3NX8A

Human camp dependent protein kinase in complex with phenol
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDINHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Experimental and computational active site mapping as a starting point to fragment-based lead discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 106
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nx8A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nx8A02
1KE7A 3OXZA 1FPUA 3UQGA 3VJOA 3Q9YA 4S31A 3FPMA 2Z8CA 4ZY5A 2RSVA 3G51A 4II5A 4BKJA 4EH3A 1OVEA 2QHMA 5G1XA 2OKRA 4O21A 3PLAE 3PPKA 1Z57A 2OJJA 2YAKA 3OP5A 5AJQA 3EQPA 3OFMA 3QCSA 1WBTA 5IISA 4O6LA 1U54B 4D4SA 4EH8A 2VO6A 4QP8A 2ZJWA 4KSQA 5CU3A 5FLFA 4A9TA 4NSTA 1GAGA 3VF8A 4C2WA 3S0OA 4RX9A 2JBOA 2PZYA 5IQEA 4NIFB 4C38A 2WQMA 4PL4A 3VBQA 4IWQA 2BROA 1OMWA 4RWIA 1FMOE 1YDTE 3HAMA 4ANOA 4BGHA 5EHOA 2OO8X 2P0CA 2QG5A 2FYSA 3FMDA 5AM7A 3PA5A 4JS8A 3R00A 1R0PA 5JN2A 3W8QA 3ZZEA 5HIDA 4HCUA 3UO5A 1XH7A 4GVJA 3LFFA 3MWUA 5E92A 4MYGA 2B9HA 4FYNA 2QOFA 3OXIA 3W2SA 4LRKA 4IVBA 2H6DA 3F9NA 3R28A 4WT6A 5HTBA 2XJ0A 5GJFA 3S2PA 3HRCA 4DEAA 5M57A 4GMYA 5HESA 4BC6A 4IEBA 3IOPA 4BI1A 2GHLA 1XH8A 3QYZA 1OPKA 5AV2A 3ZM9A 4ZLYA 3VW6A 3OBGA 4LL5A 2J0JA 1YHWA 2J51A 3BWJA 4FVQA 2ETKA 4BY9E 4L67A 2WTKC 1M52A 1R78A 5AEPA 2QKRA 2QU6A 4ZTSA 4FK6A 2UVYA 5DVRA 2YIQA 4DFXE 2VWWA 1YWNA 4FK3A 3W33A 1TQPA 3TKUA 2P2IA 3PXZA 4HYUA 3WF6A 3LCDA 5K4JA 4DN5A 3AC5A 2PZPA 2GS2A 4QOXA 3AC1A 2EXCX 3WZEA 4FSMA 4QTEA 1XWSA 2NRUA 3BE9A 2C5NA 4CFVA 5JEBA 2OIDA 3QALE 2HCKA 3ZUTA 4AN2A 2OH0E 3FZTA 5AWMA 2YDIA 4FKQA 4QMLA 3P9JA 5BX0A 2CGXA 3OOMA 2R3MA 3TIYA 2B4SB 4CT2A 5L2WA 4YURA 3E8NA 5HZNA 4EC8A 4N6YA 4IVDA 3R7YA 1R1WA 2PZRA 3LW0A 3MV5A 4G31A 4GFOA 4HGEA 2BR1A 2WMSA 2XNPA 2QOIA 4IFCA 4IW0A 1Q4LA 3CEKA 4FG9A 3QD3A 3R7GA 4MXZA 3P7BA 4K6ZA 4AA0A 3NW6A 5HD7A 4RLLA 4AP7A 2YCRA 4XP3A 4YJOA 3UE4A 2P4IA 1WVYA 4F09A 2QVSE 3BV3A 4G5JA 4K77A 4AZEA 3RNYA 5EQEA 2YDKA 4X2JA 5L2QA 5IQCA 2F2CB 5IA2A 2IZUA 4R1YA 3Q4UA 3R9NA 3QRJA 2XUUA 3NEWA 4AN9A 3UOHA 3LFCA 5B2LA 2VWXA 4Z3VA 4A9UA 3ENHA 2YWPA 2C5XA 4IC8A 4YPDA 4G1WA 5AR4A 4BKZA 4BBFA 3F5GA 2HY0A 4AW0A 4J96A 3LFQA 4JQ7A 4L7SA 2C6TA 4KNBA 3T9TA 2VX1A 3HV6A 5AUUA 5AR7A 3NW5A 4CYJA 2VX0A 4AGDA 3MSSA 3TNHA 3R2BA 5GJGA 5KHWA 4FKGA 4RIYA 5ANDA 5FD2A 3G6HA 3P23A 4I4EA 5E4HA 3D0EA 2YHVA 4EOLA 4GFMA 4K2RA 1U4DA 2B7AA 3PSBA 5CNNA 1W7HA 3F61A 4FT7A 4X3JA 4BBMA 4N0SA 5CU4A 5B7VA 2BZJA 3R1QA 2HZNA 2C1BA 4MXXA 3DQWA 4TYIA 4PY1A 3VQHA 3PDTA 3AMYA 1Q97A 4XHKB 1A9UA 3OVVA 4HPUE 4NK9A 1XH9A 3KF7A 2HXQA 4EZ3A 4WIHA 1OUYA 3FQHA 3Q5IA 3UMWA 3GU4A 1U54A 4Q5HA 2SRCA 2DS1A 3D5UA 4UZHA 3QA0A 5EM7A 5IQAA 4G3CA 4KKGA 1MRVA 1QPEA 1W82A 2ZOQA 4RGJA 4PF4A 2REIA 4X2FA 5AA9A 4NIFA 1H27A 2BKZA 4ZY6A 3ANQA 2PE2A 5FGKA 1H1RA 3A99A 3KMMA 5I4NA 3FZRA 3VNTA 5LJJA 5DGZA 5M4IA 4ANSA 2JDVA 2JC6A 4BDKA 4C34A 2VO3A 3E7OA 5M09A 3PE1A 3MIAA 2ITOA 4AGCA 3K3IA 2ITTA 2UW8A 3NUAA 3VBVA 3WIGA 4NUSA 3GU5A 3TXOA 3LLTA 4F64A 4RFYA 4RA4A 3LM5A 2JEDA 3MH3A 1DI8A 3PFQA 4UYNA 1YI4A 2QCSA 1H28A 3GC7A 4FTTA 4BTJA 4QP3A 5FBOA 4W4WA 1ZOGA 2VTSA 2X4FA 3ORPA 3CCNA 4FG7A 4ZTNA 4XG7A 2FO0A 3VS6A 4ZTRA 4FNWA 3QYWA 4C59A 4C58A 2XK9A 5EYMA 4R3PA 2QHNA 3HUCA 4XBRA 3OBJA 5I0BA 5C03A 4IHPA 5K0KA 5E8YA 2W5HA 3WE4A 2OLCA 2X8EA 2Z7QA 4FF8A 3UTOA 2R7IA 1AD5A 1KV1A 3F5UA 3GCUA 3DK3A 3RCJA 3PE2A 3JUHA 3WYYA 4C4FA 2YFXA 3PPZA 5HE2A 5I9XA 4XEYA 2WMRA 4YPSA 4WRSA 3VN9A 4BHZA 2XIKA 2BRNA 3FC1X 4AG8A 3V8SA 4N6ZA 2J90A 4D9TA 3R71A 4EORA 4YO6A 4V0GB 2VU3A 3DS6A 3MDYA 5CVGA 1ZAOA 3N4VA 2VTQA 4CFWA 5CEOA 5ETFA 3C51A 4AX8A 1OECA 3IK3A 2E2BA 3GCSA 1MQBA 4MNEB 3ZONA 1JBPE 3HMOA 4A7CA 5BQ0A 3KK8A 3UIUA 4O1OA 3QTZA 5FM3A 4D2WA 3KMWA 3NUNA 3QQJA 3L9NA 1FOTA 1YI3A 4ZTQA 5CAVA 3QC4A 3VUTA 1V0OA 2GS6A 3EHAA 3O7LD 4E5AX 4EHVA 3THBA 4I24A 3RPYA 2Y6MA 2CDZA 2DWBA 5I3RA 3A7IA 4PWNA 4ZEGA 1PYEA 3V5JA 4RJ6A 5F94A 5LWNA 3QFVA 4YNEA 3LMGA 4TWNA 2X39A 5AP2A 4FIGA 4DBNA 1U5RA 5ETCA 4AE9A 2C1AA 1FQ1B 4JAJA 4CLIA 3RZBA 4AOTA 4YLJA 2UVXA 4WKQA 2YN8A 4UWCA 3QU0A 1PKDA 2GNIA 5JGDA 4FTOA 3DAJA 4CZUA 4E6AA 4U81A 4QTBA 4MBIA 4ITHA 5IH4A 5BYLA 2PHKA 3UNZA 1AGWA 5IU2A 4V04A 1JKTA 3Q5ZA 2IW8A 4ZY4A 3VUKA 2IVVA 4YJQA 4J53A 5JSMA 4HGLA 3MS9A 2EWAA 4JQ8A 4FEWA 2OH4A 3RM6A 4WOVA 4DFLA 1DS5A 4XV9A 4FODA 1GIIA 4FV3A 5DFPA 5DG5A 2QOBA 1PMNA 3FBVA 1YI6A 4TZRA 5FTGA 3BLHA 4C0TA 4FSYA 1T45A 3I0QA 4QQTA 4FKUA 3FMEA 3OZ6A 3OW3A 4D0XA 4HJOA 4I5PA 4CQEA 1NW1A 4E26A 5AUWA 4KBCA 4RPVA 2GMXA 3SOAA 4IACA 4QMUA 1Q24A 1UV5A 5EM6A 5C1QB 5KMLA 2VO7A 5IF1A 3PIXA 2RFSA 2X8DA 3MJ1A 2W4JA 2CSNA 3UVRA 2UVZA 3PRFA 3FSKA 4G2FA 4O2ZA 4OTIA 5IKWA 3WZUA 2VTNA 4R7BA 3HRFA 4IAAA 2NO3A 2EUFB 1M14A 3TZ7A 5A46A 3CY3A 4U8ZA 4XV3A 3TUCA 2GNFA 1YXVA 5ANOA 3ORTA 4QMZA 4I23A 3ZO4A 4IAZA 4ERWA 3TACA 1ZZLA 4AWIA 5AR5A 3FE3A 2XJ2A 5KBQA 2ZVAA 4IC7A 3LPBA 5KMMA 3NMUF 4GG5A 4V01A 1ERKA 4ALVA 3EFJA 1ZYSA 4HGTA 4EHEA 1OIYA 4LV8A 4NW5A 5JK3A 3H0ZA 4QYYA 4QMXA 3TTIA 5JFWA 1LP4A 4JI9A 1HCKA 3UG1A 2PULA 3F6XA 4GIHA 3R8ZA 3PXRA 5HO8A 5IEYA 3UOLA 5FXQA 4FL2A 3PZHA 2XEYA 2UV2A 2QI8A 3LQ8A 4U40A 4CVAA 2C69A 2IN6A 3MPTA 5J95A 1FVTA 2O3PA 3C1XA 4F63A 3L1SA 2UW0A 1MUOA 4AFJA 4JX7A 4DGGA 3BGPA 2PTKA 4W4VA 5D9HA 4E4XA 3E8CA 4QRCA 1DAYA 1OKZA 3PWDA 4A9YA 4BCOA 5CAPA 3M1SA 4ANBA 4BWPA 4ANLA 1RE8A 4MF1A 4EONA 4FKVA 2JIVA 4TYJA 1J91A 3VVHA 3NGAA 2Z7RA 4WBOA 4V0GA 3NYVA 1KE6A 4RVKA 3PG1A 3K3JA 1B38A 4MNFA 3EQDA 3S1HA 2R3LA 3JVSA 3BGQA 3D2KA 1ZOEA 5BVNA 3KXHA 4MNEA 2PVNA 3PJ8A 4FKTA 4IANA 5LMKA 2XNEA 3ZCLA 1KE8A 3B8RA 3GOPA 3HKOA 3PPJA 4AE6A 4AQCA 3SD0A 4ASDA 3DXPA 2UUEA 4MK0A 4QMNA 3O7LB 3BHTA 3VUMA 3NDMA 5AM6A 4BDDA 4NWMA 2Q0NA 5LVOA 4RC3A 4BDCA 3ORLA 4BR3A 3DK7A 5HG5A 3JY0A 3QZFA 4BTFA 4IM0A 4D1ZA 2XF0A 4BYIA 1YXSA 1H08A 3MH2A 3KXZA 3L9LA 3FHRA 4FTQA 3PSDA 4YZ9A 2PZ5A 5H8EA 5CYIA 5C8MA 2NPQA 4AZWA 4ZIMA 2OJFE 3FXZA 3G9NA 4I6BA 1YW2A 2W1GA 3CTJA 3GC8A 2BRBA 3RHXA 3SOCA 4O0WA 1NVRA 3WZJA 3PY3A 2E9UA 4FTCA 3ORZA 4KSPA 1PYXA 3O51A 4JR3A 5LVLA 4D9UA 4AS0A 4I0TA 5JFXA 5IH5A 2VTJA 2OZAB 4X6RA 3MFSA 2WMXA 1M2QA 1H25A 1QL6A 3Q3BA 2J50A 3L8PA 3SW7A 2J5EA 1ZARA 1O6YA 2W4OA 3A61A 3C5UA 4X2GA 3UVPA 4BCJA 4MXOA 3ZFMA 4S30A 5KMOA 5JFSA 3DK6A 3QRTA 5J7BA 3VS1A 4AFEA 2CKQA 3UPZA 2OXDA 4BTKA 4BVUA 3DZQA 1GZNA 1PXJA 4M3QA 3MFUA 5LVMA 1ZWSA 4DC2A 3TL8A 3R2YA 5AR8A 3SG8A 2QNJA 4GT5A 2WIHA 2FGIA 4C4GA 3CGOA 1OBGA 4R1VA 4TW9A 3D9VA 2X7GA 3CP9A 4ZXTA 4BCQA 3R7UA 4RJ4A 4GCJA 5F1ZA 3VBXA 4CTBA 2G15A 1BL7A 2GFCA 2XCHA 2OWBA 3HZTA 4QMPA 3SXFA 2EU9A 3T8OA 4FTUA 4MX9A 4BCIA 3FWQA 2BTSA 1V1KA 3BYSA 4KBKA 1E1XA 3GB2A 4FI1A 4X6QC 4ACCA 2JITA 2QO2A 1ZY5A 3GOKA 2XMYA 3FLQA 3BEAA 3BU6A 4FBXA 2OJIA 4IZ5A 2EVAA 4ENXA 5C9CA 4DLIA 3VWAA 4HVIA 1ZMWA 4O82A 5JFVA 4ZOGA 3QTWA 3RM7A 3IW5A 2FSOX 2YM8A 1HCLA 4F6UA 1DM2A 4Z7HA 2GHGA 2W4KA 2XK8A 2RFEA 4BDAA 3RALA 5F9EA 4FSRA 1ND4A 2YABA 3PVBA 3HVCA 1YXXA 5E9EA 4JT3A 4H3PA 2ACXA 3DQXA 4PP9A 5L8LA 4DE4A 2A19B 2O65A 3FKLA 5CF6A 5HI2A 4EH9A 2ITYA 3R21A 1JWHA 4AT4A 5G6VA 4BCFA 4JOAA 4U97A 4UEUA 3FI2A 4EWQA 3G0FA 2J9MA 3F5PA 5IMXA 2PVMA 5EW9A 2IWIA 4BCHA 4R5SA 1YHSA 2R0UA 3OY3A 4BWKA 3POOA 3IW6A 2WZJA 4KD1A 5CT7A 3DU8A 4PX6A 2AC5A 2HOGA 2YIRA 5FEQA 1OL1A 3V3VA 4RG0A 4HNIA 4QYHA 5B2KA 5EQPA 4YTFA 4LM5A 4A4OA 4DEDA 1I09A 3EFKA 4NTSA 4BGQA 2WTIA 3Q9WA 3BELA 4DTAA 3SC1A 4DYMA 2UW3A 4J7BA 3F82A 4M15A 5K5XA 3CY2A 3E3PA 3NX8A 4XG8A 1PXKA 5HG9A 5AUXA 1QPJA 4O83A 2QR8A 3C4CA 5EI2A 2WTCA 4IIRA 4F0FA 3IW7A 1L3RE 3LJ1A 4Y5HA 3BWFA 4QD6A 3ZRLA 2WMBA 3COKA 3QZGA 3BEGA 4QTCA 5K3YA 4F9CA 3FMLA 4J8MA 4KS8A 5CZIA 3ZRMA 3CGFA 5K4IA 2JKMA 1XHAA 2QOQA 4RFMA 5CTPA 5D7AA 2FH9A 4BBEA 4OTWA 2XIZA 3DDQA 4XV2A 2C6OA 5EDRA 2P55A 2GTMA 4F1OA 1XBAA 3C4ZA 5E8WA 2PVYA 2VD5A 4NH1A 3P5KA 2VWBA 2YIYA 1CMKE 3BX5A 2R0IA 3DFAA 3MH1A 2EXEA 4QT1A 4YLKA 4FVPA 3R7IA 4OBQA 4O7NA 4B7TA 3G15A 2BDFA 4TYEA 3ZSHA 1Q5KA 2B55A 2CJMA 4NKAA 5AAGA 1B6CB 2OZAA 4GSBA 3ZLYA 3QD2B 4AGUA 3JYAA 2JDSA 4OBOA 4EOMA 1KOBA 4FR4A 4QNYA 3ORMA 4X2NA 3UIXA 3VS0A 4O0RA 3GU8A 5K9IA 2PYWA 3OROA 4S34A 3R73A 5HU9A 2WO6A 5JRQA 3SG9A 4TRLA 4XCUA 3ZBXA 3MY0A 4IB5A 5FXRA 4FEVA 4AN3A 4IDTA 3II5A 4MBJA 1WBVA 3UNKA 3FAAA 4JG6A 3VUIA 4L53A 4H3QA 3R8LA 3RP9A 4PDPA 2C68A 3DBFA 1V0BA 2X2MA 3MTFA 1QMZA 2JKKA 3A4OX 2QO9A 4ZSLA 3DLZA 4B6LA 4E8AA 4BDIA 2WTWA 4F9AA 3NVKI 1KWPA 3CJGA 5HIBA 4ZZOA 3D7TB 2WIPA 4GU9A 3TZ9A 3RPSA 3TJCA 4CKRA 2JDRA 5EFQA 3IGGA 3EN4A 1UVRA 2ZV9A 3P0MA 3LXNA 3OXTA 1OGUA 3R6XA 1FVVA 4J8NA 5CXHA 4CD0A 3PUPA 3QZIA 5HG8A 3QXPA 2VWIA 1CSNA 3FI3A 3R9RA 5CSPA 3BHUA 4A4XA 3DV3A 5KE0A 5HO7A 4M7IA 2GSFA 3FHIA 1OL7A 4NT4A 2PMNX 5DOSA 1PY5A 2G9XA 4RC2A 5HCZA 3R8UA 3QC9A 3GU7A 4RIYB 3A7FA 5AUVA 1YKRA 2HIWA 2IZTA 5L2TA 4XNEA 1WVXA 2FUMA 4EH6A 1GJOA 3EYHA 5A3XA 4O7YA 4D1XA 3AGMA 3RBWA 1OL2A 4CXAA 3LM0A 2C6IA 4FZAB 4P90A 3QQLA 2B52A 3KXMA 3R1YA 5CEKA 3F7ZA 3BE2A 4RWKA 5IPJA 3LQ5A 1J7IA 5ANEA 2VTTA 4H1MA 4JBQA 4WG4A 2F7XE 2Y9QA 3LQ3A 2ERZE 5LCJA 2UW5A 1KE9A 1UKIA 3CR0A 4WNMA 3BI6A 1PMUA 2WQBA 3CD3A 3COHA 3E5AA 3CLYA 1Q3WA 3QTIA 3A62A 3EKKA 4YJUA 5IUGA 5BVKA 1KSWA 3O8PA 3K54A 3OCGA 3KB7A 3QUPA 2W9FB 3V5QA 2G01A 3HMPA 5KMKA 3I4BA 3CBLA 2R3OA 3AC3A 3C50A 5CSXA 5HG7A 3VS4A 4GEOA 4PL5A 3D14A 2W17A 5AV4A 1NXKA 5EDPA 4EK5A 5JZJA 5KKRB 1M2PA 5EOLA 3NIEA 3V01A 1UU8A 2H9VA 4I92A 5FEDA 4TPTA 2BRGA 3Q6WA 5EYKA 4AW1A 1UNHA 4GYIA 4IVAA 4A9SA 2B1PA 3RHKA 5KZIA 3UIMA 1Q41A 3W2QA 5KCVA 3GCQA 2Z2WA 4XMOA 5ACBC 1PMEA 3FLYA 3RI1A 4IB3A 2XRWA 4GT3A 5TO8A 3MW1A 4PTGA 1MP8A 3B8QA 1Q3DA 4L45A 5A6NA 3P78A 5CF8A 1VZOA 2VGOA 5DRBA 2I0EA 1F3MC 3QQKA 4Z16A 5C01A 5AADA 3H9RA 3BHYA 4E5WA 2V22A 2PL0A 2PMLX 4ZTHA 4BB4A 3TUDA 4K18A 4EH2A 2VTMA 3HX4A 5HKMA 4O7RA 3OWJA 4XLIA 1O6LA 1WMKA 2AC3A 3FC2A 2A1AB 5LCKA 2WAJA 2XNOA 3GT8A 3EN7A 4YC6A 4JDIA 1PXNA 3OHTA 4YMJA 3AC2A 5FXSA 1FBNA 3D15A 5DEWA 2X9EA 2I6LA 2XZSA 4GJ2A 3T3UA 3JY9A 3U8WA 1NVSA 3QUEA 5CNOA 4I6HA 5BMMA 3RPOA 1SYKA 2PSQA 4EH4A 5DIAA 4E5BA 3JXWA 1WBWA 2J5FA 4FIFA 4GUEA 4W8DA 5ICPA 3HMNA 5ACKA 4YC3A 4TTHB 3UQFA 4D2PA 4ZP5A 3OC1A 1ZMVA 4LRJA 4D5HA 1Y57A 5DPVA 2BAKA 2QOHA 3GNIB 2C6MA 4AW2A 1X8BA 3NNXA 4HNFA 4F7NA 4QMWA 1WAKA 2BZHB 3NW7A 3Q2MA 2A2AA 2JFLA 1H26A 2JDOA 3T3VA 3ZS5A 2QQ7A 4G3FA 2BKKA 3ETAA 5DA3A 3DKOA 3TDWA 4E6DA 4FE2A 3D7TA 4RLKA 4XBUA 3RAWA 3A4PA 3DOGA 3D2IA 3OT3A 3AD6A 5CXZA 5A6OA 1PXLA 3EQHA 3ZUUA 4C3RA 2QOLA 2WGJA 2FB8A 3QQGA 4MHAA 3SRVA 5EYDA 2W1CA 2YZAA 3U6HA 2RGPA 4PRJA 4FGRA 2X7OA 4ZS4A 2HZ4A 2VWUA 1ZMUA 3AXWA 5DT4A 4E93A 3VS7A 3CSVA 4IVCA 5CEIA 5K0XA 2G1TA 3Q4TA 4QP7A 2CLXA 1Y6AA 4FZDB 4GG7A 5AIRA 5EM8A 5BPYA 5KMJA 3WOWA 4EBVA 4UMRA 2R64A 2VTHA 3HV4A 4FKIA 2OIQA 5HBHA 3REPA 3MESA 1YWVA 2LGCA 4AOJA 4M67A 4LRMA 2XKFA 4PMTA 4APCA 2F7EE 4QP9A 4DGMA 3R30A 3LMHA 4FV2A 3ZU7A 3EN9A 4P4CA 2YM5A 3ACKA 3VUHA 4WA9A 5C26A 5CU2A 4I1ZA 3FMMA 3KRRA 4ARKA 5M4UA 3ACJA 4PDYA 3A7HA 3MPMA 4GIIA 4X2KA 5HIEA 3QTRA 3V5LA 1IASA 2QOCA 4RC4A 2ZB1A 4HPTE 5JT2A 4FZFB 3TEIA 3VS5A 3KRXA 1L8TA 4EWHA 5TOZA 3G5DA 3RK5A 4J99A 2B54A 5IUHA 4XG3A 4I21A 2XP2A 4GVAA 3WE8A 5KKRC 3DBCA 5LWMA 4BDJA 4HZRA 2ZMCA 2RG5A 4EH5A 2UW9A 4W8EA 3QF9A 2HWOA 4O0TA 3TV6A 3FMHA 4QO9A 4QYEA 4BI2A 3R04A 2BCJA 3F3VA 4U0IA 4ZJVA 2YWVA 4Y83A 1S9IA 3MH0A 4JLCA 3PVWA 4EZ7A 4X0MA 3MPAA 4FKRA 4NM5A 3H9FA 3O17A 2NNWB 2JLDA 5L6WL 4DT8A 4YU2A 4X3FB 2QURA 3BHVA 5HVJA 3ZSIA 4UMTA 4YBKA 5TE0A 5L2IA 4ACDA 4EK4A 5HTIA 4KRCA 4C4HA 3NYXA 3EH9A 3TT0A 3PIYA 4PTEA 4S2ZA 4FV8A 4M0ZA 2X0GA 2VTRA 2R3RA 3C4WA 4KAOA 3UNJA 2E9NA 4CMOA 4FUYA 4BDHA 4FTJA 1OKVA 4IJ9A 2H34A 4JQEA 4A9RA 5J5SA 1PXMA 5AAFA 4BIDA 4E73A 3R22A 4DGNA 3QQUA 5HX6A 4BN1A 4F4PA 3QTQA 4DH5A 4YHFA 5M53A 2E9PA 4EOJA 1J1CA 1Y6BA 4IAIA 4CRSA 4W4YA 2C3LA 1WBOA 3Q9ZA 4WSYA 3W55A 2KTYA 3IW8A 3RPRA 5JQ5A 3EFLA 4Y8DA 4C4IA 3KCKA 4KB8A 2J2IB 4WO5A 4XG4A 5I9WA 1EH4A 3DNDA 3KCFA 3RWPA 4FMQA 1SVEA 3A7GA 4ANNA 3AGLA 1GNGA 3EB0A 5IA4A 1P4FA 1CKPA 5FRIA 4DFNA 4LG4A 2HZ0A 2XK3A 4IB0A 3WARA 2CNUA 3QRUA 4QQ5A 3R9OA 3KRLA 4O6EA 2ONLC 2YITA 4OTFA 4PMPA 4FT3A 4QP1A 4DEBA 4TWCA 3LAUA 2CN8A 5E8VA 2P2HA 3I60A 3OY1A 5HQ0A 3DY7A 3FEGA 3Q52A 3OEFX 5F4NA 3RZFA 4O81A 2C3KA 3ET7A 2C5YA 4NYEA 5BVWA 1OITA 4FT0A 2R3JA 2BAQA 3DAKA 4QTDA 1GY3A 3NNVA 4ZTLA 4D55A 2B9FA 4O7VA 3H0YA 4FT9A 3ZHPC 1OL6A 2ONLA 4I5HA 4YTIA 4CV8A 4FKWA 3UZTA 3F2AA 4K0YA 3W32A 3ZC5A 4LOQA 4DEGA 3ZDIA 1UU7A 5CVHA 4O7WA 3HECA 4KABA 4XYFA 5FBNC 4MD9E 3O0GA 2WMQA 4AT5A 2XBAA 4AW5A 5DMZA 1WFCA 3BYUA 3E92A 4HZSA 4AU8A 3HMIA 3HYHA 5LMAA 4J71A 4JDJA 3GEQA 4O0XA 5EDQA 3NUYA 4F99A 2DYLA 5DR2A 4C4JA 4C7TA 2FSLX 1XJDA 5HLPA 2H96A 2OJGA 3PA4A 4G9CA 1PJKA 3O96A 3C0IA 3NUUA 1Z5MA 4FV4A 4LFIA 2FSMX 4ZSEA 3EQGA 4GH2A 5L3AA 4D2TA 2JFMA 3PSCA 4ANMA 1XH4A 2EB3A 3F3UA 2GQRA 3FYJX 3F3TA 3UO6A 1APME 1ZY4A 4YLLA 3UC3A 4XH6A 4NKSA 3NUXA 2C6LA 1YOJA 2IVUA 3FJQE 2YA9A 1OUKA 4U42A 5C4LA 3WILA 2X6EA 5AP0A 1GZOA 2JKQA 3RAIA 4CV9A 4G16A 4FNYA 5KMNA 4IZAA 2JAVA 3NSZA 4HVGA 4WHZA 4FA2A 1J1BA 3DKFA 5DE2A 5TR6A 4CZTA 4YJTA 4OGRA 5HE3A 2V7OA 3JS2A 4X3FC 3R02A 3BGZA 5EM5A 3DJ6A 2UZTA 4OW8A 4OT6A 4F65A 2WEIA 4YC8A 3V8TA 4EJNA 4EHZA 5L6OA 4E20A 3ENMA 1K3AA 5M55A 3LMIA 1KOAA 5ETIA 4AF3A 5E8UA 4AA4A 3ZYAA 4QP4A 5LOHA 4MEDA 2WMAA 2X2LA 4RJ7A 1O6KA 1Y91A 3QAME 4MWIA 1U5QA 1IEPA 2PVRA 5J79A 5FG8A 1CKJA 1YHVA 1U59A 3UVQA 3IGOA 5HE1A 2ITNA 3W1FA 4EQUA 2R3FA 4GYGA 2BUJA 4X3FA 3QTSA 2BDJA 1P5EA 3LOKA 2Y0AA 4RMZA 2R9SA 3MVMA 4BRXA 2P3GX 4CFMA 5E1EA 3F5XA 3FL4A 3QKMA 5CSWA 4F1MA 1OI9A 3LCTA 2PE0A 2R3GA 3BRBA 3K2LA 2GHMA 3ULIA 4DH1A 3POZA 3IO7A 5I3OA 4DCAA 5E8XA 5M08A 3BV2A 3ORNA 4GKIA 3I81A 4IWOA 3O50A 5DR6A 3CKXA 3Q60A 2CCHA 3QLFA 4NM3A 3R8MA 4D4RA 2IW6A 3LJ2A 2BHHA 4U3YA 2PWLA 4IAFA 4IQ6A 4K9YA 3UGCA 1AQ1A 3F2NA 3ROYA 3O23A 4GU6A 4I3ZA 2OSCA 5FEEA 5CWZA 5I9UA 4CMUA 4DITA 2Z7LA 3BHHA 3LFAA 4TYHB 2ITQA 5BNJA 4EOQA 2XVDA 2ZV2A 3F88A 4EKKA 1OIRA 3QGWA 4XG2A 3TNWA 1FMKA 5BVEA 3BYOA 4I6QA 3DBQA 3FQEA 4QYFA 4CKIA 1H8FA 2BPMA 5CANA 2BIYA 4PMMA 2LAVA 4EQMA 1VEBA 4FV7A 1BI8A 4FT5A 3FI8A 3TKHA 4IZ7A 3WYXA 4IX6A 5FTQA 4B8LA 3NVMB 3EFWA 3BU5A 4BDEA 3MYGA 5AP4A 4KUJA 3DDPA 1LR4A 3Q4CA 4LGDA 1OKWA 1JNKA 4FTRA 4J95A 3W18A 1WVWA 4KIPA 3PP1A 2HELA 4NM0A 4NU1A 3R83A 2WMVA 5HE0A 1FVRA 3UP2A 1JSVA 4O96A 4CGAA 1YRPA 4ITIA 3RVGA 3GCVA 4G6NA 4E3CA 2RG6A 3EYGA 1CDKA 1BL6A 5CEMA 5CI7A 3QTUA 2YCSA 4M97A 4YSJA 4ANQA 3G90X 4USFA 2BRHA 4IBMA 4MF0A 4YJRA 2OG8A 4FEQA 2XNGA 2Y4IC 4WD5A 2QOOA 3OTUA 4Z55A 1R3CA 2H8HA 2VTAA 3D7ZA 3R01A 1M2RA 4BCMA 2G2HA 5CASA 2VUWA 4ITJA 3GGFA 4I20A 1WBPA 1JKLA 2BZKB 4R7IA 3ULZA 3ALNA 3R9HA 4CG9A 3EQCA 3E88A 3G9LX 3VS2A 2CGVA 4FKOA 4YGAA 2HY81 4AUAA 4HCVA 2FVDA 1RQQA 1JLUE 2RFDA 3NYOA 4LI5A 2NRYA 1ZYCA 2A0CX 4BL1A 4UXLA 5A4EA 1JPAA 3V51A 4WUAA 1PW2A 3QRKA 4YR8A 2R2PA 2W96B 3VRZA 5EKOA 3UOKA 3VULA 3ODZX 2BIKB 4WNKA 2PVHA 3RMFA 4BTMA 4KWPA 2WKMA 2W1IA 4G3EA 4C8BA 3R0TA 1B39A 3UP7A 5F95A 3B2TA 3NIZA 4XV1A 2W5AA 4FTLA 4W9WA 1XO2B 1UNLA 1SNXA 4I22A 2EB2A 5DEYA 3QRIA 3WF5A 4BDFA 1OL5A 4YZNA 4DH3A 5AIKA 3LCSA 2OU7A 2WD1A 4RX7A 2WOUA 3H30A 1VJYA 2YACA 5CI6A 2WPAA 4OR5A 3VUDA 1E1VA 3DGKA 2C0TA 1CTPE 2W06A 2OICA 1IAJA 5IQFA 4FNZA 3TWJA 3NNWA 1G5SA 4H39A 4MXCA 3CPBA 2WB8A 3ITZA 5AAEA 3N4UA 4DHFA 5CU6A 5CF5A 3TI1A 3I7CA 4AACA 5B0XA 2B9JA 2QR7A 4UV0A 3QX4A 3TM0A 3FSFA 3GQLA 3HNGA 4RX8A 4D28A 2O2UA 4YJSA 4QQJA 3LXPA 5IMEA 5ANJA 3KMUA 1IRKA 3EL8A 3AT2A 3NR9A 4EBWA 5GZAA 5FQDC 4FIEA 3BKBA 4QMYA 1REKA 5HNIX 2PVKA 4NCTC 1GIHA 2PVLA 1LEZA 1BMKA 4RT7A 4FTKA 1CKIA 4OTGA 4DH7A 3AOXA 5F20A 4UWBA 5L4QA 4M14A 5FDXA 4TNBA 3T9IA 4TYHA 2UW7A 3F3WA 4L00A 4G3DA 4GK2A 5E90A 5IQHA 4EK6A 5GZ9A 5ITAA 2XB7A 4Q9ZA 3ZBFA 4NCTA 1ZRZA 2C30A 4TYGA 4U44A 5CT0A 2IW9A 3WI6A 1ATPE 2F4JA 3CD8A 2QODA 5FUTA 2HENA 4RX5A 5LVPA 3GENA 3I5ZA 3CQEA 3WZDA 3FLNC 4ASXA 3MVLA 4BCKA 5IQGA 3NWWA 4PPBA 2YM7A 5DN3A 1M17A 5AX9A 2YISA 4EK3A 5KHXA 3MN3A 4C37A 3U6IA 1GOLA 2C5OA 2OBJA 3G33A 2GNJA 4YJVA 1PKGA 2F9GA 2WU6A 4FSTA 3VUGA 3HGKA 2XBJA 3UYTA 4E4MA 4E1ZA 5LXMA 3MBLA 4OAUC 4G9RA 3D83A 2JBPA 1IG1A 4ONAA 4DEHA 4BIBA 2V62A 3HV5A 3HDNA 3R7OA 2BFXA 1H24A 3UYSA 3EKNA 3AG9A 5HX8A 4IE9A 3ZDUA 5LQFA 4ZZMA 3C4XA 4FV5A 3ORIA 1W83A 1XH5A 3EN6A 2I0YA 3QHWA 4L3PA 1OKYA 4ZSGA 2YM4A 4KRDA 5BVDA 4M13A 4RZVA 3U54A 4TWPA 2IZSA 3CTQA 4L3LA 1R0EA 3UO4A 3EZRA 1MRYA 4K1BA 4QMTA 1Q8ZA 2PUPA 4FZ6A 3LXLA 1ZYLA 3DXNA 3L8SA 4QTAA 3COIA 3A7JA 3NLBA 5EH0A 5AUTA 1J7UA 2RFNA 5C8NA 2IG7A 4O7LA 2XK4A 4XS2A 4ZMEA 4R3CA 2BHEA 3MA3A 1YDRE 4IZYA 2C5VA 4RVTA 4EOSA 3TNPC 3QA8A 5HORA 4NW6A 5IA1A 4FSZA 5AV0A 2G2IA 1YWRA 5E8ZA 2R3IA 1JKSA 2CKOA 2PU8A 3I6WA 4QNAA 2GCDA 5AUZA 4AAAA 1YOLA 3ZXZA 4M12A 5HU3A 4FSUA 2BRMA 4P2KA 3FI4A 3PXQA 3W10A 1QPCA 5M44A 5JKGA 3BPRA 4RVLA 4CSVA 4TWOA 5CZHA 3ZLSA 3BCEA 5CX9A 3PY1A 4Z7GA 1Y8GA 4JIKA 2F57A 2BMCA 4FIJA 3TV4A 4HGSA 4DH8A 3EQIA 1Q8YA 4M68A 5J87A 3R1NA 5AA8A 2VWVA 2CLQA 2BVAA 2W7XA 3ELJA 2BZIB 3IDPA 4LOOA 3S4QA 1UNGA 3SLSA 4V05A 3U4UA 2B53A 4O7SA 2CCIA 2W1FA 3GI3A 4WBBB 1NA7A 4P5QA 3KXNA 4Y95A 3QKLA 3BLQA 3F66A 3WBLA 4R5YA 5FTOA 1CM8A 3PTGA 4C2VA 2BAJA 3E3BX 4C4EA 4F08A 2VRXA 3HP2A 2YIWA 3OWPA 4J1RA 3Q9XA 1ZOHA 5HCXA 4RIWB 3QCQA 3ZOSA 2W1HA 4JG7A 2BDWA 2ZM3A 2QLUA 2YIXA 4BZDA 3B2WA 4MWHA 4B0GA 4NTTA 4O0UA 2VTIA 3SRVB 3V6SA 4F7LA 4BI0A 5ANGA 2F49A 2J0MB 4MQ2A 4O7ZA 3AD5A 4JDKA 3KL8A 1A06A 4JBOA 2HZIA 5EK7A 4FKLA 5IEVA 1F5QA 2OF4A 4N4SA 3MVJA 2OZOA 3PRIA 3I79A 2W1DA 3EQRA 1M7NA 4RJ3A 2XK6A 5J1WA 4OTPA 5AR3A 3EQFA 4ALUA 2G2FA 4EOOA 2RKUA 2W0JA 3HA8A 4IFGA 5CU0A 1MRUA 1F0QA 3LFNA 2XA4A 3FZOA 4C35A 4YTCA 1YQJA 2I40A 3KVXA 3KREA 5CAQA 3LLAA 2HWPA 5HD4A 3NUSA 2FA2A 4CFUA 3UQCA 4DFUA 2VV9A 2XJ1A 3PLSA 2WEVA 5EOBA 1P2AA 1S9JA 4UMPA 3KULB 1PRYA 2GS7A 5DT3A 4YNOA 5C27A 3RAKA 5DHJA 1OPJA 2RIOA 3R1SA 3OTVA 3H9OA 2WFYA 2J0KA 2UW4A 4BZNA 4RIXB 5J9LA 3HRBA 4YZCA 2O63A 4R3RA 1RW8A 4D4YA 1SNUA 2Y7JA 4Q5EA 4A06A 4KS7A 1A48A 3E62A 2XK7A 1BKXA 4IX5A 1KE5A 2QD9A 2ZDUA 3BLRA 2VTLA 3CJFA 3QCXA 4GL9A 4IAKA 5HNGA 4AA5A 1BI7A 3FLZA 4PPAA 4UMQA 5DI1A 4X21A 3UC4A 3Q32A 4PPCA 1OBDA 3FKNA 4CNHA 3E64A 4FZ7A 3L9MA 4M84A 4MCVA 1Z9XA 3DPKA 4RJ8A 4OTQA 2C4GA 3SKCA 3QTXA 3LE6A 2O8YA 3TNQB 3WF9A 3WF8A 2O0UA 3OG7A 2C6KA 5HBEA 3R8VA 4G6LA 4BYJA 2YCQA 5K5NA 1JVPP 3PA3A 4QMMA 4W9XA 2XM9A 4OBPA 5BUIA 4O86A 3PWYA 1WBNA 4BDGA 1ZLTA 3IECA 3DCVA 3R9DA 1PXIA 3OEZA 2XNBA 4B4LA 3HLLA 4BCNA 2VWYA 2W05A 3OOGA 3VW8A 3M42A 4ALWA 4ORKA 2OI4X 5L8KA 5AFVA 2YJSA 5D1JA 4DEEA 5BYYA 4L6QA 3UMXA 3F7WA 4L68A 3E63A 2OW3A 3GP0A 4D2VA 1LEWA 5EQYA 2XRUA 5A4LA 2UZWE 3LCOA 5DRDA 4F6WA 5HVYA 4MBLA 3UPXA 4FC0A 2V0DA 4M69B 3TNIA 5IA3A 4H58A 3VHEA 4I94A 2Q83A 4QPAA 4CKJA 2QLQA 3C0HA 3FPQA 3SV0A 1K2PA 2VGPA 1J3HA 3D5VA 4GS6A 3RK7A 3SDJA 5HVKA 3JPVA 3PZEA 3U4WA 4Y72A 2BALA 4HOKA 5CS6A 5E7RA 4EJ7A 3OW4A 1SVHA 3IS5A 4IWPA 4PQNA 5GIPE 3DZOA 1JKKA 3DTWA 5IZFA 3KN6A 5CENA 2JGZA 4FEXA 1JOWB 4AZSA 4BICA 3GQIA 2XNMA 3Q4ZA 3P4KA 4O22A 4O0VA 1V0PA 5E8TA 5FP5A 4XP2A 2WMUA 3P79A 3KN5A 5BUJA 3GFWA 4LMUA 4H1JA 4Q2AA 3ZO2A 4L46A 3A2CA 4GT4A 4RQKA 4LGHA 3RNIA 3VQUA 3NAXA 2Z7SA 2ERKA 2QOKA 3ODYX 3MTLA 5KO1A 1URCA 2JD5A 4HYHA 4JJRA 4NZWB 3IW4A 3QKKA 2AUHA 3FY2A 5BVOA 5EG3A 2OGVA 3DNEA 4I0RA 3MIYA 4YO4A 1PHKA 3A8XA 4JBPA 4RIWA 2YJRA 2OK1A 2EXMA 3KGAA 1W98A 3CE3A 2WQNA 5CEQA 1TQIA 2YAAA 3KFAA 2YLFA 3VAPA 2C3IB 4ASZA 4S33A 5AMNA 5IA5A 3UIBA 5J5TA 3LIJA 4RWLA 3BBWA 3FMNA 4ZTMA 3ATSA 3OUKA 3IONA 4O1PA 3I7BA 3MJ2A 5EW3A 2XKDA 5HNBA 3SW4A 3UZPA 4IWDA 5M4FA 4PUZA 2J7TA 3EWHA 3ZUVA 4UALA 1NVQA 2VNYA 3ZM4A 2ESMA 3JR1A 3GFEA 5EKNA 5TT7A 1OIQA 4FKPA 5GJDA 4PNKA 2UW6A 3G6GA 4R8QA 3W8LA 5IEXA 3E8EA 1J7LA 4EUTA 3EQBA 2V7AA 3GC9A 2PZIA 3ALOA 1Q62A 3MFRA 3CKWA 3UDBA 4QPSA 2BTRA 4IX4A 3SXRA 4DT9A 4XG9A 4EOKA 2ZAZA 3MB7A 4I4FA 5EI8A 2J6MA 5BYZA 3V8WA 4ACMA 5LARA 4AGWA 3SVVA 3UZRA 5M51A 3BU3A 2ITWA 2GNGA 1SVGA 4BHNA 4ENYA 3AMAA 3PVUA 4C33A 3I5NA 4C57A 5HLWA 5AX3A 2WTDA 4HVDA 3KULA 4BF2A 1Q8TA 3ROCA 3D5XA 4YBJA 4N57A 2QC6A 5M4CA 5TKDA 4C61A 3RKBA 3PIZA 4GW8A 3QX2A 2FSTX 4RIXA 4U9AA 3PXFA 2HW6A 5D12A 4YHTA 3K5VA 3GBZA 4CZYB 3FZPA 3NCGA 3GU6A 4D58A 4RJ5A 5IDNA 2I0VA 4LUDA 3KA0A 4ZS0A 3ZLXA 1Q61A 3HEGA 2Y8OA 3V5WA 3C9WA 2W1EA 3N4TA 3BQRA 4ID7A 2V55A 4GK4A 3VRYA 2X4ZA 4C36A 4F9WA 5JMSA 4MD8E 3I1AA 4ERKA 4C3FA 2QO7A 2OXXA 5DNRA 3PJ1A 4GJ3A 3QXOA 4RBLA 5ANIA 1RDQE 4A4LA 2WTJA 2X1NA 2GQGA 4APPA 2GNHA 4PDOA 4EUUA 4M66A 4ZJJA 2JAMA 4WNPA 1PXOA 4HYIA 3KXGA 5FWKK 4MD7E 4TT7A 4UX9A 4O7TA 3C13A 3CIKA 5JGBA 4FUXA 2CMWA 3RTPA 4A07A 4CQGA 3KRWA 3TUBA 3OWKA 2F2UA 3V6RA 1XQZA 2GQSA 2QU5A 2ZDTA 4LMNA 4OLIA 4RWJA 3W2PA 2ZM1A 4ZSJA 4FX3A 1PF8A 2OJ9A 3R7EA 3HL7A 4BCGA 3UOJA 1BX6A 4G5PA 4LGGA 1P14A 4QYGA 3QQHA 3FZSA 4M69A 3RPVA 4ZLZA 2RF9A 1JSUA 3DKCA 4XG6A 4RFZA 4Y46A 4EYMA 4KINA 4JAIA 4KIQA 3RCDA 3KU2A 3IQ7A 4LOPA 3U9CA 2XYNA 2WELA 4C3PA 1PXPA 4JRVA 4CLJA 2QONA 3QZHA 3AQVA 2CHLA 4FTAA 4HCTA 1YXTA 3AT4A 4AZVA 4RRVA 4U7ZA 4U5JA 3OT8A 4QP6A 4RZWA 5I9VA 4MTAA 5JZNA 3DJ7A 4L01A 2W99B 3VBYA 3ERKA 2XS0A 3CS9A 4U43A 3W16A 4BWXA 5IQIA 3WF7A 1T46A 2C6DA 4DEIA 1BUHA 4XJ0A 4BZOA 3ZEWA 5E91A 4KIOA 1BLXA 1OM1A 1H01A 4XRJA 3QL8A 4JX3A 4NM7A 4G3GA 1E9HA 2YDJA 4HVHA 2C47A 4FV1A 4U80A 2I7QA 4R77A 2HYYA 5HLNA 3SXSA 4JG8A 4CRLA 5AUYA 1H1SA 3OCBA 4AZFA 4JDHA 3M2WA 3UJGA 1DI9A 1JQHA 2JDTA 1XKKA 2GFSA 3H3CA 4U45A 3G0EA 5DWRA 4EZ5A 4IJPA 5H8BA 4USDA 3DBEA 3QWKA 3HV7A 2XIXA 4NFMA 4K33A 3OWLA 3S3IA 3TIZA 4EK8A 2KULA 1FGIA 3QD0A 5JH6A 4WG5A 2WQOA 5HHWA 5D10A 1RJBA 4MXYA 3GXLA 3DT1A 3MGYA 3O2MA 4EEVA 2C0OA 4MH7A 4L7FA 3PY0A 5CSHA 4DFZE 2ZM4A 3SX9A 1I44A 4L3JA 2R7BA 1JSTA 3KF4A 1UU9A 5AV1A 5AV3A 3RGFA 4ZMFA 2ZMDA 3KY2A 3FUPA 4IM2A 3MFTA 1H00A 1MQ4A 2Y4IB 3U9NA 4IX3A 4CFXA 5EHLA 4KA3A 2I1MA 5B2MA 2R3QA 3FLSA 3MY1A 3CQWA 4IDVA 4U41A 2VAGA 1UA2A 1Q8WA 2XYUA 3W2CA 3N9XA 4EKLA 4IXPA 4JIAA 4NEUA 5T3QA 4AZTA 2YM6A 4EI4A 2XIYA 4KKHA 5L6PA 3HMMA 5M07A 3S00A 1KUTA 2DUVA 2ZV8A 3LZBA 1WBSA 4IH8A 4CMTA 1REJA 4O0YA 3ZH8A 4GRBA 3EZVA 2OXYA 2RL5A 5HEZA 4JBVA 4Y85A 3I6UA 4UMUA 2O5KA 3BBTB 4HW7A 4EYJA 1SZMA 4I93A 4OTRA 1H07A 3IG7A 5H8GA 3ZC6A 3ZLWA 1G8AA 3QCYA 4E6QA 4P5ZA 1H1QA 4D4VA 4IAYA 3F69A 3R63A 4MAOA 5DH3A 5FDPA 3EOCA 3GCPA 5I5ZA 3P7CA 3BIZA 4EL9A 4YZDA 3S95A 2WTVA 1XBCA 2OF2A 2UZDA 3LXKA 2XH5A 5D7VA 4F0IA 5A4TA 3DXQA 4F9BA 3AC4A 5GIOE 4IB1A 3Q6UA 2PE1A 4FTIA 4BKYA 4L42A 3WZKA 4DLJA 1UWJA 5DYJA 4WG3A 3DB8A 2CGUA 3VS3A 5HTCA 2YM3A 3TZ8A 4P7EA 1G8SA 4DGOA 1FGKA 4JL9A 3GC0A 2J0LA 4ZJIA 5J7HA 5IQDA 2PVFA 4F0GA 3FV8A 3N51A 1ZYDA 4O91A 3RWQA 5BMSA 5L2SA 2WNTA 1VYWA 4GK3A 2C3JA 3EMGA 3PJ3A 1TVOA 1W84A 4LUEA 3BYVA 4RQVA 1NT2A 2YZLA 4YJPA 3DTCA 2IO6A 3NAYA 5IQBA 4BCPA 3U55A 2J4ZA 5KMIA 3HA6A 3C4EA 4O2PA 3SA0A 3C7QA 4FEUA 2R3PA 4XUFA 3A8WA 5IG1A 3DKGA 4EQCA 1OIUA 1GZKA 4IADA 5AP1A 3V5TA 3DJ5A 3FDNA 4YZMA 4KIKB 2X6DA 3H4JA 4D0WA 1YVJA 4I5CA 4O84A 3Q96A 3MB6A 3E8DA 3TV7A 5CLPA 4BGGA 2O64A 4F1TA 2ITXA 2R3HA 2X9FA 3GUBA 3BQCA 3PP0A 3IDBA 1PMVA 3UG2A 3A60A 3C5IA 4ZSAA 3HV3A 4QMSA 1G3NA 2UZOA 3FXWA 3LFBA 4PV0A 3MA6A 4PP7A 5CAOA 3KVWA 2X7FA 2CN5A 4LYNA 3FYKX 3FMKA 4FGBA 5BUEA 3PXYA 4R7HA 1WZYA 3CQUA 1UWHA 4B8MA 4CFNA 4TKSA 3PXKA 4YP8A 4NJDA 3DLSA 3W2OA 4ZZNA 3LKMA 3PG3A 3CXWA 4K11A 3TG1A 4USEA 5M56A 4H05A 3LFSA 3LHJA 4RVMA 4FV6A 5LMKC 1OZ1A 2DQ7X 3DA6A 5J9YA 3AT3A 4ACHA 2VTOA 2BFYA 4L43A 4EC9A 3L8VA 4UXQA 5T68A 4EOPA 3LVPA 5HGIA 5CEPA 1H0WA 1H1PA 4YHJA 1M7QA 3V04A 5D41A 5C4KA 2CKEA 4ZK5A 2CGWA 3NCZA 4J98A 4DTBA 3Q53A 1XBBA 4FV0A 2X8IA 3P08A 4XLVA 5KZ0A 4D2RA 3RJCA 4I41A 3QQFA 3DFCB 2WOTA 3U87A 1SMHA 1UKHA 2WXVA 4U3ZA 5HICA 2VNWA 3QUDA 4Y5QA 3BYMA 4YUQA 3U6JA 4M0YA 2ETRA 4CG8A 3VO3A 4JVGA 1LPUA 4WNOA 2C6EA 1XH6A 5CY3A 3RINA 4Y73A 4CEGA 5GINE 5M06A 3K5UA 2UZLA 4DFBA 4GKHA 4U79A 2PPQA 3NYNA 4TN6A 4UB7A 3VC4A 1NY3A 4OUCA 5EHYA 3UODA 2W1ZA 4KKEA 3MVHA 5JGAA 1HOWA 2QKWB 5H2UA 4R78A 2WMTA 1Q99A 5HOAA 2PVJA 2QG7A 4DTKA 3JVRA 3OUNB 3TKIA 3QD4A 3ZMMA 2CNVA 4FIIA 2XIRA 3OCTA 5CQUA 2PK9A 2WU7A 4NJ3A 5T6KA 3PJ2A 3VJNA 4O38A 2R5TA 2GDOA 4O27B 3QLGA 4GV1A 4CTCA 1H4LA 4H3BA 4CCUA 5I9YA 2ZV7A 3KQ7A 1XR1A 2A27A 2HW7A 4PL3A 3DAEA 4C62A 5J9ZA 1VR2A 4C02A 1U46A 4D5KA 4UN0C 3ZRKA 4NFNA 4UZDA 2I0HA 2YLEA 2W5BA 4ZLOA 4NL0A 3CPCA 2R3KA 2B9IA 2PY3A 4DFYA 4ZAUA 2GTNA 3FY0A 1GIJA 1Q8UA 4FSQA 3TTJA 3KC3A 3WIKA 2UZNA 2E9VA 4QPMA 3P86A 5I9ZA 5IA0A 4XP0A 4FSWA 4KBAA 5CSVA 4ASEA 5EI6A 1O9UA 4QP2A 2VZ6A 4N70A 4F70A 4OT5A 3EN5A 4FOBA 4IM3A 4DG3E 1K9AA 3NZ0A 3MY5A 2R4BA 3F3ZA 4ACGA 3ID6C 3OS3A 4XRLA 1STCE 3NRMA 3OMVA 2B0QA 2UZEA 1H0VA 5E8SA 1P4OA 4FIHA 4K8AA 2E9OA 3FXXA 4G17A 4HYSA 5EYCA 5FM2A 3ORKA 1Y8YA 2WHBA 3ORXA 4TY1A 4J97A 5CALA 2HXLA 4FICA 3TDVA 2UZUE 4JR7A 5CQWA 4DCEA 3AMBA 4AXAA 4PNIA 3IPHA 2GU8A 3VIDA 1GZ8A 2IPXA 2YERA 2BILB 3GVUA 4M8TA 4S32A 2XM8A 4FL1A 4KIKA 1SM2A 4YZBA 2F7ZE 3DB6A 3FL5A 2IVTA 3I0OA 4QQCA 5H9BA 3LFDA 4B9DA 3E93A 5KX8A 3M11A 1IA9A 2Q0BA 2UZBA 2ITVA 3KXXA 4L9IA 4OTHA 4F7JA 2Z02A 2OFUA 5CVFA 4LV5A 4L8MA 3U51A 1H1WA 3P7AA 5H3QA 5AP5A 4B99A 4FTNA 4EOIA 5JRSA 3L8XA 4FKJA 5CAUA 3ZFYA 2XNNA 2PMIA 2JKOA 2ITUA 3D94A 3O8TA 3R8PA 3ZZWA 5CF4A 2JIUA 3QBNA 2R3NA 1ZYJA 3ZFXA 2PUUA 2GPHA 3PVGA 2GNLA 3EL7A 3VBWA 4FG8A 4F9YA 3P1AA 5IUIA 3CC6A 4XOYA 4EHGA 3TCPA 3DBDA 3E7VA 3LCKA 2ETMA 5A14A 4I6FA 2VTPA 3R7VA 3RK9A 4FYOA 4GFGA 1VYZA 3SQQA 2UZVA 5FP6A 1OB3A 3Q2JA 3FLWA 4FTMA 1BYGA 1W8CA 2ITPA 3SAYA 5J1VA 1IAHA 4FV9A 2AYPA 2CKPA 4Z9LA 1TQMA 5GZ8A 4E4LA 2V5QA 3HDMA 2PUNA 3VHKA 1ZZ2A 4MKCA 3OF0A 2XEZA 2J0IA 2JIIA 4FOCA 3W2RA 2Y4PA 5LVNA 4PTCA 4QMOA 1YXUA 3IKAA 4AOIA 3TN8A 3FMJA 5IDPA 1QCFA 2IZRA 2ZYBA 2VO0A 4F7SA 2P33A 4LQMA 3VF9A 4D2SA 4PMSA 3H10A 2IVSA 1URWA 1FINA 3PJCA 5TF9A 5A54A 5LMBA 4DG0E 2X2KA 3EIDA 3BZ3A 4E6CA 2WMWA 5E1SA 5HO6A 1YDSE 3QHRA 4TXCA 4RA5A 5A9UA 1DAWA 4W4XA 4YJNA 5C8KA 2VWZA 4WUNA 4I5MA 4G34A 4HVSA 2ITZA 5IH6A 3NPCA 3HAVA 5KBRA 4QMVA 3KEXA 4CFFA 2OFVA 3TJDA 3LJ0A 1YOMA 3FZ1A 3C4FA 4AT3A 5KNJA 4CT1A 3Q04A 1LUFA 3MI9A 4MXAA 3OD6X 3RAHA 1WCCA 3HP5A 4MQ1A 5AP3A 4WSQA 2CNQA 1IA8A 3ZTXA 4EH7A 3KK9A 2VN9A 3NS9A 4XX9A 5AP7A 1IR3A 4YSMA 3HUBA 2WQEA 4RIOA 3COMA 3OCSA 4FL3A 3C0GA 3PYYA 4WRGA 4TL0A 2CPKE 3NNUA 2WTKB 3EJ1A 5A4QA 4E7WA 4F6SA 3ZEPA 4RSSA 3QGYA 2IJMA 4DG2E 3G2FA 3D5WA 3L9PA 4JRNA 5AR2A 2C0IA 2XKCA 4D1SA 4QMQA 4FKSA 2HK5A 3ZO1A 2HAKA 4UY9A 3CTHA 3ANRA 3VBTA 5AP6A 3IDCA 3UBDA 4BIEA 5D11A 4CCBA 4OAVB 4YTHA 3O8UA 3SHEA 4MVFA 3TZMA 3AD4A 3D4QA 4E4NA 3ZSGA 4Q9SA 5A4CA 5BVFA 3IOKA 5L8JA 5JQ8A 1JAMA 2ZB0A 3F2RA 3E87A 1OPLA 4G6OA 4PDSA 2Y6OA 4XOZA 1R39A 4FNXA 2OIBA 5GNKA 3ZXTA 2W9ZB 2PMOX 2YCFA 4UYAA 4IMYA 2A4LA 4JXFA 3AC8A 4X7QA 2VX3A 4FSNA 3QWJA 3SGCA 1ZXEA 2XKEA 4OTDA 5ANKA 4H36A 4TNDA 3KKVA 1TKIA 4BFMA 1KV2A 3FQSA 3V5PA 4L44A 4UWYA 1QPDA 4U6RA 1W0XC 5ETAA 3KRJA 5DR9A 5HBJA 4UBAA 5KUPA 3LFEA 2X81A 4DA5A 2NP8A 3O71A 5HCYA 4DINA 4O0SA 4CYIA 2PUIA 3ZO3A 3ATTA 4R6VA 5GHVA 3NUPA 4BDBA 4JNWA 4DF3A 4FVRA 4DGLC 4J52A 4DBXA 2Z60A 5EW8A 4L52A 2YEXA 4LL0A 5DT0A 4GUBA 5DBXA 3FKOA 1UU3A 5J8IA 5DLSA 2XCKA 4I0SA 4DAWA
chains in the Genus database with same CATH superfamily
1KE7A 3OXZA 1FPUA 3UQGA 3VJOA 3Q9YA 4S31A 3FPMA 2Z8CA 4ZY5A 2RSVA 3G51A 4II5A 4BKJA 4EH3A 1OVEA 2QHMA 5G1XA 2OKRA 4O21A 3PLAE 3PPKA 1Z57A 2OJJA 2YAKA 3OP5A 5AJQA 3EQPA 3OFMA 3QCSA 1WBTA 5IISA 4O6LA 1U54B 4D4SA 4EH8A 2VO6A 4QP8A 2ZJWA 4KSQA 5CU3A 5FLFA 4A9TA 4NSTA 1GAGA 3VF8A 4C2WA 3S0OA 4RX9A 2JBOA 2PZYA 5IQEA 4NIFB 4C38A 2WQMA 4PL4A 3VBQA 4IWQA 2BROA 1OMWA 4RWIA 1FMOE 1YDTE 3HAMA 4ANOA 4BGHA 5EHOA 2OO8X 2P0CA 2QG5A 2FYSA 3FMDA 5AM7A 3PA5A 4JS8A 3R00A 1R0PA 5JN2A 3W8QA 3ZZEA 5HIDA 4HCUA 3UO5A 1XH7A 4GVJA 3LFFA 3MWUA 5E92A 4MYGA 2B9HA 4FYNA 2QOFA 3OXIA 3W2SA 4LRKA 4IVBA 2H6DA 3F9NA 3R28A 4WT6A 5HTBA 2XJ0A 5GJFA 3S2PA 3HRCA 4DEAA 5M57A 4GMYA 5HESA 4BC6A 4IEBA 3IOPA 4BI1A 2GHLA 1XH8A 3QYZA 1OPKA 5AV2A 3ZM9A 4ZLYA 3VW6A 3OBGA 4LL5A 2J0JA 1YHWA 2J51A 3BWJA 4FVQA 2ETKA 4BY9E 4L67A 2WTKC 1M52A 1R78A 5AEPA 2QKRA 2QU6A 4ZTSA 4FK6A 2UVYA 5DVRA 2YIQA 4DFXE 2VWWA 1YWNA 4FK3A 3W33A 1TQPA 3TKUA 2P2IA 3PXZA 4HYUA 3WF6A 3LCDA 5K4JA 4DN5A 3AC5A 2PZPA 2GS2A 4QOXA 3AC1A 2EXCX 3WZEA 4FSMA 4QTEA 1XWSA 2NRUA 3BE9A 2C5NA 4CFVA 5JEBA 1VLRA 2OIDA 3QALE 2HCKA 3ZUTA 4AN2A 2OH0E 3FZTA 5AWMA 2YDIA 4FKQA 4QMLA 3P9JA 5BX0A 2CGXA 3OOMA 2R3MA 3TIYA 2B4SB 4CT2A 5L2WA 4YURA 3E8NA 5HZNA 4EC8A 4N6YA 4IVDA 3R7YA 1R1WA 2PZRA 3LW0A 3MV5A 4G31A 4GFOA 4HGEA 2BR1A 2WMSA 2XNPA 2QOIA 4IFCA 4IW0A 1Q4LA 3CEKA 4FG9A 3QD3A 3R7GA 4MXZA 3P7BA 4K6ZA 4AA0A 3NW6A 5HD7A 4RLLA 4AP7A 2YCRA 4XP3A 4YJOA 3UE4A 4BJJB 2P4IA 1WVYA 4F09A 2QVSE 3BV3A 4G5JA 4K77A 4AZEA 3RNYA 5EQEA 2YDKA 4X2JA 5L2QA 5IQCA 2F2CB 5IA2A 2IZUA 4R1YA 3Q4UA 3R9NA 3QRJA 2XUUA 3NEWA 4AN9A 3UOHA 3LFCA 5B2LA 2VWXA 4Z3VA 4A9UA 3ENHA 2YWPA 2C5XA 4IC8A 4YPDA 4G1WA 5AR4A 4BKZA 4BBFA 3F5GA 2HY0A 4AW0A 4J96A 3LFQA 4JQ7A 4L7SA 2C6TA 4KNBA 3T9TA 2VX1A 3HV6A 5AUUA 5AR7A 3NW5A 4CYJA 2VX0A 4AGDA 3MSSA 3TNHA 3R2BA 5GJGA 5KHWA 4FKGA 4RIYA 5ANDA 5FD2A 3G6HA 3P23A 4I4EA 5E4HA 3D0EA 2YHVA 4EOLA 4GFMA 4K2RA 1U4DA 2B7AA 2X0QA 3PSBA 5CNNA 1W7HA 1TFFA 3F61A 4FT7A 4X3JA 4BBMA 4N0SA 5CU4A 5B7VA 2BZJA 3R1QA 2HZNA 2C1BA 4MXXA 3DQWA 4TYIA 4PY1A 3VQHA 3PDTA 3AMYA 1Q97A 4XHKB 1A9UA 3OVVA 4HPUE 4NK9A 1XH9A 3KF7A 2HXQA 4EZ3A 4WIHA 1OUYA 3FQHA 3Q5IA 3UMWA 3GU4A 1U54A 4Q5HA 2SRCA 2DS1A 3D5UA 4UZHA 3QA0A 5EM7A 5IQAA 4G3CA 4KKGA 1MRVA 1QPEA 1W82A 2ZOQA 4RGJA 4PF4A 2REIA 4X2FA 5AA9A 4NIFA 1H27A 2BKZA 4ZY6A 3ANQA 2PE2A 5FGKA 1H1RA 3A99A 3KMMA 5I4NA 3FZRA 3VNTA 5LJJA 5DGZA 5M4IA 4ANSA 2JDVA 2JC6A 4BDKA 4C34A 2VO3A 3E7OA 5M09A 3PE1A 3MIAA 2ITOA 4AGCA 3K3IA 2ITTA 2UW8A 3NUAA 3VBVA 3WIGA 4NUSA 3GU5A 3TXOA 3LLTA 4F64A 4RFYA 4RA4A 3LM5A 2JEDA 3MH3A 1DI8A 3PFQA 4UYNA 1YI4A 2QCSA 1H28A 3GC7A 4FTTA 4BTJA 4QP3A 5FBOA 4W4WA 1ZOGA 2VTSA 2X4FA 3ORPA 3CCNA 4FG7A 4ZTNA 4XG7A 2FO0A 3VS6A 4ZTRA 4FNWA 3QYWA 4C59A 4C58A 2XK9A 5EYMA 4R3PA 2QHNA 3HUCA 4XBRA 3OBJA 5I0BA 5C03A 3VONA 4IHPA 5K0KA 5E8YA 2W5HA 3WE4A 2OLCA 2X8EA 2Z7QA 4FF8A 3UTOA 2R7IA 1AD5A 1KV1A 3F5UA 3GCUA 3DK3A 3RCJA 3PE2A 3JUHA 3WYYA 4C4FA 2YFXA 3PPZA 5HE2A 5I9XA 4XEYA 2WMRA 4YPSA 4WRSA 3VN9A 4BHZA 2XIKA 2BRNA 3FC1X 4AG8A 3V8SA 4N6ZA 2J90A 4D9TA 3R71A 4EORA 4YO6A 4V0GB 2VU3A 4DHZA 3DS6A 3MDYA 5CVGA 1ZAOA 3N4VA 2VTQA 4CFWA 5CEOA 5ETFA 3C51A 4AX8A 1OECA 3IK3A 2E2BA 3GCSA 1MQBA 4MNEB 3ZONA 1JBPE 3HMOA 4A7CA 5BQ0A 3KK8A 3UIUA 4O1OA 3QTZA 5FM3A 4D2WA 3KMWA 3NUNA 3QQJA 3L9NA 1FOTA 1YI3A 4BJJA 4ZTQA 5CAVA 3QC4A 3VUTA 1V0OA 2GS6A 3EHAA 3O7LD 4E5AX 4EHVA 3THBA 4I24A 3RPYA 2Y6MA 2CDZA 2DWBA 5I3RA 3A7IA 4PWNA 4ZEGA 1PYEA 3V5JA 4RJ6A 5F94A 5LWNA 3QFVA 4YNEA 3LMGA 4TWNA 3O5AA 2X39A 5AP2A 4FIGA 4DBNA 1U5RA 5ETCA 4AE9A 2C1AA 1FQ1B 4JAJA 4CLIA 3RZBA 4AOTA 4YLJA 2UVXA 4WKQA 2YN8A 4UWCA 3QU0A 1PKDA 2GNIA 5JGDA 4FTOA 3DAJA 4CZUA 4E6AA 4U81A 4QTBA 4MBIA 4ITHA 5IH4A 5BYLA 2PHKA 3UNZA 1AGWA 5IU2A 4V04A 1JKTA 3Q5ZA 2IW8A 4ZY4A 3VUKA 2IVVA 4YJQA 4J53A 5JSMA 4HGLA 3MS9A 2EWAA 4JQ8A 4FEWA 2OH4A 3RM6A 4WOVA 4DFLA 1DS5A 4XV9A 4FODA 1GIIA 4FV3A 5DFPA 5DG5A 2QOBA 1PMNA 3FBVA 1YI6A 4TZRA 5FTGA 3BLHA 4C0TA 4FSYA 1T45A 3I0QA 4QQTA 4FKUA 3FMEA 3OZ6A 3OW3A 4D0XA 4HJOA 1ST0A 4I5PA 4CQEA 1NW1A 4E26A 5AUWA 4KBCA 4RPVA 2GMXA 3SOAA 4IACA 4QMUA 1Q24A 1UV5A 5EM6A 5C1QB 5KMLA 2VO7A 5IF1A 3PIXA 2RFSA 2X8DA 3MJ1A 2W4JA 4I6LA 2CSNA 3UVRA 2UVZA 3PRFA 3FSKA 4G2FA 4O2ZA 4OTIA 5IKWA 3WZUA 2VTNA 4R7BA 3HRFA 4IAAA 2NO3A 2EUFB 1M14A 3TZ7A 5A46A 3CY3A 4U8ZA 4XV3A 3TUCA 2GNFA 1YXVA 5ANOA 3ORTA 3W0NA 4QMZA 4I23A 3ZO4A 4IAZA 4ERWA 3TACA 1ZZLA 4AWIA 5AR5A 3FE3A 2XJ2A 5KBQA 2ZVAA 4IC7A 3LPBA 5KMMA 4O4EA 3NMUF 4GG5A 4V01A 1ERKA 4ALVA 3EFJA 1ZYSA 4HGTA 4EHEA 1OIYA 4LV8A 4NW5A 5JK3A 4DDIA 3H0ZA 4QYYA 4QMXA 3TTIA 5JFWA 1LP4A 4JI9A 1HCKA 3UG1A 2PULA 3F6XA 4GIHA 3R8ZA 3PXRA 5HO8A 5IEYA 3UOLA 5FXQA 4FL2A 3PZHA 2XEYA 2UV2A 2QI8A 3LQ8A 4U40A 4CVAA 2C69A 2IN6A 3MPTA 5J95A 1FVTA 2O3PA 3C1XA 4F63A 3L1SA 2UW0A 1MUOA 4AFJA 4JX7A 4DGGA 3BGPA 2PTKA 4W4VA 5D9HA 4E4XA 3E8CA 4QRCA 1DAYA 1OKZA 3PWDA 4A9YA 1TZDA 4BCOA 5CAPA 3M1SA 4ANBA 4BWPA 4ANLA 1RE8A 4MF1A 4EONA 4FKVA 2JIVA 4TYJA 1J91A 3VVHA 3NGAA 2Z7RA 4WBOA 4V0GA 3NYVA 1KE6A 4RVKA 3PG1A 3K3JA 1B38A 4MNFA 3EQDA 3S1HA 2R3LA 3JVSA 3BGQA 3D2KA 1ZOEA 5BVNA 3KXHA 4MNEA 2PVNA 3PJ8A 4FKTA 4IANA 5LMKA 2XNEA 3ZCLA 1KE8A 3B8RA 3GOPA 3HKOA 3PPJA 4AE6A 4AQCA 3SD0A 4ASDA 3DXPA 2UUEA 4MK0A 4QMNA 3O7LB 3BHTA 3VUMA 3NDMA 5AM6A 4BDDA 4NWMA 2Q0NA 4FJVA 5LVOA 4RC3A 4BDCA 3ORLA 4BR3A 3DK7A 5HG5A 3JY0A 3QZFA 4BTFA 4IM0A 4D1ZA 2XF0A 4BYIA 1YXSA 1H08A 3MH2A 3KXZA 3L9LA 3FHRA 4FTQA 3PSDA 4YZ9A 2PZ5A 5H8EA 5CYIA 5C8MA 2NPQA 4AZWA 4ZIMA 2OJFE 3FXZA 3G9NA 4I6BA 1YW2A 2W1GA 3CTJA 3GC8A 2BRBA 3RHXA 3SOCA 4O0WA 1NVRA 3WZJA 3PY3A 2E9UA 4FTCA 3ORZA 4KSPA 1PYXA 3O51A 4JR3A 5LVLA 4D9UA 4AS0A 4I0TA 5JFXA 5IH5A 2VTJA 2OZAB 4X6RA 3MFSA 2WMXA 1M2QA 1H25A 1QL6A 3Q3BA 2J50A 3L8PA 3SW7A 2J5EA 1ZARA 1O6YA 2W4OA 3A61A 3C5UA 4X2GA 3UVPA 4BCJA 4MXOA 3ZFMA 4S30A 5KMOA 5JFSA 3DK6A 3QRTA 5J7BA 3VS1A 4AFEA 2CKQA 3UPZA 2OXDA 4BTKA 4BVUA 3DZQA 1GZNA 1PXJA 4M3QA 3MFUA 5LVMA 1ZWSA 4DC2A 3TL8A 3R2YA 5AR8A 3SG8A 2QNJA 4GT5A 2WIHA 2FGIA 4C4GA 3CGOA 1OBGA 4R1VA 4TW9A 3D9VA 2X7GA 3CP9A 4ZXTA 4BCQA 3R7UA 4RJ4A 4GCJA 5F1ZA 3VBXA 4CTBA 2G15A 1BL7A 2GFCA 2XCHA 2OWBA 1ST4A 3HZTA 4QMPA 3SXFA 2EU9A 3T8OA 4FTUA 4MX9A 4BCIA 3FWQA 2BTSA 1V1KA 3BYSA 4KBKA 1E1XA 3GB2A 4FI1A 4X6QC 4ACCA 2JITA 2QO2A 1ZY5A 3GOKA 2XMYA 3FLQA 3BEAA 3BU6A 4FBXA 2OJIA 4IZ5A 2EVAA 4ENXA 5C9CA 4DLIA 3VWAA 4HVIA 1ZMWA 4O82A 5JFVA 4ZOGA 3QTWA 3RM7A 3IW5A 2FSOX 2YM8A 1HCLA 4F6UA 1DM2A 4Z7HA 2GHGA 2W4KA 2XK8A 2RFEA 4BDAA 3RALA 5F9EA 4FSRA 1ND4A 2XANA 2YABA 3PVBA 3HVCA 1YXXA 5E9EA 4JT3A 4H3PA 2ACXA 3DQXA 4PP9A 5L8LA 4DE4A 2A19B 2O65A 3FKLA 5CF6A 5HI2A 4EH9A 2ITYA 3R21A 1JWHA 4AT4A 4AQKA 5G6VA 4BCFA 4JOAA 4U97A 4UEUA 3FI2A 4EWQA 3G0FA 2J9MA 3F5PA 5IMXA 2PVMA 5EW9A 2IWIA 4BCHA 4R5SA 1YHSA 2R0UA 3OY3A 4BWKA 4MUQA 3POOA 3IW6A 2WZJA 4KD1A 5CT7A 3DU8A 4PX6A 2AC5A 2HOGA 2YIRA 5FEQA 1OL1A 3V3VA 4RG0A 4HNIA 4QYHA 5B2KA 5EQPA 4YTFA 4LM5A 4A4OA 4DEDA 1I09A 3EFKA 4NTSA 4BGQA 2WTIA 3W0RA 3Q9WA 3BELA 4DTAA 3SC1A 4DYMA 2UW3A 4J7BA 3F82A 4M15A 5K5XA 3CY2A 3E3PA 3NX8A 4XG8A 1PXKA 5HG9A 5AUXA 1QPJA 4O83A 2QR8A 3C4CA 5EI2A 2WTCA 4IIRA 4F0FA 3IW7A 1L3RE 3LJ1A 4Y5HA 3AKLA 3BWFA 4QD6A 3ZRLA 2WMBA 3COKA 3QZGA 3BEGA 4QTCA 5K3YA 4F9CA 3FMLA 4J8MA 4KS8A 5CZIA 3ZRMA 3CGFA 5K4IA 2JKMA 1XHAA 2QOQA 4RFMA 5CTPA 5D7AA 2FH9A 4BBEA 4OTWA 2XIZA 3DDQA 4XV2A 2C6OA 5EDRA 2P55A 2GTMA 4F1OA 1XBAA 3C4ZA 5E8WA 2PVYA 2VD5A 4NH1A 3P5KA 2VWBA 2YIYA 1CMKE 3BX5A 2R0IA 3DFAA 3MH1A 2EXEA 4QT1A 4YLKA 4FVPA 3R7IA 4OBQA 4O7NA 4B7TA 3G15A 2BDFA 4TYEA 3ZSHA 1Q5KA 2B55A 2CJMA 4NKAA 5AAGA 1B6CB 2OZAA 4GSBA 3ZLYA 3QD2B 4AGUA 3JYAA 2JDSA 4OBOA 4EOMA 1KOBA 4FR4A 4QNYA 3ORMA 4X2NA 3UIXA 3VS0A 4O0RA 3GU8A 5K9IA 2PYWA 3OROA 4S34A 3R73A 5HU9A 2WO6A 5JRQA 3SG9A 4TRLA 4XCUA 3W0MA 3TYKA 3ZBXA 3MY0A 4IB5A 5FXRA 4FEVA 4AAYA 4AN3A 4IDTA 3II5A 4MBJA 1WBVA 3UNKA 3FAAA 4JG6A 3VUIA 4L53A 4H3QA 3R8LA 3RP9A 4PDPA 2C68A 3DBFA 1V0BA 2X2MA 3MTFA 1QMZA 2JKKA 3A4OX 2QO9A 4ZSLA 3DLZA 4B6LA 4E8AA 4BDIA 2WTWA 4F9AA 3NVKI 1KWPA 3CJGA 5HIBA 4ZZOA 3D7TB 2WIPA 4GU9A 3TZ9A 3RPSA 3TJCA 4CKRA 2JDRA 5EFQA 3IGGA 3EN4A 1UVRA 2ZV9A 3P0MA 3LXNA 3OXTA 1OGUA 3R6XA 1FVVA 4J8NA 5CXHA 4CD0A 3PUPA 3QZIA 5HG8A 3QXPA 2VWIA 1CSNA 3FI3A 3R9RA 5CSPA 3BHUA 4A4XA 3DV3A 5KE0A 5HO7A 4M7IA 2GSFA 3FHIA 1OL7A 4NT4A 2PMNX 5DOSA 1PY5A 2G9XA 4O4FA 4RC2A 5HCZA 3R8UA 3QC9A 3GU7A 4RIYB 3A7FA 5AUVA 1YKRA 2HIWA 2IZTA 5L2TA 4XNEA 1WVXA 2FUMA 4EH6A 1GJOA 3EYHA 5A3XA 4O7YA 4D1XA 3AGMA 3RBWA 1OL2A 4CXAA 3LM0A 2C6IA 4FZAB 4P90A 3QQLA 2B52A 3KXMA 3R1YA 5CEKA 3F7ZA 3BE2A 4RWKA 5IPJA 3LQ5A 1J7IA 5ANEA 2VTTA 4H1MA 4JBQA 4WG4A 2F7XE 2Y9QA 3LQ3A 2ERZE 5LCJA 2UW5A 1KE9A 1UKIA 3CR0A 4WNMA 3BI6A 1PMUA 2WQBA 3CD3A 3COHA 3E5AA 3CLYA 1Q3WA 3QTIA 3A62A 3EKKA 4O4DA 4YJUA 5IUGA 5BVKA 1KSWA 3O8PA 3K54A 3OCGA 3KB7A 3QUPA 2W9FB 3V5QA 2G01A 3HMPA 5KMKA 3I4BA 3CBLA 2R3OA 3AC3A 3C50A 5CSXA 5HG7A 3VS4A 4GEOA 4PL5A 3D14A 2W17A 5AV4A 1NXKA 5EDPA 4EK5A 5JZJA 5KKRB 1M2PA 5EOLA 3NIEA 3V01A 1UU8A 2H9VA 4I92A 5FEDA 4TPTA 2BRGA 3Q6WA 5EYKA 4AW1A 1UNHA 4GYIA 4IVAA 4A9SA 2B1PA 3RHKA 5KZIA 3UIMA 1Q41A 3W2QA 5KCVA 3GCQA 2Z2WA 4XMOA 5ACBC 1PMEA 3FLYA 3RI1A 4IB3A 2XRWA 4GT3A 5TO8A 3MW1A 4PTGA 1MP8A 3B8QA 1Q3DA 4L45A 5A6NA 3P78A 5CF8A 1VZOA 2VGOA 5DRBA 2I0EA 1F3MC 3QQKA 4Z16A 5C01A 4QDVA 5AADA 3H9RA 3BHYA 4E5WA 2V22A 3NFFB 2PL0A 2PMLX 4ZTHA 4BB4A 3TUDA 4K18A 4EH2A 2VTMA 3HX4A 5HKMA 4O7RA 3OWJA 4XLIA 1O6LA 1WMKA 2AC3A 3FC2A 2A1AB 5LCKA 2WAJA 2XNOA 3GT8A 3EN7A 4YC6A 4JDIA 1PXNA 3OHTA 4YMJA 3AC2A 5FXSA 1FBNA 3D15A 5DEWA 2X9EA 2I6LA 2XZSA 4GJ2A 3T3UA 3JY9A 3U8WA 1NVSA 3QUEA 5CNOA 4I6HA 5BMMA 3RPOA 1SYKA 3BL9A 2PSQA 4EH4A 5DIAA 4E5BA 3JXWA 1WBWA 2J5FA 4FIFA 4GUEA 4W8DA 5ICPA 3HMNA 5ACKA 4YC3A 4TTHB 3UQFA 4D2PA 4ZP5A 3OC1A 1ZMVA 4LRJA 4D5HA 1Y57A 5DPVA 2BAKA 2QOHA 3GNIB 2C6MA 4AW2A 1X8BA 3NNXA 4HNFA 4F7NA 4QMWA 1WAKA 2BZHB 3NW7A 3Q2MA 2A2AA 2JFLA 1H26A 2JDOA 3T3VA 3ZS5A 2QQ7A 4G3FA 2BKKA 3ETAA 5DA3A 3DKOA 3TDWA 4E6DA 4FE2A 3D7TA 4RLKA 4XBUA 3RAWA 3A4PA 3DOGA 3D2IA 3OT3A 3AKKA 3AD6A 5CXZA 5A6OA 1PXLA 3EQHA 3ZUUA 4C3RA 2QOLA 2WGJA 2FB8A 3QQGA 4MHAA 3SRVA 5EYDA 2W1CA 2YZAA 3U6HA 2RGPA 4PRJA 4FGRA 2X7OA 4ZS4A 2HZ4A 2VWUA 1ZMUA 3AXWA 5DT4A 4E93A 3VS7A 3CSVA 4IVCA 5CEIA 5K0XA 2G1TA 3Q4TA 4QP7A 2CLXA 1Y6AA 4FZDB 4GG7A 5AIRA 5EM8A 5BPYA 5KMJA 3WOWA 4EBVA 4UMRA 2R64A 2VTHA 3HV4A 4FKIA 2OIQA 5HBHA 3REPA 3MESA 1YWVA 2LGCA 4AOJA 4M67A 4LRMA 2XKFA 4PMTA 4APCA 2F7EE 4QP9A 4DGMA 3R30A 3LMHA 4FV2A 3ZU7A 4O4BB 3EN9A 4P4CA 2YM5A 3ACKA 3VUHA 4WA9A 5C26A 5CU2A 4I1ZA 3FMMA 3KRRA 4ARKA 5M4UA 3ACJA 4PDYA 3A7HA 3MPMA 4GIIA 4X2KA 5HIEA 3QTRA 3V5LA 1IASA 2QOCA 4RC4A 2ZB1A 4HPTE 5JT2A 4FZFB 3TEIA 3VS5A 3KRXA 1L8TA 4EWHA 5TOZA 3G5DA 3RK5A 4J99A 2B54A 5IUHA 4XG3A 4I21A 2XP2A 4GVAA 3WE8A 5KKRC 2XAOA 3DBCA 5LWMA 4BDJA 4HZRA 2ZMCA 2RG5A 4EH5A 2UW9A 4W8EA 3QF9A 2HWOA 4O0TA 3TV6A 3FMHA 4QO9A 4QYEA 4BI2A 3R04A 2BCJA 3F3VA 4U0IA 4ZJVA 2YWVA 3NFGB 4Y83A 1S9IA 3MH0A 4JLCA 3PVWA 4EZ7A 4X0MA 3MPAA 4FKRA 4NM5A 3H9FA 3O17A 2NNWB 2JLDA 5L6WL 4DT8A 3UDTA 4YU2A 4X3FB 2QURA 3BHVA 5HVJA 3ZSIA 4UMTA 4YBKA 5TE0A 5L2IA 4ACDA 4EK4A 5HTIA 4KRCA 4C4HA 3NYXA 3EH9A 3TT0A 3PIYA 4PTEA 4S2ZA 4FV8A 4M0ZA 2X0GA 2VTRA 2R3RA 3C4WA 4KAOA 3UNJA 2E9NA 4CMOA 4FUYA 4BDHA 4FTJA 1OKVA 4IJ9A 2H34A 4JQEA 4A9RA 5J5SA 1PXMA 5AAFA 4BIDA 4E73A 3R22A 4DGNA 3QQUA 5HX6A 4BN1A 4F4PA 3QTQA 4DH5A 4YHFA 5M53A 2E9PA 4EOJA 1J1CA 1Y6BA 4IAIA 4CRSA 4W4YA 2C3LA 1WBOA 3Q9ZA 4WSYA 3W55A 2KTYA 3IW8A 3RPRA 5JQ5A 3EFLA 4Y8DA 4C4IA 3KCKA 4KB8A 2J2IB 4WO5A 4XG4A 5I9WA 1EH4A 3DNDA 3KCFA 3RWPA 4FMQA 1SVEA 3A7GA 4ANNA 3AGLA 1GNGA 3EB0A 5IA4A 1P4FA 1CKPA 5FRIA 4DFNA 4LG4A 2HZ0A 2XK3A 4IB0A 3WARA 2CNUA 3QRUA 4QQ5A 3R9OA 3KRLA 4O6EA 2ONLC 2YITA 4OTFA 4PMPA 4FT3A 4QP1A 4DEBA 4TWCA 3LAUA 2CN8A 5E8VA 2P2HA 3I60A 3OY1A 5HQ0A 3DY7A 1G8KA 3FEGA 3PUFC 3Q52A 3OEFX 5F4NA 3RZFA 4O81A 2C3KA 3ET7A 2C5YA 4NYEA 5BVWA 1OITA 4FT0A 2R3JA 2BAQA 3DAKA 4QTDA 1GY3A 3NNVA 4ZTLA 4D55A 2B9FA 4AXEA 4O7VA 3H0YA 4FT9A 3ZHPC 1OL6A 2ONLA 4I5HA 4YTIA 4CV8A 4FKWA 3UZTA 3F2AA 4K0YA 3W32A 3ZC5A 4LOQA 4DEGA 3ZDIA 1UU7A 5CVHA 2XAMA 3HECA 4O7WA 4KABA 4XYFA 5FBNC 4MD9E 4QEBA 3O0GA 2WMQA 4AT5A 2XBAA 4AW5A 5DMZA 1WFCA 3BYUA 3E92A 4HZSA 4AU8A 3HMIA 3HYHA 5LMAA 4J71A 4JDJA 3GEQA 4O0XA 5EDQA 3NUYA 4F99A 3W0SA 2DYLA 5DR2A 4C4JA 4C7TA 2FSLX 1XJDA 5HLPA 2H96A 2OJGA 3PA4A 4G9CA 3PFYA 1PJKA 3O96A 3C0IA 3NUUA 1Z5MA 4FV4A 4LFIA 2FSMX 4ZSEA 3EQGA 4GH2A 5L3AA 4D2TA 2JFMA 3PSCA 4ANMA 1XH4A 2EB3A 3F3UA 2GQRA 3FYJX 3F3TA 3UO6A 1APME 1ZY4A 4YLLA 3UC3A 4XH6A 4NKSA 3NUXA 2C6LA 1YOJA 2IVUA 3FJQE 2YA9A 1OUKA 4U42A 5C4LA 3WILA 2X6EA 5AP0A 1GZOA 2JKQA 3RAIA 4CV9A 4G16A 4FNYA 5KMNA 4IZAA 2JAVA 3NSZA 4HVGA 4WHZA 4FA2A 1J1BA 3DKFA 5DE2A 5TR6A 3AKJA 4CZTA 4YJTA 4OGRA 5HE3A 2V7OA 3JS2A 4X3FC 3R02A 3BGZA 5EM5A 3DJ6A 2UZTA 4OW8A 4OT6A 4F65A 2WEIA 4YC8A 3V8TA 4EJNA 4EHZA 5L6OA 4E20A 3ENMA 1K3AA 5M55A 3LMIA 1KOAA 5ETIA 4AF3A 5E8UA 4AA4A 3ZYAA 4QP4A 5LOHA 4MEDA 2WMAA 2X2LA 4RJ7A 1O6KA 1Y91A 3QAME 4MWIA 1U5QA 1IEPA 2PVRA 5J79A 5FG8A 1CKJA 1YHVA 1U59A 3UVQA 3IGOA 1W2FA 5HE1A 2ITNA 3W1FA 4EQUA 2R3FA 4GYGA 2BUJA 4X3FA 3QTSA 2BDJA 1P5EA 3LOKA 2Y0AA 4RMZA 2R9SA 3MVMA 4BRXA 2P3GX 4CFMA 5E1EA 3F5XA 3FL4A 3QKMA 5CSWA 4F1MA 1OI9A 3LCTA 2PE0A 2R3GA 3BRBA 3K2LA 2GHMA 3ULIA 4DH1A 3POZA 3IO7A 5I3OA 4DCAA 5E8XA 5M08A 3BV2A 3ORNA 4GKIA 3I81A 4IWOA 3O50A 5DR6A 3CKXA 3Q60A 2CCHA 3QLFA 4NM3A 3R8MA 4D4RA 2IW6A 3LJ2A 2BHHA 4U3YA 2PWLA 4IAFA 4IQ6A 4K9YA 3UGCA 1AQ1A 3F2NA 3ROYA 3O23A 4GU6A 4I3ZA 2OSCA 5FEEA 5CWZA 5I9UA 4CMUA 4DITA 2Z7LA 3BHHA 3LFAA 4TYHB 2ITQA 5BNJA 4EOQA 2XVDA 2ZV2A 3F88A 4EKKA 1OIRA 3QGWA 4XG2A 3TNWA 1FMKA 5BVEA 3BYOA 4I6QA 3DBQA 3FQEA 4QYFA 4CKIA