3NX8A

Human camp dependent protein kinase in complex with phenol
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
336
structure length
333
Chain Sequence
b'VKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDINHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Experimental and computational active site mapping as a starting point to fragment-based lead discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 106
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nx8A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nx8A02
4UWBA 4FV2A 5HCYA 1KWPA 1PMUA 5A9UA 3R7GA 4MXXA 3ZLWA 1P14A 3W55A 1HCKA 4OTHA 5HVKA 4BRXA 4IE9A 3MYGA 3ENHA 3JS2A 3R01A 5AR4A 3UP7A 3DNEA 1BKXA 2J90A 4CT1A 4JRVA 2VX3A 4RJ4A 4CVAA 5EDRA 4HZRA 2OU7A 5EQEA 3I7BA 5DGZA 3C7QA 1Q3WA 3OY3A 5TT7A 4OBQA 5BNJA 3D0EA 4MXCA 5CF6A 2YLEA 4MBJA 2PVFA 1YHWA 4TXCA 2CKOA 3QFVA 4AZSA 3TG1A 1LEWA 4H36A 4QMMA 3OEFX 5AJQA 3DOGA 3ACKA 3FSKA 3ORPA 3RINA 4F9CA 1XJDA 4QPSA 1URCA 4ALWA 5GZ8A 3ZFYA 2JEDA 3PA4A 4AZEA 3ULZA 4ITHA 3OTVA 4MXYA 3TNWA 5TKDA 4BZDA 5HNIX 1WBNA 1PXLA 3DT1A 1OKZA 4FTKA 3IECA 3GI3A 5FEQA 3QTSA 3U51A 2RIOA 1JAMA 2WMTA 3KRXA 4RQKA 4EOKA 3S3IA 1PXNA 4WNOA 4AA4A 3HRCA 4KRCA 4H05A 2DUVA 2W1EA 4U0IA 3S2PA 4EH8A 2VNYA 3ALNA 3C4EA 1GZNA 3UOLA 3WILA 4E1ZA 2BRGA 2X4ZA 3EMGA 3ETAA 2BFXA 3PVWA 3ZLSA 2IPXA 2WGJA 1OGUA 3ZO2A 4ZAUA 4X3JA 2QC6A 5HICA 5BUIA 5KMOA 3F2RA 3C0IA 3FC1X 4ASDA 1APME 1ZZ2A 2JIUA 3FJQE 3DAEA 3L9NA 4JR3A 4X6QC 2JLDA 2ZMCA 3SQQA 1UWHA 3UMWA 4WIHA 1MQBA 5FM3A 3G6GA 4PDOA 5JK3A 4G5PA 2XNNA 3LJ1A 3UIBA 3KN5A 3O0GA 1WMKA 2G1TA 3FC2A 3CPCA 1TVOA 4EOOA 3M2WA 5CAOA 2OW3A 3GU7A 3PVGA 3NW5A 4V01A 5AP4A 2RG6A 3F88A 4HGTA 4IVBA 3Q6UA 4FIGA 5CQUA 4E4MA 4TL0A 5HVYA 5GZAA 4LMNA 4PMSA 4JLCA 4LFIA 3OD6X 1XO2B 2IZTA 4DBNA 1RJBA 2RKUA 5J5TA 2XKEA 4F6WA 5IUGA 5A4QA 4EORA 2BR1A 4USDA 5CXZA 2B9IA 4BDEA 4CRSA 3KY2A 1OB3A 1LEZA 3OXTA 1U46A 3MW1A 3CKXA 2BDFA 2HWPA 4FIHA 4IC7A 1XH8A 4O2PA 1S9IA 4UXQA 2HW6A 3QU0A 4FZDB 4QQ5A 5K0XA 1KE6A 5CEOA 1OBGA 1KSWA 2QODA 2ONLC 3COIA 3Q4UA 2RFDA 3V5JA 2CNUA 5I3RA 1J1CA 4U41A 3P79A 4PPAA 2XK3A 2C6EA 3EN7A 4YBJA 4TWNA 4JIAA 4UMTA 5HE3A 4UXLA 2VO3A 2KTYA 3FXXA 4CSVA 5C4LA 5IUHA 2ZDTA 4O27B 4CG9A 3KVXA 3I1AA 4EC8A 3PJ8A 3OP5A 3TTJA 3VNTA 3PFQA 3ZXZA 3IW4A 4FTIA 5AP7A 3TNIA 3UJGA 3F2AA 3TNHA 3W18A 3BEGA 4C2VA 2VTHA 4J99A 3QYZA 4K0YA 5E92A 3V51A 3A4OX 3C4CA 2ITUA 2O8YA 3R04A 4C59A 1H1PA 2A1AB 2FO0A 4GVAA 5AV3A 4A9SA 4O0SA 5CU3A 4ACHA 3E8EA 4G17A 4E7WA 4M0YA 2XH5A 2V55A 2VTLA 3ZLXA 3L9MA 4TZRA 4TWPA 2IW9A 3IW7A 4NFNA 1SVHA 1W82A 2WTCA 2X9EA 3QZHA 4QPAA 5E1EA 3WI6A 5AV2A 3FMJA 4BB4A 4CZTA 2BROA 3N4VA 4BGGA 2EXCX 2B7AA 2JFLA 5CS6A 3OUNB 5FBNC 4C57A 5CAQA 4JG8A 4FTMA 1YDSE 3Q32A 5F95A 5J79A 1J7UA 4AA0A 2WMAA 4HZSA 3BLRA 3MH0A 3OCTA 3ELJA 2XK9A 2YM7A 2PVJA 3R2BA 3OBGA 2XUUA 5HO7A 4YJOA 5M07A 3AOXA 4C3PA 3QF9A 3R9HA 2WXVA 5HE0A 2UW9A 4XCUA 5BVEA 4ZK5A 3THBA 2WMRA 3HMMA 4HVSA 4QMZA 2QOCA 3FI4A 5DPVA 3KMWA 4BCPA 3D14A 5KKRC 3ODZX 5A54A 2BDWA 3P86A 5DG5A 2I0EA 2QURA 3MH3A 3PA5A 3DS6A 4MD9E 4CLJA 2FSLX 3ZM9A 3MV5A 3BYMA 2ZVAA 3E5AA 4FTUA 2QLQA 5JFSA 4M8TA 4EH5A 5CY3A 3A2CA 4BKZA 2CKQA 4MHAA 4XRLA 5K0KA 4ZSJA 2XKDA 3R7UA 2C6TA 4U80A 3UPXA 2WEVA 2ZM3A 3BWJA 4EK4A 3VC4A 2QG7A 3F66A 1KE5A 1H00A 4G2FA 4ANMA 4WBBB 5K3YA 2CN8A 4TYHB 4OBOA 4C4JA 4EK8A 4O1OA 5CSVA 5JZNA 4DBXA 4H3PA 4AT3A 3TV6A 2C6OA 3ZRMA 4BI2A 1YHVA 4RFYA 3LIJA 4QYGA 3SKCA 4BBFA 3R8ZA 2YIYA 4G6LA 4M3QA 2C5XA 3RK9A 2Z7QA 4FIEA 4B9DA 4DEHA 2CCHA 3MFSA 4BDGA 3S0OA 4FNWA 4MNEA 1Q41A 4QOXA 4WNKA 4CKRA 2GS2A 4C36A 4G6NA 3QTRA 4R7BA 3AMYA 2PE0A 4FNYA 1JLUE 4R3RA 4E6DA 5L6PA 3AD4A 1R39A 3MVHA 1YVJA 3P5KA 5AV1A 2VZ6A 4DH8A 2Q0NA 3P23A 4TNBA 4GJ2A 3A7HA 3A4PA 3TCPA 4Q9ZA 1M2PA 4OTWA 4QPMA 5IDNA 4UY9A 4GT3A 4W4XA 4ID7A 1CSNA 4FSQA 4F6UA 2YZLA 5CSWA 4HOKA 1YOJA 2PZ5A 1STCE 2YDJA 5HO8A 2BRBA 2QR7A 3IONA 3O8UA 3OROA 4JJRA 4C4HA 4D9UA 3BELA 5FP6A 5L2WA 4UYAA 1XBCA 5GJFA 3TKUA 4DEIA 4FT3A 4XG9A 4ZTMA 2GU8A 4KIOA 3DV3A 4N70A 5AP6A 3SC1A 3HDMA 5CVGA 3D15A 4F9BA 3RPVA 4AGDA 2CDZA 4BCIA 1U4DA 2Y4IC 4YSMA 2EU9A 4PP9A 3HMIA 3NNVA 5IA0A 4GUEA 1YW2A 4QNAA 4NSTA 4A7CA 4DGGA 4WO5A 4E8AA 5H3QA 5LCKA 3FLWA 4U7ZA 3VIDA 4ZTQA 4DEDA 5JFVA 5CU0A 2OFUA 3TIZA 1BL7A 3VUMA 5AADA 3Q9XA 4K9YA 5IQBA 4PL3A 2ZMDA 3QKKA 4IH8A 1Y6AA 2J6MA 5HESA 4FG7A 4NKAA 4QMVA 4EH9A 5LVOA 3KGAA 4FK3A 5C8NA 1TQPA 5CF4A 1GJOA 3DK7A 2YCFA 3VBTA 1XBAA 3D94A 2CJMA 2LGCA 1W7HA 1YWNA 3BLQA 2YIRA 5BVDA 3LFAA 4I21A 4YHTA 1MRUA 3OZ6A 5FTOA 3WF5A 4HPUE 5CEQA 5EQYA 4BY9E 3BQCA 3NYOA 3KXZA 4IM3A 4UZDA 5GZ9A 3WYXA 4FTLA 3Q9YA 4FYNA 4RT7A 5E90A 3R8LA 3L8PA 1GZ8A 3TV7A 4DT8A 2BALA 2VO0A 4U40A 5CEMA 5BUEA 4X3FA 5CXHA 3ZFXA 4R78A 4PMMA 3MTLA 2P2HA 4J8MA 4XEYA 2ITWA 1WCCA 3P1AA 5LMAA 1JKLA 5BVWA 4CZYB 2DQ7X 4YUQA 2GHGA 2X7FA 3T9IA 2BAQA 3KXNA 3IS5A 3QTZA 1YQJA 3KC3A 4FEXA 5A46A 3NVMB 3F5PA 4KRDA 1O6YA 4HYIA 4G31A 4TYHA 3O17A 5ANEA 2GFSA 4ITIA 3QUPA 4FIJA 3EN6A 4LRMA 4OAVB 2A19B 3VBVA 3EWHA 4G34A 2XM9A 4CMOA 4J95A 2OH4A 4K11A 5D11A 4JAIA 4NL0A 4FT5A 3W8LA 4YJVA 4RRVA 3AC1A 2PK9A 3E8NA 2OF4A 4CKJA 2UV2A 4NFMA 4D0WA 2E9VA 2FVDA 5KX8A 2PUPA 5HTIA 2OSCA 2R7IA 3UQCA 1XR1A 4W8EA 3AT2A 2GNHA 3NPCA 4D2SA 3VBQA 4RLLA 5ACBC 3Q9WA 2PL0A 4XX9A 3MFUA 4GG5A 4RX5A 4QRCA 1EH4A 4J98A 4LOOA 2VTOA 4DTKA 4FL3A 1W83A 1KV2A 4KIQA 1ZRZA 3FLSA 4BYJA 2X2MA 2FUMA 1JWHA 3SDJA 3NLBA 4HNFA 2WTWA 3FYJX 2C69A 4I22A 4QTBA 2H34A 4BDHA 4I0RA 3C5UA 2QKRA 3LCSA 4PMTA 5HTBA 2G2IA 5IA2A 1GIIA 4EUTA 1IA8A 2W1DA 2XYUA 4CQEA 4CMTA 1OM1A 2HWOA 3ORMA 1NVRA 5E1SA 3SW7A 5H8EA 3ZZEA 3LCKA 4D1XA 3I6WA 2G2FA 4AZTA 2OLCA 3W16A 1P5EA 4MTAA 4EONA 4G6OA 5K4IA 4EKLA 3MIYA 4I3ZA 3MPTA 4MD7E 1REKA 1QL6A 4IEBA 5GJDA 2WIHA 4CLIA 4DFXE 2J2IB 1OL5A 2J0KA 2CGVA 4L7FA 4ZMFA 3RTPA 4S33A 1ZARA 4ANBA 1ZZLA 3FLQA 3VWAA 3VS6A 4I6QA 3VJNA 4IZYA 3AC8A 4J97A 1URWA 5FLFA 3VF8A 5L8LA 4A9RA 3ZC5A 4JDJA 4M7IA 4CFUA 4H1JA 2I6LA 1P2AA 2VTJA 1G8AA 4BTMA 3JPVA 4MWIA 2IZRA 5M4UA 2QOLA 5A3XA 4C3RA 3HMOA 2C5YA 2VTMA 2OKRA 2X7GA 3NUSA 4NH1A 4XBUA 3NEWA 3UO4A 4DF3A 1NXKA 1MRVA 1UU3A 4AE9A 1YXTA 3TZ9A 4BN1A 4XMOA 4WRGA 3JUHA 4O0RA 4HVHA 3HUBA 3UZPA 3VF9A 3DDQA 1Q61A 4W9WA 4GT5A 4R6VA 3U4WA 2YERA 4UN0C 4O82A 3RGFA 3EB0A 4IVAA 5HU3A 3FMEA 4EHZA 1Q99A 1P4OA 4F1TA 5E8XA 4C38A 1W98A 4OUCA 3MI9A 3FLNC 3QQKA 1IR3A 4G9CA 4J52A 1UU9A 3R22A 4L68A 4MQ1A 4E4LA 5AX3A 3DNDA 3NNWA 5LOHA 4L44A 2RGPA 5JMSA 4RIYA 3MH1A 3ZBFA 2JDOA 3CEKA 2R0IA 4IAZA 5EYCA 2XIYA 5K5XA 3FL4A 2P0CA 5T3QA 4LUDA 4EI4A 5HORA 2YDIA 2Z8CA 2CLQA 3UQGA 3ZC6A 3NCZA 4NTTA 4U97A 3DXQA 3KN6A 4R5YA 5D7AA 3GNIB 5E8WA 3V8SA 5IDPA 5C4KA 1IEPA 2YLFA 5FP5A 3JY0A 4DHFA 5I9YA 3RPRA 2CGXA 1L8TA 2XS0A 4BVUA 2XK7A 4FG8A 3PTGA 4I5HA 3ORXA 4BHZA 1XHAA 3FI8A 5AP1A 3HEGA 2YIQA 5HLPA 3K5VA 4AZVA 3HMPA 4JBOA 5JN2A 2W1HA 2BPMA 2O2UA 2OJ9A 1KOBA 3ZU7A 2WQEA 2BHHA 4ZMEA 3I7CA 4AACA 1JVPP 3F5UA 3G33A 4X2JA 1E9HA 3EL8A 3SG8A 2HZNA 3QC4A 3UG1A 4F0IA 4RIOA 1CM8A 5DI1A 4BWPA 1ZLTA 4K33A 5AR2A 2UW4A 5CZHA 1PXKA 4BKYA 2R3NA 5HD4A 4BFMA 2QU5A 3KVWA 4M69B 4QTAA 4KINA 2X81A 1G5SA 4ERWA 5J7HA 4O6LA 4PNIA 2PVNA 3QUEA 3OFMA 4EWQA 3GQLA 3D7TB 4J53A 3BHVA 3KL8A 1YI3A 3ZEPA 4EOSA 4O86A 1NW1A 3AXWA 2JAVA 2W4JA 3PXQA 3CP9A 1V0BA 3E7OA 4WNMA 5HE1A 2VX0A 3VS5A 5DVRA 2WTKC 4G1WA 4FI1A 4ZTSA 5CF5A 4IACA 2V7AA 2XM8A 2HK5A 4PTEA 2WQNA 3D4QA 3Q3BA 4AGCA 3QRKA 4FZAB 3SRVB 1W0XC 5EOBA 4J1RA 3NSZA 5FUTA 4U81A 4UX9A 2O0UA 3SG9A 2ERZE 4P5ZA 3C4ZA 3W2RA 4DTBA 3DZQA 3CXWA 4G5JA 4XS2A 2ITVA 5IA1A 4FTJA 3EIDA 1U54A 3AG9A 3GCUA 5ETFA 1PHKA 3FXWA 3QKLA 5IF1A 4FV5A 1SZMA 5LQFA 3L9PA 3QD4A 4MNFA 2PZIA 4JVGA 4WT6A 4Q5EA 5CEIA 2ITYA 1PMNA 4CRLA 5FWKK 4USFA 3PG1A 3PY3A 2WMXA 1XWSA 3DBDA 3NIEA 3P9JA 1ERKA 5JEBA 2Z2WA 4EOPA 2WMSA 4EOJA 3AD6A 1VJYA 3OCBA 3F2NA 1I09A 3II5A 2IW6A 3E3PA 4FSRA 4GVJA 4OW8A 3UOKA 4GT4A 1WVWA 4NEUA 3HAMA 4RQVA 4DG2E 4GYGA 4RX9A 4PQNA 5DR6A 5C03A 5I3OA 2FSTX 3RPYA 4F1MA 3L8XA 3VAPA 3UBDA 4F09A 3TDWA 2PZRA 2XNPA 3BZ3A 1E1XA 3CLYA 4YZ9A 3U87A 4EH3A 3RCDA 2UW0A 4EOQA 4Z9LA 5JRSA 3AD5A 3A7GA 5LMKC 5AUXA 1YHSA 1Q8WA 4AU8A 3CR0A 4F64A 4QYHA 3FPMA 2FGIA 3QWKA 4GW8A 2H9VA 3MA3A 3PJ1A 4M14A 3MWUA 3CD8A 3VUHA 4JQEA 4NJ3A 3NUUA 3LMHA 5GNKA 2R3HA 2OICA 4JG6A 3S95A 3BYUA 4OTFA 4ASXA 4GUBA 1H08A 4DG3E 4IANA 4FV3A 2R3IA 3O7LB 1R1WA 3SAYA 2VTAA 3ZMMA 3O51A 3UO6A 3KF4A 4BWXA 3PYYA 4D1SA 5FXRA 4PPCA 1FBNA 2OXYA 5DIAA 1YRPA 1ZOHA 4Y95A 4O0WA 3G9LX 4LGGA 3DJ6A 5CAPA 2YM3A 2QO2A 4FKPA 3LFEA 2XB7A 3MVMA 4GU9A 3CGOA 3Q4CA 1Q3DA 4PDPA 4BTKA 2J5FA 3EN5A 2YITA 4LL0A 4QMYA 4DCEA 2BKZA 4ZTHA 5B2LA 2ERKA 3WZEA 4IAIA 1DS5A 3E62A 4EZ7A 1BLXA 3CQWA 3HV7A 4E6AA 4EYJA 2PZYA 1ZAOA 3ZOSA 3EZRA 4S2ZA 4YJTA 4DA5A 4U45A 4L3JA 5IU2A 2WELA 3D7TA 3JY9A 2W1FA 4UB7A 3A61A 3PY0A 4GH2A 2VX1A 4LV8A 2WQMA 5EM5A 4GIIA 3TKIA 4HCTA 4WD5A 4C4EA 1XH7A 4BIDA 1UWJA 3R0TA 3TKHA 3LLAA 3F6XA 4RWJA 1BYGA 3GT8A 4OBPA 3VS1A 1JKSA 4RG0A 5IQFA 4O22A 4FICA 3KXGA 4D0XA 3C51A 3LFNA 1UA2A 4YO6A 5L8JA 3PA3A 1OITA 2YM4A 5EI2A 4FSWA 5AUVA 3CSVA 2W5AA 1WVXA 4YLLA 2WMQA 4AF3A 3WBLA 2ZM4A 4QYYA 4CQGA 3QGWA 5CNNA 2UW7A 3KMUA 3QA0A 4EZ5A 2W1IA 4RIWB 3RI1A 3UZRA 3MBLA 4J7BA 4AA5A 4FL1A 4NCTC 2GHLA 4TNDA 3ORTA 3QHRA 4QMSA 4ACMA 4C8BA 3UZTA 5C8MA 1U5QA 1YXVA 3IOPA 3TI1A 3ZH8A 3ATSA 2P4IA 3VN9A 5D9HA 3IOKA 2XF0A 4M97A 4FKJA 3DB8A 4AT4A 5IQHA 3EKKA 4TPTA 4BIEA 2PVKA 1DI9A 1K2PA 3A8XA 5BMMA 3ZBXA 1JKTA 4R8QA 3G5DA 5AFVA 1R78A 3VBYA 4FEUA 3ORZA 2ESMA 3DKFA 3PSBA 5FXQA 4EWHA 4BBMA 4WG5A 4K18A 4CV8A 5JKGA 4YP8A 1BUHA 2PSQA 3Q5ZA 4XP2A 1I44A 3BLHA 4L3PA 3ANRA 1H27A 2RSVA 1JPAA 2Y4PA 3BHYA 3HUCA 2X8IA 1G3NA 3OXZA 4G3FA 3UYTA 3CQUA 3AQVA 2QO7A 2CPKE 3R7OA 3EN9A 4ZLOA 3GGFA 1ZY5A 2QOIA 2WTIA 4AGWA 5IUIA 4XRJA 4OT5A 4QMLA 4YTFA 4IADA 4I24A 4RIXA 4RJ7A 3MS9A 5H8BA 4ZY6A 2HY81 4YC8A 4YZBA 4FV1A 2XRWA 2R2PA 1DI8A 4G3GA 3UOJA 5IZFA 2J0LA 3DKCA 4XV3A 3RWPA 3ZSGA 5IH6A 2NPQA 4ZSLA 2WZJA 3CTJA 2B0QA 1K9AA 4YNOA 5E8ZA 1ND4A 3IW8A 3SD0A 4RBLA 2IG7A 2WTJA 3EZVA 3DDPA 4M84A 3EFLA 4IB0A 3E3BX 2QI8A 1Q8YA 3FL5A 2PZPA 4H58A 2WPAA 4KIPA 3I0QA 5TF9A 3C1XA 3MN3A 5CF8A 5HG8A 2WFYA 1ZY4A 3PP0A 4USEA 1OKWA 5HBHA 4MCVA 5DMZA 1JSVA 5GJGA 3RCJA 2FB8A 5A4LA 4ENXA 4I0SA 5BVFA 2QO9A 1V1KA 4L6QA 4QO9A 4D5HA 3Q60A 5A4EA 4TYJA 2ETRA 3UDBA 3O7LD 3FMLA 4BDFA 3Q96A 3QTXA 4H3BA 1KUTA 3MIAA 3SOAA 2XNEA 3TL8A 5DT3A 3ZYAA 5IA3A 1PXOA 2UZEA 5AWMA 3TWJA 5M4CA 5CU6A 4KNBA 3LCOA 3QZIA 1SVEA 2PMOX 2X9FA 5EKNA 1WBPA 4C3FA 3ROYA 4P5QA 2G9XA 2RG5A 4YLKA 3H30A 1CDKA 5KKRB 3TNPC 2F57A 2A4LA 4NW5A 4DH5A 2C6DA 2BZIB 4D2PA 2C1BA 3V6RA 3JR1A 2Q83A 1W84A 3LFQA 4KUJA 4XUFA 4O84A 4L7SA 2Y6MA 3ORLA 4CCUA 4RZWA 5L8KA 2YACA 3DJ7A 3IG7A 4C61A 3H9OA 5JZJA 4L43A 2JAMA 2W9FB 4DLJA 4J96A 4B99A 4R7IA 5H8GA 5HCZA 5J9LA 4EJ7A 2GS6A 5CVHA 2JDSA 3VRYA 4MBLA 5CVFA 3IPHA 2WEIA 4IWDA 4Y5QA 3R8UA 3UYSA 4PL5A 4MVFA 1FVVA 2R7BA 3QZGA 2Z7SA 3R30A 3NDMA 3SXRA 1PF8A 5CALA 4AN3A 1OL2A 3KRRA 3R9DA 3QXPA 4BDKA 4PV0A 4BZOA 3ZCLA 4DN5A 3DK6A 1WBVA 3IQ7A 4EKKA 5AAEA 3VQUA 2VNWA 3R2YA 4X21A 5KMJA 2XK6A 2WHBA 2FYSA 1LR4A 1H1QA 3P7AA 4LRKA 5AR3A 2GNIA 3F7ZA 5BYYA 5DOSA 2H8HA 2GMXA 3AGLA 2VU3A 3NAYA 4FK6A 5CYIA 5FDXA 5KZ0A 2X4FA 3RM6A 1OBDA 2HIWA 2UW8A 4RX8A 1H0WA 5JQ5A 3HLLA 5I9WA 5ACKA 5AR7A 5LVNA 1B38A 4L46A 4RVTA 5EG3A 4A9TA 4L00A 4CGAA 3DBEA 3NAXA 3SOCA 2YJRA 2C3LA 2DWBA 1M2QA 2UZLA 1BI7A 3BV2A 3GC0A 4HYHA 2BZHB 2R64A 3WZJA 4XG7A 4WG3A 4I6BA 1YXUA 2VTRA 3HRFA 4JL9A 1OIQA 2B1PA 2YCRA 2XJ2A 3KF7A 4JS8A 4QP9A 4QMXA 1H25A 3KREA 2OJIA 1RE8A 2YAAA 2E9UA 5CEKA 3UC3A 5H9BA 3O8TA 1NVQA 5CU4A 5AR5A 3RVGA 3CE3A 4AE6A 4WUNA 2Y4IB 4KIKB 5ICPA 3C5IA 2OO8X 3C4WA 2BRMA 3JVRA 3EFJA 3GOKA 3CPBA 4YMJA 1F0QA 4Y85A 4KB8A 3ROCA 2X0GA 1PKDA 1T46A 2ITQA 2P33A 5T6KA 4ZY4A 3QD3A 3EQDA 5I9VA 2C5VA 3FMNA 3HL7A 5L2TA 5ANIA 2RL5A 1H4LA 5B2KA 2QVSE 1XH6A 5EI6A 2IO6A 3OTUA 3G51A 2UVZA 4CMUA 4JBVA 4FC0A 3CS9A 2GDOA 4LMUA 2X6DA 2PMIA 3FUPA 4C4FA 5AA8A 4RWIA 2UVYA 2JKOA 3QX2A 2X1NA 4ZS0A 5L2QA 4HW7A 4Z55A 2GS7A 4FZ7A 4QP1A 4FKTA 3I81A 4YHFA 4I5MA 2JITA 3QRJA 5D7VA 2RFSA 4YTHA 3BHUA 4B7TA 3ZDIA 3RALA 5EI8A 5EM8A 5M4FA 4X2NA 2BHEA 4OTQA 3NZ0A 4AOIA 4O1PA 5C01A 3PXYA 5M44A 3SGCA 3GC7A 3AGMA 5L6WL 3OMVA 3E92A 4DG0E 4PRJA 3KKVA 4F99A 4NM0A 4TKSA 5DFPA 3R8PA 4FF8A 4YZNA 5I9UA 4FGBA 5ANGA 2VTPA 3NMUF 4CEGA 1O9UA 1NA7A 2J7TA 3MJ1A 3IKAA 2C6LA 1G8SA 1J7LA 3Q4ZA 4WA9A 5HBEA 1OPLA 2ZJWA 3QZFA 2ZV9A 4FODA 3NW7A 2XNOA 1FMOE 3G2FA 3HGKA 5AAGA 1NY3A 2PE1A 3D7ZA 2YM8A 4IVDA 2GNGA 3OWKA 3TACA 2UW5A 5BQ0A 4MWHA 4W4WA 3SVVA 2YZAA 3ACJA 4GIHA 3D83A 5C26A 5D1JA 1MP8A 5J8IA 3UODA 4IIRA 3M42A 4LRJA 4RVKA 2J51A 3UVPA 2GNJA 3SLSA 4YJPA 3ZDUA 3ORKA 3FQEA 5K5NA 4HGEA 3KRLA 3S4QA 3UVQA 4GSBA 3OT8A 3V5TA 3BRBA 3MPAA 4QP2A 2R3RA 4F63A 3QCQA 3C0HA 1QPJA 4M15A 3R9NA 5HOAA 3UNZA 4C4GA 3S00A 4F7JA 2YDKA 4MD8E 3ZSIA 5HU9A 2OJJA 3E7VA 3POZA 4RJ5A 3NS9A 5EFQA 4E5AX 4YJQA 4NYEA 1WBWA 3AT4A 5HIEA 4XYFA 4YHJA 4DLIA 3F61A 4CFVA 3OS3A 3DQXA 3HP2A 3F7WA 5CT0A 4PNKA 2B9HA 1ZMVA 2A0CX 4ZJVA 1R0EA 4GCJA 5ETIA 4O6EA 2EVAA 2H96A 4RJ3A 3TV4A 2XIZA 3AMAA 5AP2A 4EL9A 3U6IA 4JIKA 4U3ZA 4I4EA 4AG8A 1UNHA 2ITZA 5DEYA 3REPA 5F4NA 4IC8A 2OF2A 4HJOA 2WQBA 1MQ4A 1H26A 2QG5A 2OZAB 2Q0BA 5IMEA 4MF1A 4XLVA 5HZNA 4BGQA 4E6QA 5LWNA 4R1YA 4CFMA 4YZDA 3R7EA 3Q6WA 5EDQA 4CFWA 3VW6A 3V5LA 4OR5A 4LV5A 4CFNA 3EHAA 3W2PA 3CIKA 4FNXA 3QWJA 3RAKA 5F9EA 3TEIA 4A07A 5BPYA 3L8VA 4ACCA 2AUHA 3ALOA 4I4FA 4M13A 4AZFA 4EH4A 2WMUA 1M14A 3FXZA 1J1BA 2WU7A 3FKLA 2R9SA 4FGRA 3KULB 3ZSHA 2ITPA 4FX3A 4N0SA 3FLZA 3ULIA 4NU1A 2EUFB 1YWRA 2X8DA 3Q4TA 1FGIA 4X3FC 1OKVA 5ANOA 4BYIA 1JKKA 4C0TA 3MJ2A 2R5TA 3TJDA 2R3MA 4ZZMA 5TE0A 4UMUA 5I4NA 4NM5A 2ZB0A 3OC1A 1ZMWA 4MX9A 1AQ1A 3FLYA 1JOWB 2PVHA 3KXXA 4XH6A 5IMXA 3IDCA 3LLTA 3SV0A 4EOMA 2JBOA 4AN9A 4D2TA 2NNWB 1PYEA 1VYZA 3V04A 4Z3VA 4X0MA 5JSMA 3WARA 2XCHA 4K77A 4FYOA 4JQ8A 3Q04A 4XG4A 4W9XA 3UMXA 4FV9A 1SMHA 3QRTA 4BCOA 5LWMA 4QP8A 4PUZA 4RX7A 2I40A 1H07A 1PXMA 3MDYA 2Y8OA 1V0OA 4IDTA 4DFYA 2X8EA 4S31A 3EJ1A 4IQ6A 4PDSA 3QC9A 2BZKB 3GC9A 2QOFA 1VZOA 2XRUA 3PG3A 4FOCA 1SNUA 3D9VA 3QCSA 4S32A 2OJGA 3PUPA 4O0XA 3VJOA 3PJ2A 1Y8YA 2PVYA 2QLUA 5JQ8A 5JRQA 3E64A 1DAYA 4BR3A 5FQDC 3NNXA 2SRCA 5HBJA 4WOVA 3LQ8A 4ZJJA 4E26A 4EQMA 4KKHA 4BDAA 5A14A 1SYKA 4LOQA 2QCSA 4FTQA 3B2TA 3GFEA 3PDTA 3EFWA 4FSTA 4A4XA 3ZLYA 2ZV2A 3LM0A 2ZV7A 3ET7A 4IZAA 4BICA 4JG7A 3DFAA 4O7TA 5BYZA 3QQLA 4FT7A 4MAOA 4RGJA 2W17A 2CMWA 1DAWA 4ANLA 2XKFA 3E93A 3U9CA 4Q5HA 2WTKB 3CTQA 3F3TA 5HVJA 3SW4A 5M57A 4CG8A 3UIUA 4FT0A 3FMDA 2ETMA 3V01A 3O50A 1VEBA 4DFUA 4I0TA 2KULA 5F20A 5CANA 1H1SA 2W99B 4PMPA 4DEAA 5ETCA 1FINA 5ETAA 3O2MA 4EQUA 4OTDA 3RPSA 3HV6A 2C68A 3OCGA 4OTIA 5AX9A 5M08A 2F2UA 1CKPA 3LQ3A 3FQSA 3HA6A 2OZAA 1FVTA 2HELA 3KQ7A 3CGFA 4J8NA 5J9ZA 4BF2A 2O65A 4NM7A 4D4VA 5KMIA 2ZM1A 2XA4A 3LPBA 2REIA 3F5XA 4NJDA 4G3EA 4UYNA 5EHOA 4ANOA 4PP7A 3G9NA 2R3KA 4BTJA 4QMWA 5I0BA 2C1AA 4MH7A 3FMHA 4YPSA 2ITTA 3VBXA 2CGUA 4O7RA 3NYVA 5F1ZA 2YHVA 4IM2A 2OIQA 4IAFA 1BX6A 3R1YA 4C37A 2GPHA 2C6KA 4I41A 4IX4A 4PDYA 5CU2A 3UE4A 1OIYA 2QR8A 2UZTA 3JXWA 5ITAA 4IZ5A 3KULA 4GK4A 1OUYA 3BU5A 3OF0A 4IDVA 4HGLA 4K8AA 1OI9A 4V0GB 3WZDA 3DCVA 3FZSA 3MSSA 3PZHA 5CI6A 4RWKA 3K3IA 5IEXA 5JGBA 2VWYA 2HXQA 2O64A 4DGMA 3RK5A 4B8LA 4CXAA 1UNGA 3H4JA 4OGRA 4QP4A 4B0GA 3TM0A 2WKMA 3NCGA 5IH4A 2IZSA 4BZNA 1XH9A 5GIOE 3L1SA 4BIBA 4BTFA 2B4SB 3H9FA 4RSSA 4QYEA 5EW8A 5IEYA 1K3AA 4QTCA 5FXSA 2VTIA 2X7OA 5ANDA 3ZUTA 5LVMA 5HNGA 5CNOA 3OWJA 2AYPA 5JT2A 2IW8A 5FM2A 3FAAA 3RBWA 3G0FA 2VD5A 4FR4A 3QBNA 1YDTE 3BCEA 3NW6A 4O7VA 1PW2A 4RA5A 3MTFA 1P4FA 4YJNA 1V0PA 2CKEA 4XV1A 4I93A 4IMYA 2CSNA 3VUDA 3OEZA 1OIUA 1UV5A 2X2LA 4KWPA 2XZSA 4CZUA 1UU7A 5EYMA 4D2WA 1PMEA 5CX9A 3EQFA 3GC8A 3QLFA 4QQTA 4K2RA 4R5SA 4C4IA 4MQ2A 3U8WA 5FG8A 4L67A 2E9OA 1OL1A 3K2LA 4AWIA 4BCFA 1NT2A 2V5QA 3V8TA 4L52A 2JDRA 4D28A 4TYEA 4FV8A 4LM5A 3ZUUA 5CLPA 2I0YA 3D2KA 3PRIA 2GFCA 3KEXA 5DLSA 4BCNA 2GCDA 3KA0A 3MH2A 1XKKA 4UEUA 2C0IA 5KBRA 3OT3A 5AAFA 3O96A 2WTVA 5E7RA 3CBLA 3CJGA 3IK3A 5HEZA 2ZB1A 3UOHA 5CSPA 3M11A 4FKSA 5DNRA 2ZYBA 2PWLA 2VTQA 4FG9A 3DQWA 4HCUA 4YR8A 3HECA 1GIHA 2F4JA 4HCVA 3QALE 1BL6A 5L4QA 4E20A 4FTNA 1GZKA 3OWLA 4QMNA 4F0FA 2VUWA 3BBWA 4N6ZA 5IPJA 3WIGA 4AW2A 4O2ZA 5AMNA 1KE9A 5HE2A 3NR9A 3F3WA 3VUIA 3FZPA 2YWPA 4CT2A 4UMPA 3GU6A 3I5NA 3PIZA 3BE9A 2OH0E 1UU8A 3DAJA 3Q5IA 4G9RA 3VUGA 2CHLA 4DH1A 2XEZA 2W4KA 2I0HA 3F3UA 3BYOA 5DT4A 3OOMA 5FBOA 3WF6A 4DCAA 4DEBA 3HA8A 5FEEA 3CCNA 4IB5A 3W32A 4O7LA 3UPZA 2NRUA 2CN5A 4ZOGA 2FSMX 4MBIA 4FKRA 2JIIA 2HOGA 5G6VA 2OIDA 3R8VA 2YJSA 1F5QA 4II5A 4D55A 3EFKA 3R71A 2W1ZA 4AGUA 3E88A 4KD1A 4BC6A 2PPQA 5C1QB 4R1VA 2WB8A 1OVEA 4WKQA 2VO6A 2V22A 3QTIA 4LGHA 4H1MA 3UTOA 5LVPA 3ODYX 4RA4A 4TTHB 3VS0A 4AOJA 2FSOX 3PLAE 1QMZA 1Q62A 2PYWA 2BCJA 3NNUA 1FGKA 3P08A 4XHKB 3WF8A 4BI0A 2W96B 2J0MB 3GQIA 4GG7A 3NX8A 5DT0A 3RKBA 3DU8A 5L6OA 3CC6A 5KO1A 2XIKA 1ZOEA 3D5UA 1FPUA 2VO7A 3R1NA 4D2VA 4HNIA 4FVPA 2CGWA 2F7ZE 3C0GA 5E8YA 3UIMA 3V6SA 4IVCA 4APCA 1H24A 4Y83A 3CY2A 4QMPA 2GQGA 4D5KA 4QT1A 1F3MC 4FTOA 2GTNA 4GRBA 4EQCA 5FEDA 4M69A 5EHLA 1J7IA 5HGIA 1IG1A 3E87A 3FMMA 3MFTA 3PVBA 4O0TA 1OMWA 5HIDA 3RWQA 5KHWA 2NRYA 4IJPA 4AW1A 2I7QA 2C0TA 4FUXA 4F9AA 3AC4A 1Q4LA 1LPUA 3GB2A 4PPBA 4EC9A 4BI1A 5K4JA 3F3VA 4Y46A 5M53A 4DFLA 3A99A 3C50A 4O7YA 3KB7A 3N51A 2IVVA 2FA2A 1LUFA 3BHTA 3MPMA 4Q9SA 4IBMA 4DH7A 4FSMA 2VWVA 4U9AA 3SRVA 2XK4A 4ENYA 4AW5A 4FEWA 4FMQA 4GKIA 2JFMA 3UNJA 5DRDA 4DTAA 3VRZA 3BWFA 2R4BA 2C47A 1CTPE 5J7BA 3F69A 3QTUA 2XMYA 4FTAA 4IXPA 4CFXA 4YURA 3TDVA 2AC5A 3K3JA 4LYNA 2C3IB 3DBQA 1YXXA 5LXMA 1Q8UA 2UZWE 4BDBA 3WF9A 4O81A 1XQZA 2NO3A 3FBVA 4C34A 2OZOA 5KHXA 4XLIA 4QQJA 3LFCA 2ZDUA 1XH4A 3FE3A 4FKGA 4BGHA 3D5WA 5B7VA 3PWYA 1YOMA 3NUAA 3FKNA 4FKWA 4FV7A 2P3GX 4ZJIA 4I6HA 3ID6C 3QUDA 1VR2A 4YZMA 3HDNA 3W2CA 3G6HA 4EBVA 2QOOA 2OFVA 2XJ1A 3MFRA 3COHA 3VS4A 3FY2A 3NRMA 3ZM4A 3TUDA 3NUNA 4NCTA 4O83A 3PWDA 4RJ8A 3Q53A 2UW6A 3D5VA 2UZVA 2VWIA 3HNGA 3PPZA 4L9IA 5DE2A 4NIFB 4A06A 3E8CA 4UWYA 2J4ZA 4P2KA 2DYLA 4NK9A 4FVRA 2E9NA 1OECA 1WAKA 5CI7A 5I5ZA 2C5NA 3L8SA 3TJCA 4F7SA 5A4TA 3BGPA 3PVUA 4RVLA 5ANKA 4TWCA 4KBCA 4KSQA 1KOAA 3LJ2A 4EH2A 3C9WA 3VS7A 3LKMA 4E5BA 4Y72A 3W2OA 3A60A 4TT7A 2C3JA 3QQJA 2PVMA 5F94A 4CFFA 3BGQA 5EH0A 4EBWA 4O38A 4MKCA 1ZYCA 3RHXA 1JSUA 3LFSA 4O0UA 2W4OA 4D2RA 4RMZA 5J5SA 3FZ1A 5J1VA 1PXIA 2YIWA 2G15A 2Z7LA 3DJ5A 3FDNA 3GXLA 3LVPA 1AGWA 3FWQA 1WFCA 3EYGA 4NZWB 4ZP5A 4I23A 4YPDA 3ZO1A 5AM7A 5E8VA 3VW8A 1H1RA 3KRJA 3EQBA 2QD9A 2XBJA 5DWRA 1L3RE 2R0UA 3BV3A 3R6XA 1H8FA 4WNPA 1VYWA 4GYIA 4L3LA 1JNKA 4YC6A 5BMSA 4BDCA 2R3JA 4E4NA 3QXOA 1UVRA 3ZO3A 3V8WA 3GCQA 5IKWA 4FTRA 4N4SA 5EM6A 3G15A 3PXFA 3UVRA 3H9RA 3OOGA 4RC3A 3TN8A 4DFZE 2OJFE 2Z7RA 5CSXA 5FTQA 4XOZA 3R7IA 3CKWA 1OUKA 4FEQA 4L42A 4DE4A 2H6DA 4YO4A 4LGDA 1DM2A 4QP6A 4FT9A 3A7FA 4YTCA 3FPQA 3GCVA 3I0OA 2OGVA 3DFCB 4HYUA 5EYDA 2R3FA 2ITNA 3C13A 3IDBA 3O8PA 1UNLA 2J0JA 3G0EA 4IB3A 4TYIA 3ZS5A 4S34A 3LFFA 4FIIA 1AD5A 3NYXA 4YLJA 5IA5A 3C4FA 3GP0A 3R7VA 2WAJA 4AAAA 1SNXA 2BKKA 3SA0A 1ATPE 4BCKA 4FKQA 5T68A 4FL2A 5E8TA 2BDJA 3NYNA 3I6UA 5HI2A 3PJCA 4BDDA 1XH5A 4I92A 5EHYA 3RAHA 2XCKA 1FOTA 2A2AA 3TIYA 5IISA 4JOAA 1Q8TA 2YAKA 4A9UA 3BYSA 3FHIA 3LXPA 4LI5A 4RIWA 4EZ3A 2EB2A 4C62A 1QPEA 2ITXA 4YJSA 3P7CA 1NVSA 5L3AA 2VAGA 2RF9A 5G1XA 3KFAA 4GK3A 3H0YA 3RM7A 1YI4A 4R3CA 3WE8A 3GOPA 3WIKA 5BUJA 3BHHA 2UZNA 2R3OA 5LARA 3VUKA 3NIZA 1MRYA 5KZIA 2CCIA 2CLXA 3PSDA 4KKEA 2YABA 4RJ6A 3QQFA 4FV6A 3VQHA 4CV9A 5KUPA 5I9ZA 5CASA 3FZRA 1Z5MA 3B8RA 4JXFA 1RW8A 4NUSA 4YZCA 4L53A 4P7EA 2PTKA 1PJKA 1SVGA 4GEOA 4C35A 2J50A 4U42A 4RLKA 2C0OA 4FSZA 4LG4A 4NIFA 5DBXA 1KV1A 4JBPA 4U3YA 4WUAA 4B8MA 2ONLA 3RNYA 3PE1A 4RZVA 4NM3A 5LVLA 3WOWA 4IWQA 2VWXA 3GBZA 3A7JA 4GJ3A 4IAYA 4IM0A 1WVYA 1LP4A 3DBCA 2WOUA 3QX4A 2C4GA 5EK7A 4EHEA 4JDIA 1J91A 1U5RA 4MYGA 4NWMA 4U44A 3EH9A 4MNEB 4FE2A 5HG9A 4CNHA 4DITA 4O0YA 5EKOA 1Y8GA 4XNEA 3IO7A 4L45A 2HCKA 2CNVA 3P7BA 4WRSA 5L2SA 3KMMA 1Q5KA 4FSUA 4EOLA 4U5JA 3UNKA 1ZYLA 3OW4A 3ZRLA 4XG8A 5AIRA 1SM2A 1WBSA 5FDPA 3MVLA 3W10A 2GQSA 5KNJA 3ANQA 2BTSA 1Q8ZA 4IHPA 3BYVA 4ONAA 4TWOA 4QTEA 3R9RA 3DB6A 3TNQB 5AA9A 3V3VA 3O23A 4P90A 1OL6A 3EQPA 2NP8A 3W8QA 1PYXA 2XEYA 2VV9A 3PRFA 4XP0A 3QCXA 2YM5A 2IN6A 4AQCA 2B54A 5E91A 3EOCA 3GFWA 4M66A 3QTWA 5K9IA 1YKRA 3QD2B 5AUWA 3Q9ZA 1GNGA 1MUOA 4AOTA 4BCJA 3VS2A 4NTSA 4I94A 2XNBA 3BX5A 5GHVA 2EB3A 1A48A 2OK1A 5AUZA 3F9NA 3TT0A 3MESA 3DBFA 3QTQA 4FUYA 4AX8A 4PTCA 2XVDA 3FI2A 3IDPA 4HVGA 3LCDA 4L8MA 4FV4A 3HP5A 1M7NA 4A4OA 3BE2A 2OXXA 5HCXA 4IFGA 2XBAA 3PXZA 1FVRA 3IGOA 4I20A 4UBAA 1BI8A 4C7TA 2UZUE 3U4UA 4FTTA 3R8MA 4A4LA 3KCKA 4LQMA 3Q52A 4GL9A 2XP2A 2XKCA 5DEWA 4JDHA 2WQOA 3VHKA 4WSQA 3TXOA 1S9JA 3P0MA 3VS3A 3OG7A 2I0VA 4FVQA 4G16A 4FTCA 4LL5A 1JQHA 4UALA 3R1QA 4AP7A 5CT7A 1YI6A 5HNBA 3I4BA 4ERKA 4ASZA 3DKOA 4IAKA 4DFNA 3NUXA 5AEPA 4ASEA 3DXPA 2HY0A 4TRLA 4AXAA 2IVSA 4GFOA 4D58A 4KBAA 3UG2A 2QHMA 3WZKA 5IG1A 3MY5A 3LFBA 4PWNA 1XBBA 4RWLA 4X3FB 5HHWA 4TN6A 5IEVA 2CNQA 4S30A 5I9XA 4TYGA 2F49A 4BWKA 2ZV8A 4QMQA 4PF4A 4BCGA 3UC4A 2R3QA 1WBTA 3LHJA 2CKPA 4Q2AA 1OL7A 4FKOA 4QMTA 5KE0A 3RAIA 5AV4A 2HENA 2HZ0A 1J3HA 2HZIA 3DA6A 5JGAA 4KSPA 4AZWA 4YJRA 1YWVA 2XIXA 3Q2JA 2YWVA 4DGLC 1YOLA 4WBOA 4EEVA 2HW7A 4EK6A 2YM6A 4E6CA 4WHZA 3F82A 1ZYSA 4D9TA 4QNYA 4EK3A 4O7NA 1A9UA 3RHKA 4YNEA 4ZZNA 3F5GA 3FYKX 3HX4A 2V62A 4BCQA 4MXZA 3GU4A 4K6ZA 4ZLZA 3G90X 3KXHA 4F4PA 5AM6A 1R0PA 4BHNA 3QYWA 2WNTA 4V05A 1R3CA 2QQ7A 3ZO4A 4G3CA 3VBWA 3HKOA 4JNWA 4ZY5A 4V04A 2UW3A 3OBJA 3QRIA 2BZJA 2VWWA 4GU6A 2LAVA 5KMNA 4M12A 4KAOA 2RFNA 3GUBA 3POOA 4EOIA 4O7SA 3OY1A 4N57A 2OIBA 4D1ZA 3UP2A 2QHNA 2VWBA 3PE2A 4OT6A 4CKIA 4ZXTA 3UO5A 4PTGA 3A8WA 2BTRA 3IGGA 3GCPA 4O7WA 2UVXA 4QP3A 4KIKA 3WE4A 1M17A 3CQEA 4G3DA 4DH3A 4AS0A 5CQWA 4D4RA 2YFXA 3VULA 1U59A 4PY1A 4I1ZA 4UMRA 5JFWA 2WOTA 2PULA 2W0JA 2GTMA 1IAJA 4E5WA 3CD3A 3RZFA 3SX9A 3T3VA 3V5PA 4OTPA 5IQGA 2WIPA 1OPJA 2J0IA 3FQHA 4X2KA 2PMNX 3HZTA 3BQRA 4EH6A 2GSFA 2O5KA 3EQHA 5HG5A 3BU3A 3ATTA 2Y9QA 3P4KA 4KBKA 2VGOA 3CY3A 1HOWA 2Y6OA 3QQUA 5JGDA 3HV3A 4HVIA 4AW0A 4BL1A 5IQEA 2VTTA 3DZOA 3DAKA 4FKUA 4AUAA 3NVKI 2G01A 3BGZA 2PHKA 1B39A 4FNZA 4AT5A 3LE6A 3PIXA 4HPTE 4DEEA 4E93A 4K1BA 1Q97A 4YSJA 4JX3A 4FIFA 3PY1A 4EH7A 3COKA 2W05A 4EYMA 1WBOA 4D4SA 2W1GA 4ITJA 2E2BA 3L9LA 3IW5A 5CSHA 2XYNA 3SXSA 4TW9A 1OIRA 3QGYA 4IWOA 3LW0A 5CAUA 4BKJA 2IJMA 5B0XA 2F7XE 3W1FA 4O7ZA 1W8CA 3JYAA 4YGAA 3PXKA 5AP3A 3MY0A 3BKBA 1H1WA 2UZDA 4ZTLA 3ZHPC 3VVHA 4GFMA 4KA3A 2VRXA 5DN3A 1QPDA 3LOKA 3FKOA 5HQ0A 3TZ7A 3QLGA 4IAAA 3VO3A 2B55A 4GS6A 2UZOA 1H28A 3HVCA 4HVDA 2X39A 4YJUA 4MXOA 2AC3A 3LM5A 3S1HA 2PUNA 1CMKE 3DLSA 4RIYB 4EHGA 3DLZA 2PU8A 5HKMA 3LXLA 4W4YA 5DR9A 3VUTA 5AP0A 1O6KA 2C3KA 3D5XA 1QPCA 2V7OA 3A62A 5HD7A 3WF7A 5A4CA 5LCJA 3DKGA 3FY0A 3HAVA 4RFZA 3PSCA 2YISA 3EKNA 3GVUA 4F08A 5BX0A 5J87A 3K54A 3QD0A 3H0ZA 2VWZA 3D2IA 3R28A 4UMQA 4CTCA 4E3CA 5IH5A 4GKHA 2BIYA 4YU2A 2XNGA 1HCLA 3BIZA 1TQIA 5DYJA 4AFEA 4JQ7A 2BVAA 2R3GA 1Q24A 3OVVA 4M68A 2G2HA 5TR6A 2QONA 5J95A 4ZEGA 3RAWA 3TTIA 2V0DA 3HMNA 1PXPA 4FOBA 3UGCA 3NWWA 3ERKA 5LJJA 4R3PA 2O63A 3GCSA 5M51A 2PMLX 4DYMA 1PRYA 3RJCA 5HLWA 2ETKA 4CYJA 3ZFMA 3R21A 4XOYA 4ALVA 4FEVA 4BDJA 4ANSA 4L01A 4ANNA 5HO6A 4F70A 5HTCA 2O3PA 4RC2A 3R73A 4OTGA 2OWBA 3DXNA 3NUPA 4IZ7A 4IW0A 3U55A 5ANJA 4FZ6A 3V5QA 3FHRA 3LQ5A 3BEAA 3AMBA 2YCQA 3QL8A 3OUKA 3MVJA 1QCFA 2B53A 4C2WA 4F65A 4B6LA 4F9YA 3U6HA 4KS8A 1M2RA 4B4LA 4M67A 3ZTXA 1PKGA 2PE2A 1IRKA 3KCFA 5IQDA 2JDVA 2WMWA 5BYLA 3RZBA 4QQCA 3LMGA 4X6RA 3OHTA 5D41A 4F1OA 3SXFA 4KS7A 2WU6A 3QRUA 4ZS4A 5DA3A 3P78A 1X8BA 1PXJA 3ZUVA 2QNJA 4ZSGA 1U54B 3LAUA 4UWCA 4QMOA 2PUUA 3GU5A 2F7EE 1KE8A 3HV5A 4F6SA 1H01A 2GQRA 5AR8A 2IZUA 1CKJA 2P2IA 2W1CA 3I5ZA 3N4TA 5M4IA 5E4HA 3BI6A 4H39A 3ZXTA 4CTBA 1H0VA 3DGKA 2QOHA 1RDQE 1YDRE 2F2CB 1OPKA 1Y57A 1Z9XA 3OXIA 1ZWSA 3LFDA 3WYYA 4IB1A 3R7YA 1GIJA 1WZYA 2WTDA 5KBQA 3I79A 2I1MA 4JAJA 4I5CA 3ZONA 5A6NA 3FI3A 3W2QA 2EXEA 5CTPA 5IQCA 3IW6A 5DRBA 1B6CB 5M06A 5BVKA 5CEPA 3JVSA 2XJ0A 5D12A 2HZ4A 5BVNA 4FSYA 4DT9A 3ZEWA 3BPRA 4FV0A 3FMKA 3OCSA 3MB7A 4IJ9A 4KABA 4I5PA 4BCHA 3R1SA 4W4VA 1O6LA 2EWAA 3ORIA 4APPA 4ALUA 5IA4A 3E8DA 2JDTA 1BMKA 1M7QA 3QCYA 4RFMA 4E4XA 5A6OA 2JKMA 5EM7A 4W8DA 3LJ0A 2ITOA 5EQPA 3F3ZA 1Y91A 2EXMA 5HIBA 5AUYA 3WZUA 1ZYJA 4ZTNA 1ZXEA 4YC3A 3FZOA 3MY1A 4U6RA 5C8KA 4A9YA 4F9WA 5DHJA 4XV2A 5E8UA 2JKKA 3T3UA 4DFBA 4NT4A 1TKIA 3V5WA 5JH6A 3R00A 3GU8A 4FKIA 2OG8A 3CJFA 4GV1A 2C6IA 5AUTA 2WMBA 1ZYDA 4XG3A 3AC5A 5TO8A 2F9GA 3R63A 4JRNA 4WG4A 5D10A 1CKIA 3QAME 4IX6A 4DGOA 1REJA 3SHEA 4FZFB 4BBEA 4QP7A 2BFYA 2W06A 3FV8A 1Y6BA 4YTIA 5BVOA 2IVTA 3DK3A 4MK0A 2W5BA 2JC6A 4ACDA 4CYIA 4ARKA 4ANQA 5GINE 4ZZOA 4MEDA 2X6EA 4XV9A 2Z02A 3NGAA 4FSNA 2W9ZB 2WO6A 1FMKA 4AFJA 3PP1A 4YBKA 3AC2A 3EQGA 4FBXA 4XG2A 2JD5A 3KK8A 3UIXA 3W33A 4E73A 5J1WA 3PLSA 3GENA 5L2IA 3KK9A 4Y8DA 5KMLA 2VTSA 2VWUA 5M55A 2IVUA 2JKQA 4H3QA 1GZOA 3FZTA 4DEGA 5HX6A 3BBTB 3R9OA 3KU2A 4OTRA 2R3LA 4BDIA 4EJNA 4JX7A 3Q2MA 3RP9A 4JT3A 5KMKA 4Z7HA 3TUCA 2C30A 2JGZA 2OBJA 3B2WA 3R83A 2PVRA 3PXRA 3DPKA 4PX6A 3PPJA 3TZMA 5LMBA 5B2MA 4RVMA 1JBPE 3OW3A 4C58A 4CCBA 5CAVA 2QU6A 4IWPA 4MF0A 3LXNA 5AV0A 5C27A 2C6MA 4GFGA 4IX5A 2BRNA 4IX3A 4X7QA 3OWPA 2J9MA 4I6FA 4X2GA 1ZOGA 4OLIA 3RK7A 2VN9A 5KMMA 4R77A 3KRWA 3A7IA 5EW9A 2BIKB 5C9CA 4BCMA 4GK2A 3ORNA 4OAUC 3K5UA 2OI4X 5E8SA 3MB6A 4GMYA 2BILB 5EDPA 2Y7JA 2GNFA 4EHVA 2Y0AA 1KE7A 3ZRKA 3B8QA 2DS1A 2BRHA 2B52A 4RPVA 4F7NA 5FRIA 4V0GA 3MGYA 5HX8A 1IA9A 3N4UA 3T9TA 1IASA 1T45A 3CTHA 4ZIMA 3TZ8A 3DY7A 3EQRA 5FD2A 4PL4A 3BU6A 4O96A 5H2UA 4O0VA 5LMKA 1M52A 4U79A 2BUJA 4MXAA 2B9FA 5FTGA 4Y73A 3HYHA 5AUUA 5CZIA 2YIXA 3M1SA 3H10A 4KKGA 2IWIA 4J71A 4QMUA 4ACGA 4EK5A 4XBRA 3UQFA 4UZHA 1GAGA 4AN2A 2BAJA 3R02A 3ZZWA 2PUIA 4DINA 1PY5A 4ZSAA 1E1VA 1TQMA 1OKYA 2HYYA 2YN8A 4HYSA 1RQQA 1OZ1A 4C33A 2R3PA 2B9JA 1UKHA 2Z60A 3KXMA 4U43A 4WSYA 4FKVA 5CENA 4CD0A 3T8OA 2UUEA 4RC4A 3LCTA 4O21A 4ZLYA 4RIXB 3QHWA 4O91A 3FEGA 2ZOQA 2BAKA 3EYHA 2P55A 5EW3A 5JFXA 3LMIA 2W7XA 2VTNA 2BMCA 3PZEA 1GY3A 3MA6A 4P4CA 5DR2A 3GEQA 4IFCA 3PIYA 2QOBA 4FA2A 4ZSEA 4JBQA 3FSFA 5M56A 4QD6A 4X2FA 3HRBA 4JDKA 3VHEA 2XIRA 4R7HA 4EUUA 4XP3A 4DGNA 2YA9A 4D4YA 2J5EA 3C4XA 3EQCA 5CWZA 3EQIA 3HV4A 5HG7A 4Y5HA 4F0GA 2HXLA 3QQGA 4ORKA 3COMA 3TUBA 3ENMA 3U6JA 2XK8A 2WMVA 2QOQA 4N6YA 4C02A 3AT3A 1IAHA 1PMVA 4M0ZA 5AP5A 1Z57A 3NUYA 4FKLA 1GOLA 2PVLA 3I60A 5GIPE 4QTDA 4Z7GA 5HLNA 2FH9A 3AC3A 2UZBA 3LXKA 4ZTRA 1YXSA 4XJ0A 2C5OA 2RFEA 3N9XA 2A27A 5IQAA 2QKWB 3RPOA 2HAKA 2GHMA 2YCSA 3H3CA 5DH3A 5TOZA 5KCVA 2ZAZA 3RMFA 4DAWA 3U54A 2QOKA 4JR7A 5E9EA 2XNMA 4DC2A 1ZMUA 2X2KA 3EN4A 3ITZA 2W5HA 2E9PA 4NW6A 2GNLA 5EOLA 2VGPA 3QA8A 1A06A 3DTCA 3DTWA 2YEXA 5FGKA 1JSTA 3QQHA 5IQIA 3PJ3A 3QKMA 4NKSA 4Z16A 2JIVA 5M09A 3RNIA 4JI9A 4QYFA 5AIKA 4LOPA 4F7LA 1FQ1B 2WD1A 4HGSA 2PY3A 2ACXA 4U8ZA 5EYKA 4TY1A 4XG6A 1UKIA 3O71A 3PPKA 3EL7A 3U9NA 2OXDA 4LUEA 5J9YA 3E63A 3W2SA 2JBPA 3LZBA 4UV0A
chains in the Genus database with same CATH superfamily
1W2DA 4FV2A 4UWBA 1KWPA 1PMUA 5HCYA 3R7GA 4MXXA 3ZLWA 1P14A 3W55A 5A9UA 1HCKA 4OTHA 5HVKA 4BRXA 4IE9A 3MYGA 3ENHA 3JS2A 3R01A 5AR4A 3UP7A 3DNEA 1BKXA 2J90A 4CT1A 4JRVA 2VX3A 4RJ4A 4CVAA 5EDRA 4HZRA 2OU7A 5EQEA 3I7BA 5DGZA 3C7QA 1Q3WA 3OY3A 5TT7A 4OBQA 5BNJA 3D0EA 4MXCA 5CF6A 2YLEA 4MBJA 2PVFA 1YHWA 4TXCA 2CKOA 3QFVA 4AZSA 4QDVA 3TG1A 1LEWA 4H36A 4QMMA 5BV3A 3OEFX 5AJQA 3DOGA 3ACKA 3FSKA 3ORPA 3RINA 4F9CA 1XJDA 4QPSA 1URCA 4ALWA 5GZ8A 3ZFYA 2JEDA 3PA4A 4AZEA 3ULZA 4ITHA 3OTVA 4MXYA 3TNWA 5TKDA 4BZDA 5HNIX 1WBNA 1PXLA 3DT1A 1OKZA 4FTKA 3IECA 3GI3A 5FEQA 3QTSA 3U51A 2RIOA 1JAMA 2WMTA 3KRXA 4RQKA 4EOKA 3S3IA 1PXNA 4WNOA 4AA4A 3HRCA 4KRCA 4H05A 3W0MA 2DUVA 2W1EA 4U0IA 3S2PA 4EH8A 2VNYA 3ALNA 3C4EA 1GZNA 3UOLA 3WILA 4E1ZA 2BRGA 2X4ZA 3EMGA 3ETAA 2BFXA 3PVWA 3ZLSA 2IPXA 2WGJA 1OGUA 3ZO2A 4ZAUA 4X3JA 2QC6A 5HICA 5BUIA 5KMOA 3F2RA 3C0IA 3FC1X 4ASDA 1APME 1ZZ2A 2JIUA 3FJQE 3DAEA 3L9NA 4JR3A 4X6QC 2JLDA 2ZMCA 3SQQA 1UWHA 3UMWA 4WIHA 1MQBA 5FM3A 3G6GA 4PDOA 5JK3A 4G5PA 2XNNA 3LJ1A 3UIBA 3KN5A 3O0GA 1WMKA 4DHZA 2G1TA 3FC2A 3CPCA 1TVOA 4EOOA 3M2WA 5CAOA 2OW3A 3GU7A 3PVGA 3NW5A 4V01A 5AP4A 2RG6A 3F88A 4HGTA 4IVBA 3Q6UA 4FIGA 5CQUA 4E4MA 4TL0A 5HVYA 5GZAA 4LMNA 4PMSA 4JLCA 4LFIA 3OD6X 1XO2B 2IZTA 4DBNA 1RJBA 2RKUA 5J5TA 2XKEA 4F6WA 5IUGA 5A4QA 4EORA 2BR1A 4USDA 5CXZA 2B9IA 4BDEA 4CRSA 3KY2A 4BJJA 1OB3A 1LEZA 3OXTA 1U46A 3MW1A 3CKXA 2BDFA 2HWPA 4FIHA 4IC7A 1XH8A 4O2PA 1S9IA 4UXQA 2HW6A 3QU0A 4FZDB 4QQ5A 5K0XA 1KE6A 5CEOA 1OBGA 1KSWA 2QODA 2ONLC 3COIA 3Q4UA 2RFDA 3V5JA 2CNUA 5I3RA 1J1CA 4U41A 3P79A 4PPAA 2XK3A 2C6EA 3EN7A 4YBJA 4TWNA 4JIAA 4UMTA 5HE3A 4UXLA 2VO3A 2KTYA 3FXXA 4CSVA 5C4LA 5IUHA 2ZDTA 4O27B 4CG9A 3KVXA 3I1AA 4EC8A 3PJ8A 3OP5A 1W2CA 3TTJA 3VNTA 3PFQA 3ZXZA 3IW4A 4FTIA 5AP7A 3TNIA 3UJGA 3F2AA 3TNHA 3W18A 3BEGA 4C2VA 2VTHA 4J99A 3QYZA 4K0YA 5E92A 3V51A 3A4OX 3C4CA 2ITUA 2O8YA 3R04A 4C59A 1H1PA 2A1AB 2FO0A 4GVAA 5AV3A 4A9SA 4O0SA 5CU3A 4ACHA 3E8EA 4G17A 4E7WA 4M0YA 2XH5A 2V55A 2VTLA 3ZLXA 3L9MA 4TZRA 4TWPA 2IW9A 3IW7A 4NFNA 1SVHA 1W82A 2WTCA 2X9EA 3QZHA 4QPAA 5E1EA 3WI6A 5AV2A 3FMJA 4QEBA 4BB4A 4CZTA 2BROA 3N4VA 4BGGA 2EXCX 2B7AA 2JFLA 5CS6A 3OUNB 5FBNC 4C57A 5CAQA 4JG8A 4FTMA 1YDSE 3Q32A 5F95A 5J79A 1J7UA 4AA0A 2WMAA 4HZSA 3BLRA 3MH0A 3OCTA 3ELJA 2XK9A 2YM7A 2PVJA 3R2BA 3OBGA 2XUUA 5HO7A 4YJOA 5M07A 3AOXA 4C3PA 3QF9A 3R9HA 2WXVA 5HE0A 2UW9A 4XCUA 5BVEA 4ZK5A 3THBA 2WMRA 3HMMA 4HVSA 4QMZA 2QOCA 3FI4A 5DPVA 3KMWA 4BCPA 3D14A 5KKRC 3ODZX 5A54A 2BDWA 3P86A 5DG5A 2I0EA 2QURA 3MH3A 3PA5A 3DS6A 4MD9E 4CLJA 2FSLX 3ZM9A 3MV5A 3BYMA 2ZVAA 3E5AA 4FTUA 2QLQA 5JFSA 4M8TA 4EH5A 5CY3A 3A2CA 4BKZA 2CKQA 4MHAA 4XRLA 5K0KA 4ZSJA 2XKDA 3R7UA 2C6TA 4U80A 3UPXA 2WEVA 2ZM3A 3BWJA 4EK4A 3VC4A 2QG7A 3F66A 1KE5A 1H00A 4G2FA 4ANMA 4WBBB 5K3YA 2CN8A 4TYHB 4OBOA 4C4JA 4EK8A 4O1OA 5CSVA 5JZNA 4DBXA 4H3PA 4AT3A 3TV6A 2C6OA 3ZRMA 4BI2A 1YHVA 4RFYA 3LIJA 4QYGA 3SKCA 4BBFA 3R8ZA 2YIYA 4G6LA 4M3QA 2C5XA 3RK9A 2Z7QA 4FIEA 4B9DA 4DEHA 2CCHA 3MFSA 4BDGA 3S0OA 4FNWA 4MNEA 1Q41A 4QOXA 4WNKA 4CKRA 2GS2A 4C36A 4G6NA 3QTRA 4R7BA 4AXFA 3AMYA 2PE0A 4FNYA 1JLUE 4R3RA 4E6DA 5L6PA 3AD4A 1R39A 3MVHA 1YVJA 3P5KA 5AV1A 2VZ6A 4DH8A 2Q0NA 3P23A 4TNBA 4GJ2A 3A7HA 3A4PA 3TCPA 4Q9ZA 1M2PA 3NFGB 4OTWA 4QPMA 5IDNA 4UY9A 4GT3A 4W4XA 4ID7A 1CSNA 4FSQA 4F6UA 2YZLA 5CSWA 4HOKA 1YOJA 2PZ5A 1STCE 2YDJA 5HO8A 2BRBA 2QR7A 3IONA 3O8UA 3OROA 4JJRA 4C4HA 4D9UA 3BELA 5FP6A 5L2WA 4UYAA 1XBCA 5GJFA 3TKUA 4DEIA 4FT3A 4XG9A 4ZTMA 2GU8A 4KIOA 3DV3A 4N70A 5AP6A 3SC1A 3HDMA 5CVGA 3D15A 4F9BA 3RPVA 4AGDA 2CDZA 4BCIA 1U4DA 2Y4IC 4YSMA 2EU9A 4PP9A 3HMIA 3NNVA 5IA0A 4GUEA 1YW2A 4QNAA 4NSTA 4A7CA 4DGGA 4WO5A 4E8AA 5H3QA 5LCKA 3FLWA 4U7ZA 3VIDA 3PUFC 4ZTQA 4DEDA 5JFVA 5CU0A 2OFUA 3TIZA 1BL7A 3VUMA 5AADA 3Q9XA 4K9YA 5IQBA 4PL3A 2ZMDA 3QKKA 4IH8A 1Y6AA 2J6MA 5HESA 4FG7A 4NKAA 4QMVA 4EH9A 5LVOA 3KGAA 4FK3A 5C8NA 1TQPA 5CF4A 1GJOA 3DK7A 2YCFA 3VBTA 1XBAA 3D94A 2CJMA 2LGCA 1W7HA 1YWNA 3BLQA 2YIRA 5BVDA 3LFAA 4I21A 4YHTA 1MRUA 3OZ6A 5FTOA 3WF5A 4HPUE 5CEQA 5EQYA 4BY9E 3BQCA 3NYOA 3KXZA 4IM3A 4UZDA 5GZ9A 3WYXA 4FTLA 3Q9YA 4FYNA 4RT7A 5E90A 3R8LA 3L8PA 1GZ8A 3TV7A 4DT8A 2BALA 2VO0A 4U40A 5CEMA 5BUEA 4X3FA 5CXHA 3ZFXA 2XAOA 4R78A 4PMMA 3MTLA 2P2HA 4J8MA 4XEYA 2ITWA 1WCCA 3P1AA 5LMAA 1JKLA 2XARA 5BVWA 4CZYB 2DQ7X 4YUQA 2GHGA 2X7FA 3W0SA 3T9IA 2BAQA 3KXNA 3IS5A 3QTZA 1YQJA 3AKJA 3KC3A 4FEXA 5A46A 3W0PA 3NVMB 3F5PA 4KRDA 1O6YA 4HYIA 4G31A 4TYHA 3O17A 5ANEA 2GFSA 4ITIA 3QUPA 4FIJA 3EN6A 4LRMA 4OAVB 2A19B 3VBVA 3EWHA 4G34A 2XM9A 4CMOA 4J95A 2IF8A 2OH4A 4K11A 4JAIA 5D11A 4NL0A 4FT5A 3W8LA 4YJVA 4RRVA 3AC1A 2PK9A 3E8NA 2OF4A 4CKJA 2UV2A 4NFMA 4D0WA 2E9VA 2FVDA 5KX8A 2PUPA 5HTIA 2OSCA 2R7IA 3UQCA 1XR1A 4W8EA 3AT2A 2GNHA 3NPCA 4D2SA 3VBQA 4RLLA 5ACBC 3Q9WA 2PL0A 4XX9A 3MFUA 4GG5A 4RX5A 4QRCA 1EH4A 4J98A 4LOOA 2VTOA 4DTKA 4FL3A 1W83A 1KV2A 4KIQA 1ZRZA 3FLSA 4BYJA 2X2MA 2FUMA 1JWHA 3SDJA 3NLBA 4HNFA 2WTWA 3FYJX 2C69A 4I22A 4QTBA 2H34A 4BDHA 4I0RA 3C5UA 2QKRA 3LCSA 4PMTA 5HTBA 2G2IA 5IA2A 1GIIA 4EUTA 1IA8A 2W1DA 2XYUA 4CQEA 4CMTA 3BL9A 1OM1A 2HWOA 3ORMA 1NVRA 5E1SA 3SW7A 5H8EA 3ZZEA 3LCKA 4D1XA 3I6WA 2G2FA 4AZTA 2OLCA 3W16A 1P5EA 4MTAA 4EONA 4G6OA 5K4IA 4EKLA 3BL7A 3MIYA 4I3ZA 2XAMA 3MPTA 4MD7E 1REKA 1QL6A 4IEBA 5GJDA 2WIHA 4CLIA 4DFXE 2J2IB 1OL5A 2J0KA 2CGVA 4L7FA 4ZMFA 3RTPA 4S33A 1ZARA 4ANBA 1ZZLA 3FLQA 3VWAA 3VS6A 4I6QA 3VJNA 4IZYA 3AC8A 4J97A 1URWA 5FLFA 3VF8A 5L8LA 2A98A 4A9RA 3ZC5A 4JDJA 4M7IA 4CFUA 4H1JA 2I6LA 1P2AA 2VTJA 1G8AA 4BTMA 3JPVA 4MWIA 2IZRA 5M4UA 2QOLA 5A3XA 4C3RA 3HMOA 2C5YA 2VTMA 2OKRA 2X7GA 3NUSA 4NH1A 4XBUA 3NEWA 3UO4A 4DF3A 1NXKA 1MRVA 1UU3A 4AE9A 1YXTA 3TZ9A 4BN1A 4XMOA 4WRGA 3JUHA 4O0RA 4HVHA 3HUBA 3UZPA 3VF9A 3DDQA 1Q61A 4W9WA 4GT5A 4R6VA 3U4WA 2YERA 4UN0C 4O82A 3RGFA 3EB0A 4IVAA 5HU3A 3FMEA 4EHZA 1Q99A 1P4OA 4F1TA 5E8XA 4C38A 1W98A 4OUCA 3MI9A 3FLNC 3QQKA 1IR3A 4G9CA 4J52A 1UU9A 3R22A 4L68A 4MQ1A 4E4LA 5AX3A 3DNDA 3NNWA 5LOHA 4L44A 2RGPA 5JMSA 4RIYA 3MH1A 3ZBFA 2JDOA 3CEKA 2R0IA 4IAZA 5EYCA 2XIYA 5K5XA 3FL4A 2P0CA 5T3QA 4LUDA 4EI4A 5HORA 2YDIA 2Z8CA 2CLQA 3UQGA 3ZC6A 3NCZA 4NTTA 4U97A 3DXQA 3KN6A 4R5YA 5D7AA 3GNIB 5E8WA 3V8SA 5IDPA 5C4KA 1IEPA 2YLFA 5FP5A 3JY0A 4DHFA 5I9YA 3RPRA 2CGXA 1L8TA 2XS0A 4BVUA 2XK7A 4FG8A 3PTGA 4I5HA 3ORXA 4BHZA 1XHAA 3FI8A 5AP1A 3HEGA 2YIQA 5HLPA 3K5VA 4AZVA 3HMPA 4JBOA 5JN2A 2W1HA 2BPMA 2O2UA 2OJ9A 1KOBA 3ZU7A 2WQEA 2BHHA 4ZMEA 3I7CA 4AACA 1JVPP 3F5UA 3G33A 4X2JA 1E9HA 3EL8A 3SG8A 2HZNA 1TZDA 3QC4A 3UG1A 4F0IA 4RIOA 1CM8A 5DI1A 4BWPA 1ZLTA 4K33A 5AR2A 2UW4A 5CZHA 1PXKA 4BKYA 2R3NA 5HD4A 4BFMA 2QU5A 3KVWA 4M69B 4QTAA 4KINA 2X81A 1G5SA 4ERWA 5J7HA 4O6LA 4PNIA 2PVNA 3QUEA 3OFMA 4EWQA 3GQLA 3D7TB 4J53A 3BHVA 3KL8A 1YI3A 3ZEPA 4EOSA 4LDTA 4O86A 1NW1A 3AXWA 2JAVA 2W4JA 3PXQA 3CP9A 1V0BA 3E7OA 4WNMA 5HE1A 2VX0A 3VS5A 5DVRA 2WTKC 4G1WA 4FI1A 4ZTSA 5CF5A 4IACA 2V7AA 2XM8A 2HK5A 4PTEA 2WQNA 3D4QA 3Q3BA 4AGCA 3QRKA 4FZAB 3SRVB 1W0XC 5EOBA 4J1RA 3NSZA 5FUTA 4U81A 4UX9A 2O0UA 3SG9A 2ERZE 4P5ZA 3C4ZA 3W2RA 4DTBA 3DZQA 3CXWA 4G5JA 4XS2A 2ITVA 5IA1A 4FTJA 3EIDA 1U54A 3AG9A 3GCUA 5ETFA 1PHKA 3FXWA 3QKLA 5IF1A 4FV5A 1SZMA 5LQFA 3L9PA 3QD4A 4MNFA 2PZIA 4JVGA 4WT6A 4Q5EA 5CEIA 2ITYA 1PMNA 4CRLA 5FWKK 4USFA 3PG1A 3PY3A 2WMXA 1XWSA 3DBDA 3NIEA 3P9JA 1ERKA 5JEBA 2Z2WA 4EOPA 2WMSA 4EOJA 3AD6A 1VJYA 3OCBA 3F2NA 1I09A 3II5A 2IW6A 3E3PA 4FSRA 4GVJA 4OW8A 3UOKA 4GT4A 1WVWA 4NEUA 3HAMA 4RQVA 4DG2E 4GYGA 4RX9A 4PQNA 5DR6A 5C03A 5I3OA 2FSTX 3RPYA 4F1MA 3L8XA 3VAPA 3UBDA 4F09A 3TDWA 2PZRA 2XNPA 3BZ3A 1E1XA 3CLYA 4YZ9A 3U87A 4EH3A 3RCDA 2UW0A 4EOQA 4Z9LA 5JRSA 3AD5A 3A7GA 5LMKC 5AUXA 1YHSA 1Q8WA 4AU8A 3CR0A 4F64A 4QYHA 3W0NA 3FPMA 2FGIA 3QWKA 4GW8A 2H9VA 3MA3A 3PJ1A 4M14A 3MWUA 3CD8A 3VUHA 4JQEA 4NJ3A 3NUUA 3LMHA 5GNKA 2R3HA 2OICA 4JG6A 1VLRA 3S95A 3BYUA 4OTFA 4ASXA 4GUBA 1H08A 4DG3E 4IANA 4FV3A 2R3IA 3O7LB 1R1WA 3SAYA 2VTAA 3ZMMA 3O51A 3UO6A 3KF4A 4BWXA 3W0RA 3PYYA 4D1SA 5FXRA 4PPCA 1FBNA 2OXYA 5DIAA 1YRPA 1ZOHA 4Y95A 4O0WA 3G9LX 4LGGA 3DJ6A 5CAPA 2YM3A 2QO2A 3KIOC 4FKPA 3LFEA 2XB7A 3MVMA 4GU9A 3CGOA 3Q4CA 1Q3DA 4PDPA 4BTKA 2J5FA 3EN5A 2YITA 4LL0A 4QMYA 4DCEA 2BKZA 4ZTHA 5B2LA 2ERKA 3WZEA 4IAIA 1DS5A 3E62A 4EZ7A 1BLXA 3CQWA 3HV7A 4E6AA 4EYJA 2PZYA 1ZAOA 3ZOSA 3EZRA 4S2ZA 4YJTA 4DA5A 4U45A 4L3JA 5IU2A 2WELA 3D7TA 3JY9A 2W1FA 4UB7A 3A61A 3PY0A 4GH2A 2VX1A 4LV8A 2WQMA 5EM5A 4GIIA 3TKIA 4HCTA 4WD5A 4C4EA 1XH7A 4BIDA 1UWJA 3R0TA 3TKHA 3LLAA 3F6XA 4RWJA 1BYGA 3GT8A 4OBPA 3VS1A 1JKSA 4RG0A 5IQFA 4O22A 4FICA 3KXGA 4D0XA 3C51A 3LFNA 1UA2A 4YO6A 5L8JA 3PA3A 1OITA 2YM4A 5EI2A 4FSWA 5AUVA 3CSVA 2W5AA 1WVXA 4YLLA 2WMQA 4AF3A 3WBLA 2ZM4A 4QYYA 4CQGA 3QGWA 5CNNA 2UW7A 3KMUA 3QA0A 4EZ5A 2W1IA 4RIWB 3RI1A 3UZRA 3MBLA 4J7BA 4AA5A 4FL1A 4NCTC 2GHLA 4TNDA 3ORTA 3QHRA 4QMSA 4ACMA 4C8BA 3UZTA 5C8MA 1U5QA 1YXVA 3IOPA 3TI1A 3ZH8A 3ATSA 2P4IA 3VN9A 2XANA 5D9HA 3IOKA 2XF0A 4M97A 4FKJA 3DB8A 4AT4A 5IQHA 3EKKA 4TPTA 4BIEA 2PVKA 1DI9A 1K2PA 3A8XA 5BMMA 3ZBXA 1JKTA 4R8QA 3G5DA 5AFVA 1R78A 3VBYA 4FEUA 3ORZA 2ESMA 3DKFA 3PSBA 5FXQA 4EWHA 4BBMA 4WG5A 4K18A 4CV8A 5JKGA 4YP8A 1BUHA 2PSQA 3Q5ZA 4XP2A 1I44A 3BLHA 4L3PA 3ANRA 1H27A 2RSVA 1JPAA 2Y4PA 3BHYA 3HUCA 2X8IA 1G3NA 3OXZA 4G3FA 3UYTA 3CQUA 3AQVA 2QO7A 2CPKE 3R7OA 3EN9A 4ZLOA 3GGFA 1ZY5A 2QOIA 2WTIA 4AGWA 5IUIA 4XRJA 4OT5A 4QMLA 4YTFA 4IADA 4I24A 4RIXA 4RJ7A 3MS9A 5H8BA 4ZY6A 2HY81 4YC8A 4YZBA 4FV1A 2XRWA 2R2PA 1DI8A 4G3GA 3UOJA 5IZFA 2J0LA 3DKCA 4XV3A 3RWPA 3ZSGA 5IH6A 2NPQA 4ZSLA 2WZJA 3CTJA 2B0QA 1K9AA 4YNOA 5E8ZA 1ND4A 3IW8A 3SD0A 4RBLA 2IG7A 2WTJA 3EZVA 3DDPA 4M84A 3EFLA 4IB0A 3E3BX 2QI8A 1Q8YA 3FL5A 2PZPA 4H58A 2WPAA 4KIPA 3I0QA 5TF9A 3C1XA 3MN3A 5CF8A 5HG8A 2WFYA 1ZY4A 3PP0A 4USEA 1OKWA 5HBHA 4MCVA 5DMZA 1JSVA 5GJGA 3RCJA 2FB8A 5A4LA 4ENXA 4I0SA 5BVFA 2QO9A 1V1KA 4L6QA 4QO9A 4D5HA 3Q60A 5A4EA 4TYJA 2ETRA 3UDBA 3O7LD 3FMLA 4BDFA 3Q96A 3QTXA 4H3BA 1KUTA 3MIAA 3SOAA 2XNEA 3TL8A 5DT3A 3ZYAA 5IA3A 1PXOA 2UZEA 5AWMA 3TWJA 5M4CA 5CU6A 4KNBA 3LCOA 3QZIA 1SVEA 2PMOX 2X9FA 5EKNA 1WBPA 4C3FA 3ROYA 4P5QA 2G9XA 2RG5A 4YLKA 3H30A 1CDKA 5KKRB 3TNPC 2F57A 2A4LA 4NW5A 3AKLA 4DH5A 2C6DA 2BZIB 4D2PA 2C1BA 3V6RA 3JR1A 2Q83A 1W84A 3LFQA 4KUJA 4XUFA 4O84A 4L7SA 2Y6MA 3ORLA 4CCUA 4RZWA 5L8KA 2YACA 3DJ7A 3IG7A 4C61A 3H9OA 5JZJA 4L43A 2JAMA 2W9FB 4DLJA 4J96A 4B99A 4R7IA 5H8GA 5HCZA 5J9LA 4EJ7A 2GS6A 5CVHA 2JDSA 3VRYA 4MBLA 5CVFA 3IPHA 2WEIA 4IWDA 4Y5QA 3R8UA 3UYSA 4PL5A 4MVFA 1FVVA 2R7BA 3QZGA 2Z7SA 3R30A 3NDMA 3SXRA 1PF8A 5CALA 4AN3A 1OL2A 3KRRA 3R9DA 3QXPA 4BDKA 4PV0A 4BZOA 3ZCLA 4DN5A 3DK6A 1WBVA 3IQ7A 4EKKA 5AAEA 3VQUA 2VNWA 3R2YA 4X21A 5KMJA 2XK6A 2WHBA 2FYSA 1LR4A 1H1QA 3P7AA 4LRKA 5AR3A 2GNIA 3F7ZA 5BYYA 5DOSA 2H8HA 2GMXA 3AGLA 2VU3A 3NAYA 4FK6A 5CYIA 5FDXA 5KZ0A 2X4FA 3RM6A 1OBDA 2HIWA 2UW8A 4RX8A 1H0WA 5JQ5A 3HLLA 5I9WA 5ACKA 5AR7A 5LVNA 1B38A 4L46A 4RVTA 5EG3A 4A9TA 4L00A 4CGAA 3DBEA 3NAXA 3SOCA 2YJRA 2C3LA 2DWBA 1M2QA 2UZLA 1BI7A 3BV2A 3GC0A 4HYHA 2BZHB 2R64A 3WZJA 4XG7A 4WG3A 4I6BA 1YXUA 2VTRA 3HRFA 4JL9A 1OIQA 2B1PA 2YCRA 2XJ2A 3KF7A 4JS8A 4QP9A 4QMXA 1H25A 3KREA 2OJIA 1RE8A 2YAAA 2E9UA 5CEKA 3UC3A 5H9BA 3O8TA 1NVQA 5CU4A 5AR5A 3RVGA 3CE3A 4AE6A 4WUNA 2Y4IB 4KIKB 5ICPA 3C5IA 2OO8X 3C4WA 2BRMA 3JVRA 3EFJA 3GOKA 3CPBA 4YMJA 1F0QA 4Y85A 4KB8A 3ROCA 2X0GA 1PKDA 1T46A 2ITQA 2P33A 5T6KA 4ZY4A 3QD3A 3EQDA 5I9VA 2C5VA 3FMNA 2AQXA 3HL7A 5L2TA 5ANIA 2RL5A 1H4LA 5B2KA 2QVSE 1XH6A 5EI6A 2IO6A 3OTUA 3G51A 2UVZA 1G8KA 4CMUA 4JBVA 4FC0A 2GDOA 3CS9A 4LMUA 2X6DA 2PMIA 3FUPA 4C4FA 5AA8A 4RWIA 2UVYA 2JKOA 3QX2A 2X1NA 4ZS0A 5L2QA 4HW7A 4Z55A 2GS7A 4FZ7A 4O4EA 4QP1A 4FKTA 3I81A 4YHFA 4I5MA 2JITA 3QRJA 5D7VA 2RFSA 4YTHA 3BHUA 4B7TA 3ZDIA 3RALA 5EI8A 5EM8A 5M4FA 4X2NA 2BHEA 4OTQA 3NZ0A 4AOIA 4O1PA 5C01A 3PXYA 5M44A 3SGCA 3GC7A 3AGMA 5L6WL 3OMVA 3E92A 4DG0E 4PRJA 3KKVA 4F99A 4NM0A 4TKSA 5DFPA 3R8PA 4FF8A 4YZNA 5I9UA 4FGBA 5ANGA 2VTPA 3NMUF 4CEGA 1O9UA 1NA7A 2J7TA 3MJ1A 3IKAA 2C6LA 1G8SA 1J7LA 3Q4ZA 4WA9A 5HBEA 1OPLA 2ZJWA 3QZFA 2ZV9A 4FODA 2X0OA 2XNOA 1FMOE 3G2FA 3HGKA 3NW7A 5AAGA 1NY3A 2PE1A 3D7ZA 2YM8A 4IVDA 2GNGA 3OWKA 3TACA 2UW5A 5BQ0A 4MWHA 4W4WA 3SVVA 2YZAA 3ACJA 4GIHA 3D83A 5C26A 5D1JA 1MP8A 5J8IA 3UODA 4IIRA 3M42A 4LRJA 4RVKA 2J51A 3UVPA 2GNJA 3SLSA 4YJPA 3ZDUA 3ORKA 3FQEA 5K5NA 4HGEA 3KRLA 3S4QA 3UVQA 4GSBA 3OT8A 3V5TA 3BRBA 3MPAA 4QP2A 2R3RA 4F63A 3QCQA 3C0HA 1QPJA 4M15A 3R9NA 5HOAA 3UNZA 4C4GA 3S00A 4F7JA 2YDKA 4MD8E 3ZSIA 5HU9A 2OJJA 3E7VA 3POZA 4RJ5A 3NS9A 5EFQA 4E5AX 4YJQA 4NYEA 1WBWA 3AT4A 5HIEA 2ZFYA 4XYFA 4YHJA 4DLIA 3F61A 4CFVA 3OS3A 3DQXA 3HP2A 3F7WA 5CT0A 4PNKA 2B9HA 1ZMVA 2A0CX 4ZJVA 1R0EA 4GCJA 5ETIA 4O6EA 2EVAA 2H96A 4RJ3A 3TV4A 2XIZA 3AMAA 5AP2A 4EL9A 3U6IA 4JIKA 4U3ZA 4I4EA 4AG8A 1UNHA 2ITZA 5DEYA 3REPA 5F4NA 4IC8A 2OF2A 4HJOA 4DDIA 2WQBA 1MQ4A 1H26A 2QG5A 2OZAB 2Q0BA 5IMEA 4MF1A 4XLVA 5HZNA 4BGQA 4E6QA 5LWNA 4R1YA 4CFMA 4YZDA 3R7EA 3Q6WA 5EDQA 4CFWA 3VW6A 3V5LA 4OR5A 4LV5A 4CFNA 3EHAA 3W2PA 3CIKA 4FNXA 3QWJA 3RAKA 5F9EA 3TEIA 4A07A 5BPYA 3L8VA 4ACCA 2AUHA 3ALOA 4I4FA 4M13A 4AZFA 4EH4A 2WMUA 1M14A 3FXZA 1J1BA 2WU7A 3FKLA 2R9SA 4FGRA 3KULB 3ZSHA 2ITPA 4FX3A 4N0SA 3FLZA 3ULIA 4NU1A 2EUFB 1YWRA 2X8DA 3Q4TA 1FGIA 4X3FC 1OKVA 5ANOA 4BYIA 1JKKA 4C0TA 3MJ2A 2R5TA 3TJDA 2R3MA 4ZZMA 5TE0A 4UMUA 5I4NA 4NM5A 2ZB0A 3OC1A 1ZMWA 4MX9A 1AQ1A 3FLYA 1JOWB 2PVHA 3KXXA 4XH6A 5IMXA 3IDCA 3LLTA 3SV0A 4EOMA 2JBOA 4AN9A 4D2TA 2NNWB 1PYEA 1VYZA 3V04A 4Z3VA 4X0MA 5JSMA 3WARA 2XCHA 4K77A 4FYOA 4JQ8A 3Q04A 4XG4A 4W9XA 3UMXA 4MUQA 4FV9A 1SMHA 3QRTA 4BCOA 5LWMA 4QP8A 4PUZA 4RX7A 2I40A 1H07A 1PXMA 3MDYA 2Y8OA 1V0OA 4IDTA 4DFYA 2X8EA 4S31A 3EJ1A 4IQ6A 4PDSA 3QC9A 2BZKB 3GC9A 2QOFA 1VZOA 2XRUA 3PG3A 4FOCA