3NX8A

Human camp dependent protein kinase in complex with phenol
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDINHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Experimental and computational active site mapping as a starting point to fragment-based lead discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 106
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nx8A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nx8A02
4M68A 4OTGA 2YM7A 4FNYA 2Z7LA 1OVEA 1FINA 4PL3A 4F7LA 3IDPA 4XV3A 4D9TA 2UW8A 2VX0A 3LAUA 5CX9A 4ANNA 5IA4A 2W9ZB 5KBRA 3SVVA 3EQCA 1J1CA 3A7FA 4QNAA 2UZUE 3RCDA 4D28A 3R7YA 3KFAA 4FI1A 4KRCA 3ZXTA 4BZNA 3GFEA 3HA6A 1ND4A 2WMUA 4AZEA 4TYGA 2XJ1A 4IM0A 3Q04A 4WUNA 3PXYA 4IQ6A 4E4XA 5T68A 2ZV8A 4MQ2A 2GNLA 5KUPA 1W82A 4E1ZA 3BLQA 4U3YA 2UW6A 2ZB1A 4FKVA 4RIXA 4AA4A 1O6YA 4AGWA 1P4FA 4YJQA 3H0ZA 3NLBA 3NYOA 3OY1A 4K33A 4L3JA 4QPMA 5FXSA 4B99A 5C26A 3LQ8A 2GDOA 5CANA 4CMOA 2A27A 2UW0A 4EZ3A 2VTIA 3KK8A 3ETAA 3KXXA 3R73A 4LL0A 3GU4A 5EHYA 4FODA 5FD2A 4YO4A 4ORKA 4J53A 4DGOA 4J95A 4K8AA 4R77A 3V5QA 3CGOA 3G33A 2H6DA 4EUUA 3CQEA 1BUHA 3R8ZA 2C68A 2OJFE 3G2FA 4OTDA 2CGXA 4ZLZA 2CGVA 3ORZA 1OUYA 4OW8A 5AA9A 3R8UA 4I20A 5HESA 4MXAA 3OCSA 2W96B 3QL8A 2ITWA 5HBEA 1WFCA 5AA8A 4IVBA 2BDJA 4HZSA 3QTSA 4XOYA 4BIEA 2JDTA 3E8CA 1URCA 4UWCA 3QHRA 5DRDA 3DXPA 4UMTA 4O38A 4QTDA 2FGIA 2FYSA 3DV3A 3ODYX 2CNQA 2Z02A 4BIBA 4G3FA 5HX6A 4AZFA 2FO0A 5TT7A 3FMKA 3C9WA 2R9SA 1SYKA 1XBCA 2ETKA 3D7ZA 4I0RA 4YNOA 4HGEA 4TNBA 5ETCA 3QGYA 3ZC6A 4FSQA 5DLSA 2JKOA 3JXWA 3PPJA 1GZNA 4EC9A 3FZSA 4BHZA 4EC8A 2VNWA 3BV3A 3QTXA 5FUTA 2R3JA 5C27A 3CXWA 3UC3A 3QBNA 1KE7A 3R7GA 4YZBA 4EOIA 5IQGA 2ERZE 3NPCA 3DQXA 2YWVA 3KEXA 5AP0A 3VUKA 2YHVA 3B8RA 1ZYLA 3U9CA 4IX6A 5HLWA 2WMQA 2ZMDA 4O7YA 4FICA 4QD6A 3FLZA 2PZ5A 2JKMA 3EN4A 4QMLA 3RI1A 1Q62A 3P5KA 3TV7A 4H3QA 5ANJA 2VO3A 3FMMA 4GJ2A 5CALA 2ITTA 4DH8A 3PIYA 5J9ZA 5LWNA 2WO6A 4D9UA 5IMXA 2CKOA 4BDIA 5TO8A 3BYOA 3FZ1A 3ORXA 2ZDTA 5LXMA 2UW4A 3LXPA 3QLGA 4ZS0A 1OKWA 4RIYA 5DR9A 4RWJA 1V1KA 5FM2A 4C38A 2R0UA 4RRVA 2Y6MA 4D2RA 4X2FA 4JNWA 3M1SA 3I5ZA 2I0VA 2JKQA 3HRCA 4RVMA 3PPZA 3HV4A 4X7QA 2CNVA 1LUFA 4JOAA 3FL5A 2YLFA 5A4EA 5AX3A 4TWOA 1OB3A 1K2PA 3VUHA 4QTBA 1RE8A 2X6DA 5GZAA 4FG7A 3PSDA 3I7BA 3ZU7A 3QCXA 4PL4A 3TUBA 3DZQA 2OLCA 4M69B 3Q6UA 4DH1A 3MPAA 4TWPA 2IVVA 2R4BA 4FIEA 4O7SA 3TDVA 1PXIA 4CXAA 5EKOA 3AT3A 2HZIA 3MA3A 3EKNA 4QMNA 4IJPA 3RVGA 5A9UA 5EYCA 4MBLA 4C4GA 2GTMA 3BHYA 3AMYA 3BHHA 4YHFA 3WYYA 4DEIA 5I9ZA 2W5AA 4YLLA 4TRLA 5KE0A 2PWLA 1R39A 4Q9SA 3V51A 5CVGA 2O63A 4W4WA 4ACMA 3U4WA 4ZSAA 1JWHA 5CU6A 2OF4A 3SLSA 4JIAA 3WBLA 2CLQA 3R63A 4C3FA 2HXLA 3CGFA 4U8ZA 3ULIA 3KB7A 4MD9E 4FBXA 2CLXA 2B1PA 3F5GA 5ACKA 1PXMA 4E4MA 4B9DA 4W4VA 1YWVA 4ITHA 3E3BX 4ASXA 4BCFA 3UO4A 3ZDIA 2BAJA 2YABA 5EW3A 4XG6A 5EW9A 2GNIA 4DGMA 4B0GA 4MCVA 4IWOA 5BPYA 3PPKA 2YCRA 1XO2B 2GMXA 4FSTA 4TN6A 1NVRA 4ZSJA 3SHEA 3MH2A 2R3HA 4MX9A 4CYJA 2YM6A 2FSTX 4FV0A 5FBOA 3R8LA 1ZY5A 3R9RA 2QKWB 3CKWA 4YPSA 1JKLA 2QOCA 3F61A 2PVFA 3GGFA 4IX4A 4JRVA 4UZHA 3RNYA 1G3NA 4UY9A 4AT5A 3HA8A 5AUVA 3DB6A 3KK9A 4R3CA 4FA2A 5L3AA 2B54A 5EI8A 5AUUA 2BR1A 3BGPA 4O1PA 2WOUA 3NW5A 3PSCA 4C3PA 4Q5EA 2GQRA 4YJVA 3EQIA 3K5VA 3O7LB 4BWXA 2SRCA 2HY81 4K18A 1ZARA 4NM5A 3TXOA 3P08A 3EJ1A 2W1ZA 4IFCA 5AP4A 4YPDA 1OL7A 4IH8A 4R7IA 1P4OA 1DAYA 1JAMA 3EFWA 4BICA 3U54A 4I5MA 1M2PA 4AFEA 5TR6A 5D7VA 3CS9A 2W05A 3LJ0A 1LEZA 4Y95A 3VS3A 4O7TA 2I0YA 3ZONA 4EOOA 4O1OA 3IG7A 5AAGA 4FKTA 2XNEA 3OS3A 2W0JA 4YC3A 2ITOA 4RJ6A 5AV2A 1S9JA 2HOGA 3CIKA 4FKJA 1SVEA 3RKBA 5BX0A 3VUTA 3NRMA 2IW6A 2UW9A 2BZKB 4Q2AA 4B4LA 4O86A 3DAEA 1ZOEA 2ZM3A 5M53A 4BI0A 3ENHA 3NVMB 5IA3A 2C6OA 4C7TA 3W8QA 5LVOA 2ZAZA 2ZYBA 4GK3A 4CV8A 3BGQA 1IA8A 4F99A 4OTIA 4AUAA 3T9IA 2YAKA 2HZ0A 4TKSA 4NJDA 4WG3A 4EHVA 2R2PA 4C2WA 2X7FA 3IW8A 4DFXE 5CAOA 5LOHA 2OBJA 1YI3A 4DFYA 3EOCA 2QHNA 3NEWA 5E91A 2QG7A 1H27A 2G2HA 4BCOA 1K3AA 2VTLA 3E8EA 3U4UA 2NNWB 4GK2A 3LFQA 1FGIA 2JFLA 2XJ0A 5CEIA 3TKUA 3A8XA 1UV5A 3D7TB 3E92A 2ONLC 4RLKA 3DDQA 3W32A 5G1XA 5HCXA 2XIZA 3R30A 1A48A 3PA5A 4WKQA 3L9MA 4TYHA 2IVUA 2OK1A 4LMUA 4QMSA 4EKLA 3SKCA 3R1NA 4EL9A 3TUDA 5TE0A 5DWRA 1H1SA 3LPBA 1YVJA 3GT8A 4YTIA 4NIFB 4AW5A 4EK3A 5J5SA 2JKKA 3LFCA 4MNEB 4RX7A 5EI2A 4RA5A 3VAPA 4AT4A 3TG1A 3G15A 1ATPE 3NAYA 3R7IA 5HVJA 4O2ZA 3K3IA 5HI2A 4TZRA 3QTIA 4KBKA 3MY1A 4MWIA 4R7HA 1HOWA 3VW8A 4M84A 3OWJA 4Y5HA 5IF1A 4YJRA 4DT8A 3L9NA 1OKZA 3V5PA 4ZY5A 3O23A 5EM7A 3D83A 3NIZA 4UMRA 3IO7A 5AR3A 4BRXA 5EQEA 3BIZA 5AR2A 3SG9A 5HHWA 3EZVA 1FVRA 1JPAA 2GNHA 3ALNA 4U6RA 4BBMA 4DF3A 2B7AA 3LLTA 3VRZA 3TNHA 4ZZMA 4FSNA 2JDVA 1GIIA 2J5FA 2XEYA 3Q4UA 3F3TA 1OL1A 3R1QA 2VU3A 5CF4A 4UXQA 1Q8TA 1PYXA 4QMVA 4MHAA 5J1VA 3MDYA 3SDJA 1MQBA 2CN5A 5FEQA 3TNIA 3EHAA 3DBQA 4PX6A 4AN3A 5AV0A 3JS2A 4D5KA 4YZDA 3FWQA 3KQ7A 2OJJA 4XUFA 3FBVA 4EH4A 4W4XA 2XCKA 2ITQA 3MVLA 3PWYA 3Q5ZA 4ACCA 3FMNA 4Z16A 2ITVA 1PW2A 4CFFA 4LYNA 4XNEA 4E7WA 2E9OA 2RSVA 3NAXA 4HVDA 4DG2E 1XHAA 1XBBA 3O2MA 3QA8A 2VTMA 2B4SB 4OBQA 3DBFA 2XP2A 4L45A 4ZSEA 4BVUA 5FP5A 4GMYA 4ZTRA 3KXHA 4CCBA 3HAMA 1T46A 5EQYA 3KCKA 2I1MA 4UMQA 5IQCA 4KIPA 4MAOA 4ZJVA 3DS6A 3W2QA 2OJGA 3IW7A 4R8QA 4F65A 4C4IA 3U6IA 5A46A 5KKRC 2WMSA 3Q60A 3PFQA 3CJGA 4YNEA 4GYGA 3VVHA 4DLIA 1YDTE 4DG3E 3LHJA 2CCHA 1XH9A 2WHBA 4E8AA 5LJJA 2CGUA 4G34A 5AUZA 5J7HA 2OH0E 3OW3A 4D1XA 3P78A 4MBIA 2VTJA 3WF8A 4AZWA 3WZKA 3RZFA 4XG8A 4FE2A 3E88A 2ZV9A 3DLZA 4ZAUA 5I5ZA 4PDPA 1NY3A 3MI9A 3OY3A 5BVOA 3VIDA 3K5UA 2C5YA 3COMA 4TL0A 3CQUA 4ZLOA 4CG9A 3OTVA 3ZSIA 4M0ZA 3U9NA 3PE2A 2J0MB 3CTHA 5K9IA 3VHEA 3PRIA 3Q3BA 1YXTA 4UYAA 4DBXA 3QD4A 5F1ZA 2WZJA 3UGCA 2JLDA 4AOIA 3LFAA 3R0TA 4FT3A 3OBJA 4PPAA 5BMMA 3N4TA 2XJ2A 3IGOA 4X21A 3EN7A 4L9IA 4CSVA 3AGMA 4O21A 3U6JA 3VHKA 4F63A 1FBNA 2BTRA 4O0YA 5HEZA 3QZIA 5CU0A 3UOHA 1BI7A 2VZ6A 4X3FA 2Y0AA 3DAJA 4NZWB 5JKGA 3QQHA 4AE6A 4FKGA 3R8VA 3PSBA 4RVTA 2XNNA 4FT5A 4QP3A 2ITXA 4RC4A 3OF0A 4AS0A 2VV9A 3GC8A 3V6RA 2WMBA 2W4JA 3ULZA 2HAKA 3AC8A 3W2CA 5CQWA 1T45A 5HCYA 3R9HA 1H1QA 2CGWA 3F5PA 4WNOA 3P7AA 3Q9WA 2QODA 5BNJA 5DE2A 4O0RA 1YI4A 3CY3A 3BHTA 3Q96A 4K0YA 3RBWA 3VC4A 2ZM4A 4BWKA 3NUYA 4AF3A 1M17A 2HWPA 1Q99A 2AYPA 1BYGA 5A6NA 3FI2A 3RHXA 3GENA 3W1FA 4IXPA 3O50A 4B6LA 4RA4A 4QMQA 1PJKA 3FPQA 4CNHA 4B7TA 3G6GA 1OM1A 2Y8OA 3FE3A 4GG7A 5J87A 3THBA 5A54A 2G01A 3LMGA 4EOLA 3EH9A 4EH6A 2HY0A 2NRYA 4FUYA 2WIHA 4FYNA 2YM3A 4JDKA 4BIDA 5EYKA 3ZRMA 2DS1A 2RIOA 4IWPA 4X3FC 5LMKA 5E8ZA 5AV1A 4U41A 4IANA 5DT4A 3VUMA 3MW1A 4DTKA 5KHWA 3R8PA 1XH8A 4LUDA 5AIKA 3R6XA 4HZRA 5IZFA 1RJBA 3QUPA 4O84A 3OXZA 3P86A 3R21A 4K9YA 4EOPA 4O0XA 4NM7A 1Y8GA 2W17A 3DDPA 5CI7A 2BIKB 4I4FA 2UZDA 4BY9E 3GU5A 3JVSA 4M8TA 2VTHA 3GUBA 3ZFYA 3PG1A 4OLIA 2X4ZA 3QD2B 2BAQA 5L6WL 3UO5A 2E9NA 3D5VA 4X0MA 2FUMA 3ATTA 4DA5A 4JG8A 1J3HA 3RPYA 4TYIA 4AXAA 2QO7A 2HW6A 4CKJA 5GIOE 4O91A 4HGSA 4MNFA 5CZHA 4A9SA 4DEBA 2XRUA 2VRXA 3G5DA 3OOMA 4KIKA 4LFIA 5KMOA 1XJDA 3A60A 2PVYA 5F9EA 5JFSA 3NUPA 4LUEA 4L3LA 1JSTA 2CJMA 2YDKA 2PSQA 3MVMA 4PTGA 2RFNA 5CSVA 4H39A 4QP7A 3BLHA 3NUUA 2A0CX 2C47A 4AE9A 3FMLA 2XIKA 3LCDA 4G9RA 5FBNC 2IZUA 3R1YA 3LQ3A 2BZHB 4FEUA 2Z7SA 5C8KA 4TW9A 3WF6A 3QD0A 3QWJA 1CDKA 2IG7A 5J9YA 3VO3A 2QKRA 2H96A 4FKQA 2BKZA 1OITA 4O83A 3JUHA 4USDA 4AW0A 4XG9A 3JY0A 4FTIA 2OGVA 3QKLA 2C6KA 1KWPA 4UEUA 3TL8A 5EW8A 4BDEA 4C0TA 3B2WA 4FIGA 3OCBA 1Q24A 3U87A 5AP5A 4BCQA 3I1AA 3E62A 5C1QB 4ZTHA 5HO7A 3Q9XA 3FLSA 3UP2A 5I9VA 2YCQA 3QQUA 4GUEA 1F0QA 3RAHA 3BBWA 5J8IA 4FV7A 4BCHA 4RPVA 3ZLWA 4JR3A 4D5HA 1FVTA 1VYZA 4D2TA 1APME 3F2AA 4BDFA 5AEPA 3MBLA 2DYLA 2PE0A 4FZ7A 1ZOHA 2QURA 3QRJA 4XEYA 3KMMA 4U3ZA 3ZCLA 4OGRA 3UE4A 4IW0A 3MSSA 4U80A 2OU7A 2WTWA 4CRSA 4EHGA 3I7CA 3K2LA 3JR1A 5IQHA 4FV6A 3P79A 1Q3WA 3GEQA 3MYGA 4QQ5A 4QYGA 4CLIA 4M67A 4XBUA 3FKLA 4G3EA 4WG5A 4PMPA 3I81A 5CEKA 2XF0A 3ENMA 2AUHA 2W1DA 1ZZLA 4JVGA 4ZTQA 4F08A 3VS6A 4CZTA 3UVQA 3HLLA 3O8UA 5F20A 3HUBA 2JD5A 3Q32A 4AX8A 4R7BA 4IFGA 1YHSA 5KMLA 5A14A 4JXFA 1OL2A 3FMEA 3LKMA 2Q0NA 4W8DA 4NYEA 2EXEA 3NMUF 5AR4A 3ZEPA 4DEDA 4LMNA 5J79A 3CEKA 2XNBA 5EM6A 5AM7A 2J7TA 1W98A 2VX1A 3OMVA 3IK3A 5LMAA 5I9YA 3KXNA 1CSNA 2BUJA 3QX4A 1XQZA 3ET7A 4FVQA 3UZRA 2F7XE 2J4ZA 4RIXB 4X2KA 1ZZ2A 4RFZA 4C35A 3PVUA 2RFEA 5L2IA 3QXOA 3TCPA 4U0IA 4V04A 3L1SA 4JAIA 4B8LA 3LMHA 3KRLA 1KSWA 4Y73A 1OPKA 1WVYA 2QOHA 3PYYA 1M7NA 3NGAA 3BI6A 4L67A 3E87A 4RC3A 3VS0A 3WIKA 3E63A 5KMJA 2UW3A 2ZV7A 2GS6A 3QD3A 3C51A 1LPUA 1I44A 1QPCA 4XP0A 2CNUA 2O65A 1YKRA 1YOMA 3BRBA 4XLVA 2Y4IC 4EOQA 4QPAA 4UV0A 3SC1A 3FI8A 4Y72A 1A9UA 1Q4LA 3V5TA 4ERKA 4BGHA 3WYXA 3JY9A 4FKLA 5I3OA 4M13A 5CSXA 1JSUA 3AD4A 1OECA 4YTHA 1VJYA 2YISA 4UMPA 4I24A 2GNGA 3OD6X 4J8NA 4OT6A 4BKZA 3FQEA 5C4LA 1R78A 2PU8A 3BQCA 4QRCA 4HNIA 2XNOA 4RLLA 5GJDA 2VWUA 5FGKA 4F9CA 5GIPE 2J9MA 4GEOA 2FSLX 4JAJA 4OTFA 4RWIA 4CTBA 4YUQA 3RHKA 1A06A 4QTEA 4QP4A 3TV4A 2XM9A 3VUDA 2C3KA 2HWOA 3F69A 3FMJA 4EOJA 3HMMA 2XM8A 2XNMA 4RJ7A 3OG7A 4FKWA 4RWLA 3E93A 3KCFA 2WELA 4YTCA 4HGLA 5IA5A 3NS9A 3I79A 4I6BA 1JKSA 5DIAA 3ZLXA 4D4VA 4O6LA 2H8HA 4FV3A 2VWBA 3FZOA 3MGYA 4YJPA 3HUCA 5ANOA 1ZLTA 5AP1A 5HOAA 3ZYAA 4EK4A 1KV2A 2WMTA 1YXUA 2WQNA 3H0YA 3PXKA 3ZS5A 4YJUA 3IONA 3E8DA 4RX5A 2Z8CA 1H1RA 4RJ5A 2H34A 2Z7QA 3LFNA 4O0TA 5EHLA 4K1BA 3R2BA 4I41A 5DG5A 4H3PA 3Q4ZA 4KBCA 3GCPA 3VS5A 5CXHA 4EONA 5IEXA 3CTQA 4P5ZA 3QQJA 3TZ7A 2DWBA 1JBPE 3RPSA 2UZLA 3QYWA 2XH5A 1ZOGA 5HGIA 3TV6A 4E5AX 4FEWA 4OBOA 5DN3A 4RIYB 2PZIA 3IW5A 4F7SA 5K5NA 4ARKA 1CMKE 3MV5A 2R3IA 2VWIA 3OOGA 3KMUA 4R5SA 2GFCA 1FPUA 1H28A 3TZ8A 4DLJA 1W7HA 4I3ZA 2E9UA 1KV1A 2G9XA 2EUFB 2O2UA 4OTPA 1DAWA 2UUEA 4KRDA 4O22A 2WMWA 1U54A 3MH1A 4ZY4A 1SZMA 3QUEA 3EQPA 5K4JA 2XNPA 4FL3A 3QRTA 3UO6A 3WIGA 5CS6A 4A06A 4BZOA 3I4BA 3ZTXA 4ITIA 4K2RA 4CGAA 2CHLA 3DU8A 2I40A 3Q53A 2CCIA 4H3BA 3PE1A 2VAGA 2R0IA 3A4PA 3ORPA 3MFRA 3SQQA 1OMWA 4FKPA 5GJFA 4MYGA 5IDNA 2GQSA 2PY3A 4U7ZA 4EKKA 3LVPA 2WTDA 4WD5A 4ZOGA 5FTOA 4RZVA 4OBPA 2HK5A 1WVWA 3SRVA 4CFMA 4S31A 2W5HA 4U5JA 2A2AA 4A4OA 2BMCA 2R3GA 2X2MA 3F9NA 4BDKA 3HL7A 3TNQB 1J91A 4CRLA 4A07A 5M55A 1B38A 2CPKE 1WBWA 3R7OA 4DYMA 4LL5A 2VTQA 2EB3A 4DH5A 4YLJA 3HYHA 4G6NA 4L52A 4BDDA 5DYJA 2C6IA 2NRUA 3H30A 2R3PA 3ZBXA 4IM3A 5A4QA 4IZ5A 1Y6BA 2IVTA 1EH4A 1XBAA 4JBPA 4QMUA 4MXZA 4JDIA 4F9AA 1M2RA 1H8FA 4CVAA 5J5TA 2CDZA 4LM5A 4GFMA 5JGBA 3TUCA 4V01A 4HW7A 3NZ0A 2R3FA 4PDSA 4C34A 3AC1A 4X2GA 3DOGA 3KRRA 3W2SA 5AR5A 1LEWA 2WD1A 5CZIA 3SOAA 2PE1A 3UYSA 4LOOA 3QQKA 2WMAA 3HGKA 4PL5A 3OCGA 1PMEA 3EIDA 1YQJA 2C3IB 4I92A 2W1IA 4JL9A 2O8YA 4BDJA 4ZS4A 2R64A 3EN6A 4Y83A 5D7AA 5F94A 4EH5A 3NNVA 4J97A 4RFMA 4KB8A 1WBVA 2QHMA 3BYSA 4GU9A 3PXFA 2UW5A 2C5OA 3H9FA 4E6AA 2BTSA 3OEFX 4IAKA 5DI1A 3DFCB 4L8MA 3I6WA 1UKIA 5JZNA 5IPJA 3ZO2A 3WI6A 4QYEA 4RJ3A 3C4CA 3R7EA 4BTFA 5DPVA 4DCEA 1GIJA 3PVGA 3ZOSA 4IAFA 3BLRA 4JG7A 1PY5A 1CKJA 1RQQA 4BKJA 4QMXA 1ZXEA 4GG5A 3LIJA 3QC4A 2IN6A 2OKRA 2CKEA 2PL0A 3MH3A 5CNOA 2WTKC 5AIRA 4X6QC 5JQ5A 4K6ZA 3RK5A 4E5BA 5JQ8A 3GFWA 3GNIB 4D4RA 4R78A 2XK8A 4GCJA 4OUCA 1IAHA 5JT2A 4IMYA 1AGWA 4U79A 2PMIA 4GKIA 4YTFA 4ZJJA 4Y8DA 4P5QA 5HU3A 5M06A 3SXSA 1Z57A 2FH9A 4WNMA 4BWPA 4EHEA 3WILA 4JLCA 2RFDA 4TY1A 2GPHA 2B53A 1KE9A 2WQOA 3DJ5A 4I1ZA 2C6LA 3F88A 3RPVA 2C0IA 4FSZA 4BDAA 1Y57A 4QNYA 4E5WA 4FZ6A 4FZDB 3MESA 5BQ0A 1NW1A 3PDTA 2BIYA 2PUPA 2W9FB 1IA9A 4HYHA 4O7LA 1K9AA 2CMWA 2YZLA 3ATSA 2OXXA 3CC6A 4NFMA 4PPBA 3UIXA 4P2KA 4ALWA 4I93A 3KVXA 2NP8A 3SOCA 3T8OA 3Q52A 3DCVA 4CZUA 3CCNA 3AT4A 5KO1A 1YWRA 2UZOA 1VYWA 3KULA 2X2LA 3NCGA 3FY0A 3QALE 4NEUA 1YXVA 4KS8A 5J95A 2QO2A 2YZAA 5T6KA 3WARA 3EFLA 4N6ZA 2I7QA 3BHUA 3D94A 4QP2A 3F7WA 4TYHB 3QF9A 4ZK5A 2W7XA 3BE2A 3FQSA 1NXKA 3WZUA 3VN9A 1WVXA 1VR2A 4XBRA 1PKGA 2A1AB 3MJ1A 3E7VA 4OTHA 4AGCA 4RX8A 5CY3A 4HPUE 1CKIA 5E92A 4ANMA 2HELA 3IS5A 4GT4A 3W2OA 4Q9ZA 4Q5HA 5HO6A 1YDSE 3EN5A 4D2PA 4BI2A 3BGZA 3OUKA 4R3PA 4YJNA 5CEMA 2OG8A 4X2NA 5JMSA 3UOJA 3RJCA 2PUUA 4BF2A 3BYVA 4ZSGA 4NT4A 3KKVA 3UP7A 2VTOA 4YSJA 5BMSA 3UDBA 3P4KA 1Q61A 4WBOA 2BFXA 2WEVA 4M97A 2LAVA 5I9XA 5KKRB 1HCKA 3U8WA 4FV2A 4BC6A 3WOWA 4ANQA 3UQGA 4ACGA 1WBPA 5BVNA 3P0MA 3V6SA 4A4LA 3RNIA 5CENA 3PLAE 4PRJA 1Q8YA 4XLIA 5D1JA 5CU3A 5L8LA 2X8EA 1ZYSA 2PZPA 2REIA 3HV5A 3NNWA 4G5JA 3D5UA 5HTIA 4CG8A 4DBNA 4KA3A 3DB8A 4U42A 2VTTA 4ANSA 3C5IA 1R1WA 3PP1A 3ORLA 5GJGA 2RFSA 1NA7A 3VULA 3FMHA 4FNWA 4BDGA 4EQUA 3QCYA 4R1VA 2VN9A 2Y6OA 4J71A 4O7WA 1ZMWA 3WE8A 3KVWA 4APPA 2XIXA 1OPJA 4YBJA 4ZTLA 4WT6A 1Q5KA 2P2HA 4WBBB 2ONLA 2YJSA 3HV7A 4FOCA 4B8MA 3MTFA 3TWJA 3AC3A 5H8EA 1CKPA 4W9XA 2OWBA 2R5TA 4XX9A 5EDRA 4F9WA 4ZIMA 3D0EA 1PMVA 5D11A 2PMNX 4EBWA 3EKKA 2JIVA 5ACBC 3TDWA 2G1TA 3BYMA 3QZFA 4DFNA 3BWFA 2OJIA 1UU8A 2QVSE 3ITZA 4G17A 3O51A 3FZPA 2BRBA 4N0SA 2ACXA 3DKCA 3PA4A 2YCFA 3VW6A 4AGUA 3IDBA 5L2QA 4KSPA 3ORTA 3R28A 1UU9A 3C0GA 4BTJA 3POZA 3O17A 5L2TA 4UB7A 1ZYJA 5HNGA 2C30A 4WOVA 3W33A 4WRGA 4BCMA 4H05A 3QKMA 5B2MA 3A61A 3K54A 1P2AA 3VS1A 4ANOA 3H9OA 2UW7A 2XYUA 3RP9A 3FAAA 5FWKK 3LFSA 3HMNA 2Z60A 4FTKA 3NX8A 2YACA 2BRGA 4GW8A 3PTGA 5E1SA 3B8QA 3D5WA 4OTWA 2ZVAA 4QYHA 5FTQA 2P2IA 5CXZA 3BV2A 3OUNB 3ZC5A 3NUNA 1WBOA 1STCE 3R02A 4KWPA 4R1YA 5CLPA 4GYIA 5HE0A 2C6DA 1DS5A 4QQTA 1U5QA 2OFVA 1NVQA 2OXYA 3DPKA 5L6OA 2VWZA 4JG6A 2VTNA 4X3FB 3RPRA 2QNJA 2PPQA 2EXMA 2XK9A 3RCJA 4ZZNA 2C0TA 2XB7A 5BUEA 4RBLA 4CQEA 3QLFA 5DH3A 5EH0A 5CNNA 2F9GA 2O0UA 4BI1A 1KE6A 4JDJA 4ERWA 2QU5A 3N9XA 2P33A 4JQ7A 3G51A 4F0GA 4R5YA 3FZTA 3QC9A 1OPLA 3N51A 3TN8A 3KL8A 4ZZOA 5KX8A 3IDCA 4RIWA 4XG3A 4RQVA 2ITPA 3KN5A 2OO8X 2VO0A 4J98A 1ZY4A 5HG8A 3ZHPC 3VF8A 4CFXA 2V7OA 4NSTA 1UA2A 5HVKA 4CT1A 1GZOA 4FOBA 4OTQA 4WNPA 3ZBFA 2JIUA 2BAKA 4GFGA 4O27B 4CFUA 3MWUA 4DGNA 3RALA 4E3CA 4EWHA 3S95A 1WBNA 4FZFB 3DK6A 4JBOA 4FT7A 4XJ0A 3QQGA 3AOXA 4FEQA 4GH2A 3R9DA 4BFMA 3UIBA 1R0EA 3RGFA 3VS4A 5E4HA 1IR3A 3A62A 5B0XA 4M12A 4XOZA 1E9HA 3ORNA 3SXRA 4QQJA 3S3IA 1O6LA 4C37A 1J1BA 5A4TA 2YDIA 4BCJA 3ROYA 4WRSA 3HRFA 3PJCA 3QKKA 3R7VA 1FVVA 3R01A 3PY3A 4HCUA 3VRYA 3W8LA 4DGGA 4NWMA 4O81A 3RM7A 3FV8A 3V8TA 3KC3A 4L01A 5D9HA 5CF6A 3HMOA 5LWMA 4IADA 2X9FA 3DA6A 1OKVA 5EM8A 3EZRA 4CV9A 3R83A 3O71A 4YU2A 4G3CA 4V0GA 2YIRA 5H9BA 3KGAA 4DAWA 3GVUA 1V0OA 4GRBA 2BPMA 3K3JA 3HX4A 2W06A 4Z7HA 3H10A 4NTSA 3ZLSA 5K3YA 2I0EA 3R22A 4KIKB 5L8JA 5FG8A 1FGKA 4HJOA 3NUAA 3GI3A 2OZAA 4XCUA 4ZJIA 3Q2JA 3WZEA 3PP0A 2QOLA 2WTCA 4Z7GA 2YA9A 4O0UA 4RT7A 1E1VA 2JBOA 4QMWA 4PNIA 4CZYB 4I6HA 4J96A 3SA0A 2FSOX 2B55A 3AMAA 5IUGA 1J7LA 2F2CB 4O82A 1GJOA 2J5EA 3AC5A 3QTZA 5DEYA 5A6OA 1ZYDA 2HENA 4QP8A 3OVVA 4FV8A 3DXNA 2XKFA 3UOKA 2JAVA 5L2SA 5L2WA 3F5UA 4QYYA 2EWAA 5CVFA 2VUWA 3UVPA 4IIRA 5E8YA 4ALVA 2GS2A 3KRXA 4V05A 1H1PA 4HVIA 2X7OA 3UG2A 3LM5A 1LP4A 1Q97A 4MTAA 2C6EA 3UG1A 2XKCA 3C4WA 4AWIA 1H4LA 3CD8A 4IM2A 4MWHA 3POOA 4MK0A 2IW9A 4E4LA 1UU7A 5IISA 3F6XA 4DN5A 2J0KA 4ZSLA 4DFUA 2WMVA 1GZKA 2BROA 3VBXA 5CVHA 4FK3A 4EK5A 1BMKA 3MFSA 4F4PA 4TT7A 2F4JA 3HV6A 3GOPA 4QPSA 4KBAA 4ZMFA 3CR0A 2BZIB 3D14A 4I21A 5D41A 3IOPA 3B2TA 4FZAB 3DGKA 4JX3A 4LG4A 3G9LX 3UIUA 3V8WA 5CAPA 4CLJA 4JRNA 4FSMA 4FVRA 4EOMA 2R3RA 3COIA 2IVSA 3OT8A 4A9TA 3HVCA 4EQCA 4NW6A 3UNJA 4O7RA 3VBVA 5DVRA 4ZEGA 4BBFA 2Y4IB 1ZAOA 3M11A 4FVPA 5IQFA 5AR8A 2V55A 3A8WA 2F7ZE 1H00A 2XKEA 3I0QA 4IZAA 2UZBA 2A4LA 4ZTSA 3T3UA 3UMXA 3H4JA 4DITA 3AD5A 1ERKA 1YOJA 2V5QA 3DXQA 3QCQA 5LCJA 3OXIA 1DI8A 1VEBA 2X8DA 1JKTA 4FKSA 4D55A 3FKNA 5JGDA 3QRKA 3GCSA 5LMBA 3FYKX 1JOWB 4R6VA 2QOBA 1ZMVA 3EYHA 3F5XA 3OWPA 1QPJA 2AC3A 3NCZA 4FSWA 4FX3A 2VTAA 3NSZA 3PIXA 4BCIA 1WAKA 3ROCA 4C2VA 4ID7A 3FSFA 4LGDA 4XV1A 2PK9A 3DTCA 2HW7A 3WE4A 4AOJA 1W0XC 2RGPA 5I0BA 3V3VA 5FM3A 5CAVA 3PY0A 3HDNA 5IMEA 4MBJA 5H8GA 4AW2A 2PZYA 3S00A 5AP6A 4JS8A 4YR8A 3FY2A 3UZPA 2ITUA 3RAKA 4APCA 4FSUA 3QUDA 4CQGA 1QMZA 1UWJA 4NU1A 4C36A 1YOLA 3KMWA 2WGJA 3GCUA 3WF7A 1IEPA 4BHNA 1F3MC 4EJ7A 3PRFA 2JGZA 2R3OA 4P90A 4QP9A 4ENYA 4AN9A 4F6WA 4DFZE 5IU2A 3MPMA 4YHJA 3ZDUA 5ETIA 1J7IA 3EL8A 2BDWA 4EORA 4A9UA 4KSQA 2QR8A 2GFSA 5CEQA 3CE3A 4IX3A 4EQMA 5CASA 4BYIA 4FEVA 3ZUTA 3GQIA 3HECA 4EUTA 4DEHA 4C58A 1RW8A 2LGCA 4BL1A 3VQUA 1OBDA 3L9PA 3FZRA 4G2FA 3TKIA 4QTAA 1QPEA 2WIPA 3VBTA 4IAAA 1Q3DA 4O0VA 3BWJA 5AFVA 4GU6A 5HG5A 3C1XA 1BL7A 3II5A 3MB7A 3Q9ZA 4HPTE 4YP8A 3ANRA 2IJMA 5E7RA 4A7CA 3I60A 4UBAA 2WMXA 4OAUC 4BYJA 4HNFA 4CEGA 4PUZA 4WHZA 2W99B 3PLSA 2B9IA 2R3QA 4YLKA 3FKOA 3D4QA 4YZMA 3RPOA 1KOAA 5M56A 2IPXA 3BPRA 2GU8A 2HXQA 4F6SA 3SW7A 3ACKA 3OXTA 3AXWA 4GVAA 5HICA 4CKRA 3UTOA 2JITA 5CI6A 5AAFA 3P1AA 2VNYA 3FMDA 3TTJA 4CFNA 5DR6A 2QOIA 3BKBA 3PJ2A 3VUIA 3PXRA 3SX9A 3O96A 4BB4A 5C01A 5CU4A 2XCHA 2P4IA 2VTPA 3L9LA 4YC6A 1FMOE 4AP7A 4EH9A 4XV2A 4BKYA 4C57A 3MIAA 4DEGA 4L7FA 5JSMA 1I09A 4QT1A 4O7ZA 4A9RA 5FXRA 2BALA 2VWXA 3ACJA 5CSHA 4O7VA 5M44A 3IQ7A 1QPDA 1U54B 5DT0A 3V5WA 3OHTA 2QU6A 2YWPA 3O8TA 4FNZA 4FKOA 3W55A 2PVKA 4LRMA 4P7EA 2W1CA 2YM8A 5M57A 4IHPA 5JEBA 5JRSA 4MXCA 1UVRA 3DBCA 3HDMA 4IACA 1WCCA 5JN2A 1TQIA 4DTAA 3T3VA 4MVFA 4UX9A 3U55A 4L46A 2W5BA 2XIYA 3SRVB 4F6UA 2GTNA 3NIEA 3PXQA 3JPVA 4IAZA 4F9BA 4IDTA 4YBKA 5CU2A 5AWMA 4E6CA 2C5NA 4G6OA 2YITA 4GL9A 3E7OA 3L8XA 5HG7A 4LOQA 4XHKB 2H9VA 4PTEA 2XEZA 4USEA 5J7BA 4ENXA 1RDQE 2WQMA 3AC4A 4GJ3A 1S9IA 4ACHA 3GP0A 4J7BA 4RGJA 3FUPA 3IW4A 5M4CA 2B9HA 3DTWA 3CSVA 1P5EA 4M3QA 5HQ0A 4HCVA 5HLNA 1Y6AA 4E6QA 5I3RA 3PZHA 4I6FA 3CPBA 1SM2A 3R9NA 3OTUA 4NFNA 3UOLA 3HRBA 3TIYA 3QTQA 2EVAA 4F7NA 2G15A 3FLWA 3ORKA 2GQGA 2GHMA 4N70A 3LZBA 4XH6A 3UC4A 3PXZA 4YSMA 4IB5A 3IKAA 4NM3A 4CD0A 2YIQA 3LCSA 4RVKA 3U6HA 4G5PA 1PMUA 4RZWA 4CMUA 4USFA 3ODZX 3TNPC 2GNJA 2QOKA 5AMNA 2XK6A 2FSMX 2ZM1A 4LV5A 4MXOA 3ZRLA 4CMTA 2WTJA 3QZHA 4JR7A 1G8AA 5BVWA 3O7LD 2CSNA 3FLYA 1VZOA 4PMTA 1REJA 5IEVA 4JQ8A 4GFOA 1F5QA 1H25A 3LW0A 2JDOA 4HGTA 1IRKA 4OR5A 2PYWA 3C0HA 3AMBA 4FSYA 5CWZA 5AADA 3R00A 1WBSA 1KOBA 3D9VA 3OWLA 1H08A 3KXMA 2XZSA 3FC2A 3PY1A 4K77A 4BN1A 3SV0A 2FVDA 3FYJX 3QZGA 3DFAA 4MH7A 4RX9A 3LJ2A 3VWAA 1SMHA 5TF9A 4D4SA 4L44A 4EOKA 3NYNA 4G6LA 3DNDA 4IC8A 5EDPA 5KCVA 3Q9YA 3PUPA 4XV9A 4DEAA 1OIRA 3LM0A 4ZXTA 4D1ZA 5JH6A 3H3CA 5AV3A 3SXFA 5A3XA 4Y46A 3D2KA 1PKDA 2JBPA 3MJ2A 3IGGA 5IA1A 2C6MA 4CFWA 4X3JA 2C0OA 3LXKA 4HVHA 5E8VA 2C69A 4NH1A 5JFWA 4HOKA 4KKGA 4N57A 5IA2A 5AAEA 3G90X 4DT9A 3F3WA 4PMMA 3BU3A 1DI9A 3MN3A 5HKMA 3FC1X 3V04A 1V0BA 4YMJA 4H36A 1UNLA 5J9LA 5FLFA 4IDVA 2VGOA 4FNXA 5JGAA 3BQRA 4NM0A 4EH3A 2XS0A 2ITNA 4AZVA 5HCZA 2OF2A 4L00A 3ZUUA 1UNHA 5JZJA 2PVMA 4EEVA 2XBAA 3CY2A 2F57A 3EQHA 4GS6A 4PY1A 4F64A 1YDRE 1Q8WA 4GUBA 1H0WA 3AC2A 3V5JA 2J50A 2BILB 1M52A 4PQNA 4GT5A 5EDQA 4JQEA 1MUOA 4CYIA 4LRJA 3RMFA 2PULA 1JVPP 2O5KA 2V0DA 3F2NA 4FTAA 1QL6A 1XWSA 5IH5A 3KULB 4EH8A 4JX7A 3M42A 2WAJA 5IH4A 3QTUA 1PXPA 2C1BA 2PZRA 2Q0BA 3DKFA 2QLUA 3DK7A 3F7ZA 1SVHA 3NDMA 3QCSA 3QU0A 1G5SA 4J8MA 4X2JA 2YIYA 4ALUA 1GAGA 5B2KA 4KABA 1YI6A 4ZY6A 4PMSA 4G31A 2B0QA 3RWPA 3OBGA 3P9JA 3CPCA 1B39A 1MRVA 5IG1A 3MPTA 4UZDA 1ZYCA 4MEDA 1M14A 5CTPA 5HIDA 4C61A 2VGPA 5DGZA 3OW4A 3SAYA 3C50A 3EWHA 3UVRA 2PE2A 4ITJA 4RMZA 2DUVA 4GV1A 1FOTA 3CTJA 4FT9A 4AN2A 4HYSA 4YJTA 1H07A 5ANKA 4ASZA 1BI8A 3GC7A 4D1SA 5B7VA 3CLYA 2W1GA 1W83A 4JIKA 4H1JA 4Y85A 4KIOA 4RJ8A 2QO9A 1PXJA 4L7SA 4AU8A 2WKMA 5HE3A 3QX2A 1YXSA 3GB2A 5HIEA 1O9UA 3DJ6A 4QQCA 4S33A 2PMLX 4RC2A 3NUSA 1PMNA 2GHGA 3ZSHA 4HVSA 4F1MA 4NW5A 4Z9LA 3ORIA 3QQLA 2RL5A 4HVGA 2PVNA 4BCGA 5GINE 2R3LA 3HV3A 3V5LA 4YZCA 4O6EA 4L6QA 2OH4A 5A4CA 3G6HA 2BFYA 2I6LA 3PJ3A 4FEXA 1W8CA 2BHEA 2YCSA 4GT3A 1HCLA 3FXWA 4HYUA 4D2VA 4FKRA 5IH6A 3R2YA 3BBTB 5DA3A 4EH2A 4EYMA 1YWNA 2PVLA 1GOLA 2VTSA 2JIIA 2A19B 4DHFA 5K4IA 5EYDA 4FIJA 4KKEA 4LOPA 5KMKA 2VWWA 4W4YA 4UWBA 2WQBA 2X1NA 5JRQA 2IZRA 2UZEA 4ZTNA 3DBEA 3F2RA 4M7IA 1YHWA 2PVRA 5BVDA 4DH7A 4S2ZA 4QP6A 2P0CA 5JFXA 3RM6A 2BRHA 2W1HA 2Z2WA 3DJ7A 4RFYA 4LGHA 1IASA 2F49A 2W4OA 3FXXA 4XG7A 3OWKA 3EQBA 3ZM4A 3AT2A 3C4ZA 3HP5A 3FSKA 1BLXA 2W4KA 2ITZA 2BCJA 2DQ7X 4I0TA 1PYEA 4TPTA 5LVLA 4BGQA 3S0OA 3FLQA 2Y4PA 2CKPA 3HAVA 4WIHA 4BDHA 5CF5A 1P14A 3P23A 3VJNA 5IEYA 3MS9A 2EU9A 1OBGA 3KU2A 4BCKA 4GIHA 2J51A 2ZOQA 4O0WA 5AP2A 5E8TA 2XRWA 3W16A 1Z5MA 4XRJA 5DOSA 3GC0A 5I9WA 2UV2A 3EN9A 4CTCA 2WQEA 4DTBA 3LXLA 4FK6A 2I0HA 4QYFA 3UYTA 2G2FA 1JLUE 5HU9A 3JYAA 3IOKA 3S2PA 4ASEA 3TZMA 4NKSA 4H1MA 2E9PA 4WUAA 4I5HA 3CBLA 2JFMA 4RQKA 2X7GA 5BYZA 2IW8A 1L8TA 3C13A 2UVXA 4HYIA 3N4VA 3R8MA 2J90A 3NYVA 1O6KA 2VTRA 3FL4A 4I4EA 5KMMA 4DC2A 1JNKA 3W2RA 3R1SA 2HZ4A 4IZ7A 1LR4A 3WZDA 4EYJA 3LFFA 4IVCA 3CQWA 2WU7A 3PG3A 1JSVA 4D58A 3GU8A 4RIWB 4DE4A 4KINA 3TM0A 3T9TA 3RK9A 4BGGA 4GKHA 2X81A 3W18A 3KRJA 3UJGA 2C4GA 4DH3A 4IB1A 4Y5QA 5C8MA 4JT3A 5AR7A 2RG5A 3PVWA 2OI4X 1U4DA 4ONAA 4YC8A 5EOBA 3MY0A 2OICA 2ZDUA 3TNWA 3W2PA 3MFUA 3BU6A 4AT3A 4L43A 4XP2A 3QYZA 2X6EA 2B9FA 5HG9A 5IDPA 1NVSA 3GCVA 3Q6WA 4I6QA 4LRKA 5FP6A 5LCKA 3UBDA 1R0PA 2BKKA 5DEWA 5L8KA 3TACA 1H0VA 1FQ1B 5M09A 5IUIA 3ERKA 4PDYA 5CAQA 3ANQA 2XBJA 1SNUA 4XG4A 1H01A 2VWVA 5HO8A 3NNUA 1OIUA 4IB3A 3KXGA 4QMTA 3GXLA 4GK4A 4GSBA 3HNGA 3C4FA 3S4QA 4NKAA 1SVGA 4TWCA 4AZTA 1MRUA 3RTPA 5C8NA 1WZYA 3BZ3A 4J99A 1PXNA 4EOSA 4BCPA 3PWDA 2P3GX 3BX5A 4KD1A 3LFEA 4M14A 5AP7A 2X9EA 3Q5IA 1AD5A 2J2IB 3GC9A 4UWYA 2VX3A 5ANGA 3R7UA 4RVLA 4V0GB 4D0WA 3UNKA 1URWA 2ITYA 3BCEA 3NUXA 5HVYA 5KNJA 2WOTA 2NPQA 2XVDA 1TKIA 4U43A 5HD4A 1M7QA 2C5XA 4F70A 2ERKA 5F4NA 5HBJA 3RZBA 5ANEA 5FDXA 4BCNA 2OZAB 4I0SA 4MKCA 3LLAA 5AUTA 4FKUA 5CAUA 1WBTA 5HX8A 3HZTA 4C59A 1SNXA 3KF7A 2GHLA 4JJRA 4L3PA 3NWWA 4C4JA 4JBQA 2V7AA 4TNDA 2YJRA 3RWQA 3F66A 4EJNA 3BHVA 4PF4A 3F82A 4WSYA 3Q4TA 2JC6A 3F3VA 5BVFA 3FXZA 2RF9A 4H58A 3V8SA 5KBQA 3UQFA 3GCQA 4LQMA 2ETRA 2VO6A 3ZMMA 2ETMA 2OIBA 4PTCA 5E8SA 2G2IA 2P55A 4KAOA 3ELJA 2F2UA 4AOTA 3ZZWA 4G3DA 4IVDA 4WA9A 5IUHA 3DNEA 1KE8A 3MTLA 4MXYA 2X39A 4M69A 2R7BA 3MY5A 2CN8A 4FF8A 2OW3A 3SD0A 1IAJA 3NW6A 3KF4A 4EK8A 3HP2A 3LCKA 3R04A 4M15A 3O8PA 4AZSA 4FR4A 4LV8A 4PPCA 1ZMUA 5ANDA 3ZO3A 4EHZA 2KULA 4P4CA 2W1EA 3MIYA 4PWNA 4TWNA 3DKOA 5BYLA 3HKOA 2E2BA 3NR9A 3QTRA 5BUJA 2J0JA 5GNKA 4MF1A 4RJ4A 5HE2A 4AA0A 3OP5A 4QMYA 3EQFA 5E8WA 2YAAA 4XRLA 5IQAA 4QMOA 3A7IA 4FTMA 4C8BA 1CM8A 5HZNA 5CEPA 3EQRA 3KY2A 3OT3A 3PJ8A 4KKHA 5HLPA 2OFUA 4W8EA 3LCTA 2XKDA 4IAYA 3MB6A 4CT2A 5DNRA 4FTOA 2WTVA 2XK3A 3DLSA 4BZDA 3EQGA 1XH4A 2UVYA 2PTKA 3OEZA 4I5CA 5L4QA 5EFQA 3REPA 5K0KA 5ITAA 4NK9A 4IVAA 1GY3A 3Q4CA 3KREA 3HMPA 4RG0A 4FKIA 4YZ9A 4A4XA 3I5NA 4BTMA 2WTIA 5ICPA 1WMKA 3GOKA 4FIIA 1U5RA 1PHKA 4UYNA 4TTHB 4FIFA 3VF9A 4ANBA 3MH0A 4FIHA 4PP7A 5CF8A 4F9YA 2OZOA 1R3CA 5CT7A 4FTUA 2WPAA 3C0IA 1UU3A 1Y8YA 1UWHA 3G0EA 4I5PA 1KUTA 4DG0E 4RIOA 4FV4A 4JDHA 4XMOA 3V01A 3EQDA 5KMIA 5CEOA 3LFDA 2UVZA 4PV0A 3TI1A 5LVPA 3A4OX 1H26A 4M0YA 2XUUA 3BELA 4AFJA 5FTGA 5EK7A 3P7BA 4BTKA 4U97A 2B9JA 1AQ1A 4ZLYA 2QOFA 4FV1A 1OL6A 2PHKA 4C4FA 3U51A 4XP3A 4LGGA 4EBVA 3VS2A 5M08A 4YZNA 2IZSA 2O3PA 2B52A 3ORMA 5E1EA 3ZXZA 4O96A 3LOKA 4CCUA 5ANIA 4U9AA 4I94A 3Q2MA 1E1XA 2YIWA 5HD7A 3ZFMA 2J6MA 4C33A 2BHHA 5M4UA 2E9VA 5EHOA 1W84A 5FXQA 4F09A 2QI8A 3CP9A 2QLQA 3EFJA 1OUKA 2NO3A 3FQHA 4X6RA 1OIQA 1Z9XA 4E4NA 4E6DA 5C4KA 3I6UA 4FSRA 4RWKA 2YERA 2XYNA 5BVKA 5T3QA 3KRWA 3ZUVA 4UMUA 1OL5A 5HNBA 4FG8A 2RKUA 2XA4A 1H1WA 2WFYA 1YRPA 4FYOA 3FHRA 3LXNA 3UZTA 4L68A 4O2PA 5KZIA 5EI6A 3DBDA 3I0OA 3EYGA 4FL1A 2X0GA 2ZV2A 5DT3A 5JFVA 5KMNA 2R7IA 4IZYA 1X8BA 3MA6A 4MQ1A 3AGLA 4Z55A 4G3GA 4FTJA 2C1AA 4LI5A 4UXLA 4EH7A 4TXCA 2XNGA 5IKWA 3DKGA 2ESMA 3O0GA 5I9UA 2C3LA 3UODA 1U46A 3QGWA 4OAVB 2PVHA 3N4UA 2BZJA 1GZ8A 3PZEA 3D7TA 3P7CA 5G6VA 3TZ9A 3DZOA 3GU7A 3OC1A 3WF9A 1OZ1A 3QQFA 4FL2A 3CJFA 4N4SA 2IZTA 3L8VA 5AP3A 5M07A 3HEGA 5DFPA 2C6TA 3EFKA 3D2IA 4BBEA 5FQDC 1PF8A 3VQHA 4KUJA 3QFVA 4NIFA 3SW4A 4IC7A 3LJ1A 4L53A 4MNEA 5D10A 5GHVA 1Y91A 3ZM9A 3F3ZA 5BVEA 3RAIA 3SGCA 1XH7A 5L6PA 1MP8A 5LVNA 5IQDA 4ACDA 2J0IA 3FDNA 2ZB0A 4WNKA 5GZ9A 2YFXA 3LE6A 3QXPA 2WNTA 4FTTA 2C3JA 1TVOA 4DINA 2JEDA 3FHIA 1B6CB 4II5A 3ZEWA 3ZH8A 4ASDA 5EG3A 2WMRA 3OCTA 1MQ4A 2QOQA 1OGUA 3R71A 4AACA 4A9YA 4F1OA 3IW6A 1YW2A 5A4LA 4MF0A 2GCDA 5CSPA 3ZRKA 5FEDA 3UPXA 3MVJA 4DGLC 1U59A 3UPZA 2UZNA 4KNBA 3IPHA 1ZWSA 3MVHA 5E8UA 2RG6A 3FPMA 4G9CA 4FV9A 4Z3VA 1XH5A 4MD7E 4DCAA 5M4IA 1MRYA 1YHVA 2F7EE 2R3KA 4EK6A 5HBHA 5AV4A 4U40A 1UNGA 4QMPA 4FTRA 4QMMA 1JKKA 4O7NA 4NUSA 1PXLA 3BE9A 3OFMA 3DQWA 4IBMA 5EYMA 3F3UA 3CKXA 4U45A 3M2WA 3L8SA 3ZLYA 4C02A 2XK7A 2V62A 2XIRA 2HYYA 4WG4A 4UN0C 2QC6A 2IO6A 5FDPA 4D0XA 3OZ6A 3QA0A 1OIYA 3LQ5A 3IECA 4UALA 4E26A 4E73A 4U81A 3G9NA 4NJ3A 5LQFA 4NL0A 5IQIA 3LMIA 4EZ5A 3ZO4A 5M51A 4JBVA 5DR2A 2QOOA 5IA0A 3H9RA 5H8BA 3RINA 5E9EA 4G16A 3MFTA 4FTNA 3QWKA 3BEAA 2HIWA 2PVJA 5KZ0A 5J1WA 2XMYA 3PA3A 3QRUA 2JDSA 4FC0A 4S32A 4YJSA 4MD8E 3R9OA 3A7HA 5BYYA 4BDCA 3FI3A 2GSFA 1H24A 3ZSGA 5C9CA 2ZMCA 2R3NA 4FUXA 1NT2A 1PXOA 4PDOA 4D2WA 5DBXA 4YO6A 3UNZA 3DK3A 5LARA 1FMKA 4IE9A 4AW1A 4EZ7A 5LMKC 1UKHA 3BEGA 5TKDA 3E5AA 2Z7RA 2YDJA 3NYXA 4WSQA 5CSWA 4EI4A 3LCOA 3VUGA 5LVMA 5D12A 4YURA 1TQPA 2YN8A 3WZJA 3UQCA 2VD5A 4IEBA 3LFBA 5AM6A 3NVKI 1GNGA 2BRMA 3KN6A 4FTQA 3SG8A 4D2SA 3ZFXA 3QRIA 4M66A 1M2QA 5C03A 3GU6A 4I22A 2YEXA 4EWQA 4F7JA 5M4FA 3HMIA 3A7JA 4XS2A 2W1FA 4QP1A 4S34A 5K5XA 4TYEA 4NCTA 4CKIA 3UMWA 2OIQA 3TEIA 5H3QA 5BUIA 5KHXA 3A7GA 5AUWA 3A99A 3KXZA 4S30A 3TTIA 3RAWA 4F0IA 3NNXA 4WO5A 3S1HA 4F1TA 4QOXA 3TKHA 1G8SA 4E20A 4CFVA 1TQMA 1L3RE 1GIHA 4ZTMA 4FGRA 2ZJWA 2QR7A 4FT0A 3EMGA 5EM5A 5FEEA 3AG9A 3AQVA 3OROA 5IQEA 3ZZEA 4DFLA 2BRNA 1CTPE 2YM4A 4E93A 2YLEA 2EB2A 3D15A 5DHJA 4ZMEA 3FJQE 3DT1A 3BU5A 1XH6A 1KE5A 1XR1A 3AD6A 4U44A 3GQLA 2WU6A 2GS7A 5F95A 4I23A 4IJ9A 3KA0A 5IQBA 2WXVA 3G0FA 2BVAA 2VO7A 4KIQA 1BL6A 4RSSA 4FG9A 5I4NA 3A2CA 3W10A 1REKA 1Q8UA 4NCTC 4YGAA 2J0LA 2QD9A 2X2KA 4IWDA 1Q41A 4AA5A 4K11A 4R3RA 4FTLA 2Y9QA 2HCKA 2AC5A 2YIXA 4FTCA 4JI9A 4OT5A 5HNIX 3C7QA 1DM2A 2X8IA 5AJQA 4XG2A 5ETFA 1IG1A 4GIIA 3CD3A 5EQPA 2QCSA 2JAMA 4ANLA 4KS7A 5CQUA 2UZWE 3VS7A 2O64A 5CT0A 3E3PA 5EKNA 5HORA 4J1RA 4MXXA 5HE1A 5E90A 2XK4A 3TJCA 1PRYA 3FEGA 2OIDA 2WTKB 4G1WA 1BX6A 1ZRZA 3VNTA 3TJDA 3VBQA 1PXKA 4TYJA 5FRIA 4GVJA 3ZO1A 4D4YA 3ID6C 4IAIA 5AUYA 2IWIA 2WEIA 2OXDA 5E8XA 2KTYA 3COHA 5HTCA 5K0XA 1Q8ZA 4F0FA 3DY7A 4C3RA 3L8PA 1QCFA 1J7UA 4L42A 2PUIA 2Y7JA 3E64A 4FMQA 5CYIA 3QAME 3EL7A 4OTRA 3VBYA 4DEEA 2OSCA 3PJ1A 4O0SA 2VWYA 2CKQA 4YHTA 5EOLA 4QO9A 3RK7A 4C62A 4C4HA 4FGBA 4YJOA 3NW7A 3JVRA 4IX5A 2WB8A 5ETAA 2X4FA 3COKA 3FLNC 4IB0A 3VBWA 3C4XA 3TIZA 1BKXA 4ZP5A 3FI4A 3C5UA 4NTTA 5DMZA 3E8NA 1OI9A 4N6YA 5JK3A 2JDRA 4AG8A 3EB0A 3TT0A 3QTWA 2R3MA 2OJ9A 4FV5A 4AQCA 4XYFA 4IWQA 1YXXA 2QQ7A 1V0PA 4HCTA 5AX9A 2YM5A 1XKKA 3D5XA 5H2UA 3UIMA 2Q83A 2C5VA 3VJOA 4PP9A 5B2LA 3PIZA 2BDFA 2QG5A 3C4EA 3QHWA 1JQHA 5AUXA 3WF5A 1OKYA 4BDBA 2FA2A 4DFBA 2UZTA 4AAAA 2UZVA 3ALOA 5TOZA 3BYUA 5GZ8A 2QONA 2GNFA 3DAKA 2PMOX 5HTBA 4BR3A 5HIBA 2EXCX 2HZNA 4C4EA 4AGDA 4QTCA 3PVBA 2V22A 4W9WA 2PUNA 4PNKA 4J52A 5DRBA 3GBZA 4QMZA 2FB8A
chains in the Genus database with same CATH superfamily
4M68A 4OTGA 2YM7A 4FNYA 2Z7LA 1OVEA 1FINA 4PL3A 4F7LA 3IDPA 4XV3A 4D9TA 2UW8A 2VX0A 3LAUA 5CX9A 4ANNA 5IA4A 2W9ZB 5KBRA 3SVVA 3EQCA 1J1CA 3A7FA 4QNAA 2UZUE 3RCDA 4D28A 3R7YA 3KFAA 4FI1A 4KRCA 3ZXTA 4BZNA 3GFEA 3HA6A 1ND4A 2WMUA 4AZEA 4TYGA 2XJ1A 4IM0A 3Q04A 4WUNA 3PXYA 4IQ6A 4E4XA 5T68A 2ZV8A 4MQ2A 2GNLA 5KUPA 1W82A 4E1ZA 3BLQA 4U3YA 2UW6A 2ZB1A 4FKVA 4RIXA 4AA4A 1O6YA 4AGWA 1P4FA 4YJQA 3H0ZA 3NLBA 3NYOA 3OY1A 4K33A 4L3JA 4QPMA 5FXSA 4B99A 5C26A 3LQ8A 2GDOA 5CANA 4CMOA 2A27A 2UW0A 4EZ3A 2VTIA 3KK8A 3ETAA 3KXXA 3R73A 4LL0A 3GU4A 5EHYA 4FODA 5FD2A 4YO4A 4ORKA 4J53A 4DGOA 4J95A 4K8AA 4R77A 3V5QA 4JMQA 3CGOA 3G33A 2H6DA 4EUUA 3CQEA 1BUHA 3R8ZA 2C68A 2OJFE 3G2FA 4OTDA 2CGXA 4ZLZA 2CGVA 3ORZA 1OUYA 4OW8A 5AA9A 3R8UA 4I20A 5HESA 4MXAA 3OCSA 2W96B 3QL8A 2ITWA 5HBEA 1WFCA 1G8JA 5AA8A 4IVBA 2BDJA 4HZSA 3QTSA 4XOYA 4BIEA 2JDTA 3E8CA 1URCA 4UWCA 3QHRA 5DRDA 3DXPA 4UMTA 4O38A 4QTDA 2FGIA 2FYSA 3DV3A 3ODYX 2CNQA 2Z02A 4BIBA 4G3FA 5HX6A 4AZFA 2FO0A 5TT7A 3FMKA 3C9WA 2R9SA 1SYKA 1XBCA 2ETKA 3D7ZA 4I0RA 4YNOA 4HGEA 4TNBA 5ETCA 3QGYA 3ZC6A 4FSQA 5DLSA 2JKOA 3JXWA 3PPJA 1GZNA 4EC9A 3FZSA 4BHZA 4EC8A 2VNWA 3BV3A 3QTXA 5FUTA 2R3JA 5C27A 2XAMA 3CXWA 3UC3A 3QBNA 1KE7A 3R7GA 4YZBA 4EOIA 5IQGA 2ERZE 3NPCA 3DQXA 2YWVA 3KEXA 5AP0A 3VUKA 2YHVA 3B8RA 1ZYLA 3U9CA 4IX6A 5HLWA 2WMQA 2ZMDA 4O7YA 4FICA 4QD6A 3FLZA 2PZ5A 2JKMA 3EN4A 4QMLA 3RI1A 1Q62A 3P5KA 3TV7A 4H3QA 5ANJA 2VO3A 3FMMA 4GJ2A 5CALA 2ITTA 4DH8A 3PIYA 5J9ZA 5LWNA 2WO6A 4D9UA 5IMXA 2CKOA 4BDIA 5TO8A 3BYOA 3FZ1A 3ORXA 2ZDTA 5LXMA 2UW4A 3LXPA 3QLGA 4ZS0A 1OKWA 4RIYA 5DR9A 4RWJA 1V1KA 5FM2A 4C38A 2R0UA 4RRVA 2Y6MA 4D2RA 4X2FA 4JNWA 3M1SA 3I5ZA 2I0VA 2JKQA 3HRCA 4RVMA 3PPZA 3HV4A 4X7QA 2CNVA 1LUFA 4JOAA 3FL5A 2YLFA 5A4EA 5AX3A 4TWOA 1OB3A 1K2PA 3VUHA 4QTBA 1RE8A 2X6DA 5GZAA 4FG7A 3PSDA 3I7BA 3ZU7A 3QCXA 1XMLA 4PL4A 3TUBA 3DZQA 2OLCA 4M69B 3Q6UA 4DH1A 3MPAA 4TWPA 2IVVA 2R4BA 4FIEA 4O7SA 3TDVA 1PXIA 4CXAA 5EKOA 3AT3A 2HZIA 3MA3A 3EKNA 4QMNA 4IJPA 3RVGA 5A9UA 5EYCA 4MBLA 4C4GA 2GTMA 3BHYA 3AMYA 3BHHA 4YHFA 3WYYA 4DEIA 5I9ZA 2W5AA 4YLLA 4TRLA 5KE0A 2PWLA 1R39A 4Q9SA 3V51A 5CVGA 2O63A 4W4WA 4ACMA 3U4WA 4ZSAA 1JWHA 5CU6A 2OF4A 3SLSA 4JIAA 3WBLA 2CLQA 3R63A 4C3FA 2HXLA 3CGFA 4U8ZA 3ULIA 3KB7A 4MD9E 4FBXA 2CLXA 2B1PA 3F5GA 5ACKA 1PXMA 4E4MA 4B9DA 4W4VA 2AQXA 1YWVA 4ITHA 3E3BX 4ASXA 4BCFA 3UO4A 3ZDIA 2BAJA 2YABA 5EW3A 4XG6A 5EW9A 2GNIA 4DGMA 4B0GA 4MCVA 4IWOA 5BPYA 3PPKA 2YCRA 1XO2B 2GMXA 4FSTA 4TN6A 1NVRA 4ZSJA 3SHEA 1G8KA 3MH2A 2R3HA 4MX9A 4CYJA 2YM6A 2FSTX 4FV0A 5FBOA 3R8LA 1ZY5A 3R9RA 2QKWB 3CKWA 4YPSA 1JKLA 2QOCA 3F61A 2PVFA 3GGFA 4IX4A 4JRVA 4UZHA 3RNYA 1G3NA 4UY9A 4AT5A 3HA8A 5AUVA 3DB6A 3KK9A 4R3CA 4FA2A 5L3AA 2B54A 5EI8A 5AUUA 2BR1A 3BGPA 4O1PA 2WOUA 3NW5A 3PSCA 4C3PA 4Q5EA 2GQRA 4YJVA 3EQIA 3K5VA 3O7LB 4BWXA 2SRCA 2HY81 4K18A 1ZARA 4NM5A 3TXOA 3P08A 3EJ1A 2W1ZA 4IFCA 5AP4A 4YPDA 1OL7A 4IH8A 4R7IA 1P4OA 1DAYA 1JAMA 3EFWA 4BICA 3U54A 4I5MA 1M2PA 4AFEA 5TR6A 5D7VA 3CS9A 2W05A 3LJ0A 1LEZA 4Y95A 3VS3A 1TFFA 4O7TA 4F78A 2I0YA 3ZONA 4EOOA 4O1OA 3IG7A 5AAGA 4FKTA 2XNEA 3OS3A 2W0JA 4YC3A 2ITOA 4RJ6A 5AV2A 1S9JA 2HOGA 3CIKA 4FKJA 1SVEA 3RKBA 5BX0A 3VUTA 3NRMA 2IW6A 2UW9A 2BZKB 4Q2AA 4B4LA 4O86A 3DAEA 1ZOEA 2ZM3A 5M53A 4BI0A 3ENHA 3NVMB 5IA3A 2C6OA 4C7TA 3W8QA 3BL7A 5LVOA 3PUFC 2ZAZA 2ZYBA 4GK3A 4QEBA 4CV8A 3BGQA 1IA8A 4F99A 4OTIA 4AUAA 3T9IA 2YAKA 2HZ0A 4TKSA 4NJDA 4WG3A 4EHVA 2R2PA 4C2WA 2X7FA 3IW8A 4DFXE 5CAOA 5LOHA 2OBJA 1YI3A 4DFYA 3EOCA 2QHNA 3NEWA 5E91A 2QG7A 1H27A 2G2HA 4BCOA 1K3AA 2VTLA 3E8EA 3U4UA 2NNWB 4GK2A 3LFQA 1FGIA 2JFLA 2XJ0A 5CEIA 3TKUA 3A8XA 4BJJA 1UV5A 3D7TB 3E92A 2ONLC 4RLKA 3DDQA 3W32A 5G1XA 5HCXA 2XIZA 3R30A 1A48A 3PA5A 4WKQA 3L9MA 4TYHA 2IVUA 2OK1A 4LMUA 4QMSA 4EKLA 3SKCA 3R1NA 4EL9A 3TUDA 5TE0A 5DWRA 1H1SA 3LPBA 1YVJA 3GT8A 4YTIA 4NIFB 4AW5A 4EK3A 5J5SA 2JKKA 3LFCA 4MNEB 4RX7A 5EI2A 4RA5A 3VAPA 4AT4A 3TG1A 3G15A 1ATPE 3NAYA 3R7IA 5HVJA 4O2ZA 3K3IA 5HI2A 4TZRA 3QTIA 4KBKA 3MY1A 4MWIA 4R7HA 1HOWA 3VW8A 4AXCA 4M84A 3OWJA 4Y5HA 5IF1A 4YJRA 4DT8A 3L9NA 1OKZA 3V5PA 4ZY5A 3O23A 5EM7A 3D83A 3NIZA 4UMRA 3IO7A 5AR3A 4BRXA 5EQEA 3BIZA 5AR2A 3SG9A 5HHWA 3EZVA 1FVRA 1JPAA 2GNHA 3ALNA 4U6RA 4BBMA 4DF3A 2B7AA 3LLTA 3VRZA 3TNHA 4ZZMA 4FSNA 2JDVA 1GIIA 2J5FA 2XEYA 3Q4UA 3F3TA 1OL1A 3R1QA 2VU3A 5CF4A 4UXQA 1Q8TA 1PYXA 4QMVA 4MHAA 5J1VA 3O5AA 3MDYA 3SDJA 1MQBA 2CN5A 5FEQA 3TNIA 3EHAA 3DBQA 4PX6A 4AN3A 5AV0A 3JS2A 4D5KA 4YZDA 3FWQA 3KQ7A 2OJJA 4XUFA 3FBVA 4EH4A 4W4XA 2XCKA 2ITQA 3MVLA 3PWYA 3Q5ZA 4ACCA 3FMNA 4Z16A 2ITVA 1PW2A 4CFFA 4LYNA 2IEWA 4XNEA 4E7WA 2E9OA 2RSVA 3NAXA 4HVDA 4DG2E 1XHAA 1XBBA 3O2MA 3QA8A 2VTMA 2B4SB 4OBQA 3DBFA 2XP2A 4L45A 4ZSEA 4BVUA 5FP5A 4GMYA 4ZTRA 3KXHA 4CCBA 2AEGA 1T46A 3HAMA 5EQYA 3KCKA 2I1MA 4LDTA 4UMQA 5IQCA 4KIPA 4MAOA 4ZJVA 3DS6A 3W2QA 2OJGA 3IW7A 4R8QA 4F65A 4C4IA 3U6IA 5A46A 5KKRC 2WMSA 3Q60A 3PFQA 3CJGA 4YNEA 4GYGA 3VVHA 4DLIA 1YDTE 4DG3E 3LHJA 2CCHA 1XH9A 2WHBA 4E8AA 5LJJA 2CGUA 4G34A 5AUZA 5J7HA 2OH0E 3OW3A 4D1XA 3P78A 4MBIA 2VTJA 3WF8A 4AZWA 4O4EA 3WZKA 3PFYA 3RZFA 4XG8A 4FE2A 3E88A 2ZV9A 3DLZA 4ZAUA 5I5ZA 4PDPA 1NY3A 3MI9A 3OY3A 5BVOA 3W0QA 3VIDA 3K5UA 3NFGB 2C5YA 3COMA 4TL0A 3CQUA 4ZLOA 4CG9A 3OTVA 3ZSIA 4M0ZA 3U9NA 3PE2A 2J0MB 3CTHA 5K9IA 3VHEA 3PRIA 3Q3BA 1YXTA 4UYAA 4DBXA 3QD4A 5F1ZA 2WZJA 3UGCA 2JLDA 4AOIA 3LFAA 3R0TA 4FT3A 3OBJA 4PPAA 5BMMA 3N4TA 2XJ2A 3IGOA 4X21A 3EN7A 4L9IA 4CSVA 3AGMA 4O21A 3U6JA 3VHKA 4F63A 1FBNA 2BTRA 4O0YA 5HEZA 3QZIA 5CU0A 3UOHA 1BI7A 2VZ6A 4X3FA 2Y0AA 3DAJA 4NZWB 5JKGA 3QQHA 4AE6A 4FKGA 3R8VA 3PSBA 4RVTA 4AXDA 2XNNA 4FT5A 4QP3A 2ITXA 4RC4A 3OF0A 4AS0A 2VV9A 3GC8A 3V6RA 2WMBA 2W4JA 3ULZA 2HAKA 3AC8A 3W2CA 5CQWA 1T45A 5HCYA 3R9HA 1H1QA 2CGWA 3F5PA 4WNOA 3P7AA 3Q9WA 2QODA 5BNJA 5DE2A 4O0RA 1YI4A 3CY3A 3BHTA 3Q96A 4K0YA 3RBWA 3VC4A 2ZM4A 4BWKA 3NUYA 4AF3A 1M17A 2HWPA 1Q99A 2AYPA 1BYGA 5A6NA 3FI2A 3RHXA 3GENA 3W1FA 4IXPA 3O50A 4B6LA 4RA4A 4QMQA 1PJKA 3FPQA 4CNHA 4B7TA 3G6GA 1OM1A 2Y8OA 3FE3A 4GG7A 5J87A 3THBA 5A54A 2G01A 3LMGA 4EOLA 3EH9A 4EH6A 2HY0A 2NRYA 4FUYA 2WIHA 4FYNA 2YM3A 4JDKA 4BIDA 5EYKA 3ZRMA 2DS1A 2RIOA 4IWPA 4X3FC 5LMKA 5E8ZA 5AV1A 4U41A 4IANA 5DT4A 3VUMA 3MW1A 4DTKA 5KHWA 3R8PA 1XH8A 4LUDA 5AIKA 3R6XA 4HZRA 5IZFA 1RJBA 3QUPA 4O84A 3OXZA 3P86A 3R21A 4K9YA 4EOPA 4O0XA 4NM7A 1Y8GA 2W17A 3DDPA 5CI7A 2BIKB 4I4FA 2UZDA 4BY9E 3GU5A 3JVSA 4M8TA 2VTHA 3GUBA 3ZFYA 3PG1A 4OLIA 2X4ZA 3QD2B 2BAQA 5L6WL 3UO5A 2E9NA 3D5VA 4X0MA 2FUMA 3ATTA 4DA5A 4JG8A 1J3HA 3RPYA 1TZDA 4TYIA 2QO7A 4AXAA 2HW6A 4CKJA 5GIOE 4O91A 4HGSA 4MNFA 5CZHA 4A9SA 4DEBA 2XRUA 2VRXA 3G5DA 3OOMA 4KIKA 4LFIA 5KMOA 1XJDA 3A60A 2PVYA 5F9EA 5JFSA 3NUPA 4LUEA 4L3LA 1JSTA 2CJMA 2YDKA 2PSQA 3MVMA 4PTGA 2RFNA 5CSVA 4H39A 4QP7A 3BLHA 3NUUA 2A0CX 2C47A 4AE9A 3FMLA 2XIKA 3LCDA 4G9RA 5FBNC 2IZUA 3R1YA 3LQ3A 2BZHB 4FEUA 2Z7SA 5C8KA 4TW9A 3WF6A 3QD0A 3QWJA 1CDKA 2IG7A 5J9YA 3VO3A 2QKRA 2H96A 4FKQA 2BKZA 1OITA 4O83A 3JUHA 4USDA 4AW0A 4XG9A 3JY0A 4FTIA 2OGVA 3QKLA 2C6KA 1KWPA 4UEUA 3TL8A 5EW8A 4BDEA 4C0TA 3B2WA 4FIGA 3OCBA 1Q24A 3U87A 5AP5A 4BCQA 1W2FA 3I1AA 3E62A 5C1QB 4ZTHA 5HO7A 3Q9XA 3FLSA 3UP2A 5I9VA 2YCQA 3QQUA 4GUEA 1F0QA 3RAHA 3BBWA 5J8IA 4FV7A 4BCHA 4RPVA 3ZLWA 4JR3A 4D5HA 1FVTA 1VYZA 4D2TA 1APME 3F2AA 4BDFA 5AEPA 3MBLA 2DYLA 2PE0A 4FZ7A 1ZOHA 2QURA 3QRJA 4XEYA 3KMMA 4U3ZA 3ZCLA 4OGRA 3UE4A 4IW0A 3MSSA 4U80A 2OU7A 2WTWA 4CRSA 4EHGA 3I7CA 3K2LA 3JR1A 5IQHA 4FV6A 3P79A 1Q3WA 3GEQA 3MYGA 4QQ5A 4QYGA 4CLIA 4M67A 4XBUA 3FKLA 4G3EA 4WG5A 4PMPA 3I81A 5CEKA 2XF0A 3ENMA 2AUHA 2W1DA 1ZZLA 4JVGA 4ZTQA 4F08A 3VS6A 4CZTA 3UDTA 3UVQA 3HLLA 3O8UA 5F20A 3HUBA 2JD5A 3Q32A 4AX8A 4R7BA 4IFGA 1YHSA 5KMLA 5A14A 4JXFA 1OL2A 3FMEA 3LKMA 2Q0NA 4W8DA 4NYEA 2EXEA 3NMUF 5AR4A 3ZEPA 4DEDA 4LMNA 5J79A 3CEKA 2XNBA 5EM6A 5AM7A 2J7TA 1W98A 2VX1A 3OMVA 3IK3A 5LMAA 5I9YA 3KXNA 1CSNA 2BUJA 3QX4A 1XQZA 3ET7A 4FVQA 3UZRA 2F7XE 2J4ZA 4RIXB 4X2KA 1ZZ2A 4RFZA 4C35A 3PVUA 2RFEA 5L2IA 3QXOA 3TCPA 4U0IA 4V04A 3L1SA 4JAIA 4B8LA 3LMHA 3KRLA 1KSWA 4Y73A 2XANA 1OPKA 1WVYA 2QOHA 3PYYA 1M7NA 3NGAA 3BI6A 4L67A 3E87A 4RC3A 3VS0A 3WIKA 3E63A 5KMJA 2UW3A 2ZV7A 2GS6A 3QD3A 3C51A 1LPUA 1I44A 1QPCA 4XP0A 2CNUA 2O65A 1YKRA 1YOMA 3BRBA 4XLVA 2Y4IC 4EOQA 4QPAA 4UV0A 3SC1A 3FI8A 4Y72A 1A9UA 1Q4LA 3V5TA 4ERKA 4BGHA 3WYXA 3JY9A 4FKLA 3NFFB 5I3OA 4M13A 5CSXA 1JSUA 3AD4A 1OECA 4YTHA 1VJYA 2YISA 4UMPA 4I24A 2GNGA 3OD6X 4J8NA 4OT6A 4BKZA 3FQEA 5C4LA 1R78A 2PU8A 3BQCA 4QRCA 4HNIA 2XNOA 4RLLA 5GJDA 2VWUA 5FGKA 4F9CA 5GIPE 2J9MA 4GEOA 2FSLX 4JAJA 4OTFA 4RWIA 4CTBA 4YUQA 3RHKA 2XALA 1A06A 4QTEA 4QP4A 3TV4A 2XM9A 3VUDA 2C3KA 2HWOA 3F69A 3FMJA 4EOJA 3HMMA 2XM8A 2XNMA 4RJ7A 3OG7A 4FKWA 4RWLA 3E93A 3KCFA 2WELA 4YTCA 4HGLA 5IA5A 3NS9A 3I79A 4I6BA 1JKSA 5DIAA 3ZLXA 4D4VA 4O6LA 2H8HA 4FV3A 2VWBA 3FZOA 3MGYA 4YJPA 3HUCA 5ANOA 1ZLTA 5AP1A 5HOAA 3ZYAA 4EK4A 1KV2A 2WMTA 1YXUA 2WQNA 3H0YA 3PXKA 3ZS5A 4YJUA 3IONA 3E8DA 4RX5A 2Z8CA 1H1RA 4RJ5A 2H34A 2Z7QA 3LFNA 4O0TA 5EHLA 4K1BA 3R2BA 4I41A 5DG5A 4H3PA 3Q4ZA 4KBCA 3GCPA 3VS5A 5CXHA 4EONA 5IEXA 3CTQA 4P5ZA 3QQJA 3TZ7A 2DWBA 1JBPE 3RPSA 2UZLA 3QYWA 2XH5A 1ZOGA 5HGIA 3TV6A 4E5AX 4FEWA 4OBOA 5DN3A 4RIYB 2PZIA 3IW5A 4F7SA 5K5NA 4ARKA 1OGYA 1CMKE 3MV5A 2R3IA 2VWIA 3OOGA 3KMUA 4R5SA 2GFCA 1FPUA 1H28A 3TZ8A 4DLJA 1W7HA 4I3ZA 2E9UA 1KV1A 2G9XA 2EUFB 2O2UA 4OTPA 1DAWA 2UUEA 4KRDA 4O22A 2WMWA 1U54A 3MH1A 4ZY4A 1SZMA 3QUEA 3EQPA 5K4JA 2XNPA 4FL3A 3QRTA 3UO6A 3WIGA 5CS6A 4A06A 4BZOA 3I4BA 3ZTXA 4ITIA 4K2RA 4CGAA 2CHLA 3DU8A 2I40A 3Q53A 3UDZA 2CCIA 4H3BA 3PE1A 2VAGA 2R0IA 3A4PA 3ORPA 3MFRA 3SQQA 1OMWA 4FKPA 5GJFA 4MYGA 5IDNA 2GQSA 2PY3A 4U7ZA 4EKKA 3LVPA 2WTDA 4WD5A 4ZOGA 5FTOA 4RZVA 4OBPA 2HK5A 1WVWA 3SRVA 4CFMA 4S31A 2W5HA 4U5JA 2A2AA 4A4OA 2BMCA 2R3GA 2X2MA 3F9NA 4BDKA 3HL7A 3TNQB 1J91A 4CRLA 4A07A 3AKJA 5M55A 1B38A 2CPKE 1WBWA 3R7OA 4DYMA 4LL5A 2VTQA 2EB3A 4DH5A 4YLJA 3HYHA 4G6NA 4L52A 4BDDA 5DYJA 2C6IA 2NRUA 3H30A 2R3PA 3ZBXA 4IM3A 5A4QA 4IZ5A 1Y6BA 2IVTA 1EH4A 1XBAA 4JBPA 4QMUA 4MXZA 4JDIA 4F9AA 1M2RA 1H8FA 4CVAA 5J5TA 2CDZA 4LM5A 4GFMA 5JGBA 3TUCA 4V01A 4HW7A 3NZ0A 2R3FA 4PDSA 4C34A 3AC1A 4X2GA 3DOGA 3KRRA 3W2SA 5AR5A 1LEWA 2WD1A 5CZIA 3SOAA 2PE1A 3UYSA 4LOOA 3QQKA 2WMAA 3HGKA 4PL5A 3OCGA 1PMEA 3EIDA 1YQJA 2C3IB 4I92A 2W1IA 4JL9A 2O8YA 4BDJA 4ZS4A 2R64A 2IF8A 3EN6A 4Y83A 5D7AA 5F94A 4EH5A 3NNVA 5BV3A 4J97A 4RFMA 4KB8A 1WBVA 2QHMA 3BYSA 4GU9A 3PXFA 2UW5A 2C5OA 3H9FA 4E6AA 2BTSA 3OEFX 4IAKA 5DI1A 3DFCB 4L8MA 3I6WA 1UKIA 5JZNA 5IPJA 3ZO2A 3WI6A 4QYEA 4RJ3A 3C4CA 3R7EA 4BTFA 5DPVA 4DCEA 1GIJA 3PVGA 3ZOSA 4IAFA 3BLRA 4JG7A 1PY5A 1CKJA 1RQQA 4BKJA 4QMXA 1ZXEA 4GG5A 3LIJA 3QC4A 2IN6A 2OKRA 2CKEA 2PL0A 3MH3A 5CNOA 2WTKC 5AIRA 4X6QC 5JQ5A 4K6ZA 3RK5A 4E5BA 5JQ8A 3GFWA 3GNIB 4D4RA 4R78A 2XK8A 4GCJA 4OUCA 1IAHA 5JT2A 4IMYA 1AGWA 4U79A 2PMIA 4GKIA 4YTFA 4ZJJA 4Y8DA 4P5QA 5HU3A 5M06A 3SXSA 1Z57A 2FH9A 4WNMA 4BWPA 4EHEA 3WILA 4JLCA 2RFDA 4TY1A 2GPHA 2B53A 1KE9A 2WQOA 3DJ5A 4I1ZA 2C6LA 3F88A 3RPVA 2C0IA 4FSZA 4BDAA 1Y57A 4QNYA 4E5WA 4FZ6A 4FZDB 3MESA 5BQ0A 1NW1A 3PDTA 2BIYA 2PUPA 2W9FB 1IA9A 4HYHA 4O7LA 1K9AA 2CMWA 2YZLA 3ATSA 2OXXA 3CC6A 4NFMA 4PPBA 3UIXA 4P2KA 4ALWA 4I93A 3KVXA 2NP8A 3SOCA 3T8OA 3Q52A 3DCVA 4CZUA 4BJJB 3CCNA 3AT4A 5KO1A 1YWRA 2UZOA 1VYWA 3KULA 2X2LA 3NCGA 3FY0A 3QALE 4NEUA 1YXVA 4KS8A 5J95A 2QO2A 2YZAA 5T6KA 3WARA 3EFLA 4N6ZA 2I7QA 3BHUA 3D94A 4QP2A 3F7WA 4TYHB 3QF9A 4ZK5A 2W7XA 3BE2A 3FQSA 1NXKA 3WZUA 3VN9A 1WVXA 1VR2A 4XBRA 1PKGA 2A1AB 3MJ1A 3E7VA 4OTHA 4AGCA 4RX8A 5CY3A 4HPUE 1CKIA 5E92A 4ANMA 2HELA 3IS5A 4GT4A 3W2OA 4Q9ZA 4Q5HA 5HO6A 1YDSE 3EN5A 4D2PA 4BI2A 3BGZA 3OUKA 4R3PA 4YJNA 5CEMA 2OG8A 4X2NA 5JMSA 3UOJA 3RJCA 2PUUA 4BF2A 3BYVA 4ZSGA 4NT4A 3KKVA 3UP7A 2VTOA 4YSJA 5BMSA 3UDBA 3P4KA 1Q61A 4WBOA 2BFXA 2WEVA 4M97A 2LAVA 5I9XA 5KKRB 1HCKA 3U8WA 4FV2A 4BC6A 3WOWA 4ANQA 3UQGA 4ACGA 1WBPA 5BVNA 3P0MA 3V6SA 4A4LA 3RNIA 5CENA 3PLAE 3ML1A 4PRJA 1Q8YA 4XLIA 5D1JA 5CU3A 5L8LA 4FJVA 2X8EA 1ZYSA 2PZPA 2REIA 3HV5A 3NNWA 4G5JA 3D5UA 5HTIA 4CG8A 4DBNA 4KA3A 3DB8A 4U42A 2VTTA 4ANSA 3C5IA 1R1WA 3PP1A 3ORLA 5GJGA 2RFSA 1NA7A 3VULA 3FMHA 4FNWA 4BDGA 4EQUA 3QCYA 4R1VA 2VN9A 2Y6OA 4J71A 4O7WA 1ZMWA 3WE8A 3KVWA 4APPA 3BL9A 2XIXA 1OPJA 4YBJA 4ZTLA 4WT6A 1Q5KA 2P2HA 4WBBB 2ONLA 2YJSA 3HV7A 4FOCA 4B8MA 3MTFA 3TWJA 3AC3A 5H8EA 1CKPA 4W9XA 2OWBA 2R5TA 4XX9A 5EDRA 4F9WA 4ZIMA 3D0EA 1PMVA 5D11A 2PMNX 4EBWA 3EKKA 2JIVA 5ACBC 3TDWA 2G1TA 3BYMA 3QZFA 4DFNA 3BWFA 2OJIA 1UU8A 2QVSE 3ITZA 4G17A 3O51A 3FZPA 2BRBA 2A98A 4N0SA 2ACXA 3DKCA 3PA4A 2YCFA 3VW6A 4AGUA 3IDBA 5L2QA 4KSPA 3ORTA 3R28A 1UU9A 3C0GA 4BTJA 3POZA 3O17A 5L2TA 4UB7A 1ZYJA 5HNGA 2C30A 4WOVA 3W33A 4WRGA 4BCMA 4H05A 3QKMA 5B2MA 3A61A 3K54A 1P2AA 3VS1A 4ANOA 3H9OA 2UW7A 2XYUA 3RP9A 3FAAA 5FWKK 3LFSA 3HMNA 2Z60A 4FTKA 3NX8A 2YACA 2BRGA 4GW8A 1XMMA 3PTGA 5E1SA 3B8QA 3D5WA 4OTWA 2ZVAA 4QYHA 5FTQA 2P2IA 5CXZA 3BV2A 3OUNB 3ZC5A 3NUNA 1WBOA 1STCE 3R02A 4KWPA 4R1YA 5CLPA 4GYIA 5HE0A 2C6DA 1DS5A 4QQTA 1U5QA 2OFVA 1NVQA 2OXYA 3DPKA 5L6OA 2VWZA 4JG6A 2VTNA 4X3FB 3RPRA 2QNJA 2PPQA 2EXMA 2XK9A 3RCJA 4ZZNA 2C0TA 2XB7A 5BUEA 4RBLA 4CQEA 3QLFA 5DH3A 5EH0A 5CNNA 2F9GA 2O0UA 4BI1A 1KE6A 4JDJA 4ERWA 2QU5A 3N9XA 2P33A 4JQ7A 3G51A 4F0GA 4R5YA 3FZTA 3QC9A 1OPLA 3N51A 3TN8A 3KL8A 4ZZOA 5KX8A 3IDCA 4RIWA 4XG3A 4RQVA 2ITPA 3KN5A 2OO8X 2VO0A 4J98A 1ZY4A 5HG8A 3ZHPC 3VF8A 4CFXA 2V7OA 4NSTA 1UA2A 5HVKA 4CT1A 1GZOA 4FOBA 4OTQA 4WNPA 3ZBFA 2JIUA 2BAKA 4GFGA 4O27B 4CFUA 3MWUA 4DGNA 3RALA 4E3CA 4EWHA 4I6LA 3S95A 1WBNA 4FZFB 3DK6A 4JBOA 4FT7A 4XJ0A 3QQGA 3AOXA 4FEQA 4GH2A 3R9DA 4BFMA 3UIBA 1R0EA 3RGFA 3VS4A 5E4HA 1IR3A 3A62A 5B0XA 4DDGA 4M12A 4XOZA 1E9HA 3ORNA 3SXRA 4QQJA 3S3IA 1O6LA 4C37A 1J1BA