA 4DG2E 5FXRA 3N4UA 4D55A 2RKUA 5AMNA 4BRXA 2WB8A 3UGCA 3FYKX 5AAEA 2CNVA 2R3OA 3E8CA 4R5YA 3TZ8A 2ZB1A 1OKZA 1W82A 3BX5A 3SRVA 3ACJA 4D58A 5F95A 4CT1A 4PF4A 3QQUA 4CV9A 3TTJA 3RAIA 1F5QA 2GQGA 2ITWA 3O8TA 1JVPP 2W7XA 5FXSA 3QLFA 1FINA 2C47A 2GTNA 3KK8A 3L9PA 4G3GA 4YHJA 1CKJA 5T68A 4ARKA 4DCAA 4KBAA 5EQYA 4EK6A 4KIKB 3BU6A 5BVOA 4RC3A 4O6EA 1JNKA 4DGLC 5A3XA 4Y83A 2J0MB 3OS3A 4QYHA 3PXQA 5IQDA 3U6HA 4KIPA 3IQ7A 3F3WA 4H1MA 4H1JA 1P5EA 2R3MA 2Y9QA 3F5GA 4RZVA 3UO6A 3SX9A 3NNVA 4AT3A 5BUEA 4F7NA 4FV4A 1CKPA 2XZSA 3LCDA 5DVRA 4RA4A 5IQEA 4C62A 3DS6A 5AP3A 3CPBA 4MF0A 2IW9A 3VN9A 2AUHA 2WMQA 4FKQA 1Y57A 4BDCA 4Z7GA 1G8AA 5CASA 3QQFA 4C4HA 4FV8A 1SZMA 1P4FA 1TKIA 3MJ1A 4BWKA 4A07A 2YCQA 5AP7A 3QF9A 1XH6A 2PMIA 2PVHA 3JY9A 3ZTXA 5DYJA 5CALA 1XH5A 5C03A 1JKSA 4QTCA 4TYGA 5DR2A 4KKEA 1FMKA 4I5PA 4IE9A 5M55A 2QHMA 5AP1A 4C59A 4E5AX 3OHTA 4BCNA 3RAHA 3AC5A 4UB7A 5CVGA 3Q04A 5HTBA 2C0TA 1XO2B 3ZSHA 3QTSA 2JDRA 2BUJA 2C3JA 1PXOA 4DC2A 1CM8A 2QKWB 3AMBA 3ZM4A 3QTQA 3H0YA 4ZZOA 2HWOA 1DI9A 3GNIB 2YCFA 4PMMA 2X81A 1YKRA 4D9UA 3PSDA 3GQLA 4FGRA 3RK7A 3F7WA 5LCKA 3VUKA 4BTFA 4CD0A 2GHGA 3PVBA 4CNHA 5HO7A 5KMNA 3S0OA 2BAJA 3CPCA 5EG3A 4F9CA 3Q60A 2UZLA 2Z8CA 4FV9A 2QOQA 4MXCA 3IK3A 5DH3A 4MWHA 1OB3A 1GOLA 5CU2A 2GNHA 3H9FA 3JUHA 5FRIA 4ACHA 4Y5QA 2UZDA 3HNGA 1YDTE 4DH8A 4YZMA 3CBLA 3C0HA 4AE6A 4LV8A 4FGBA 2WIPA 1GZOA 2GS2A 5IEVA 2C69A 2ZOQA 5DIAA 3CKXA 3EJ1A 4IW0A 4XS2A 4YJVA 4AQCA 4HVIA 2X8DA 5CU4A 2GHMA 5KMMA 5IQGA 3ZEWA 2PHKA 1BL6A 5IA5A 4L44A 2C3IB 3SV0A 1H0VA 1WVYA 4IM3A 2BVAA 3QA8A 4FUYA 4JBOA 5HG7A 3QAME 4F6SA 4CGAA 1OL5A 2PZRA 4MX9A 3O7LB 4FK6A 4FSQA 4J1RA 1QPCA 2GTMA 3FHRA 1UU8A 3I1AA 3CE3A 5DI1A 2OFUA 3GQIA 2PTKA 5DRDA 4O27B 4AT4A 4BCJA 4UZDA 4EQCA 3W2PA 3PPJA 2YDJA 4C61A 4CSVA 1NT2A 3OBJA 5H8BA 5A4TA 3DFCB 3EN9A 2CGVA 4JIKA 2BCJA 3SXRA 4FSNA 3LFNA 4MYGA 3EL7A 4OW8A 3VULA 2BMCA 5AWMA 4ZLOA 4FTRA 3P4KA 4KAOA 4U42A 4UMQA 4U5JA 3COIA
chains in the Genus database with same CATH superfamily
3CD3A 3VVHA 5A4QA 2R3RA 3LQ5A 3LLTA 3LOKA 3TNIA 1XH9A 2GCDA 2HIWA 5K4IA 1WAKA 5IZFA 2YWVA 3FSFA 4BC6A 1OUYA 2CN5A 4FSYA 4EC8A 1KV2A 4Z55A 3RZFA 2FA2A 2HK5A 4FTQA 5L2WA 4GFMA 5L2IA 4O0RA 2CNUA 4O7YA 2A2AA 2XM9A 3NCZA 2PZPA 2F7XE 2VO0A 4GSBA 4CTCA 3FI2A 2XK4A 4JQ8A 5CU0A 5IF1A 4EZ7A 4O7NA 3VRZA 4MBIA 3RZBA 3OY3A 3C9WA 4G6LA 2O65A 4NSTA 5KZIA 3WIKA 3ZLYA 4GUEA 3QQJA 4XG7A 5BVNA 2XK9A 2P4IA 3GFEA 5HO6A 5IQCA 4E4NA 4W4YA 4QQTA 5IU2A 3HV7A 4C37A 2HXQA 2ZYBA 3UVQA 4UXLA 5AV1A 4CLJA 3LJ2A 2PZIA 3VS7A 3MBLA 4O0YA 5EYKA 2VTQA 4DGMA 1Q8UA 4GK3A 4AA0A 1J1CA 3WIGA 4DEEA 3F88A 4YC3A 4EOLA 5HX8A 5HU3A 3RAWA 2XEYA 3ZONA 2XARA 1YI3A 2W5BA 5J7HA 3NFFB 2OW3A 3NUUA 2X4ZA 3ERKA 4BB4A 3LMHA 1VEBA 3NR9A 2GNJA 2P3GX 3WF9A 3CQUA 4OT6A 4QNAA 1QL6A 2PVYA 5H8EA 1GNGA 3DNDA 1FMOE 2BHHA 3IW7A 3PZHA 5HICA 4YBJA 4BCMA 4C35A 3FDNA 3Q3BA 4GU6A 2NRUA 3LXPA 4HZSA 3ZO1A 4AUAA 4EOOA 4C3RA 5C8KA 1QCFA 4X6QC 4S33A 2WMVA 2JIVA 5AAFA 4AGWA 2WNTA 4K18A 2X1NA 4DAWA 4J8NA 3W18A 3P23A 4DYMA 4E6QA 4ASZA 3GT8A 5KMIA 4L9IA 4YZCA 3Q5IA 3KU2A 3MFTA 4IB1A 5A6OA 2W4OA 1O9UA 4YSMA 5BMSA 1QPJA 4OR5A 2PE0A 3Q2MA 3LXNA 4JG8A 4A4XA 4D4YA 1Q5KA 3FPMA 3FYJX 3RVGA 2NYAA 4AW1A 3QRUA 5BMMA 2EWAA 3T3UA 3MN3A 4F7JA 4J95A 5HHWA 4FR4A 3CIKA 3VRYA 3DJ6A 3AC1A 5F4NA 3DK7A 3OWKA 3BBTB 2OSCA 2A4LA 4IAYA 3NFGB 2FUMA 4BDGA 3RPVA 4C58A 2PVKA 3UQGA 3RMFA 3OT8A 3NNUA 3MTLA 4D9TA 3ZCLA 4CVAA 1CDKA 2HZIA 1YXUA 4G34A 3R8PA 1H01A 1SYKA 5JRQA 4QDEA 4FNWA 2BIKB 4CYIA 1IASA 5CF8A 4CG9A 3TTIA 5DMZA 4B0GA 3MYGA 4TKSA 2X6DA 1Y6BA 3RALA 3C4EA 2WTCA 1E1XA 3GCPA 2PVNA 2XJ2A 2A27A 4KIOA 4YTHA 3ALNA 1Q61A 4M14A 3OCGA 4EI4A 2CCHA 3QXPA 4UX9A 4LV7A 2H34A 3OY1A 3PE1A 3R2BA 4FUXA 5H8GA 4FT7A 3UP2A 5IA1A 4X0MA 2XJ0A 2W9ZB 2ONLA 3BPRA 5DRBA 3WBLA 4HGSA 1G8JA 4FTIA 3UC4A 5JT2A 3MTFA 4JQ7A 5LMKC 3EQIA 4ZY6A 3SDJA 4V01A 2PZ5A 5D41A 5M08A 1V0PA 3R8UA 4QOXA 3ZC5A 5I3OA 3CTHA 5CI6A 4YHFA 2PUPA 5LVNA 4L01A 2JEDA 3ML1A 3GC9A 3PG3A 2C5YA 4FV7A 2ESMA 2JC6A 3P86A 4XMOA 5DHJA 5EOLA 3FLZA 4RWKA 4F0IA 3DB6A 3QWKA 3RM7A 4ANLA 5FM2A 2YZAA 2BPMA 3JXWA 2WO6A 3U87A 2QLQA 4Q9ZA 4TW9A 5IQFA 4R7IA 3L8PA 4DG0E 3R63A 3VUHA 5DA3A 3ORIA 5E1SA 2ITTA 3GC8A 4EBVA 3HMMA 3EL8A 5KE0A 1ZZLA 1OPJA 4IX5A 3AT2A 2VGPA 4NM7A 3DT1A 3W0MA 2BRBA 3PY0A 2EXMA 3IO7A 4YJNA 2OF2A 3R8LA 3A60A 1S9IA 2JDVA 3EH9A 4BDKA 1H4LA 3EKNA 4DTBA 2C6OA 2F49A 3AGLA 3U55A 5ANEA 4CLIA 4BVUA 1GJOA 3K3JA 4G1WA 1GAGA 4JJRA 5EKNA 2BFYA 4DH5A 4FEUA 3KK9A 4M12A 4V0GB 2VAGA 4FZFB 3ODZX 4PTEA 5M07A 5LVMA 4AOIA 3KIOC 3Q4ZA 2W99B 3NW6A 1V0BA 5B0XA 2BALA 3UYTA 5IH4A 3MB7A 2BRNA 3TDWA 1J1BA 2A0CX 4ZTRA 3N4VA 3AGMA 3G0EA 4H3PA 4S31A 4TYIA 4BCOA 4C0TA 3R8VA 4EH7A 5K3YA 3KMUA 3UTOA 5CT7A 3EN7A 3EQDA 1Q3WA 4IC7A 4NCTA 3LMIA 3CS9A 4IB3A 4LV5A 4DHJA 2J9MA 4I0RA 2RFSA 1KE9A 3BYMA 4Y85A 3BLHA 1JOWB 4KSPA 4NJDA 4CMUA 3MESA 4AXFA 3MWUA 2HYYA 3LFSA 4PV0A 5D11A 4WA9A 4O2PA 5EH0A 4EH9A 3BU3A 2Z02A 3THBA 5CWZA 2C6EA 3KVXA 4JAJA 4BGQA 4UEUA 3ZXTA 2J0KA 4HVGA 4EK4A 5HORA 4GT4A 4EOSA 5H2UA 1WBSA 4YMJA 4RFZA 4BZDA 4NW5A 5CAOA 3HRBA 4UMPA 3NEWA 3ANRA 2JKMA 3SG8A 4FV6A 2YA9A 1OL1A 3FJQE 3LM5A 4EH4A 3QTIA 5JK3A 2PULA 3POZA 3HECA 1OZ1A 2QHNA 4NKSA 3VF8A 5JQ5A 5J7BA 2ZMCA 4O7VA 1VR2A 1JQHA 3DPKA 1TQIA 4ANQA 2OU7A 4ZSLA 3RK5A 3H9OA 4U43A 2EXEA 3FLSA 3LFAA 1J91A 4UMUA 4FVRA 4ZS4A 4CFMA 4WG5A 5AUWA 1VJYA 4A06A 1SNXA 3A99A 5JQ8A 4FVPA 3IKAA 4XOZA 5AUTA 3NUXA 2KULA 4C38A 4C34A 1VYWA 4ZY5A 3BEGA 3GI3A 5IH6A 2VTJA 3PIZA 3QKLA 3TNWA 3FLWA 4F99A 4O1PA 2JIUA 1JSUA 1UU7A 4F08A 3EYHA 4F6WA 2C6LA 2WTJA 3OUNB 2W1ZA 2HZNA 4PMTA 5CY3A 5EM6A 4I21A 4NIFA 4BKYA 3M1SA 2X6EA 3ZM9A 4LUDA 2HENA 4FKTA 3GOPA 3TZ7A 2I6LA 2XK8A 1RW8A 4ZTQA 5GINE 5D9HA 4RLKA 4EL9A 4O0SA 4IFGA 4ZMEA 3TKUA 5IA3A 2G01A 3BWFA 2YM5A 5C27A 4A4LA 4W4VA 3DU8A 4ASDA 4P90A 4MVFA 4NTSA 5DPVA 3ZDUA 2XKEA 1AQ1A 2BZJA 3PTGA 3FPQA 4BHZA 1PRYA 4RBLA 2OJIA 3EQGA 1M2PA 2G9XA 4RJ8A 4QMMA 4M15A 1KE8A 4D4SA 4PNIA 2Q0NA 3FZRA 4LI5A 5DGZA 4A9TA 2BAKA 1H00A 4WSQA 3UPXA 3IGOA 4IX4A 5BVWA 3FUPA 5HLPA 3W2RA 4EOQA 4BTJA 2R3GA 3UODA 3BHHA 4CQGA 2R2PA 4NT4A 4AS0A 3AKKA 3TYKA 2DQ7X 4O4FA 5LWNA 2PVRA 1KE7A 1ZZ2A 5I0BA 4I23A 1DI8A 2YIRA 3F3ZA 3QRJA 2CGXA 2W4JA 4QYGA 3VHKA 4EHEA 5IPJA 3TKHA 3LLAA 3IECA 2C0IA 4FKIA 4IB0A 1T46A 4YJTA 5A4LA 4CEGA 3QZFA 3RI1A 3DBFA 2YM4A 3NW7A 2PUUA 4OTQA 2A19B 2WQBA 2R3QA 2B9IA 3WF8A 2YM7A 4Y8DA 3VQHA 5HBHA 4QP6A 1JLUE 2B1PA 3EFJA 3NZ0A 4M8TA 3O2MA 4O7ZA 2UW7A 2QKRA 4WBOA 4DEAA 3R83A 4UXQA 3VS5A 1TQPA 4DE4A 4NUSA 3VJOA 3Q4UA 4O4DA 4TRLA 5L2SA 1W2FA 4OTRA 1IA9A 3LCTA 5CENA 3ID6C 4EJNA 4MQ1A 3D5UA 2V55A 1Q8WA 4J71A 5CEQA 3W16A 3EFLA 4ZK5A 3FWQA 1W98A 2OIQA 3BBWA 3FLQA 3NW5A 3D7ZA 4FVQA 4I20A 2F2UA 4ITJA 3DXQA 1RQQA 1H1WA 3QUEA 4OTWA 5AR3A 4BCFA 4I1ZA 3PY3A 4XRLA 2R3IA 2C5NA 4XP0A 4ALWA 3JVRA 4K77A 4B8MA 3KXMA 4D0XA 5DN3A 5AP0A 5CF6A 3COMA 1BI8A 2WGJA 3WE8A 2YIQA 5AEPA 4ACMA 4IVCA 4APPA 3E87A 2QOLA 4HYIA 5I5ZA 4XG8A 3DAEA 5CEMA 2XH5A 3ZRLA 1ND4A 2JKKA 2OH0E 4DFBA 2W1EA 4QTBA 2OGVA 2XUUA 2VTPA 2ONLC 4IAIA 3CGFA 4JT3A 4NM5A 1U54B 2YABA 3CKWA 5KBRA 3SA0A 3TV4A 5HG8A 1PHKA 5K4JA 1S9JA 5HE0A 3PVWA 4RA5A 4UWYA 1BI7A 3L8XA 4D2RA 4EH6A 1VZOA 2PVFA 1JSVA 2VWWA 5CU6A 2NO3A 4R8QA 5JGDA 3QKKA 4JG7A 2C6DA 3ROCA 4U41A 4NZWB 5FP6A 4X2KA 4R3CA 4X21A 4RC4A 3RPRA 4BTMA 3FI8A 4RX9A 4E4XA 3KMWA 2OXDA 2X8EA 3FMJA 2GQRA 3GU8A 4JBPA 4AZWA 5A46A 5HE1A 5TE0A 4TN6A 4F9BA 5BYZA 4YTIA 3C5IA 5IISA 3IW6A 4L7SA 4YZDA 4Q9SA 2WTKB 4D5KA 2VWXA 3V5TA 2EVAA 5J1VA 2V22A 3PP0A 2UW5A 2PE1A 3R7EA 2J0IA 4TYJA 4BBFA 5LMBA 2VWVA 2UW4A 4CQEA 2PWLA 3CCNA 4W9WA 5EM5A 1MUOA 3TN8A 3R8MA 5AM7A 4FKRA 4DA5A 4QMUA 4II5A 1Q24A 4QNYA 4D2WA 3UDTA 5HIBA 2C3LA 4XG6A 2WQNA 4HYSA 1T45A 3D83A 3HP5A 4U40A 4F7SA 1OPKA 1OKVA 3UC3A 3S1HA 1LUFA 3D7TA 5E91A 4AGDA 3P5KA 5EFQA 2BDWA 2HOGA 5CF4A 2AEGA 3EN6A 4S34A 4E6DA 3V6RA 4N0SA 4XG4A 3ZO3A 4FEXA 4OLIA 2XBJA 1H1SA 5BV3A 5B2MA 3QZIA 3PY1A 5ANDA 3C50A 3KCKA 1YI4A 4ASXA 1U5RA 4X3JA 4XYFA 3FC2A 1STCE 3VAPA 4EWQA 4JMQA 3O7LD 4L53A 2VGOA 3FZSA 4L45A 3VBWA 4AN3A 2I1MA 2J4ZA 4QYYA 4D2SA 3UG1A 3KXNA 3FY2A 2FH9A 3R01A 5AP6A 3V5LA 4G3FA 3F2RA 4LMUA 4BDHA 2RSVA 2DS1A 5LMAA 4IHPA 5DT0A 3BHYA 3VUIA 5FUTA 2JLDA 1UWHA 3PRFA 5A9UA 4M97A 2P2IA 4FG7A 3RAKA 4EUTA 4MD7E 1LPUA 1IAJA 5ITAA 2QI8A 2VX3A 2PZYA 3D14A 3KVWA 3NUNA 2EB2A 1WMKA 1ZAOA 4E93A 5LCJA 3MW1A 3F9NA 2CNQA 4N6ZA 3W10A 4RRVA 4MH7A 4PPAA 3VBYA 4CRLA 3FKNA 3WZDA 3W0PA 4IMYA 1WBTA 5A4CA 2QO2A 4FIFA 4I5MA 1SM2A 1GZKA 3DAJA 3C51A 1XR1A 4E6CA 4E3CA 5BVDA 4M67A 4ZLZA 5EQEA 4BR3A 4BY9E 2XYUA 4IANA 1NW1A 5AUUA 3WI6A 3DQXA 4N4SA 3BE9A 3DCVA 4GIHA 2C3KA 3CY2A 3NUPA 3U9CA 3NYVA 4MXAA 5AX3A 5HNGA 2R3LA 2BFXA 1Q41A 3REPA 3QRKA 5ANOA 4AGUA 3TNPC 4HVSA 1UWJA 3HZTA 4CKJA 5I9ZA 2W1IA 3R0TA 2C0OA 3CLYA 2XAMA 3FMNA 3G51A 2IW6A 3QLGA 1URCA 5L8KA 4GV1A 3FV8A 2VTLA 2CMWA 4G2FA 5AIRA 3W55A 4A9SA 4JLCA 2OI4X 3WZJA 2Y6OA 3RGFA 3ENHA 4QD6A 1PYEA 5TR6A 2UZUE 3TV6A 2DUVA 3M11A 4GMYA 3TZ9A 3KF4A 2W1CA 4FSUA 1PF8A 5HKMA 2H9VA 4NM3A 2JITA 4OT5A 3F5XA 3MS9A 4GG5A 3R6XA 4S2ZA 4BCPA 1NA7A 3SRVB 4FSZA 2B7AA 3KULA 3E3PA 4FODA 3VIDA 2OZAA 1LP4A 3HDMA 4L43A 3FQEA 1OUKA 3RM6A 3WZEA 4WNPA 3FAAA 3TWJA 3ZLWA 3GC0A 1H8FA 2WIHA 3DB8A 3R7VA 1W2DA 5DOSA 5HNIX 1M14A 3KULB 4E4LA 5BVEA 4B8LA 5IMEA 3VUDA 3CR0A 4O83A 4AAYA 4LRMA 4Q2AA 4CRSA 3EQBA 1UA2A 2AC3A 4GJ3A 3L9LA 3OW3A 5ANGA 5TF9A 1H26A 3B2WA 2JD5A 3CQEA 3GCSA 3HP2A 5EKOA 4BDAA 2R64A 4BGHA 2OH4A 3PIYA 1A06A 1MQ4A 4ENXA 3ZZWA 4DLJA 2Y0AA 2VU3A 3EQRA 4NFMA 3QKMA 4PNKA 5C4KA 1LR4A 3OCTA 4YR8A 2GU8A 3ZHPC 4AQKA 2YLFA 4DFLA 4CCBA 5JZJA 3SG9A 4MQ2A 2BKKA 3H4JA 4UZHA 4WT6A 5GJFA 3LFEA 4IWDA 3T9IA 3QRIA 4PL3A 3ATTA 4QMVA 3HKOA 3CTJA 4FV0A 5J79A 1O6LA 4FRFA 3E7VA 3QALE 3A7IA 2UV2A 2J7TA 2ZAZA 4XUFA 5JMSA 5GZ8A 2PYWA 1ZY4A 1U4DA 3M2WA 4R1YA 2PVJA 3KN6A 4RVMA 3U4WA 3NUYA 4FTJA 1Q8YA 1J7LA 3MY0A 4OTDA 4RVTA 2BDFA 4CKIA 3GC7A 2NNWB 3LQ3A 3PE2A 3MI9A 3DJ5A 1OECA 5JZNA 3FMMA 4OTPA 3MY5A 3H30A 3PXYA 4ANMA 1JPAA 3ENMA 4WNKA 4JDKA 4EOMA 1OBDA 4X2GA 1U5QA 4EONA 3I7CA 3JS2A 2IVVA 2IZTA 3FY0A 2ITVA 3Q9ZA 3TI1A 2JBOA 3W0SA 4P2KA 5FWKK 1NVSA 2W1GA 4TPTA 3A2CA 5ANKA 4MXXA 1PY5A 1ZYJA 3BI6A 3LFFA 4PDSA 1Y8YA 3TXOA 5HX6A 1KOBA 2NPQA 4V05A 2CKOA 3HMPA 4D2TA 2YDIA 3A7GA 2UZTA 2XP2A 3OG7A 5EOBA 2P33A 2X0OA 3R7OA 2V7AA 2J51A 2OFVA 4KRCA 3SQQA 5JH6A 4GCJA 4KBKA 3U54A 4DTKA 5L2TA 4C57A 3ET7A 3G90X 4TYEA 3D5WA 2WTKC 3VS6A 3R1YA 3QD0A 3NVKI 1O6YA 2RFEA 1XH4A 5CQWA 4EH5A 5BUJA 2YZLA 3LCSA 3GP0A 4WRSA 3C4WA 5HBEA 3UPZA 3D94A 4ITIA 2UZOA 2VRXA 3BLRA 3QX2A 4UMTA 3SXSA 4FBXA 4BWXA 5AUYA 3W0OA 5CSWA 5CF5A 3BQCA 4U6RA 4J52A 4D5HA 4RX5A 3UJGA 2B9JA 5CSPA 3LIJA 5HU9A 4RIOA 4FOCA 5CYIA 2UZNA 5JGBA 3II5A 3Q2JA 3C0IA 2B54A 4EJ7A 3L1SA 3POOA 1W83A 3ORXA 5E8WA 4E7WA 2HCKA 2DYLA 2IPXA 3G15A 4RQVA 3ZMMA 4I92A 1R1WA 5LVLA 3QXOA 3RBWA 1UKHA 1H25A 2E9NA 5IQHA 3R9HA 4O7RA 3E92A 1PMVA 2OXXA 4G31A 4R1VA 4WRGA 3KRLA 4F0FA 1YWRA 4PDPA 3DKOA 2XCHA 2WAJA 2LGCA 5F94A 2PPQA 4XCUA 5HIEA 3KA0A 3R9DA 3QHRA 4MHAA 4HZRA 4Z16A 3QBNA 3SVVA 1QPEA 2NP8A 4IAFA 1JWHA 4FTCA 4QRCA 5K5XA 5I3RA 4EEVA 2PY3A 1GIIA 5K0KA 2GSFA 4F70A 1OIRA 1OVEA 1RE8A 3AD4A 1NVRA 4HYHA 1OGUA 4M69A 1APME 4QPAA 3F6XA 4I6BA 5JN2A 5HLWA 4ORKA 2GNLA 4TWPA 4QMTA 4EC9A 1GIJA 4PMSA 2X0GA 5D10A 4AGCA 4K0YA 3ORLA 1KSWA 4PUZA 5CAVA 2OLCA 4M66A 4I24A 2QONA 4IDVA 2UW3A 4FYOA 2J50A 4C4FA 1IRKA 3S3IA 4FKWA 4M69B 5AADA 4LGHA 3W2OA 4EK5A 1M17A 3NS9A 3VW6A 5KCVA 2ZV9A 3JY0A 3QC9A 3V8SA 5L8LA 5JRSA 4MD8E 2IZRA 1TQMA 5T6KA 3MH2A 1DM2A 4HPTE 5ETCA 4DEIA 2R9SA 2V5QA 2OWBA 2W5AA 3B8RA 3NYNA 2RF9A 4IWOA 5D7VA 4YTCA 5I9WA 5KMJA 3BRBA 3DBEA 3PDTA 4AZEA 2C5XA 5FGKA 3DDPA 4F0GA 1I44A 3P7AA 2UW8A 3V5PA 5H3QA 1FGKA 1BYGA 3H3CA 3IPHA 4I41A 3RK9A 5CXZA 3KF7A 4ZS0A 1W7HA 3QQLA 4QPSA 4W8DA 4WD5A 2BKZA 3AOXA 3SHEA 1REJA 1K3AA 3HVCA 1YHVA 3OP5A 4U9AA 3LJ0A 4UYAA 1YDRE 2XKDA 4FE2A 3UDZA 3BYVA 4JNWA 2ITOA 2OF4A 4TY1A 1YWVA 3KY2A 3ORPA 4M7IA 3DLZA 3ZFMA 5IG1A 3C4XA 4BDEA 3LFCA 3UQCA 4J98A 4QMPA 4F64A 3C0GA 1XKKA 1YOLA 2YHVA 1G3NA 1JKLA 3BHTA 5EHLA 5L3AA 5EK7A 3UZPA 4O7LA 3BLQA 3VC4A 1TVOA 1FOTA 2C5VA 3FE3A 4BI0A 4XRJA 3PA4A 4LMNA 2RIOA 2W05A 5AV4A 1ZYDA 3LM0A 4U80A 1PXKA 4O84A 4I4FA 3PFYA 2J90A 4DT9A 3Q53A 4C4IA 3R7GA 3I5NA 4RIXA 3DTWA 4FTLA 2XIZA 4X2JA 4LGDA 3ORMA 1ZOHA 4NK9A 3ZOSA 5IMXA 4AFJA 3QUPA 1XBBA 3AQVA 4DHIB 2RG6A 2QD9A 3K5VA 5DEYA 3SAYA 3UOHA 4DFXE 1AD5A 4IJPA 2BROA 2YM3A 3E7OA 5E4HA 3QC4A 4GVJA 5AR2A 4DG3E 1UU9A 4YLLA 3F5UA 2R3HA 4CG8A 4ENYA 4BFMA 3EN4A 2W9FB 4QMLA 3FMEA 3AC8A 2BZIB 2YISA 4GRBA 4FEVA 2GNIA 2VTRA 3MGYA 5DE2A 4I6LA 3ORKA 2GPHA 5KBQA 3COHA 5EW9A 2HW7A 3OXTA 5IUGA 3MFRA 1QPDA 4P7EA 4KD1A 3HYHA 2NRYA 4JRNA 3Q5ZA 5KHWA 5M4UA 1OPLA 1IR3A 2G1TA 4CT2A 5FG8A 4QP9A 5HLNA 1ST4A 3GBZA 3KRJA 3MFUA 3TNHA 5FTGA 3F2AA 4XH6A 3T3VA 2A1AB 4RPVA 4DHZA 1ZMUA 4GKIA 3WARA 1ZYSA 4DDIA 3C13A 1CTPE 3HV5A 4EK3A 2FSLX 4YLKA 4XV2A 4QYFA 1WBVA 3NNXA 4I0SA 3MSSA 3OROA 2C6MA 4XBRA 4ANBA 1PJKA 3F69A 3WOWA 3TEIA 5DT3A 3CJFA 3HMNA 4JQEA 4R5SA 4U8ZA 4YUQA 2IWIA 3UMXA 1UNHA 1KE5A 3P1AA 1PYXA 4X2NA 1WBWA 1G8KA 1P14A 3G5DA 4I5HA 4RIWA 4E1ZA 4DDGA 5EI2A 2F2CB 3QD3A 1Z5MA 3DKFA 1JAMA 4JDJA 4UBAA 1OKWA 3E8EA 4I6QA 1REKA 3K54A 3KRRA 4C2WA 4YJPA 5AP5A 2ITXA 4IFCA 5IA0A 5HG9A 2WQMA 4MBLA 5IKWA 2VWIA 2FSMX 4YC6A 5GHVA 2CLXA 3QZHA 2R3FA 4HOKA 3HAMA 5IUHA 3I4BA 2BZKB 2Z60A 3C1XA 5E92A 5AP4A 5ETFA 3W2CA 2X9EA 2PU8A 4JX7A 3PG1A 3VS1A 3VUTA 1YVJA 4C36A 4WNMA 2I0EA 5J1WA 4EZ5A 3JPVA 3PJ2A 5AR7A 4TXCA 4ACGA 3LCKA 2WMUA 1SNUA 4M3QA 4BKJA 4BJJA 3AT4A 4ZTLA 4AXDA 3R30A 4IX6A 4TZRA 4RZWA 3LMGA 3QFVA 3BLAA 3Q4CA 4TYHA 3TNQB 5KHXA 4X7QA 4W8EA 5AJQA 4DH1A 4JG6A 4EHGA 4FTAA 4I5CA 5AV3A 2E9OA 1R39A 2BR1A 2VX1A 4OTFA 1EH4A 3QRTA 3RPOA 2J0JA 4BJJB 4NH1A 2OICA 3TDVA 2W1FA 2UVXA 2ITPA 3LCOA 3UMWA 1MRVA 3ZRMA 3ZS5A 2OK1A 4U7ZA 3VJNA 3P79A 5KUPA 4D1ZA 1IA8A 2J6MA 3FZTA 3MVJA 4LQMA 4E26A 1BMKA 5A6NA 3KCFA 4QMSA 3BQRA 4RJ3A 3SW7A 2HZ4A 4FSRA 4KRDA 3QCXA 2FGIA 4QQJA 4RJ7A 4OBOA 4YHTA 3U9NA 3DQWA 2Z7RA 3ORNA 5F20A 3RTPA 2W1HA 2FB8A 4NM0A 3PXRA 4U44A 3ACKA 5E7RA 4HJOA 2WTVA 4O96A 4IQ6A 3BZ3A 2C1AA 3D4QA 3R2YA 4G9RA 3PYYA 3OOGA 4JOAA 4HW7A 2YN8A 3P08A 4L3JA 4ACCA 3LW0A 3PA5A 2W06A 3P0MA 3PPKA 2WOTA 3R1QA 2YJSA 4C3FA 5ETAA 4WHZA 2OG8A 1I09A 2O0UA 3G2FA 2WTDA 3U51A 4BZNA 4U97A 2BRHA 2ZM4A 4CZYB 2XRUA 4WKQA 3UNZA 4IAKA 5HD4A 2XNPA 3GU6A 2WXVA 3IDCA 4GG7A 4YO4A 3TUBA 4ANOA 4NIFB 5K0XA 2WQEA 3QTXA 2JAVA 4QMWA 4AXAA 3QGYA 4F4PA 3Q9YA 5L2QA 3UIUA 4IZ5A 4BCGA 4DEDA 3NPCA 2Q0BA 5KKRB 3B8QA 4G16A 3MY1A 4HYUA 2FYSA 5F9EA 3CXWA 3E88A 3OF0A 4BN1A 3KC3A 4NKAA 4IVAA 1A9UA 3L9NA 4L3LA 4AXCA 2Y4IB 3MJ2A 4IADA 4U81A 2YCRA 3HV3A 2BTSA 2C5OA 2LAVA 5A4EA 4QPMA 3ATSA 2XAOA 3CD8A 1FVTA 2CDZA 3O96A 4FV1A 4NW6A 3BV2A 3DY7A 4A9UA 5CAPA 3PLAE 4R3RA 5HBJA 1WBNA 4ZOGA 2KTYA 3UIMA 4ANSA 3E8NA 5J95A 5IQBA 3QTUA 4L7FA 4O7SA 5LQFA 3IDPA 2CCIA 2Z7LA 1CMKE 1XH8A 2X39A 2YERA 3E8DA 4HVHA 2G2FA 2WTWA 4M84A 5DR9A 2OJJA 3OD6X 3E93A 2XNNA 1GZNA 1PW2A 4AF3A 2FSOX 4UY9A 4U3YA 4F1OA 3R1NA 4GFOA 3R7UA 4QTEA 4ERKA 3DAKA 4FZ7A 5M4FA 5M4CA 2H8HA 1XMMA 2WEIA 4GU9A 3VONA 2PVLA 5AA9A 3R04A 4MWIA 3WF7A 4OTGA 3I60A 3VO3A 4F6UA 2R5TA 3HA8A 3BKBA 4L46A 5AV0A 1SVGA 2WZJA 5GIPE 3BV3A 2X7FA 3HEGA 5L6WL 2GFCA 4ONAA 1Z9XA 3IGGA 4LOOA 1XBCA 5G1XA 3COKA 4DEBA 2XVDA 2WKMA 3MIYA 5H9BA 3TKIA 4F9AA 5TKDA 1NVQA 2X9FA 4YJOA 4ZP5A 5CAQA 2CKQA 2GS6A 4FNZA 5AX9A 4D4VA 4EH2A 5HCYA 4ZJIA 5LVPA 3UZTA 5FBNC 2OJ9A 2Z7SA 3IOKA 3NLBA 4RJ5A 3OW4A 3SOCA 1PXMA 2OJFE 3FXXA 4GH2A 3OWPA 4JVGA 5E90A 4XG9A 4FYNA 3UVRA 4DHFA 2IEWA 2PE2A 2XIYA 2B53A 3NIZA 3RHKA 2R3KA 3FZPA 4H36A 4KBCA 4YP8A 5HO8A 2C6KA 1E1VA 1H24A 3D5XA 3VW8A 3NUSA 3A7JA 4ZTMA 4XP3A 4FL2A 3KRXA 2QQ7A 1XQZA 1Q4LA 4ITHA 2YIYA 3IG7A 3V6SA 3ZH8A 1XBAA 3HV6A 4AWIA</