3OUNB

Crystal structure of the fhaa fha domain complexed with the intracellular domain of rv3910
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
257
structure length
256
Chain Sequence
QLVPGARIANGRYRLLIFHGGVPPLQFWQALDTALDRQVALTFVDPQGVLPDDVLQETLSRTLRLSRIDKPGVARVLDVVHTRAGGLVVAEWIRGGSLQEVADTSPSPVGAIRAMQSLAAAADAAHRAGVALSIDHPSRVRVSIDGDVVLAYPATMPDANPQDDIRGIGASLYALLVNRWPLPEAGVRSGLAPAERDTAGQPIEPADIDRDIPFQISAVAARSVQGDGGIRSASTLLNLMQQATAVADREVLGPID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TB39.8
publication title A phosphorylated pseudokinase complex controls cell wall synthesis in mycobacteria
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein binding/transferase
total genus 69
structure length 256
sequence length 257
ec nomenclature
pdb deposition date 2010-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ounB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ounB01
4BCOA 2EU9A 3HV7A 4EOQA 2JIIA 4OTDA 2C30A 2W5AA 3VIDA 1SVHA 5KHWA 2PPQA 2C3LA 3B2WA 4FT3A 3E8NA 4X2NA 1XH4A 5J5SA 4RJ3A 2W4OA 3DJ6A 4NW6A 4ANNA 5LQFA 5BVNA 1BLXA 3TDWA 4XLIA 3BLRA 4YSJA 3U8WA 3W2OA 4BCQA 3A4OX 3DBFA 2B1PA 2C5XA 4QP9A 3U9NA 4ASDA 4F1TA 1H1SA 3FWQA 4M69A 4W4VA 4BICA 4R7IA 2XM9A 3PFQA 2ZV7A 3I7CA 4FSRA 5E8XA 4E20A 4BCNA 1OKWA 2V55A 2GNFA 4ZZNA 2JKQA 4NW5A 5D12A 4XH6A 4MXAA 5H8EA 3E7OA 3MBLA 4YTFA 2C3KA 2RGPA 4C8BA 4XP2A 5AUXA 5H9BA 3COMA 5EQEA 1SYKA 4QP3A 1YOLA 2PZIA 2ITYA 4XUFA 5AX9A 4GUEA 2YIQA 4K33A 1BL7A 4MK0A 3OMVA 4RWJA 3TV7A 4FODA 2VTHA 3PIZA 5IUGA 3CD8A 5BYZA 3QRTA 3S2PA 1DI8A 3HUBA 3MPMA 3V6SA 2CKEA 2XNEA 3NUPA 3LXNA 3JXWA 3KKVA 3R73A 4HPTE 4Z55A 4M66A 1REKA 3BQRA 4CYJA 3FEGA 5JK3A 3R21A 5HG9A 4D0WA 4JRNA 4QOXA 3I5NA 3QCXA 4XP3A 2VO0A 1KOBA 3NYOA 3W8QA 2RF9A 2OWBA 2UZDA 5CZIA 4QPMA 3N4TA 2Z8CA 5FEQA 2FSTX 4MWIA 3VAPA 4DGGA 5IKWA 4RBLA 4ZSJA 4D2TA 4JI9A 2CDZA 1LEWA 3Q2MA 4QPAA 3PA3A 1S9IA 3QD2B 2JC6A 4QNYA 4IB5A 4X2FA 5E8VA 2QCSA 4IX6A 4BIBA 4JDJA 4DFYA 3D7TA 4O2ZA 3UOKA 4XOYA 4YC8A 3Q6UA 1TQIA 3A8WA 3NW6A 5M4FA 3PJ2A 3OCBA 5L4QA 4IE9A 5CENA 4BYJA 3D2IA 5GZ9A 5C01A 1J7LA 5CSXA 5EI6A 2WKMA 2I0YA 4NFMA 2AC5A 2PVMA 3GFEA 2BHHA 4YJNA 3KGAA 5DNRA 2WQOA 3LMGA 1WBWA 2YLEA 4I4FA 4PF4A 4BRXA 5JFVA 3FYKX 5A4EA 4AUAA 1OKYA 5M53A 2HZ0A 3REPA 4FIEA 3GQIA 3TUDA 4OTQA 1QPEA 4NJDA 5CTPA 3QQKA 4BN1A 4G5PA 4L67A 2BRHA 1KE6A 2XJ2A 4YC3A 5TE0A 3VS1A 5CWZA 4FKVA 4ZTLA 4FZFB 2O3PA 3W1FA 4JDIA 4A4XA 3EQGA 5DYJA 4F9CA 4GVJA 4C02A 4PNIA 4ONAA 2OFUA 4UXQA 3NUSA 4DEAA 2C6LA 4RIOA 2PVYA 1CM8A 1YDSE 3F88A 3MGYA 4BDJA 5CEOA 3PLAE 4L45A 4DCEA 5IG1A 3IK3A 4YHJA 3WBLA 2VGOA 1DI9A 2SRCA 3MB6A 2YN8A 5CEPA 4UYAA 4A4OA 2YIWA 3JVSA 2YWVA 4GRBA 4D28A 3I7BA 3LCDA 1R78A 2CN8A 2PVRA 3A62A 4KB8A 5DLSA 3UMXA 4PMPA 3VUMA 2YCSA 5HG7A 5A4QA 1YW2A 3P7BA 3LW0A 1APME 3UPXA 3VWAA 5I9ZA 5BMMA 3ZFMA 2W1EA 2XIZA 4XOZA 5HD4A 2CCHA 1IASA 2WTKC 4NUSA 2QG7A 4XMOA 2JD5A 5GZ8A 3DKFA 3N4UA 2PSQA 4EOJA 3NIZA 4E73A 1Q8UA 4UZDA 1OBGA 3SV0A 2VGPA 3VS0A 4HGEA 1O9UA 1Q3DA 3FDNA 5CNNA 4O86A 2R3IA 4IXPA 2VNWA 4LGHA 4ZY5A 5JFXA 4PWNA 3SQQA 4TL0A 4CSVA 4F0IA 4G2FA 3ZSIA 2WTIA 4APCA 4C61A 3KRXA 3LJ1A 1P2AA 3L9NA 3M1SA 1OL6A 4DINA 4EWHA 1ZY4A 1CMKE 2OU7A 4L68A 4RLKA 1IAJA 5KX8A 3IS5A 5ETAA 4BB4A 1JNKA 3RZFA 5CF4A 3RK9A 4BBEA 4D1ZA 1BYGA 4RG0A 4XNEA 5EH0A 4BWKA 2X8EA 2CKOA 4FKPA 4O7YA 3RPRA 3UQGA 4MXCA 5FRIA 2VN9A 4JBQA 3BE9A 4QRCA 3D94A 5IH6A 3CY3A 3FSFA 4QTEA 5HQ0A 2UZEA 2VNYA 4QMYA 4ZSLA 5FXQA 1OZ1A 1WVYA 4MBIA 2QO7A 3QD0A 2BDWA 3HV6A 4BKJA 1BL6A 2GNIA 4E7WA 2GFCA 4J96A 3RVGA 2OZAA 2QKRA 5CAOA 3LJ2A 3WF8A 5GHVA 4IQ6A 3A4PA 5AUWA 4FSMA 5DT3A 2XJ0A 2W5HA 5AUYA 2JBPA 3VUDA 5KHXA 3Q5ZA 3QLFA 4PMSA 4IADA 3B8QA 4XBRA 1F0QA 1P4FA 2Z2WA 2ZDUA 1UKHA 1KE7A 3FY0A 3F2RA 2XIRA 4KIPA 4OT5A 3U4WA 5FTQA 3RPSA 3O96A 4ZS0A 3MJ2A 5C1QB 1WVXA 3RCJA 4ZY4A 5M4IA 3CP9A 4DHFA 2ITWA 2F4JA 2OI4X 4UY9A 4EEVA 4EUUA 3EWHA 3FI3A 4ZLOA 4FEWA 1YDRE 4UALA 4CFFA 2OLCA 3KCKA 5CSHA 2ETKA 5BYLA 5AR7A 4ZSAA 2QHNA 1GZOA 1RW8A 3E8DA 3G6GA 2ERZE 2IG7A 4XG9A 5JEBA 3BIZA 3QCYA 5AP7A 4FKOA 4C4JA 5I4NA 2YERA 1JKTA 5C8NA 2UZBA 4MXOA 3SA0A 5EQPA 3NDMA 4TYIA 5K9IA 2X8IA 2UW4A 2X7OA 2NP8A 3BLQA 3CQWA 4FIHA 4BBFA 2QI8A 3SW7A 2WMBA 4NEUA 4ZTQA 3BLHA 4MXYA 5EDPA 2QLQA 4JLCA 1J7IA 3GOKA 2C5OA 2HZ4A 1ZYDA 2G15A 2FUMA 4ERWA 2CCIA 5A9UA 3G15A 4AOTA 4R7BA 4BDAA 2XEZA 1QMZA 4PPCA 5CXHA 2GNGA 4H1MA 5CT7A 3TV6A 1OUKA 5AR3A 5EYMA 4FEVA 4QMXA 4J99A 4YJSA 2R7BA 3KULA 2YLFA 3AQVA 3D14A 1Q8WA 2YJRA 3E63A 2YHVA 3OVVA 1OVEA 2UZVA 4IVAA 4J7BA 3OEFX 4IJPA 2YDJA 4AN3A 4GU6A 4RJ8A 3ZONA 5E4HA 1NVRA 5AADA 3KK9A 1YVJA 3OOMA 3VHEA 4X0MA 3LMIA 4GK2A 4U45A 3SGCA 4BDIA 2CKQA 2V22A 3WE4A 3OUKA 4I20A 2V7OA 2OSCA 3RGFA 1Y57A 3L8PA 5BYYA 2Z7LA 2HY81 2QURA 4IVBA 3R0TA 1OGUA 3QYZA 3MIYA 4G3CA 4LGGA 4WNMA 2PVHA 3UVQA 4BCGA 5HGIA 4UV0A 2PY3A 2PTKA 3LFDA 5EK7A 2G2IA 3CGFA 1ZAOA 3EN7A 3G9LX 3HP5A 3Q3BA 4FEQA 3UG1A 1W83A 3D5WA 5HX6A 4EK8A 4PDYA 4ARKA 3MA6A 3Q4TA 3MIAA 4X3FC 3KF4A 3BHTA 2WQNA 4WBBB 2FSMX 2VTJA 4MH7A 3EH9A 4XG8A 4LUDA 2C5NA 3BV2A 3P1AA 4S33A 3UVRA 4NM7A 5JSMA 3SVVA 4KA3A 1YI3A 3FKNA 1M7NA 4FUYA 4TXCA 4WG3A 5HIDA 3HUCA 3OCTA 4IZ5A 1FMKA 4N70A 5D7VA 5L6PA 2YITA 5AP3A 3R1YA 5ETFA 3BYUA 1Z5MA 3TKIA 5EHLA 1GJOA 2QOBA 2RFEA 3KRWA 4RIXA 4V04A 5L3AA 3B2TA 2W4JA 3ZC5A 5D41A 4ZOGA 4I5PA 3OOGA 5E1SA 2F57A 2BKZA 1PXMA 4BKYA 1PY5A 4EYJA 4B0GA 3MY1A 2W0JA 3FJQE 5LCKA 1WMKA 2PULA 4R3CA 2OJJA 4USDA 5EOBA 1ZOEA 5IEYA 4A07A 3KMMA 1WAKA 3ZEWA 4BDEA 4S30A 4R3RA 5L8KA 2XP2A 3WYXA 3SAYA 3HRBA 5F4NA 4NYEA 3DDQA 1HOWA 2RG5A 5M4UA 2V0DA 2B4SB 4FK6A 4BWXA 2J0MB 4X3FA 4NIFB 4XRLA 3RMFA 2OK1A 3WIGA 2ITPA 3Q5IA 2A1AB 3WARA 2BRGA 2OJGA 3UODA 3AC3A 5AM6A 5LVOA 4FKUA 2DWBA 4C62A 2ITOA 4I5CA 4KINA 4DC2A 5KMIA 3DGKA 3HRFA 4K6ZA 3TJDA 3TN8A 4L3JA 4EQCA 2HW7A 2LGCA 4E4XA 4EWQA 5HU9A 3F69A 3HL7A 3QA8A 5ICPA 1YOJA 2C47A 2IWIA 3UNJA 3QBNA 5BVFA 4DG3E 3ORMA 4KKHA 4WRSA 2RG6A 3DZOA 2O5KA 5ANGA 3ETAA 4XJ0A 4I21A 2E9NA 4N57A 4ZAUA 5HVJA 2QO2A 4EOIA 5HOAA 2PVFA 5CSPA 3PP0A 2DS1A 4J95A 3ZLXA 3ORXA 3EN4A 3O23A 2J5FA 3HV3A 5G6VA 2PZYA 1JAMA 2IVSA 3DXNA 4FYNA 4OTWA 5EHOA 2Y4IB 4M15A 4ZTNA 3WF6A 3CKXA 2J9MA 5FTOA 3FE3A 4G9CA 3LLAA 5A6OA 4H1JA 1H1WA 4Y5HA 5AV1A 4GEOA 3TG1A 4EH6A 2X39A 4LQMA 3EIDA 5FP5A 4IZAA 3VULA 3KRLA 3QQJA 4O0RA 4G6OA 5CF6A 4DE4A 3BHUA 5KZIA 3SDJA 3AOXA 1A48A 4NM0A 4JNWA 2XF0A 2ZOQA 3OWLA 4FBXA 2BVAA 4YJRA 2VRXA 1KV2A 3KXXA 4AF3A 4WNKA 4M13A 3VQHA 4L00A 5CALA 2O63A 2VTMA 3W10A 3UC3A 3E88A 4C2VA 3QAME 1CKJA 4FKLA 4ZSEA 4IH8A 2XK7A 3DAEA 1H8FA 4LGDA 4LMUA 1SMHA 3SOCA 5BVKA 2UW8A 3RK5A 3BPRA 4OTGA 3VUGA 3W16A 2C5VA 2GDOA 4O38A 5GJFA 5JRSA 4ZXTA 4CCBA 3U54A 2R0UA 5HE2A 4I22A 3RK7A 1OL5A 4TYJA 5AV0A 3L9PA 2CGXA 2IVVA 3MN3A 3QTRA 4AQCA 4JG8A 5DBXA 4MX9A 4DGOA 2QU5A 2W1CA 3D2KA 3PLSA 3LFCA 2PUIA 2QOLA 4IVCA 4I1ZA 5DEWA 3V8WA 1IR3A 1URWA 4TN6A 1CKIA 4G31A 5AR2A 4G5JA 2BR1A 2ITXA 4F08A 3QQGA 5C8MA 4FUXA 5DIAA 3EYGA 2YA9A 2EWAA 3F3TA 4ZTMA 1JPAA 4C4FA 2F7ZE 2WAJA 4AA0A 2Z02A 3OTVA 2QOIA 3QTZA 3SC1A 4J98A 3FXZA 2R3JA 3ORKA 3DK7A 4AN9A 4BGQA 3AMAA 3R8LA 5HTIA 2WD1A 2UW6A 2X0GA 3FKLA 1YI6A 2YM8A 1QCFA 3FL4A 3OP5A 4V0GB 1NT2A 3WE8A 2J6MA 3FZPA 5IDPA 4DBXA 4I0TA 3FI4A 4CRSA 5FG8A 4PRJA 3IW6A 3C13A 2JDSA 2YIRA 4TWNA 5AX3A 1U5RA 3G2FA 3GC0A 5J79A 3I4BA 4NKSA 3IW8A 4KIQA 3E7VA 3I79A 4O84A 3BE2A 4QTBA 2EB3A 1JSTA 2YCQA 3IONA 3Q9XA 3C4EA 3BWFA 3RAWA 2QR7A 2WTWA 2UW7A 4FSQA 4FV2A 2BCJA 2PZPA 4IC8A 4J1RA 2JIUA 1JKKA 3UGCA 2W7XA 4WRGA 4CEGA 2VWVA 4FNWA 4R1VA 4BDKA 2ONLC 5JZJA 4XV1A 2PVJA 3C51A 3KXZA 5EOLA 5HHWA 4WUAA 1ZY5A 3A60A 4IEBA 3L9LA 5DA3A 1URCA 2XKCA 3HX4A 5K3YA 3TV4A 3AT3A 4QMSA 3C5UA 3D0EA 3HV4A 3KN5A 4QMNA 2ZMDA 4L44A 3EYHA 4S2ZA 3RAKA 3ZU7A 3F9NA 2X4ZA 4U6RA 1YXXA 2XBJA 3Q96A 2C1AA 4IB0A 4WA9A 2VTOA 4HNFA 4TYEA 4CZUA 3I81A 5EG3A 5HI2A 2X7FA 4R78A 5EDRA 1YRPA 3VBYA 5K5XA 1M2PA 1OPJA 1Y8GA 3EZRA 4BI0A 4CRLA 4ZLYA 5CT0A 5IDNA 1VJYA 3U9CA 3AD5A 3U55A 3BU3A 3DCVA 3K54A 1Q97A 2BKKA 5EM8A 2NRYA 5AAEA 3KY2A 5EDQA 3PY1A 3V5LA 5AAGA 5HLNA 4CFMA 4DFUA 4IWDA 4YMJA 2XCHA 3ZUUA 5ACKA 4E4MA 4JRVA 3GFWA 2ONLA 4FV5A 4F63A 5A46A 3DAJA 2C6TA 3MDYA 3OFMA 4FK3A 4JDKA 1WBNA 5GJDA 4JT3A 4HNIA 5A4TA 3KXNA 5AJQA 3RNIA 2BFXA 3VS3A 4GKIA 2CLXA 1MQBA 1OPKA 3R8MA 3A2CA 4EZ7A 4YZDA 4FGBA 3NUAA 3DTWA 3KREA 3PDTA 3N51A 4CFVA 3QWKA 2AYPA 3QCSA 3NEWA 4IAFA 2O65A 4GVAA 2W96B 5FD2A 4W4WA 4BGGA 5CASA 5CU3A 5CX9A 5IMEA 3DFCB 3UQFA 1Q8TA 4QP1A 4R1YA 3R7OA 3LFFA 4X6QC 5KZ0A 5IQGA 3BZ3A 4FOCA 2WEVA 3K3IA 3QQUA 4WHZA 3PPZA 2QONA 4HZSA 2JDRA 4A06A 5KKRC 2Y0AA 2QOFA 4CD0A 4L46A 4AZFA 2R3PA 2C0TA 2WTJA 4PPBA 5AWMA 2G2HA 5CY3A 4O91A 3WZDA 4ACGA 1G8AA 4YBKA 2HK5A 3H30A 3TTJA 1OUYA 3ZO2A 3KC3A 4M3QA 5I9UA 4OTPA 2O0UA 3EQDA 4EBVA 5CAVA 1ZMWA 4MD7E 4DFXE 3NNXA 5ANEA 1H1RA 3IW5A 3EJ1A 4RPVA 1T45A 5EYDA 4M8TA 5L2WA 2FH9A 2XNOA 2XRUA 5HE3A 3RHXA 2XK3A 3PSCA 3FMEA 3NYVA 3IGGA 2CGUA 3R1NA 2X9EA 4RMZA 2VWUA 3DPKA 5D7AA 1MP8A 1KE5A 2VX1A 1JQHA 3VBTA 4JJRA 3TUBA 1XWSA 3OG7A 3ANRA 4YJUA 3OXTA 4JVGA 4Q9ZA 4NZWB 5A54A 2GHGA 4RWLA 4BTKA 5BVOA 4ZS4A 2WOUA 4XP0A 2HCKA 5DN3A 3ACJA 2P4IA 5E8YA 4YO4A 5AMNA 5I9YA 5JGAA 1SM2A 2ZMCA 1E1XA 2J4ZA 1U4DA 4RGJA 2E9VA 3LXPA 5IQHA 1UVRA 3PVUA 1IAHA 1R3CA 4QMLA 2HELA 4QTAA 4HW7A 3LCKA 3FMMA 4NK9A 4N0SA 3UIMA 4FKJA 2Y6OA 3VO3A 2XH5A 3ET7A 1BX6A 3F82A 3O51A 4MEDA 3ZLSA 4I6BA 4QYEA 3U4UA 3OXIA 3VF9A 5LARA 5LMBA 1VR2A 1Q3WA 3QL8A 3VBXA 4B8MA 3CXWA 3ZTXA 3K5UA 1S9JA 3D15A 4UN0C 3RP9A 3Q4UA 4KABA 4L01A 3RZBA 2ACXA 2XYNA 4I5MA 2C3IB 4LL0A 4X6RA 3NW5A 4CZTA 2WB8A 5BMSA 4U79A 4C58A 3QFVA 3UZTA 4GK3A 2W1IA 3UP2A 4QYYA 1H01A 1CTPE 1L8TA 4EONA 4Z16A 4D4SA 4C33A 5HIBA 4X2GA 3DLZA 3BBWA 4K2RA 3NGAA 3PG1A 3R7YA 5HESA 4DTKA 4PDPA 1WBPA 2QG5A 3QHRA 2OH4A 3BCEA 1GNGA 1YQJA 2J0LA 4C38A 4CLIA 4Y8DA 2QKWB 3NPCA 3QQFA 2WMXA 4RIYB 4W4YA 4LM5A 2JEDA 3GVUA 3OXZA 5H8GA 2YAKA 5HD7A 1QL6A 3KCFA 4C4GA 4M0YA 4QMWA 5B0XA 4BFMA 2GQSA 2BZKB 1TQMA 4WIHA 1PYEA 4USEA 4CT2A 4DLIA 5BVDA 3CS9A 5HO7A 1RQQA 5AUUA 3POZA 5HO6A 4OBOA 4EOPA 3G90X 3PY0A 1Q61A 2BPMA 3A8XA 4F0GA 4C4HA 3MSSA 5H2UA 2J51A 4L8MA 4UMRA 3EQFA 2W4KA 2PK9A 2QO9A 3F2AA 2JDTA 4I0SA 3MVMA 2WMRA 2BAKA 4RVLA 3HMNA 1H0WA 3PXFA 4P4CA 1U59A 3BEAA 4LG4A 4P90A 4YR8A 2BDJA 3PVBA 3TTIA 5I9WA 3UZRA 4FT9A 3VBVA 3LXKA 2WQEA 2B53A 3DFAA 4FE2A 4D5HA 2GHMA 5FEEA 3FUPA 3V51A 2BMCA 2B9JA 3DV3A 5HLPA 5HIEA 1UU3A 4FV9A 2FVDA 3C0GA 3R00A 5JGBA 2R0IA 3Q4ZA 3GNIB 3A99A 4RC3A 5LWNA 1H24A 4KKGA 3LCOA 3MFTA 2XVDA 3CTJA 4RT7A 5JQ8A 4IBMA 1LPUA 3ROCA 1BI7A 4M68A 3AD6A 2H96A 2Z7RA 3O71A 4MKCA 4RZVA 3R71A 4D4VA 3DBEA 4XV9A 4EC8A 3HNGA 3IDBA 3KVWA 4TY1A 2P3GX 1LR4A 4O27B 3OBJA 1NVQA 4K77A 5E92A 4BIEA 3DQXA 1ZLTA 4FTNA 4I92A 4C4IA 5ANKA 3WZEA 1GY3A 4RA5A 4LYNA 3LFNA 5IPJA 3PJ8A 4RA4A 4KD1A 2GS2A 2BHEA 3C0IA 3QZHA 4OTHA 4E3CA 2R3MA 2I1MA 2WNTA 3F6XA 3ID6C 3UIBA 4L9IA 3H4JA 5FQDC 2CJMA 2YJSA 5E8SA 2XEYA 3W8LA 3BGZA 3GGFA 1HCKA 4B99A 4F6WA 2BALA 4O7LA 4R77A 5DRDA 3MH3A 4EH5A 1XH5A 3CIKA 3E8EA 3F5GA 3ZDIA 3CJFA 5J1WA 4EH3A 5M57A 3C7QA 2ITNA 5KMJA 2OH0E 4RRVA 4X3JA 3OEZA 2YABA 5T6KA 3RM7A 1W8CA 3HDNA 5DMZA 1XH8A 4FTKA 4DAWA 4DGLC 2W9FB 4FTUA 2QD9A 2FGIA 2NRUA 3QRUA 5CSVA 5DH3A 3R9RA 4F0FA 4HVGA 3C4WA 2XNGA 2R3GA 2GNHA 5AP0A 3OUNB 1YXSA 2DQ7X 2ZB1A 1ZXEA 3POOA 4IZ7A 2YDIA 3TNQB 1V0OA 3GC7A 3UG2A 4FV4A 2W05A 3U51A 1R0EA 4HGTA 3EQHA 5JMSA 4FTQA 3TM0A 2R7IA 3C1XA 3ZC6A 4IVDA 5HE0A 5L8LA 3MJ1A 1ZMUA 1SNXA 3BGQA 3P7CA 4DITA 4YPDA 2CGWA 4BL1A 5DFPA 3MESA 4U7ZA 5HTBA 4NFNA 4LI5A 4G17A 3DBCA 3IGOA 3NLBA 4DH3A 2Y4PA 3PPKA 3BWJA 3SRVB 4D2SA 2XIXA 4FZ6A 2GNJA 4QQTA 2YIXA 2HW6A 5TOZA 4PP9A 3UYSA 3A7HA 3HGKA 4ANMA 4QMPA 4UMTA 5K4IA 5A3XA 4EK5A 3O8UA 4LOPA 3QALE 2VWZA 4MBLA 3BEGA 4MWHA 3NUNA 3RI1A 3F3UA 4ANOA 5CI7A 3FBVA 3D7ZA 3FLWA 5AR5A 4EORA 3D4QA 3EL8A 1H0VA 3B8RA 4FSTA 3K3JA 3EN5A 2UZNA 4NWMA 1YXVA 4QMZA 4UYNA 5DEYA 4BCMA 4ORKA 3HKOA 2W17A 5D1JA 1FQ1B 1KOAA 3KL8A 4IX4A 4MBJA 4RVMA 4W9XA 3UC4A 5J7BA 3LQ3A 4FGRA 4O21A 1TKIA 2C4GA 4R3PA 4RJ5A 4EBWA 4KUJA 1UU8A 4FVPA 2XUUA 5HZNA 4HZRA 2BTSA 4DCAA 2YM3A 4F64A 4AW2A 3LE6A 2UVZA 5DGZA 2G01A 1SVEA 3EMGA 4QMUA 5M56A 3UNZA 3ORNA 3SHEA 2QLUA 2W06A 3HMMA 4L3PA 3VRZA 3ZDUA 2YZAA 5I0BA 1ZRZA 2CKPA 4GT3A 1IG1A 4W8EA 1V1KA 4OT6A 3ZXTA 4A7CA 4FG9A 4BTMA 5LOHA 3DBDA 1MRVA 5HO8A 4DA5A 2JGZA 4Q5HA 4RLLA 4K1BA 3Q6WA 5JKGA 2PMIA 3MY5A 1H27A 2JAMA 3VW6A 1UNGA 4PTGA 2C6OA 2FO0A 2CGVA 2GSFA 3FPQA 1BMKA 3QTUA 2YCRA 3NR9A 4GUBA 2OGVA 5AP4A 3HAMA 3VS2A 2PVKA 4I23A 3SG9A 1ND4A 3PWDA 4IDVA 2PL0A 3DK6A 2PVLA 3DNEA 2WMWA 2I7QA 5KMKA 3PE1A 4QP7A 4MYGA 4FT0A 2A4LA 3F3VA 3H3CA 1ZYLA 2QOCA 3KXHA 4ITIA 4PTCA 3TT0A 1U5QA 4AP7A 3UE4A 4YGAA 2FA2A 3VW8A 4AWIA 4O0VA 4DYMA 2HY0A 5L2SA 1H25A 3N4VA 3QU0A 3S0OA 2PU8A 4IB3A 5IQEA 1FGKA 3F3ZA 3QYWA 3TNHA 5BVEA 5IQFA 5KCVA 5IU2A 4PL4A 2EXCX 5L2IA 3S1HA 5HCXA 3WZUA 1YI4A 3OCSA 3HZTA 4YTIA 3CGOA 4IAKA 1OKVA 4YLJA 5CF8A 4CTBA 4XG7A 4K9YA 4YU2A 2DYLA 3ELJA 3CTHA 2GHLA 5EFQA 1PMEA 2QOKA 5AV3A 3P08A 4AZVA 1GAGA 1YOMA 3GCQA 1RE8A 4FKIA 4YURA 4KWPA 3ZLYA 3QUDA 4J71A 3ZHPC 2PE0A 2ZV8A 1FINA 5J1VA 4CG9A 4FNZA 3EQIA 2R5TA 4K18A 3ALNA 4FI1A 4O6LA 4Q9SA 4BCIA 2NNWB 2ZVAA 3CKWA 3OC1A 4F1MA 2VWIA 3WZJA 1A06A 4ZJVA 3LQ8A 3V5TA 3PPJA 5GJGA 4IAIA 3ZZEA 2OG8A 4CKJA 2RFDA 4RX8A 4UXLA 3DS6A 4R8QA 4JAIA 3PA4A 3LAUA 3RKBA 2HZIA 5EM5A 3R7UA 3K5VA 4EHZA 4H3PA 2CPKE 1YHSA 5AM7A 4S31A 3Q53A 4O96A 4ZK5A 4BCKA 4OGRA 4DEDA 4K11A 4NCTC 2GPHA 4E4NA 3M42A 5M55A 2ETRA 3ZRKA 3MFUA 1CSNA 3W32A 1V0BA 4G34A 3D5VA 4IDTA 3CPCA 4JQ7A 4WD5A 4AAAA 4D1SA 4E6DA 3TCPA 4F4PA 4LOQA 5FBNC 3PSBA 3H9FA 5EKOA 1PHKA 5CSWA 5IUHA 4PTEA 4IFCA 3SW4A 1P5EA 2PYWA 3H0YA 3QD4A 3IG7A 2GTMA 4MHAA 1DAWA 4IANA 3THBA 2H6DA 4FZAB 3GB2A 4H3QA 4R6VA 3LFSA 3BU5A 4KAOA 3OBGA 3CE3A 4IM3A 5B2MA 5L2TA 4YLKA 2JFMA 3DJ5A 3PSDA 3TL8A 4APPA 3EFKA 5JZNA 2WMQA 4IAZA 4AGWA 3WOWA 3IOKA 4KKEA 3GU8A 4GSBA 3DBQA 1UNHA 4TYHB 4FX3A 4U41A 5CVGA 5K0KA 4CFWA 3ZMMA 5AP1A 3DDPA 2XNBA 3TDVA 3RNYA 3QKKA 4ASEA 3Q9YA 2X1NA 4FKSA 4DT8A 4QNAA 2OF4A 4QQCA 3U87A 2JKKA 4TKSA 3C4FA 4BI2A 4D2PA 2VTQA 3FV8A 1OBDA 4PY1A 3C0HA 3FLYA 3QTQA 4JX3A 2OZOA 2YDKA 4YJTA 3R8ZA 4EH7A 4EQMA 4M7IA 4O0WA 4HYHA 4AG8A 2VO3A 2GCDA 5I3OA 3U6IA 1PKGA 3S3IA 3Q32A 3TIYA 2X4FA 4QO9A 5CQWA 5IZFA 2JITA 4FTRA 3R9DA 3W2QA 3VC4A 2R3RA 3VF8A 1FOTA 2ZV9A 3FXXA 4KSPA 4XX9A 3W33A 2WXVA 5E7RA 3MFRA 1YHVA 3LLTA 5TO8A 1H07A 2WIPA 5F1ZA 5M07A 2OJ9A 5CYIA 1OI9A 3H10A 2OKRA 3OY3A 5DHJA 3ZBXA 3JY0A 4F7JA 4DG2E 5AEPA 3ZLWA 2H9VA 4CFNA 5LVPA 5LVNA 5DT0A 4C2WA 2FYSA 2EB2A 2OZAB 3C9WA 4U40A 3HRCA 3BELA 1IRKA 4FKWA 1PW2A 4BI1A 1A9UA 3DKCA 5J5TA 2YM5A 1OIQA 4FV3A 2LAVA 3IW4A 4F6UA 4BYIA 3HYHA 5AR4A 5CLPA 4GH2A 4G6NA 4FC0A 3QTWA 4J53A 5DVRA 3W2PA 2W9ZB 3R9HA 3ZS5A 4OBQA 5AAFA 5DR2A 4JBOA 5FLFA 4C37A 1M2QA 5LVMA 2OIQA 1PXJA 4EZ3A 3NYNA 4BR3A 2VX3A 3GOPA 3K2LA 1JLUE 3QUPA 3LKMA 1OIRA 2C3JA 4G1WA 4YTCA 5CAUA 3DKOA 1YKRA 4FV7A 5HEZA 4U43A 2OIDA 2UV2A 2OF2A 3BBTB 1FBNA 4FTMA 1IA9A 2IPXA 3AG9A 3V3VA 4FG8A 2I0HA 4FKTA 5HVYA 3FZ1A 5HBJA 3T3UA 3AC5A 4HYSA 4UBAA 2O8YA 1Y6AA 2OXXA 4KS7A 1FPUA 4O0YA 4X2JA 4GG5A 4C3PA 3N9XA 5IEXA 2J0JA 4AN2A 3P7AA 1U54A 3VUTA 4FEXA 4D4RA 4CMUA 4JDHA 1F3MC 4EK6A 2YZLA 3FZSA 2AUHA 3VS4A 4AZSA 2BZIB 3UBDA 4IWPA 4CFUA 3R7VA 3EKKA 3MB7A 1OIUA 3GXLA 4KSQA 3SKCA 5FDPA 1XH6A 3ZM4A 4TW9A 5K4JA 4IACA 2R3FA 1O6KA 3COIA 2F49A 4PUZA 5HCYA 3SXSA 4F9WA 3JS2A 4AA4A 4PL3A 3OY1A 2VZ6A 5IUIA 1GIHA 2VWYA 3KULB 3PXZA 3CJGA 5TF9A 4AE6A 4CLJA 1DAYA 3L9MA 4XV2A 4DTAA 4NTSA 4TNBA 4FTIA 2IZSA 4HGSA 2XM8A 4D0XA 3GCVA 2XJ1A 4PMTA 4QQ5A 2VTNA 4F7LA 5IQCA 5CVFA 5FEDA 3NCZA 4GU9A 3HP2A 4IM2A 3R2YA 4DEBA 3DKGA 3OTUA 1Q62A 4KIOA 1H1QA 3G0FA 1OECA 4I6HA 5CVHA 3TWJA 4EZ5A 3BYMA 2VTAA 4RSSA 2XBAA 4YZCA 2C6DA 4RIWA 3QTXA 1JSUA 4I4EA 5HICA 3ZSHA 4D9UA 4O82A 3D5UA 4X7QA 1M2RA 4I6QA 3QCQA 4Z3VA 5KMLA 4WBOA 3JY9A 2J5EA 4BCHA 4F6SA 4KIKA 3I6UA 1JWHA 4L43A 4DLJA 1GIJA 2V62A 3PUPA 5BUJA 3BHHA 5B2KA 4RC2A 4CT1A 4G3DA 1PXLA 5I3RA 4FTOA 4MD9E 2R4BA 2B9IA 4N6YA 3LFQA 3PXKA 1OMWA 3OS3A 4YTHA 1MQ4A 3BU6A 4GFMA 4FVQA 5GNKA 4D4YA 2PUUA 1W98A 1J91A 5IEVA 2RSVA 1XHAA 2I0EA 3DB6A 4FNXA 3ZRMA 4HVDA 1XBCA 3R22A 2ZDTA 2C1BA 4EH4A 3ZO4A 4OR5A 3KEXA 3O7LD 4D2VA 4RFYA 2BDFA 5JRQA 3QQLA 4FOBA 4DEIA 5HLWA 2X7GA 2XK6A 3L8XA 3MVLA 4DG0E 1VYWA 1W7HA 2H34A 4FTJA 2XNNA 3ANQA 3AT2A 4RIXB 5FBOA 4N6ZA 4R5SA 3DLSA 3L1SA 2GS6A 1OL7A 4ALVA 3RAIA 3PJ1A 3ORLA 1T46A 4DBNA 3VQUA 1IA8A 4TTHB 4KNBA 2PWLA 3R1QA 5ETIA 4BIDA 3L8VA 4DFZE 2WFYA 1OM1A 2BIYA 3BI6A 3P5KA 3R2BA 4GS6A 2PZ5A 5ANDA 5J8IA 4C3FA 2I0VA 2OO8X 5EHYA 4JR7A 2HXQA 3E62A 3DA6A 3SLSA 4ID7A 3HMPA 5LMAA 4D5KA 5CU0A 3QHWA 1XH7A 5J9ZA 3L8SA 1ZOHA 3Q04A 5EW8A 4BZNA 4TWPA 4X3FB 4ENYA 2JDVA 3WYYA 3NVMB 2PE1A 4RIYA 1PMNA 3Q9ZA 1PXOA 4EOOA 3ODYX 3SXRA 4HGLA 3DXQA 3PXYA 2PZRA 2F7EE 5C8KA 4JX7A 3OWJA 2HIWA 3TJCA 5CI6A 1PMUA 4I5HA 3GEQA 2J0IA 2B0QA 4ZEGA 3A7IA 1FVRA 1PXKA 3P79A 3IO7A 4LL5A 4IC7A 2Q0NA 3O8PA 4JQEA 4EK3A 2BILB 2WMUA 4XG3A 4AZEA 4TRLA 3CD3A 1J7UA 5I9XA 5E91A 3HDMA 3JPVA 2XK8A 4E6QA 3DXPA 1SNUA 3AXWA 4ANBA 3TKUA 5C4KA 4FICA 3TZMA 4MNEB 4RJ4A 2WZJA 5BPYA 3MVJA 3S00A 5IQIA 4WNOA 3E87A 1NVSA 4RX5A 4JIKA 2XIYA 1WBTA 5AUVA 3KRRA 4YNEA 2W99B 5CZHA 5FP6A 5IA4A 3PRFA 3GC8A 3QRIA 4C7TA 4NT4A 5TT7A 2IW6A 3R63A 5ANIA 4BDHA 4D55A 3V8SA 2R64A 2DUVA 4O0SA 4EQUA 4L3LA 3V6RA 1JBPE 3E64A 3LOKA 4RFZA 2VWXA 4CNHA 4I24A 1FGIA 4BCPA 4F9AA 4CCUA 1PYXA 4FSYA 3IECA 3LCTA 2VD5A 2P2HA 2UZLA 2JBOA 3FYJX 5CS6A 4B9DA 4IM0A 2WEIA 2YWPA 4FMQA 1F5QA 5FM2A 4WT6A 5HBEA 5C9CA 3MPTA 4PQNA 5CU4A 5ANOA 3T9TA 1JKSA 3G6HA 3VUHA 3PXQA 5ACBC 1M14A 2YIYA 1ATPE 3HEGA 4CQEA 3VVHA 2F9GA 3D5XA 4FL2A 3MTLA 4BKZA 2XS0A 4BZDA 4EL9A 1BUHA 2XKFA 2EXMA 5JFSA 4U42A 1PXPA 2O64A 3AC1A 4E5WA 1OKZA 1GIIA 5KE0A 3MTFA 4O7TA 5L6WL 3TZ7A 4K0YA 4NM5A 4U5JA 3MH1A 3OW4A 4ACDA 2PMOX 5FTGA 3FL5A 3RBWA 1CDKA 4U8ZA 2X6EA 4MD8E 4Y72A 3VS7A 4QTDA 5EYCA 3BQCA 3C4CA 3ENMA 4QPSA 3I5ZA 4N4SA 1LUFA 4D1XA 3UO6A 5F20A 3NAXA 3TZ9A 5HORA 3QQHA 4F1OA 5IA3A 4JL9A 4FKGA 4QP4A 4XS2A 2RFSA 3MI9A 2EXEA 3G0EA 4E6AA 3KVXA 1GZKA 3NCGA 3MWUA 3FQSA 3U6HA 4YZMA 3SX9A 4LRJA 2WOTA 4MXZA 3VJOA 4C57A 3JUHA 4M0ZA 1G8SA 3FPMA 5JQ5A 3OWKA 1R39A 2XNPA 2RIOA 5KO1A 4FL3A 5FXSA 4DEHA 4U3YA 3LCSA 4DH1A 2VTIA 4HCVA 4E93A 2C69A 4CKIA 3T9IA 1GZNA 2B52A 5CANA 2OIBA 4G6LA 4BDCA 5LJJA 4YHFA 4BTJA 5HG8A 3Q9WA 3FZRA 2IJMA 3SRVA 5CAPA 3IPHA 3C4XA 3NNUA 3EN9A 3RINA 2Y8OA 2BZJA 3G9NA 4GJ2A 4AA5A 3UVPA 4IAYA 2HOGA 4Q2AA 1UA2A 3FLQA 4GCJA 3V8TA 3P86A 4WOVA 2R3KA 3NWWA 3LFAA 4DEEA 4NL0A 3GCSA 3QZIA 2R3QA 2PHKA 3NNWA 4MF1A 4EH2A 5E9EA 4CMTA 1KUTA 3ERKA 3BV3A 3V04A 4BTFA 4B7TA 3E5AA 3QZFA 3I0OA 3P9JA 4IIRA 3DU8A 4JBVA 4Y5QA 3ROYA 4P5QA 3I0QA 5ITAA 3NRMA 4JOAA 1G5SA 1H1PA 1Q99A 1QPDA 2GMXA 4UZHA 4XRJA 3P4KA 5AFVA 2B55A 4FSNA 5KUPA 4TWOA 5IQDA 1FVTA 2B9HA 5GINE 4EHGA 3FXWA 3RJCA 4YC6A 3DTCA 3LJ0A 3W2SA 2BFYA 3CSVA 4O7WA 2ETMA 4DEGA 3G51A 3HLLA 2OICA 4GKHA 3VHKA 1YWNA 4EJNA 4HVIA 3F2NA 3E8CA 3ZYAA 3FMKA 4TT7A 4XLVA 4QT1A 2REIA 3OD6X 3CCNA 3LM5A 4F09A 2W1DA 3OHTA 3F5UA 4S32A 4DH7A 4IMYA 4DFLA 3II5A 3BX5A 4AU8A 2VWBA 3JVRA 4C3RA 4A9RA 3MFSA 4BGHA 4YLLA 2RKUA 3UOLA 3R9OA 3EKNA 4O0XA 4YNOA 4DGNA 3VJNA 2YAAA 4LV8A 4PPAA 3F61A 2C0OA 5EYKA 3F5XA 4C35A 4E1ZA 4FV6A 4IAAA 5CEIA 4CMOA 5HBHA 3NNVA 5CU6A 3RM6A 3OT8A 4EHVA 3SG8A 3IDPA 3OW3A 3PVGA 4AZWA 1PXIA 3JYAA 4L7SA 2X81A 4IHPA 4JXFA 4UEUA 5J87A 4AZTA 4MQ1A 4FTCA 5KBQA 2UVXA 3W55A 2YISA 4L52A 4P2KA 3BYSA 3WF5A 3Q52A 3QTIA 4L53A 3R83A 1EH4A 4FZDB 4MTAA 4I41A 3V5WA 5M51A 2B7AA 4FKQA 4EYMA 3BGPA 2VO7A 4GYGA 4V05A 2ITTA 1ZYCA 3R01A 5DOSA 3QRKA 5CEKA 4BF2A 2GQGA 2ZM1A 5AP6A 3UJGA 2JIVA 4BDBA 2BAQA 4PP7A 4J8MA 3QUEA 3NVKI 4FVRA 1NY3A 2BRNA 3PA5A 4U44A 5M4CA 5FWKK 1OL1A 2YACA 2ITQA 2ZB0A 3CPBA 3GU5A 2UZWE 3MPAA 3RHKA 3WZKA 4YSMA 1WBSA 3TACA 1P14A 4KS8A 4ZIMA 1Z9XA 1Q8ZA 3IDCA 2Z7QA 4JAJA 4AX8A 5G1XA 3PWYA 2QQ7A 5KMMA 5B2LA 5F9EA 3CY2A 1OITA 3ZO3A 4CGAA 5TKDA 4O22A 4WSYA 1KV1A 3EL7A 3FMLA 4GIIA 4CFXA 1QPCA 1ZOGA 3AT4A 1STCE 3WI6A 4QYHA 2CNUA 4QMQA 1NW1A 1XR1A 4JS8A 4MAOA 4ZMEA 3GU6A 3LMHA 2XMYA 4GIHA 3D83A 3O17A 3CQEA 3FC2A 4F9BA 4GYIA 4XV3A 4AE9A 5AUTA 3FZTA 2IW8A 3ULZA 4DGMA 4EUTA 2P2IA 2YCFA 3IW7A 5FXRA 4RQKA 3TEIA 2FB8A 3QF9A 3TI1A 3DAKA 3T3VA 2YM7A 4AT4A 3HV5A 4OLIA 4KRDA 5HNBA 2XRWA 2BUJA 2BRBA 2P0CA 3EQBA 3KQ7A 3OT3A 4R5YA 2I40A 4C0TA 5JT2A 2CNQA 2NO3A 4PDSA 5E8UA 4ACMA 1XH9A 4XBUA 3V5QA 5KKRB 3EN6A 4OAUC 1UU7A 4O0TA 4XG6A 4BZOA 4GV1A 3F7ZA 4D2WA 2VTPA 1G3NA 1TVOA 4WKQA 2GS7A 4Q5EA 5ANJA 4YJPA 3QC4A 5L2QA 4ALWA 3ZOSA 1M52A 4PMMA 3MH0A 2IZTA 4XEYA 1GZ8A 5DRBA 2UW9A 2R3HA 3LIJA 3RPYA 5E8ZA 3HAVA 2CN5A 1KWPA 5EQYA 4TYHA 2X2KA 3ZUTA 4LOOA 1J1CA 3GP0A 5F94A 1JKLA 2PUPA 4KBKA 3ORPA 4V01A 1YDTE 1H28A 1UWJA 4KBAA 4Y83A 1I09A 4TPTA 4FKRA 4KRCA 3MV5A 2R3LA 3PIYA 3MVHA 3NUUA 4FTAA 4RX7A 2Y4IC 1UKIA 3OZ6A 5C4LA 4EH8A 2J0KA 3V5JA 4U0IA 3NSZA 4UWYA 4A9TA 2A0CX 4DH5A 4FEUA 3LM0A 1SVGA 4J8NA 4YJQA 2VAGA 5A4CA 2QR8A 4FZ7A 2OJIA 4NIFA 4YP8A 2IW9A 1UNLA 4PL5A 1JOWB 2VV9A 3MA3A 3EB0A 3QTSA 4IWQA 4Z9LA 2VTLA 4XYFA 4FIJA 4Y46A 5J9YA 2C6IA 4I94A 4M69B 3FLZA 4PNKA 4H3BA 3E3BX 3BYOA 2J7TA 4J52A 4U81A 2C6EA 3VUKA 3NS9A 4TNDA 1YXTA 1XBAA 5M44A 3NX8A 3EFJA 3SD0A 3E3PA 4E5BA 1O6LA 3GENA 3OROA 2KTYA 3RPOA 4IX5A 4IWOA 3UTOA 2YM4A 3ATSA 4DF3A 2F7XE 3QD3A 4G3GA 4NSTA 3IOPA 3RWQA 2WGJA 4GT4A 4WO5A 4FG7A 4H39A 3DOGA 4AGUA 4Y73A 4OTFA 1Y8YA 1H08A 4Z7HA 3ENHA 3UYTA 2R3OA 3AD4A 4FT7A 4O6EA 2Y7JA 2UVYA 1OB3A 3QWJA 4YBJA 4RQVA 3LQ5A 5IQBA 4E5AX 3QKLA 2W1HA 4M97A 4UB7A 4UMQA 4O0UA 2WQMA 2VTRA 3PIXA 4U80A 3WF9A 4U97A 3COHA 4PX6A 4Y85A 3E92A 4QMMA 3JR1A 3S95A 3G5DA 4ZTSA 4ZZMA 5HNIX 3R7GA 3D9VA 4L7FA 3WILA 2E9OA 1FVVA 3RWPA 2A2AA 4Y95A 5AIRA 5LWMA 4U9AA 4IW0A 2ESMA 1PXNA 3VBWA 2C6MA 4CV9A 5C26A 5JH6A 3TUCA 1PMVA 4G3EA 2Z60A 2GU8A 4M84A 3D7TB 4WSQA 5IH4A 1VZOA 5FUTA 4FSZA 4OUCA 5M09A 4ANSA 3KU2A 2Q83A 2IVUA 2XA4A 4I0RA 4AOIA 2O2UA 4QP2A 5HCZA 3ZSGA 2BAJA 2UZTA 5DI1A 2G2FA 4ZZOA 4ZTHA 5DR9A 2GNLA 3UMWA 4ACHA 3UNKA 2UZUE 3ZXZA 3QX2A 2JAVA 3NUYA 3EQCA 4XCUA 5K0XA 4ZLZA 3QZGA 4JR3A 3AGMA 1M7QA 3MH2A 4LV5A 3F7WA 5KNJA 3GUBA 4HOKA 2A27A 3LVPA 4JIAA 1ZYSA 1YWVA 3QXOA 4UMPA 5GZAA 5C03A 1XKKA 2VTSA 5AA9A 3GU7A 4FNYA 2YFXA 3CQUA 3MS9A 4GFOA 2VUWA 1XO2B 1SZMA 2HAKA 3H0ZA 1YHWA 1J1BA 4CZYB 3GCPA 2WTCA 4IFGA 4EI4A 2IZUA 3R02A 3QRJA 5KMNA 3R8UA 5EKNA 1Q41A 3LHJA 4NTTA 3R8VA 2C0IA 2XIKA 3EQRA 4RJ7A 5CU2A 4EKLA 4LRKA 2V5QA 4O7ZA 3FI2A 1MRUA 4O1OA 4GFGA 4A4LA 4A9YA 3AC8A 4O7VA 3KK8A 4V0GA 5DWRA 4XHKB 3KFAA 5AP2A 5IA5A 4EOKA 4W9WA 3ZEPA 1R1WA 4D2RA 4MCVA 3FY2A 3GQLA 3DT1A 2XKEA 5DR6A 3FSKA 4K8AA 5GIPE 2WELA 1RJBA 5D9HA 5JN2A 4QQJA 3CTQA 5E90A 3NZ0A 2C68A 4D9TA 2UW0A 3CC6A 4QTCA 1H26A 2HXLA 3E93A 4FT5A 2OBJA 2QNJA 4GW8A 4BCFA 1ZARA 4F99A 1ZWSA 4FTTA 2HWOA 2OW3A 4I3ZA 4YJVA 4AS0A 4NCTA 3MW1A 2VO6A 5LVLA 2G9XA 5E1EA 3KMUA 5IH5A 3FMHA 2X2LA 2PE2A 3LFEA 2GQRA 5CXZA 3PE2A 4KBCA 3W2RA 3A61A 3HECA 1JSVA 2QOOA 2XYUA 3PZHA 4P7EA 4AOJA 3EFWA 1DS5A 3AC2A 3HA8A 4ZJIA 5I9VA 4QMOA 2OFVA 4MVFA 4EOMA 1OIYA 4FL1A 1Q5KA 2QHMA 3O8TA 2JDOA 4OTIA 4JBPA 3QX4A 3ODZX 4W4XA 5EM6A 3PG3A 3UP7A 4QD6A 2WTKB 3UO4A 3ZFYA 5D11A 4EJ7A 2V7AA 5EI2A 2ZV2A 3FMJA 3PXRA 4RX9A 5DPVA 3UO5A 4ZJJA 4BWPA 2Y9QA 5A6NA 5DE2A 1KE8A 3ZH8A 3FHIA 2WIHA 4TZRA 1VEBA 5F95A 5IQAA 3KXGA 3ZFXA 5HVKA 2BZHB 2W1GA 2WQBA 3WF7A 4CG8A 1AD5A 3CEKA 3KF7A 5JGDA 2GTNA 2ITZA 4L42A 1UWHA 5BVWA 4A9SA 4BDDA 5AR8A 4QP6A 2F2CB 3GI3A 4ZY6A 4NM3A 2IN6A 4R7HA 4JG7A 4MNFA 4YZBA 2JFLA 3I1AA 2JLDA 4YZ9A 2UW5A 4DFBA 4HVSA 1WZYA 3F66A 1OL2A 2WTVA 2HZNA 3DZQA 1Q4LA 5BX0A 3P78A 2CSNA 4ASZA 4EC9A 2E9UA 2E9PA 3NUXA 2RL5A 5IISA 3VUIA 2A19B 5KMOA 2QC6A 1O6YA 5J7HA 4ANLA 4CXAA 4MNEA 3RPVA 5HTCA 4MQ2A 4ALUA 2FSOX 2GFSA 4RWKA 4E4LA 3KB7A 3DK3A 2VTTA 4F9YA 5M06A 1Y91A 4YUQA 4TYGA 1R0PA 3AGLA 2G1TA 2XCKA 4FIFA 4CV8A 4FA2A 4GJ3A 1UU9A 1OPLA 4WUNA 2Y6MA 2ITVA 3FQHA 2QODA 3KN6A 2J90A 5HE1A 2ZAZA 4MXXA 3UOJA 2HENA 4RJ6A 2R3NA 4DH8A 3OF0A 2XK4A 1I44A 4NH1A 1L3RE 4RZWA 4DN5A 4FV0A 3RALA 4USFA 5DT4A 1KE9A 3IQ7A 3NMUF 2WMVA 5CQUA 3BRBA 3QKMA 4YPSA 2UZOA 2Z7SA 4UMUA 3Q60A 3QGWA 2AC3A 2WMSA 3FZOA 4WG4A 2C6KA 3Q4CA 4O2PA 4HCUA 4BDFA 4F7SA 3S4QA 5T3QA 4RWIA 4EKKA 3BHVA 4FF8A 4FR4A 4ITJA 1YWRA 1MUOA 3BHYA 4M67A 4AGCA 3O2MA 1X8BA 2NPQA 3TZ8A 2QOQA 3ZZWA 1B6CB 2W1ZA 3A7GA 4FIGA 1LP4A 5HX8A 4O7NA 1DM2A 3A7JA 3VNTA 3ACKA 3TKHA 4B4LA 2OJFE 5BNJA 4I93A 3I6WA 4IJ9A 5CF5A 2XZSA 3R6XA 2JKOA 5LMKC 2ZYBA 2J50A 3LPBA 1AQ1A 4G16A 1M17A 3CLYA 1BKXA 4OTRA 5ETCA 1WVWA 1ZMVA 4CQGA 4J97A 3O0GA 2KULA 2BTRA 2JKMA 4X21A 1H4LA 4D58A 5BUIA 4BVUA 3I60A 3EOCA 4QYGA 4CVAA 4UWBA 2WTDA 3PVWA 2PMNX 2PUNA 4CYIA 3R7EA 3RAHA 5M08A 3QGYA 4FTLA 4W8DA 1E9HA 2XKDA 1ERKA 4U3ZA 4LFIA 5E8WA 4BC6A 1GOLA 4A9UA 2C5YA 2P33A 4BHZA 3EHAA 4IZYA 4HCTA 4EHEA 2XNMA 3VBQA 4JQ8A 5AUZA 2X8DA 1V0PA 1ZZ2A 5D10A 1Q8YA 2ITUA 3UIUA 4RVTA 3ZUVA 4DFNA 2WMTA 1J3HA 4JG6A 3P23A 3SOAA 4E8AA 2R9SA 3AC4A 4DTBA 2QOHA 3SXFA 4O7SA 4YZNA 2FSLX 2YM6A 3EZVA 4ERKA 1ZZLA 4BBMA 1XJDA 2UUEA 3DNDA 2WHBA 4O83A 3O7LB 1ZYJA 4EH9A 5L8JA 5TR6A 3ITZA 5IA1A 3TNPC 3UOHA 3KMWA 3EQPA 4AXAA 1U46A 2WPAA 4UWCA 3M11A 3VN9A 1NA7A 5LMKA 2BIKB 5T68A 2CMWA 2X9FA 4HJOA 3R8PA 4AW0A 5J95A 5K5NA 4B6LA 2CNVA 4S34A 4GT5A 4QMVA 4HVHA 4RFMA 3GC9A 1WCCA 5AV4A 5CAQA 1B38A 2CLQA 3QXPA 4WNPA 5FGKA 5FM3A 1RDQE 2WO6A 4G3FA 4ZSGA 5BUEA 3IKAA 3VS5A 1XQZA 3GBZA 5I5ZA 5LCJA 3FI8A 4O7RA 3CBLA 3OCGA 1XBBA 3BYVA 4XG2A 5IA2A 2H8HA 4I6FA 3HMIA 2ZM3A 4ASXA 5CNOA 3FKOA 3DJ7A 3UDBA 3PY3A 5J9LA 4ANQA 3TIZA 3DQWA 3HA6A 3PYYA 1H00A 2W1FA 3VRYA 2IVTA 4QP8A 3V5PA 4EOSA 5EW9A 2EVAA 4G9RA 3HMOA 5AIKA 2ERKA 5H8BA 4Z7GA 4L6QA 4X2KA 3FLSA 5C27A 4MF0A 2QU6A 4P5ZA 4QMTA 4AW5A 4YO6A 3EFLA 3FLNC 5DG5A 4CKRA 1Z57A 1TQPA 1CKPA 3A7FA 3F3WA 4FYOA 4AT5A 5GIOE 3KRJA 4OBPA 5LXMA 3GU4A 2YEXA 2UW3A 3KXMA 4BHNA 3AMBA 2QVSE 3TNWA 4QYFA 3M2WA 5EM7A 3UIXA 4CTCA 4C4EA 3FMDA 5A4LA 5L6OA 4C59A 4HPUE 3R1SA 3R9NA 4BY9E 1W82A 3C50A 4II5A 2X6DA 4H36A 1E1VA 5BQ0A 4M14A 1VYZA 4NKAA 3FC1X 3ORIA 1UV5A 5CEQA 4TWCA 4ZMFA 3ZM9A 4RVKA 1P4OA 2PVNA 2R2PA 5HKMA 3PJCA 3ZRLA 5HG5A 4HYUA 2VU3A 3FAAA 4ACCA 2Q0BA 3ALOA 1MRYA 3ATTA 4LUEA 4FSWA 5E8TA 4YHTA 4PV0A 3FMNA 4WG5A 3QA0A 3HVCA 4EK4A 5IA0A 2BRMA 3NYXA 4GL9A 3PZEA 1U54B 2WMAA 1HCLA 4ITHA 4F7NA 3R04A 1K3AA 3LFBA 1B39A 4AFJA 4GG7A 4AGDA 3U6JA 1YXUA 2P55A 3FHRA 3PP1A 1NXKA 5HNGA 3UZPA 4E6CA 4XG4A 4PDOA 3RTPA 3TXOA 4IB1A 3V01A 4FIIA 2RFNA 5AP5A 5EW3A 4DT9A 1PKDA 1W84A 5HU3A 3H9RA 4LRMA 4UX9A 2VWWA 4LMNA 2BROA 3WIKA 1REJA 5FDXA 3W2CA 3LXLA 3MYGA 1FMOE 3PJ3A 4IX3A 3ZBFA 1PRYA 4ZTRA 3TNIA 3OWPA 4C36A 4AFEA 2IO6A 2J2IB 5B7VA 2B54A 4F70A 4NU1A 4H05A 5AV2A 3UQCA 2WU7A 4ZP5A 4AW1A 3CR0A 3R28A 4O1PA 1PF8A 2IZRA 1KSWA 4B8LA 4RC4A 3F5PA 2OXDA 2CHLA 4YJOA 3W18A 1W0XC 3PRIA 5KBRA 1AGWA 3ORTA 2HYYA 2X2MA 3P0MA 5IF1A 4RIWB 2VX0A 2OXYA 5A14A 3NAYA 4GMYA 3LZBA 1WFCA 3H9OA 5JFWA 3DY7A 5EI8A 3G33A 1WBVA 4C34A 4AT3A 1JVPP 1LEZA 4FV8A 1QPJA 4KIKB 2EUFB 1PJKA 5IMXA 3AMYA 3Q2JA 3GT8A 2I6LA 5H3QA 3PTGA 3T8OA 2B9FA 2ZJWA 4F65A 4M12A 3C5IA 2ZM4A 3GCUA 3COKA 4E26A 4OAVB 1Q24A 4OW8A 2W5BA 2XK9A 2F2UA 3BKBA 3DB8A 3ORZA 5AA8A 2E2BA 3MY0A 3QLGA 3O50A 3R30A 3FQEA 4BCJA 4FV1A 2WU6A 3RCDA 4ENXA 3NW7A 3QC9A 1BI8A 3C4ZA 3VS6A 3ZCLA 4O81A 3ULIA 1IEPA 3ZO1A 4AACA 4HYIA 2PMLX 1K2PA 4NJ3A 2XB7A 3KA0A 2HWPA 4GK4A 4H58A 3R7IA 3NIEA 1Y6BA 5CEMA 4EOLA 1K9AA 4FSUA 4BDGA 1WBOA 3UPZA
chains in the Genus database with same CATH superfamily
4BCOA 2EU9A 3HV7A 4EOQA 2JIIA 4OTDA 2C30A 2W5AA 3VIDA 1SVHA 5KHWA 2PPQA 2C3LA 3B2WA 4FT3A 3E8NA 4X2NA 1XH4A 5J5SA 4RJ3A 2W4OA 3DJ6A 4NW6A 4ANNA 5LQFA 5BVNA 1BLXA 3TDWA 4XLIA 3BLRA 4YSJA 3U8WA 3W2OA 4BCQA 3A4OX 3DBFA 2B1PA 2C5XA 4O4FA 4QP9A 3U9NA 4ASDA 4F1TA 1H1SA 3FWQA 4M69A 4W4VA 4BICA 4R7IA 2XM9A 3PFQA 2ZV7A 3I7CA 4FSRA 5E8XA 4E20A 4BCNA 1OKWA 2V55A 2GNFA 4ZZNA 2JKQA 4NW5A 5D12A 4XH6A 4MXAA 5H8EA 3E7OA 3MBLA 4YTFA 2C3KA 2RGPA 4C8BA 4XP2A 5AUXA 5H9BA 3COMA 5EQEA 1SYKA 4QP3A 1YOLA 2PZIA 2ITYA 4XUFA 5AX9A 4GUEA 2YIQA 4K33A 1BL7A 4MK0A 1G8JA 3OMVA 4RWJA 3TV7A 4FODA 2VTHA 3PIZA 5IUGA 3CD8A 5BYZA 3QRTA 3S2PA 1DI8A 3HUBA 3MPMA 3V6SA 2CKEA 2XNEA 3PUFC 3NUPA 3LXNA 3JXWA 3KKVA 3R73A 4HPTE 4Z55A 3W0OA 4M66A 1REKA 3BQRA 4CYJA 3FEGA 5JK3A 3R21A 5HG9A 4D0WA 4JRNA 4QOXA 3I5NA 3QCXA 4XP3A 2VO0A 1KOBA 3NYOA 3W8QA 2RF9A 2OWBA 2UZDA 5CZIA 4QPMA 3N4TA 2Z8CA 5FEQA 2FSTX 4MWIA 3VAPA 4DGGA 5IKWA 4RBLA 4ZSJA 4D2TA 4JI9A 2CDZA 1LEWA 3Q2MA 4QPAA 3PA3A 1S9IA 3QD2B 2JC6A 4QNYA 4IB5A 4X2FA 5E8VA 2QCSA 4IX6A 4BIBA 4JDJA 4DFYA 3D7TA 4O2ZA 3UOKA 4XOYA 4YC8A 3Q6UA 1TQIA 3A8WA 3NW6A 5M4FA 3PJ2A 3OCBA 5L4QA 4IE9A 5CENA 3AKKA 2IF8A 3D2IA 5GZ9A 5C01A 4BYJA 5CSXA 5EI6A 2WKMA 1J7LA 2I0YA 4NFMA 2AC5A 2PVMA 3GFEA 2BHHA 4YJNA 3KGAA 5DNRA 2WQOA 3LMGA 1WBWA 2YLEA 4I4FA 4PF4A 4BRXA 5JFVA 3FYKX 5A4EA 4AUAA 1OKYA 5M53A 2HZ0A 3REPA 4FIEA 3GQIA 3TUDA 4OTQA 1QPEA 4NJDA 5CTPA 3QQKA 4BN1A 4G5PA 4L67A 2BRHA 1KE6A 2XJ2A 4YC3A 5TE0A 3VS1A 5CWZA 4FKVA 4ZTLA 4FZFB 2O3PA 3W1FA 4JDIA 4A4XA 3EQGA 5DYJA 4F9CA 4GVJA 4C02A 4PNIA 4ONAA 2OFUA 4UXQA 3NUSA 4DEAA 2C6LA 4RIOA 2PVYA 1CM8A 1YDSE 3F88A 3MGYA 4BDJA 5CEOA 3PLAE 4AXFA 4L45A 4DCEA 5IG1A 3IK3A 4YHJA 3WBLA 2VGOA 1DI9A 2SRCA 3MB6A 2YN8A 5CEPA 4UYAA 4A4OA 2YIWA 3JVSA 2YWVA 4GRBA 4D28A 3I7BA 3LCDA 1R78A 2CN8A 2PVRA 3A62A 4KB8A 5DLSA 3UMXA 4PMPA 3VUMA 2YCSA 5HG7A 5A4QA 1YW2A 3P7BA 3LW0A 1APME 3UPXA 3VWAA 5I9ZA 5BMMA 3ZFMA 2W1EA 2XIZA 4XOZA 5HD4A 2CCHA 1IASA 2WTKC 4NUSA 2QG7A 4XMOA 2JD5A 5GZ8A 3DKFA 3N4UA 2PSQA 4EOJA 3NIZA 4E73A 1Q8UA 4UZDA 1OBGA 3SV0A 2VGPA 3VS0A 4HGEA 1O9UA 1Q3DA 3FDNA 5CNNA 4O86A 2R3IA 4IXPA 2VNWA 4LGHA 4ZY5A 5JFXA 4PWNA 3SQQA 4TL0A 4CSVA 4F0IA 4G2FA 3ZSIA 2WTIA 4APCA 4C61A 3KRXA 3LJ1A 1P2AA 3L9NA 3M1SA 1OL6A 4DINA 4EWHA 1ZY4A 1CMKE 2OU7A 4L68A 4RLKA 1IAJA 5KX8A 3IS5A 5ETAA 4BB4A 1JNKA 3RZFA 5CF4A 3RK9A 4BBEA 4D1ZA 1BYGA 4RG0A 4XNEA 5EH0A 4BWKA 2X8EA 2CKOA 4FKPA 4O7YA 3RPRA 3UQGA 4MXCA 5FRIA 2VN9A 4JBQA 3BE9A 4QRCA 3D94A 5IH6A 3CY3A 3FSFA 4QTEA 4QDVA 5HQ0A 2UZEA 2VNYA 4QMYA 4ZSLA 5FXQA 1OZ1A 1WVYA 4MBIA 2QO7A 3QD0A 2BDWA 4DHIB 3HV6A 4BKJA 1BL6A 2GNIA 4E7WA 2GFCA 4J96A 3RVGA 2IEWA 2OZAA 2QKRA 5CAOA 3LJ2A 3WF8A 5GHVA 4IQ6A 3A4PA 5AUWA 4FSMA 5DT3A 2XJ0A 2W5HA 5AUYA 2JBPA 3VUDA 5KHXA 3Q5ZA 3QLFA 4PMSA 4IADA 3B8QA 4XBRA 1F0QA 1P4FA 2Z2WA 2ZDUA 1UKHA 1KE7A 3FY0A 3F2RA 2XIRA 4KIPA 4OT5A 3U4WA 5FTQA 3RPSA 3O96A 4ZS0A 3MJ2A 5C1QB 1WVXA 3RCJA 4ZY4A 5M4IA 3CP9A 4DHFA 2ITWA 2F4JA 2OI4X 4UY9A 4EEVA 4EUUA 3EWHA 3FI3A 4ZLOA 4FEWA 1YDRE 4UALA 4CFFA 2OLCA 3KCKA 5CSHA 2ETKA 5BYLA 5AR7A 4ZSAA 2QHNA 1GZOA 1RW8A 3E8DA 3G6GA 2ERZE 2IG7A 4XG9A 5JEBA 3BIZA 3QCYA 5AP7A 4FKOA 4C4JA 5I4NA 2YERA 1JKTA 5C8NA 2UZBA 4MXOA 3SA0A 5EQPA 3NDMA 4TYIA 5K9IA 2X8IA 2UW4A 2X7OA 2NP8A 3BLQA 3CQWA 4FIHA 4BBFA 2QI8A 3SW7A 2WMBA 4NEUA 4ZTQA 3BLHA 4MXYA 5EDPA 2QLQA 4JLCA 1J7IA 3GOKA 2C5OA 2HZ4A 1ZYDA 2G15A 2FUMA 4ERWA 2CCIA 5A9UA 3G15A 4AOTA 4R7BA 4BDAA 2XEZA 1QMZA 4PPCA 5CXHA 2GNGA 2XAOA 4H1MA 5CT7A 3TV6A 2AEGA 1OUKA 5AR3A 5EYMA 4FEVA 2X0OA 4QMXA 4J99A 4YJSA 2R7BA 3KULA 2YLFA 3AQVA 3D14A 1Q8WA 2YJRA 3E63A 2YHVA 3OVVA 1OVEA 2UZVA 4IVAA 4J7BA 3OEFX 4IJPA 2YDJA 4AN3A 4GU6A 4RJ8A 3ZONA 5E4HA 1NVRA 5AADA 3KK9A 1YVJA 3OOMA 3VHEA 4I6LA 4X0MA 3LMIA 4GK2A 4U45A 3SGCA 4BDIA 2CKQA 2V22A 3WE4A 3OUKA 4I20A 2V7OA 2OSCA 3RGFA 1Y57A 3L8PA 5BYYA 2Z7LA 2HY81 2QURA 4IVBA 3R0TA 1OGUA 3QYZA 3MIYA 4G3CA 4LGGA 4WNMA 2PVHA 3UVQA 4BCGA 5HGIA 4UV0A 2PY3A 2PTKA 3LFDA 5EK7A 2G2IA 3CGFA 1ZAOA 3EN7A 3G9LX 3HP5A 3Q3BA 4FEQA 3UG1A 1W83A 3D5WA 5HX6A 4EK8A 4PDYA 4ARKA 3MA6A 3Q4TA 3MIAA 4X3FC 3KF4A 3BHTA 2WQNA 4WBBB 2FSMX 2VTJA 4MH7A 3EH9A 4XG8A 4LUDA 2C5NA 3BV2A 3P1AA 4S33A 3UVRA 4NM7A 5JSMA 3SVVA 4KA3A 1YI3A 3FKNA 1M7NA 4FUYA 4TXCA 4WG3A 5HIDA 3HUCA 3OCTA 4IZ5A 1FMKA 4N70A 5D7VA 5L6PA 2YITA 5AP3A 3R1YA 5ETFA 1OGYA 3BYUA 1Z5MA 3TKIA 5EHLA 1GJOA 2QOBA 2RFEA 3KRWA 4RIXA 4V04A 5L3AA 3B2TA 2W4JA 3ZC5A 5D41A 4ZOGA 4I5PA 3OOGA 5E1SA 2F57A 2BKZA 1PXMA 4BKYA 1PY5A 4EYJA 4B0GA 3MY1A 2W0JA 3FJQE 5LCKA 1WMKA 2PULA 4R3CA 2OJJA 4USDA 5EOBA 1ZOEA 5IEYA 4A07A 3KMMA 1WAKA 3ZEWA 4BDEA 4S30A 4R3RA 5L8KA 2XP2A 3WYXA 3SAYA 3HRBA 5F4NA 4NYEA 3DDQA 1HOWA 2RG5A 5M4UA 2V0DA 2B4SB 4FK6A 4BWXA 2J0MB 4X3FA 4NIFB 4XRLA 3RMFA 2OK1A 3WIGA 2ITPA 3Q5IA 2A1AB 3WARA 2BRGA 2OJGA 3UODA 3AC3A 5AM6A 5LVOA 4FKUA 2DWBA 4C62A 2ITOA 4I5CA 4AQKA 4KINA 4DC2A 5KMIA 3DGKA 3HRFA 4K6ZA 3TJDA 3TN8A 4L3JA 4EQCA 2HW7A 2LGCA 4E4XA 4EWQA 5HU9A 3F69A 3HL7A 3QA8A 5ICPA 1YOJA 2C47A 2IWIA 3UNJA 3QBNA 5BVFA 4DG3E 3ORMA 4KKHA 4WRSA 2RG6A 3DZOA 2O5KA 5ANGA 3ETAA 4XJ0A 4I21A 2E9NA 4N57A 4ZAUA 5HVJA 2QO2A 4EOIA 5HOAA 2PVFA 5CSPA 3PP0A 2DS1A 4J95A 3ZLXA 3ORXA 3EN4A 3O23A 2J5FA 3HV3A 5G6VA 2PZYA 1JAMA 2IVSA 3DXNA 4FYNA 4OTWA 5EHOA 2Y4IB 4M15A 4ZTNA 3WF6A 3CKXA 3W0PA 2J9MA 5FTOA 3FE3A 4G9CA 1G8KA 3LLAA 5A6OA 4H1JA 1H1WA 4Y5HA 5AV1A 4GEOA 3TG1A 4EH6A 2X39A 4LQMA 3EIDA 5FP5A 4IZAA 3VULA 3KRLA 3QQJA 4O0RA 4G6OA 5CF6A 4DE4A 3BHUA 5KZIA 3SDJA 3AOXA 1A48A 4NM0A 4JNWA 2XF0A 2ZOQA 3OWLA 4FBXA 2BVAA 4YJRA 2VRXA 1KV2A 3KXXA 4AF3A 4WNKA 4M13A 3VQHA 4L00A 5CALA 2O63A 2VTMA 3W10A 3UC3A 3E88A 4C2VA 3QAME 1CKJA 4FKLA 4ZSEA 4IH8A 2XK7A 3DAEA 1H8FA 4LGDA 4LMUA 1SMHA 3SOCA 5BVKA 2UW8A 3RK5A 3BPRA 4OTGA 3VUGA 3W16A 2C5VA 2GDOA 4O38A 5GJFA 5JRSA 4ZXTA 4CCBA 3U54A 2R0UA 5HE2A 4I22A 3RK7A 1OL5A 4TYJA 5AV0A 3L9PA 2CGXA 2IVVA 3MN3A 3QTRA 4AQCA 4JG8A 5DBXA 4MX9A 4DGOA 3BL7A 2QU5A 2W1CA 3D2KA 3PLSA 3LFCA 2PUIA 2QOLA 4IVCA 4I1ZA 5DEWA 3V8WA 1IR3A 1URWA 4TN6A 1CKIA 4G31A 5AR2A 4G5JA 2BR1A 2ITXA 4F08A 3QQGA 5C8MA 4FUXA 5DIAA 3EYGA 2YA9A 2EWAA 3F3TA 4ZTMA 1JPAA 4C4FA 2F7ZE 2WAJA 4AA0A 2Z02A 3OTVA 2QOIA 3QTZA 3SC1A 4J98A 3FXZA 2R3JA 3ORKA 3DK7A 4AN9A 4BGQA 3AMAA 3R8LA 5HTIA 2WD1A 2UW6A 2X0GA 3FKLA 1YI6A 2YM8A 1QCFA 3FL4A 3OP5A 4V0GB 1NT2A 3WE8A 2J6MA 3FZPA 5IDPA 4DBXA 4I0TA 3FI4A 4CRSA 5FG8A 4PRJA 3IW6A 3C13A 2JDSA 2YIRA 4TWNA 5AX3A 1U5RA 3G2FA 3GC0A 5J79A 3I4BA 4NKSA 3IW8A 4KIQA 3E7VA 3I79A 4O84A 3BE2A 4QTBA 2EB3A 1JSTA 2YCQA 3IONA 3Q9XA 3C4EA 3BWFA 3RAWA 2QR7A 2WTWA 2UW7A 4FSQA 4FV2A 2BCJA 2PZPA 4IC8A 4J1RA 2JIUA 1JKKA 3UGCA 2W7XA 4WRGA 4CEGA 2VWVA 4FNWA 4R1VA 4BDKA 2ONLC 5JZJA 4XV1A 2PVJA 3C51A 3KXZA 5EOLA 4DDGA 5HHWA 4WUAA 1ZY5A 3A60A 4IEBA 3L9LA 5DA3A 1URCA 2XKCA 3HX4A 5K3YA 3TV4A 3AT3A 4QMSA 3C5UA 3D0EA 3HV4A 3KN5A 4QMNA 2ZMDA 4L44A 3EYHA 4S2ZA 3RAKA 3ZU7A 3F9NA 2X4ZA 4U6RA 1YXXA 2XBJA 3Q96A 2C1AA 4IB0A 4WA9A 2VTOA 4HNFA 4TYEA 4CZUA 4AXEA 3I81A 5EG3A 5HI2A 2X7FA 4R78A 5EDRA 1YRPA 3VBYA 5K5XA 1M2PA 1OPJA 1Y8GA 3EZRA 4BI0A 4CRLA 3UDSA 4ZLYA 5CT0A 5IDNA 1VJYA 3U9CA 3AD5A 3U55A 3BU3A 3DCVA 3K54A 1Q97A 2BKKA 5EM8A 2NRYA 5AAEA 3KY2A 5EDQA 3PY1A 3V5LA 5AAGA 5HLNA 4CFMA 4DFUA 4IWDA 4YMJA 2XCHA 3ZUUA 5ACKA 4E4MA 4JRVA 3GFWA 2ONLA 4FV5A 4F63A 5A46A 3DAJA 2C6TA 3MDYA 3OFMA 4FK3A 4JDKA 1WBNA 5GJDA 4JT3A 4HNIA 5A4TA 3KXNA 5AJQA 3RNIA 2BFXA 3VS3A 4GKIA 2CLXA 1MQBA 1OPKA 3R8MA 3A2CA 4EZ7A 4YZDA 4FGBA 3NUAA 3DTWA 3KREA 3PDTA 3N51A 4CFVA 3QWKA 2AYPA 3QCSA 3NEWA 4IAFA 2O65A 4GVAA 2W96B 5FD2A 4W4WA 4BGGA 5CASA 5CU3A 5CX9A 5IMEA 3DFCB 3UQFA 1Q8TA 4QP1A 4R1YA 3R7OA 3LFFA 4X6QC 5KZ0A 5IQGA 3BZ3A 4FOCA 2WEVA 3K3IA 3QQUA 4WHZA 3PPZA 2QONA 4HZSA 2JDRA 4A06A 5KKRC 2Y0AA 2QOFA 4CD0A 4L46A 4AZFA 2R3PA 2C0TA 2WTJA 4PPBA 5AWMA 2G2HA 5CY3A 4O91A 3WZDA 4ACGA 1G8AA 4YBKA 2HK5A 3H30A 3TTJA 1OUYA 3ZO2A 3KC3A 4M3QA 5I9UA 4OTPA 2O0UA 3EQDA 4EBVA 5CAVA 1ZMWA 4MD7E 4DFXE 3NNXA 5ANEA 1H1RA 3IW5A 3EJ1A 4RPVA 1T45A 5EYDA 4M8TA 5L2WA 2FH9A 2XNOA 3P5JC 2XRUA 5HE3A 3RHXA 2XK3A 3PSCA 3FMEA 3NYVA 3IGGA 2CGUA 3R1NA 2X9EA 4RMZA 2VWUA 3DPKA 5D7AA 1MP8A 1KE5A 2VX1A 1JQHA 3VBTA 4JJRA 3TUBA 1XWSA 3OG7A 3ANRA 4YJUA 3OXTA 4JVGA 4Q9ZA 4NZWB 5A54A 2GHGA 4RWLA 4BTKA 5BVOA 4ZS4A 2WOUA 4XP0A 2HCKA 5DN3A 3ACJA 2P4IA 5E8YA 4YO4A 5AMNA 5I9YA 5JGAA 3NFGB 1SM2A 2ZMCA 1E1XA 2J4ZA 1U4DA 3TYKA 2X0PA 3ML1A 4RGJA 2E9VA 2X0QA 3LXPA 1UVRA 3PVUA 5IQHA 1IAHA 1R3CA 4QMLA 2HELA 4QTAA 4HW7A 3LCKA 4BJJB 3FMMA 4NK9A 4N0SA 3UIMA 4FKJA 2Y6OA 3VO3A 2XH5A 3ET7A 1BX6A 3F82A 3O51A 4MEDA 4DHJA 3ZLSA 4I6BA 4QYEA 3U4UA 3OXIA 3VF9A 1XMLA 5LARA 5LMBA 1VR2A 1Q3WA 3QL8A 3VBXA 4B8MA 3CXWA 3ZTXA 3K5UA 1S9JA 3D15A 4UN0C 3RP9A 4LDTA 3Q4UA 4KABA 4L01A 3RZBA 2ACXA 2XYNA 4I5MA 2C3IB 4LL0A 4X6RA 3NW5A 4CZTA 2WB8A 5BMSA 4U79A 4C58A 3QFVA 3UZTA 4GK3A 2W1IA 3UP2A 4QYYA 1H01A 1CTPE 1L8TA 4EONA 4Z16A 4D4SA 4C33A 5HIBA 4X2GA 3DLZA 3BBWA 4K2RA 3NGAA 3PG1A 3R7YA 5HESA 4DTKA 4PDPA 1WBPA 2QG5A 3QHRA 2OH4A 3BCEA 1GNGA 1YQJA 2J0LA 4C38A 4CLIA 4Y8DA 2QKWB 3NPCA 3QQFA 2WMXA 4RIYB 4W4YA 4LM5A 2JEDA 3GVUA 3OXZA 5H8GA 2YAKA 5HD7A 1QL6A 3KCFA 4C4GA 4M0YA 4QMWA 5B0XA 4BFMA 2GQSA 2BZKB 1TQMA 4WIHA 1PYEA 4USEA 4CT2A 4DLIA 5BVDA 3CS9A 5HO7A 1RQQA 5AUUA 3POZA 5HO6A 4OBOA 4EOPA 3G90X 3PY0A 1Q61A 2BPMA 3A8XA 4F0GA 4C4HA 3MSSA 5H2UA 2J51A 4L8MA 4UMRA 3EQFA 2W4KA 2PK9A 2QO9A 3F2AA 2JDTA 4I0SA 3MVMA 2WMRA 2BAKA 4RVLA 3HMNA 1H0WA 3PXFA 4P4CA 1U59A 2AQXA 3BEAA 4LG4A 4P90A 4YR8A 2BDJA 3PVBA 3TTIA 5I9WA 3UZRA 4FT9A 3VBVA 3LXKA 2WQEA 2B53A 3DFAA 4FE2A 4D5HA 2GHMA 5FEEA 3FUPA 3V51A 2BMCA 2B9JA 3DV3A 5HLPA 5HIEA 1UU3A 4FV9A 2FVDA 3C0GA 3R00A 5JGBA 3W0SA 2R0IA 3Q4ZA 3GNIB 3A99A 4RC3A 5LWNA 1H24A 4KKGA 3LCOA 3MFTA 2XVDA 3CTJA 4RT7A 5JQ8A 4IBMA 1LPUA 3ROCA 1BI7A 4M68A 3AD6A 2H96A 2Z7RA 3O71A 4MKCA 4RZVA 3R71A 4D4VA 3DBEA 4XV9A 4EC8A 3HNGA 3IDBA 3KVWA 4TY1A 2P3GX 1LR4A 4O27B 3OBJA 1NVQA 4K77A 5E92A 4BIEA 3DQXA 1ZLTA 4FTNA 4I92A 4C4IA 5ANKA 3WZEA 1GY3A 4RA5A 4LYNA 3LFNA 5IPJA 3PJ8A 4RA4A 4KD1A 2GS2A 2BHEA 3C0IA 3QZHA 4OTHA 4E3CA 2R3MA 2I1MA 2WNTA 3F6XA 3ID6C 3UIBA 4L9IA 3H4JA 5FQDC 2CJMA 2YJSA 5E8SA 2XEYA 3W8LA 3BGZA 3GGFA 1HCKA 4B99A 4F6WA 2BALA 4O7LA 4R77A 5DRDA 3MH3A 3KIOC 4EH5A 1XH5A 3CIKA 3E8EA 3F5GA 3ZDIA 3CJFA 5J1WA 4EH3A 5M57A 3C7QA 2ITNA 5KMJA 2OH0E 4RRVA 4X3JA 3OEZA 2YABA 5T6KA 3RM7A 1W8CA 3HDNA 5DMZA 1TZDA 1XH8A 4FTKA 4DAWA 4DGLC 3TMOA 2W9FB 4FTUA 2QD9A 2FGIA 2NRUA 3QRUA 5CSVA 5DH3A 3R9RA 4F0FA 4HVGA 3C4WA 2XNGA 2R3GA 2GNHA 5AP0A 3OUNB 1YXSA 2DQ7X 2ZB1A 1ZXEA 3POOA 4IZ7A 2YDIA 3TNQB 1V0OA 3GC7A 3UG2A 4FV4A 2W05A 3U51A 1R0EA 4HGTA 3EQHA 5JMSA 4FTQA 3TM0A 2R7IA 3C1XA 3ZC6A 4IVDA 5HE0A 5L8LA 3MJ1A 1ZMUA 1SNXA 3BGQA 3P7CA 4DITA 4YPDA 2CGWA 4BL1A 5DFPA 3MESA 4U7ZA 5HTBA 4NFNA 4LI5A 4G17A 3DBCA 3IGOA 3NLBA 4DH3A 2Y4PA 3PPKA 3BWJA 3SRVB 4D2SA 2XIXA 4FZ6A 2GNJA 4QQTA 2YIXA 2HW6A 5TOZA 4PP9A 3UYSA 3A7HA 3HGKA 4ANMA 4QMPA 4UMTA 5K4IA 5A3XA 4EK5A 3O8UA 4LOPA 3QALE 2VWZA 4MBLA 3BEGA 4MWHA 3NUNA 3RI1A 3F3UA 4ANOA 5CI7A 3FBVA 3D7ZA 3FLWA 5AR5A 4EORA 3D4QA 3EL8A 1H0VA 3B8RA 4FSTA 1W2CA 3K3JA 3EN5A 2UZNA 4NWMA 1YXVA 4QMZA 4UYNA 5DEYA 4BCMA 4ORKA 3HKOA 2W17A 5D1JA 1FQ1B 1KOAA 3KL8A 4IX4A 4MBJA 4RVMA 4W9XA 3UC4A 5J7BA 3LQ3A 4FGRA 4O21A 1TKIA 2C4GA 4R3PA 4RJ5A 4EBWA 4KUJA 1UU8A 4FVPA 2XUUA 5HZNA 4HZRA 2BTSA 4DCAA 2YM3A 4F64A 4AW2A 3LE6A 2UVZA 5DGZA 2G01A 1SVEA 3EMGA 4QMUA 5M56A 3UNZA 3ORNA 3SHEA 2QLUA 2W06A 3HMMA 4L3PA 3VRZA 3ZDUA 2YZAA 5I0BA 4AXCA 1ZRZA 2CKPA 4GT3A 1IG1A 4W8EA 1V1KA 4OT6A 3ZXTA 4A7CA 4FG9A 4BTMA 5LOHA 3DBDA 1MRVA 5HO8A 4DA5A 2JGZA 4Q5HA 4RLLA 4K1BA 3Q6WA 5JKGA 2PMIA 3MY5A 1H27A 2JAMA 3VW6A 1UNGA 4PTGA 2C6OA 2FO0A 2CGVA 2GSFA 3FPQA 1BMKA 3QTUA 4DHZA 2YCRA 3NR9A 4GUBA 2OGVA 5AP4A 3HAMA 3VS2A 3PFYA 3VONA 2PVKA 4I23A 3SG9A 1ND4A 3PWDA 4IDVA 2PL0A 3DK6A 2PVLA 3DNEA 2WMWA 2I7QA 2XANA 5KMKA 3PE1A 4QP7A 4MYGA 4FT0A 2A4LA 3F3VA 3H3CA 1ZYLA 2QOCA 3KXHA 4ITIA 4PTCA 3TT0A 1U5QA 4AP7A 3UE4A 4YGAA 2FA2A 3VW8A 4AWIA 4O0VA 4DYMA 2HY0A 5L2SA 1H25A 3N4VA 3QU0A 3S0OA 2PU8A 4IB3A 5IQEA 1FGKA 3F3ZA 3QYWA 3TNHA 5BVEA 5IQFA 5KCVA 5IU2A 4PL4A 2EXCX 5L2IA 3S1HA 5HCXA 3WZUA 1YI4A 3OCSA 3HZTA 4YTIA 3CGOA 4IAKA 1OKVA 4YLJA 5CF8A 4CTBA 4XG7A 4K9YA 4YU2A 2DYLA 3ELJA 3CTHA 2GHLA 5EFQA 1PMEA 2QOKA 5AV3A 3P08A 4AZVA 1GAGA 1YOMA 3GCQA 1RE8A 4FKIA 4YURA 4KWPA 3ZLYA 3QUDA 4J71A 3ZHPC 2PE0A 2ZV8A 1FINA 5J1VA 4CG9A 4FNZA 3EQIA 2R5TA 4K18A 3ALNA 4FI1A 4O6LA 4Q9SA 4BCIA 2NNWB 2ZVAA 3CKWA 3OC1A 4F1MA 2VWIA 3WZJA 1A06A 4ZJVA 2ZFYA 3LQ8A 3V5TA 3PPJA 5GJGA 4IAIA 3ZZEA 2OG8A 4CKJA 2RFDA 4RX8A 4UXLA 3DS6A 4R8QA 4JAIA 3PA4A 3LAUA 3RKBA 2HZIA 5EM5A 3R7UA 3K5VA 4EHZA 4H3PA 2CPKE 1YHSA 5AM7A 4S31A 3Q53A 4O96A 4ZK5A 4BCKA 4OGRA 4DEDA 4K11A 4NCTC 2GPHA 4E4NA 3M42A 5M55A 2ETRA 3ZRKA 3MFUA 1CSNA 3W32A 1V0BA 4G34A 3D5VA 4IDTA 3CPCA 4JQ7A 4WD5A 4AAAA 4D1SA 4E6DA 3TCPA 4F4PA 4LOQA 5FBNC 3PSBA 3H9FA 5EKOA 1PHKA 5CSWA 5IUHA 4PTEA 4IFCA 3SW4A 1P5EA 2PYWA 3H0YA 3QD4A 3IG7A 2GTMA 4MHAA 1DAWA 4IANA 3THBA 2H6DA 4FZAB 3GB2A 4H3QA 4R6VA 3LFSA 3BU5A 4KAOA 3OBGA 3CE3A 4IM3A 5B2MA 5L2TA 4YLKA 2JFMA 3DJ5A 3PSDA 3TL8A 4APPA 3EFKA 5JZNA 2WMQA 4IAZA 4AGWA 3WOWA 3IOKA 4KKEA 3GU8A 4GSBA 3DBQA 1UNHA 4TYHB 4FX3A 4U41A 5CVGA 5K0KA 4CFWA 3ZMMA 5AP1A 3DDPA 2XNBA 3TDVA 3RNYA 3QKKA 4ASEA 3Q9YA 2X1NA 4FKSA 4DT8A 4QNAA 2OF4A 4QQCA 3U87A 2JKKA 4TKSA 3C4FA 4BI2A 4D2PA 2VTQA 3FV8A 1OBDA 4PY1A 3C0HA 3FLYA 3QTQA 4JX3A 2OZOA 2YDKA 4YJTA 3R8ZA 4EH7A 4EQMA 4M7IA 4AXDA 4O0WA 4HYHA 4AG8A 2VO3A 2GCDA 5I3OA 3U6IA 1PKGA 3S3IA 3Q32A 3TIYA 2X4FA 4QO9A 5CQWA 5IZFA 2JITA 4FTRA 3R9DA 3W2QA 3VC4A 2R3RA 3VF8A 1FOTA 2ZV9A 3FXXA 4KSPA 4XX9A 3W33A 2WXVA 5E7RA 3MFRA 1YHVA 3LLTA 5TO8A 1H07A 2WIPA 5F1ZA 5M07A 2OJ9A 5CYIA 1OI9A 3H10A 2OKRA 3OY3A</