3NX8A

Human camp dependent protein kinase in complex with phenol
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDINHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Experimental and computational active site mapping as a starting point to fragment-based lead discovery.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nx8A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nx8A02
4ZZNA 3HDMA 4BIEA 2GFSA 4FEXA 4FKQA 1Q24A 3ORPA 5AR3A 1ZZ2A 4AZVA 4A4OA 4KS8A 1YDTE 5IH4A 3Q9YA 3UZPA 4D2RA 1H25A 3QKMA 5BX0A 1WBOA 2X4FA 1J91A 2XK3A 4Y95A 1YI3A 4P4CA 2WTIA 2PZ5A 4ZSGA 4DFBA 3DT1A 2B9FA 3FMHA 3G9NA 3HGKA 2JDOA 4IWDA 2YCSA 3R02A 2JKMA 4DEBA 2JAVA 2JDRA 4UX9A 1M17A 1P2AA 3ZFMA 4BB4A 2QD9A 4D5KA 4A9RA 1URWA 4JDKA 2W1ZA 4AW0A 3FZ1A 3NUAA 3HECA 2JBOA 4M0ZA 2CKPA 4D0XA 1MUOA 2W4JA 4ACMA 3ZTXA 4KAOA 4HPTE 5K3YA 4BCJA 4X6QC 3E8EA 4C3PA 4E93A 1O6LA 3HMMA 2Q0BA 3PSBA 5GJFA 1OIRA 4B6LA 4BYJA 5A6OA 3LFNA 4ZTNA 2H34A 3ZYAA 3BE2A 4YJSA 4B9DA 4EQCA 3FMKA 3AQVA 4PL3A 4I0SA 3DAKA 3ATSA 4DTAA 1ZYCA 4PMSA 5CU0A 1O6YA 2WTJA 5AUXA 4AP7A 4L67A 2YJSA 4HGTA 5CT0A 5HCXA 3R7YA 3U51A 2CKQA 2J90A 3DA6A 2PYWA 3KU2A 4MNEB 2OIQA 4GIHA 1WCCA 2C6LA 1M2PA 4KUJA 3R30A 4FTMA 4CXAA 2GQGA 5IA1A 3HAVA 3EN5A 1BL6A 4L3PA 4TYEA 5ETAA 5FTOA 2GNFA 4DEAA 4OAVB 3MB7A 2X8IA 1JKKA 3AT3A 3OVVA 2J0MB 3PXKA 3VAPA 5KKRC 1Q99A 3D0EA 1DI8A 4NU1A 3MPAA 5CT7A 5H2UA 2XNNA 3R8PA 4GK3A 5EDPA 3KXZA 4O0RA 4LYNA 3TEIA 4EJNA 4FIEA 2ETKA 3BHUA 3QF9A 4ERWA 3R7EA 1R0PA 1Y6BA 2VTLA 4BVUA 3QD3A 2UUEA 4FL1A 3KF4A 4YZ9A 3H10A 3ZUVA 4E5AX 2W1IA 5HIEA 4FZ6A 3R00A 5AP7A 2BTRA 3FXWA 3NR9A 2XYUA 3KQ7A 1MP8A 3OF0A 5AP2A 4AW2A 4DFXE 3F2RA 3HRBA 2I1MA 3PJ1A 5CAPA 1F5QA 3VNTA 3IK3A 1FBNA 4MXXA 3R9HA 4XBRA 3LFDA 3QTXA 4Y85A 1S9JA 3NNUA 5E8YA 5KKRB 2X8EA 3K5VA 4LL5A 4AAAA 2AC3A 2VX3A 3EL7A 1PXOA 3L8PA 2QI8A 1OL5A 2JLDA 2YWVA 2DS1A 2WIHA 4PNIA 4PP9A 3DXQA 1TVOA 1YXVA 5I4NA 3FQHA 5JZJA 4PDSA 3LIJA 4P5QA 3EQHA 1FMOE 4LFIA 4DEGA 2R64A 4FUXA 3GQLA 3MESA 3MFSA 3TZMA 3BPRA 3NUUA 1PHKA 3NW5A 4WBOA 4LV8A 3SA0A 1OKVA 4RGJA 3CGFA 2W9ZB 3EMGA 3I6WA 3LQ3A 3SW4A 5KZ0A 4C4GA 2C5NA 3KULB 3ZH8A 4X2GA 4TL0A 2IVTA 5E4HA 3QUEA 4C37A 2OFVA 4O0YA 4M84A 3VBWA 1Q8WA 2VTJA 3W33A 4EL9A 2CHLA 1NVQA 3GU6A 4BICA 2UZUE 4BCIA 4C2VA 4FT0A 1HCKA 4TTHB 3ZBFA 3OW4A 3VHKA 4GK4A 3EQGA 4WNOA 4UXLA 3OXTA 4EOSA 3FZRA 4TYHA 2YM6A 4XP3A 4KIKB 2XK8A 2YAKA 5BQ0A 2BZKB 4EQUA 4FTKA 3MY0A 1WVWA 1XQZA 4RWLA 3E8NA 1NVSA 4I4EA 1ZRZA 1SVEA 3PFQA 4HGSA 2GS7A 3BE9A 4LOQA 3FMJA 2CN5A 2OZOA 1OL2A 5CF4A 3HV3A 4IAKA 4QRCA 5ACKA 2J5EA 5HU9A 3JPVA 3NVKI 4YTHA 3B2WA 4ERKA 1UWJA 1XH5A 2A4LA 2PVYA 4Q2AA 3JVRA 5E8XA 3KXXA 3QUDA 3OC1A 4F08A 2X7FA 2ZV2A 1VYWA 3IGOA 4OTIA 4F9BA 4UMUA 4BCNA 4AGWA 3UOJA 3R2BA 3FLSA 3HP2A 1NA7A 4N57A 1CDKA 4ORKA 3W2RA 2YM7A 4RWIA 5CEKA 4ITIA 5C03A 3BV2A 1PYXA 4TWCA 4R3CA 2CN8A 3DAEA 2W96B 3ZRKA 4OUCA 4FTAA 5E8VA 3I79A 4YPSA 2A19B 3LMGA 3THBA 4AA0A 4F65A 5C4LA 3JS2A 2P55A 5BUEA 5J1WA 1YI4A 2YM8A 1WBSA 1CKPA 3R9DA 5DBXA 5BMMA 3LCOA 2J7TA 3UNJA 4BKZA 4M68A 5E91A 2OXDA 3MH0A 3NUPA 1VYZA 5FM3A 2OXXA 5CF8A 3TIYA 2XA4A 2F4JA 4ALVA 4G2FA 4MD7E 1UVRA 3OROA 4GEOA 3UIMA 4H3PA 2C69A 3UIXA 3H0YA 4EOJA 1LEWA 3RWPA 3RJCA 2JFLA 3MPTA 4J7BA 3SGCA 4MXYA 2WQOA 4FBXA 4OBOA 2B7AA 2CGUA 4FSQA 5TOZA 4C2WA 3QZGA 1OIUA 2QOCA 2WNTA 4HVHA 3T8OA 5J7HA 1T45A 5EHLA 2J51A 3Q3BA 3LE6A 2AUHA 3HUBA 2J0JA 2XIYA 5AUVA 3AC5A 3NCZA 1GJOA 2EXEA 4IJ9A 4WO5A 2VD5A 4FG8A 4WT6A 5AR2A 2YN8A 3OWKA 4PP7A 5AP4A 4QMTA 3SXRA 2CLXA 3KA0A 3DKCA 4JBOA 5J79A 4MXZA 3L9PA 1QL6A 1VEBA 1KOBA 3VQHA 5EKOA 3OUNB 2XBJA 3EOCA 2EVAA 1BLXA 4IDVA 3QCYA 3LXLA 1LPUA 1JLUE 2R7IA 1H4LA 4H3BA 4OW8A 3OS3A 5C8MA 1QPDA 2VTMA 4IB5A 4WIHA 4HVDA 3Q4UA 2C6IA 2VU3A 4IFGA 4F9YA 4OTQA 4FKSA 3C50A 1XWSA 3BCEA 3FXXA 4OT6A 3EQRA 3ALOA 4BBMA 5GINE 2ZV8A 2QCSA 2QU5A 5CENA 4BZNA 4OLIA 4O7VA 3TNPC 4S31A 4O38A 2FGIA 3Q9ZA 1KUTA 3F9NA 1ZMVA 2PK9A 4PPBA 3NUNA 4DN5A 3K3JA 3BELA 4CEGA 4DH1A 5ETIA 1CKIA 1Q97A 3OMVA 3V8TA 3BYVA 4I41A 3OY1A 5HTIA 2XNEA 1OPLA 3BHTA 3HEGA 4GW8A 2YABA 2YITA 3QLGA 2ONLC 3PA4A 3NWWA 4G3FA 5D41A 4BHZA 3I81A 3WZJA 5JN2A 4J52A 4I22A 2JFMA 4CRLA 4D1XA 1WBWA 2X7GA 2BCJA 3HV6A 2W5BA 5FBNC 3I0OA 1JWHA 4XP2A 4XHKB 1WZYA 4QNAA 3G6HA 4U41A 4FV9A 3F3VA 3Q53A 3BX5A 5EG3A 5H8BA 1YDRE 4F0IA 4GKHA 4JS8A 5CQUA 3ZO4A 3N4VA 3UP2A 2ITNA 2BRHA 3TV6A 1U54A 4KKHA 3TWJA 3OFMA 3BYMA 3KN5A 3QD2B 4L8MA 1APME 2QLUA 2BAQA 4D9UA 3LFAA 3MVMA 3R7IA 2BPMA 3IW5A 1WMKA 3POOA 5EHOA 2OH0E 2VWBA 5KO1A 3VUTA 4LRKA 5KMNA 5CU6A 4YO6A 4EK6A 3ZFYA 5I3OA 5KMJA 4WG5A 4FNYA 4AGCA 1OL1A 2V62A 3D15A 3D7TA 3F3TA 2IW9A 5I9XA 1ZOEA 4XG9A 2W05A 3CPBA 3RTPA 3VUIA 3QUPA 5KCVA 3C4FA 4HZSA 4NKAA 3ORIA 4FSTA 3O51A 4EBWA 4JRVA 4HGEA 5J8IA 2HK5A 3GCQA 4BDDA 3N4UA 3CPCA 4IAAA 5J95A 5FDXA 4FSYA 2YZAA 5IQEA 4ZSEA 1H26A 4NJDA 3BRBA 4I5CA 4DFUA 3ORTA 3CD3A 4IZ7A 5F20A 3TUBA 2BDFA 5CEQA 4YJVA 4IWQA 3F88A 4ZJVA 3F7WA 2UW4A 3I0QA 2OZAA 5ACBC 5EOBA 3R7OA 3PY1A 4R5SA 4DF3A 3DDQA 3FI2A 2B9HA 4Y73A 2XKEA 3PIYA 3QYWA 4UYNA 4IEBA 4IWPA 5FEQA 3SG9A 3ZEPA 2A0CX 3UOLA 3BYUA 3PSCA 3EFLA 4YC6A 3T9IA 5BMSA 3F5XA 2HY0A 1WVYA 4DEDA 3OOMA 3RINA 4EWQA 5FXRA 4O7YA 3RK5A 4WA9A 4TKSA 1FVTA 5FP5A 3BLQA 3U54A 2CKOA 2WMWA 2IZUA 3FLYA 2R4BA 4H1MA 4YLKA 4E4XA 1VR2A 4O1OA 4LUEA 1PKDA 3P0MA 5AX9A 5B0XA 4NCTC 3CXWA 2A2AA 3OUKA 5E8ZA 3KCKA 3QTSA 1REJA 1U46A 4FKRA 4USDA 5HTCA 5K4IA 4XV3A 5M4CA 5T68A 4UB7A 4QTDA 2ZV7A 5CQWA 4U6RA 3RPYA 2H6DA 1I44A 3C4XA 5K9IA 4MHAA 3UMXA 5M07A 3QFVA 2CJMA 2GCDA 5BVOA 2W1GA 5EYDA 3RI1A 3PDTA 1Q8ZA 2JDSA 4RJ7A 2PSQA 5ANIA 3C13A 4BGGA 3D2IA 1B38A 4FKWA 4K18A 4PMPA 5HQ0A 3DQXA 4RIWA 3LCSA 4XV9A 3UPXA 5CEMA 3PVBA 5BYZA 2DUVA 3Q60A 3W2PA 3WZEA 4EOIA 4FV8A 4M3QA 1XKKA 2UW0A 4GU6A 4IFCA 4YC8A 1O9UA 1T46A 2BMCA 5CEPA 3TT0A 4S34A 4W9XA 5C01A 2DYLA 2FYSA 2G1TA 3U9NA 3VS5A 3UJGA 1GZKA 2PZRA 2W7XA 4U44A 4GKIA 1OITA 2YAAA 3A4OX 2YFXA 5TO8A 4Z16A 1XO2B 4GYGA 5D1JA 2W4KA 3MY1A 2VX1A 2OH4A 2PULA 3HMIA 3VJNA 3A7IA 5CXZA 4ZSJA 4XBUA 5BVFA 3ZRMA 4X3JA 3VW8A 4F6SA 2OJGA 3FMDA 1V0BA 3DQWA 3LLTA 3OEFX 4B0GA 4J98A 3DPKA 2BRGA 4JVGA 3DBFA 4BWPA 3GNIB 4E20A 4O7SA 3MB6A 4S30A 2O0UA 2R3LA 2ZDUA 3DZQA 3NYXA 4EZ7A 3PRIA 4R3PA 5ANGA 3FMNA 4Y46A 3AGMA 2PVHA 1KE9A 3AD4A 3FMEA 4IVAA 5C9CA 3AD5A 2BAJA 3Q2MA 4FZ7A 4R6VA 1MRVA 4BDFA 3SRVB 3VJOA 3MH3A 4FEWA 4D58A 1K9AA 1YHSA 3IS5A 4LOOA 5AA9A 4X2JA 2JC6A 2BDJA 4YBKA 3F82A 3IGGA 3QYZA 4KSQA 3CTHA 2J0IA 2BFXA 4C61A 2VTSA 2JITA 3DXPA 5AAFA 3SHEA 4FV1A 3FMMA 3Q4ZA 4TYJA 3HV5A 2OIBA 4BWXA 2VUWA 2VTHA 4IAYA 5A4EA 4AZEA 4JJRA 3EHAA 5AX3A 4F1TA 2XM9A 4QMOA 3VS0A 1YXTA 2NPQA 3HYHA 2IW8A 3F2AA 3ZS5A 2Z7SA 2IG7A 4AE6A 2BRBA 4IXPA 2AYPA 4QD6A 3T3VA 2J2IB 3F2NA 5BVWA 3WZDA 4AOIA 4OTGA 4EH3A 4QYEA 2JAMA 3UGCA 3VVHA 5J1VA 4O81A 2E9PA 3BWFA 1ZXEA 4YSMA 4EK5A 4DA5A 5HCYA 1W83A 4XCUA 4ALWA 4BTFA 3QCXA 5E90A 3I7CA 5LMKA 4XRLA 1EH4A 3BIZA 2GTMA 2WD1A 4MBLA 4F9AA 2IVSA 4KWPA 4RC2A 2PMLX 5HNIX 3D14A 3QRJA 1BUHA 5E8UA 3QRKA 4G5PA 3I60A 2QO7A 4UN0C 5C26A 5HKMA 4I92A 5JKGA 3KCFA 3K2LA 1ZZLA 3LXNA 2BKKA 3JUHA 5EW9A 4ARKA 4C4IA 5HD4A 4DTKA 3NIZA 1OPJA 2HZIA 2PVRA 3KY2A 3KXMA 4L52A 4MNFA 5DE2A 3DKGA 1ND4A 1PF8A 3IW8A 3ROYA 2WKMA 3KVWA 5CF5A 1UWHA 2QONA 4BKYA 4CKJA 3ZSGA 5J5TA 2PE2A 2C0OA 3QQUA 5AV2A 3UG2A 2GNIA 5HIDA 4YZDA 3NUSA 3OWPA 5K0KA 1GIIA 3F66A 2QOLA 3DJ5A 3KXGA 4M69A 5EM5A 4B7TA 5J5SA 3UZRA 3TKUA 2FUMA 2VTAA 3MVLA 4EK3A 3HRCA 1W0XC 4FGBA 4FMQA 4QMLA 2PU8A 4Z3VA 2UV2A 3PP1A 3PPJA 5IQDA 2J50A 2NP8A 3NX8A 2OXYA 5IA0A 2PVKA 3ULZA 2OO8X 5AV4A 2IPXA 3DCVA 3E3PA 4FSNA 4YJPA 2NO3A 1ZARA 2FH9A 4EHGA 3PXQA 2VTRA 3TCPA 1H00A 3PPZA 3R04A 3MPMA 2BTSA 4NIFB 2VNYA 4GH2A 3DGKA 4MQ2A 4QQJA 5DRDA 3C4EA 4QO9A 4GV1A 2F57A 3OWLA 3W2QA 1V1KA 4CV8A 1JNKA 4GK2A 1UU8A 2QU6A 3COKA 5ANOA 3VUHA 4R8QA 2HZNA 2UW6A 4FV6A 4O7WA 3IOPA 4FEQA 5FXQA 3WF8A 1F0QA 3GXLA 1BL7A 3N51A 4AA5A 2ITUA 2E9NA 2WGJA 3ENHA 3MH2A 4QQCA 4NKSA 4BI0A 4N0SA 4JBQA 4RA5A 4RX9A 4J8NA 3LQ5A 2PVNA 4WHZA 2WXVA 5M08A 5IEVA 4QPMA 2X39A 3VUMA 4G9RA 5DMZA 2C3JA 4H58A 3FY0A 3FKNA 5DN3A 4CV9A 4QP1A 3CKXA 2WQBA 5DR9A 5EOLA 5IQIA 3MTFA 2XK4A 5LOHA 3FKOA 4KRCA 3NPCA 3FPMA 3PJCA 4MBJA 4ZSLA 5GIOE 4AG8A 3LCDA 3D5XA 3QRIA 4I21A 4OR5A 4DGLC 2ZOQA 2PE0A 3HA8A 4C4JA 2BHEA 3FMLA 4DGNA 4F9WA 1UV5A 3OEZA 5CSHA 5JQ8A 4R7HA 5CF6A 4ZZOA 2QR7A 1JKSA 3ODZX 3UO4A 4YZCA 3C4CA 4IB1A 3PJ8A 3SKCA 4OTHA 4CZTA 2O8YA 5LCKA 3G0FA 2GNJA 2BALA 4C7TA 2JIIA 2XNMA 4TT7A 5IQAA 5K5XA 3W8QA 3FYJX 3GEQA 2ITZA 4IC8A 1R1WA 2ZB0A 3GOPA 3MI9A 3GVUA 2W1HA 4FV5A 1J7UA 2P2HA 4LGGA 5H9BA 1TQMA 5GZAA 3TTIA 4XV1A 4JG7A 3S1HA 2C6OA 2BILB 2C3IB 3G0EA 4QMVA 4TWPA 4G17A 5AMNA 4BDAA 3REPA 3R22A 3JVSA 4C3FA 3GCUA 1AGWA 4C4HA 3AT2A 4IM3A 4JOAA 4E7WA 2VO7A 3E7OA 4EONA 4PL5A 4NM7A 4MTAA 5E9EA 1OKWA 3KMWA 2J4ZA 3G2FA 5TE0A 5FTGA 4PUZA 3R9OA 5HGIA 1Q3DA 2XNOA 5A3XA 5ANEA 2GS2A 4FG9A 3DS6A 2WQNA 4FIIA 4MBIA 4E4LA 2ZM1A 3EN9A 5L2QA 4O22A 4ZS0A 1KV1A 1CTPE 2W99B 4BCKA 4CLJA 4MVFA 4AGUA 2O64A 2PMNX 2GU8A 4EQMA 4DH5A 4PMMA 3Q52A 3LFQA 4IX6A 4FKJA 5I9UA 4WNKA 3ROCA 4FT9A 3FSFA 4DEEA 3LFEA 3V5TA 3ZOSA 2WMBA 4R1VA 3DLZA 5ANKA 3PY0A 1JBPE 2VTTA 3BQCA 2CNQA 4Q9ZA 2QKWB 3DBEA 4EJ7A 3TNHA 2BHHA 4MNEA 2ZYBA 4I6FA 4QPSA 1KE5A 1M14A 4GYIA 2PUPA 4JQ8A 5LVLA 5D11A 4K2RA 2ESMA 1QCFA 2XH5A 4PTEA 2HZ0A 4FKIA 4MX9A 5HHWA 2R3IA 1SMHA 5DWRA 2QURA 1XHAA 4XOZA 4RVLA 5CAQA 4AUAA 4FK6A 4IX3A 5EI6A 4EH4A 4JDIA 4HOKA 3Q6UA 4ZXTA 3EB0A 3T9TA 5IDPA 4W4WA 3MDYA 4FR4A 3I1AA 2YCQA 3BGQA 3UOKA 3WARA 3DJ7A 1OECA 4N6ZA 3BLRA 4K6ZA 4PF4A 2LAVA 4QOXA 4CFVA 3TKIA 1XJDA 4MF0A 4PY1A 4BL1A 2PZIA 3OHTA 4ID7A 4JX7A 2G9XA 3CEKA 3MGYA 4K77A 1JSTA 4K33A 1DM2A 3UYSA 3BYSA 3M42A 3ZLWA 2PUUA 3ET7A 4YJUA 2PPQA 3N4TA 5HG5A 2HWPA 4FGRA 4RLLA 2UZTA 2VO3A 3ZMMA 2FSLX 4CD0A 2R3QA 4R7BA 1BI7A 2IVUA 3AGLA 4QMUA 4UWYA 3AMYA 2XEZA 4RZVA 5ETFA 3TNWA 4RC3A 4FTIA 3RBWA 3CC6A 2OU7A 2W1DA 2YEXA 4IAZA 1ZOGA 1TKIA 3ZM4A 2WIPA 3V51A 4BBEA 3EKKA 3VBVA 3C0IA 1UNLA 4JIAA 2E9VA 3L8XA 2RG5A 1Q3WA 3ZC5A 4UALA 2OWBA 4Q5HA 3SC1A 5EW8A 1KE6A 3CKWA 3I5ZA 3QGYA 3WOWA 4IM0A 5JZNA 2YM5A 2XJ1A 2J9MA 3MVHA 2BVAA 5IH6A 4ZMFA 4IX4A 3R8UA 3BEGA 2ZM4A 4XRJA 2QO2A 1BKXA 5K0XA 4X3FC 2QG7A 1DAWA 4YR8A 3SDJA 2ETMA 2OJFE 3Q5IA 3TKHA 5T6KA 2R0IA 4I3ZA 3R9RA 5L8LA 2YJRA 2C68A 3M1SA 3QQKA 4ZTSA 3G5DA 1BI8A 4JT3A 4X6RA 3SXSA 4K0YA 4RBLA 3MH1A 4CKIA 2WQEA 1YXUA 1PXJA 2WU7A 4O7ZA 4XG8A 1OKZA 5KE0A 3TN8A 2PUNA 4ZY4A 3CGOA 3CCNA 3EQDA 4S2ZA 5FLFA 3RVGA 2B4SB 4D28A 2WPAA 4KIKA 4QMSA 4F0GA 5HZNA 4RMZA 4C33A 3QKLA 3RP9A 2ZJWA 3V5WA 3QX4A 3M2WA 4IAIA 4YZMA 2A27A 2HW7A 4X3FB 1OVEA 2VRXA 1PXNA 2YDJA 2OJJA 3FC2A 3UO5A 4BF2A 4M8TA 1JKLA 1XH9A 3I5NA 4F63A 3HZTA 2IZTA 2WZJA 3HMPA 4G1WA 4EK8A 4JXFA 4O0UA 4U7ZA 4TZRA 5JMSA 3SLSA 3SG8A 3EZRA 5JSMA 4IVDA 3Q2JA 4EOOA 4BGQA 4OTDA 4O84A 4IB0A 4EYJA 3HKOA 1BYGA 2ITYA 4MD9E 4ACHA 2YHVA 2ITTA 3PXYA 2R3KA 2OF4A 5JGAA 1PW2A 5EW3A 1UKIA 1OKYA 4HCUA 2WMUA 4CFUA 2Y7JA 4XMOA 1XH7A 3ZFXA 4FL2A 4J95A 3QHWA 5JFSA 2ZMCA 5DRBA 3SOCA 2RSVA 5IUIA 4BDJA 4G3EA 2GFCA 4MXAA 3RCDA 4NM0A 4FT5A 4RIXB 4G3DA 4TN6A 4IM2A 3VO3A 4C4FA 1UU9A 3DNEA 3ORKA 3OXZA 3PXZA 5GHVA 3WE8A 4I6BA 4F4PA 3PSDA 2XRUA 2OJIA 4G3GA 4IWOA 4AU8A 3H9FA 2OG8A 5IISA 4G6OA 5FP6A 4ENXA 4RIYA 5EM7A 2WHBA 4BHNA 5E92A 4DFNA 2PMIA 3QKKA 2VNWA 3E87A 1WBVA 5KMMA 3UVRA 3GOKA 3S95A 3UIBA 1DS5A 5CU4A 3RAHA 1PRYA 4G9CA 1Z9XA 2C3KA 4LMUA 3DK7A 4BDIA 4J71A 1V0PA 4YJQA 4RVMA 3UO6A 4L46A 3POZA 5AV0A 3ITZA 3U87A 1SVGA 2BZJA 1OUYA 3WF7A 2YLEA 3MWUA 4BDBA 5AEPA 3MA6A 4D2PA 2BZHB 4I1ZA 4R7IA 3CTQA 1AD5A 1IR3A 1KV2A 2HAKA 4C62A 2CMWA 5L6OA 1FINA 4U5JA 4JDJA 3UQGA 1Z57A 3UQCA 4X2KA 1PMEA 2CDZA 2YIQA 3CD8A 2WTCA 4NFMA 1YWNA 4L45A 3D83A 2R0UA 2X1NA 1HCLA 4YNOA 5FEDA 5A9UA 3WZUA 1CM8A 1WBTA 3DY7A 5TF9A 4ZTLA 4B8MA 4C36A 5IQCA 1KE7A 5J87A 4CYIA 4IIRA 2WMTA 3I4BA 3LFCA 4MK0A 4O2PA 4YGAA 4ACDA 2JIUA 5CVFA 2JD5A 3FC1X 3DKFA 4A9SA 5KNJA 5CNNA 1BMKA 3GGFA 5DEWA 4BTKA 4BZDA 2IZRA 3FLZA 4X7QA 3KXHA 1M2QA 1PY5A 1Q8UA 4FYNA 2P4IA 5EQEA 3MVJA 5AM6A 2R7BA 3E3BX 2Q83A 3QBNA 2YZLA 3BHYA 4RJ4A 3VW6A 4FV0A 5FGKA 5HESA 4EH2A 4TYHB 1DI9A 5I9YA 4O7TA 4RJ5A 5CEOA 2QOKA 2C6DA 2ITVA 3QQLA 4FEVA 2VO0A 1H07A 2FO0A 3D2KA 4OTRA 2XNBA 5J9YA 5AA8A 4W4YA 4U3ZA 3G9LX 5KBQA 4FSWA 3V8WA 2VWZA 4YLJA 2Y4PA 3E8DA 2YDIA 2GMXA 3CTJA 3EZVA 3TNQB 3GP0A 4WUAA 4JL9A 1A9UA 4FKGA 3II5A 2IJMA 2KTYA 3EQCA 2YIYA 5CSVA 3B8QA 3V6SA 5M51A 3E62A 1JQHA 4MXOA 4WNPA 3QALE 4QP6A 3RGFA 3UYTA 1GZNA 5L2WA 3W8LA 3EFJA 3R0TA 3MYGA 5BYYA 5CAUA 4PX6A 4CLIA 4A4XA 4A06A 1M2RA 4FTNA 3OBJA 2R9SA 4RFZA 1OIQA 4CYJA 4QYYA 3RAWA 1YDSE 4X2NA 3LMIA 4KIOA 3KMUA 4FNXA 2P2IA 1JOWB 3GC7A 4D2SA 4V04A 4AZSA 5LMBA 1UNGA 3HV4A 3S00A 2AC5A 2Z7QA 4QMQA 4ZLZA 4JDHA 4RJ6A 2X8DA 3ACJA 4CSVA 1YOLA 1IRKA 5AAGA 3K54A 3TG1A 3KK8A 1P4FA 3R71A 5CTPA 3ZZWA 3U6IA 5BUJA 3VC4A 3COHA 3H0ZA 3PIZA 4A7CA 1CKJA 2F7EE 4DG0E 5AUYA 2PHKA 4YU2A 1A48A 3ZM9A 4JIKA 2ITPA 3DKOA 3L9MA 1LP4A 1P5EA 4OBPA 5CSWA 4AX8A 4D55A 4CGAA 3Q9XA 2ZVAA 4FIJA 4AZWA 4Z7GA 4KNBA 3EFKA 4LV5A 4MD8E 4ZP5A 4EOPA 2CKEA 5IZFA 1A06A 5M4FA 3A62A 5D9HA 3MTLA 5AV3A 1UA2A 1YHWA 5GNKA 2WMXA 4LI5A 1STCE 2CGXA 3AC3A 5JK3A 3AXWA 2ITOA 4ZTHA 4F6UA 3LM0A 4KSPA 5DVRA 3V5QA 4AFEA 4O0WA 3PLAE 4AQCA 2DQ7X 2F7XE 2F2CB 1YRPA 3LVPA 2FSMX 4FC0A 4RQKA 2J5FA 5CY3A 3DOGA 1YOJA 2VGPA 3CY2A 3FLNC 4S32A 4RQVA 3R7VA 1GZOA 1YXXA 4LOPA 4F09A 4C8BA 2Z7RA 4BKJA 4AW1A 1OBGA 5E8TA 4FTQA 2HY81 4WOVA 4CMUA 4FIGA 3TUDA 5DEYA 3PPKA 3QTWA 3LJ2A 5I9VA 3LPBA 3ZLXA 5M06A 2X6EA 4I5PA 3R8LA 2E2BA 2QOFA 2C5OA 4J53A 2NRYA 2PMOX 3BBWA 3VRYA 2RGPA 2V22A 3O0GA 5CI7A 2VX0A 3KRRA 4Q9SA 3BHVA 5EKNA 2JGZA 1YHVA 4FVRA 4NCTA 5DLSA 4WD5A 3V8SA 4YHTA 4KRDA 4GU9A 4L7SA 3RZFA 1YKRA 3DK3A 4ANSA 2HENA 1FVRA 5EDRA 2PVFA 3RPSA 4W8EA 3DTWA 2WEVA 3ZHPC 1XH6A 2R3FA 3S4QA 4IZYA 1JKTA 1GOLA 2C0IA 5HOAA 3JR1A 4GVJA 3ORZA 3QC4A 2X81A 5DPVA 3B2TA 2WOTA 3UOHA 2XNPA 1IAHA 4CFNA 3DNDA 4HPUE 3LFBA 2B0QA 3D9VA 3G90X 3MN3A 1U54B 2UW5A 5D7AA 1YVJA 2JDVA 2PY3A 2UVYA 3Q9WA 4K8AA 5FRIA 2UW9A 5IEXA 2R2PA 4CCUA 2REIA 5A46A 3AT4A 5GJDA 5JFVA 2X2MA 2IO6A 1XBCA 1GNGA 5HU3A 3HL7A 2YCFA 2QQ7A 3BHHA 4I20A 3OY3A 5HE0A 4EH5A 4EYMA 4DCAA 4DT9A 4AOTA 4QMPA 5JH6A 3NNWA 3E63A 3NAYA 4BN1A 4J1RA 3FWQA 4GFGA 2XCKA 3D7TB 2W1EA 4QMZA 2X6DA 3WF6A 4HGLA 4L6QA 3GI3A 4YJNA 1W82A 5HNGA 3A2CA 2GSFA 2VAGA 2XEYA 2UZDA 3FHRA 4KBKA 1TQIA 3BV3A 5CXHA 5EQPA 4ZS4A 5CYIA 3HRFA 2JIVA 3KN6A 1H27A 2I7QA 3QL8A 3NIEA 3QZHA 3KEXA 5IUGA 4D0WA 3MSSA 3MS9A 2O2UA 1UU3A 1H0VA 2OZAB 5LVMA 3PA3A 1DAYA 3NEWA 3ALNA 3R9NA 4IHPA 3L1SA 5ANJA 2OK1A 3RK9A 3ZLYA 5AJQA 4FTOA 4PRJA 4D2VA 1URCA 4O96A 1R78A 4N6YA 1P4OA 3OOGA 4MXCA 2B1PA 4IB3A 2QOOA 4FNZA 1H1QA 5IMEA 4QP7A 3PIXA 4H36A 5IU2A 3BQRA 4KKEA 3ETAA 2GS6A 2W0JA 5TKDA 1YQJA 2Q0NA 2EUFB 3VS2A 5C8KA 3HAMA 3R1SA 2QODA 3UMWA 2FB8A 4TNBA 3TL8A 3I7BA 2GTNA 2BR1A 3RM6A 3GENA 4FF8A 4MF1A 4AOJA 5B2LA 3AOXA 1K2PA 2XS0A 3KK9A 4I6HA 3FPQA 4FTCA 4AN9A 4V05A 3WYXA 3C9WA 4EC9A 5C27A 3FI8A 3WI6A 4RRVA 3GBZA 3KMMA 3QAME 4FZFB 4F7NA 3TJDA 4CZYB 3F3WA 3HNGA 3TJCA 4F9CA 4C57A 2UZOA 5IA4A 4EKLA 2GNGA 2XP2A 2IW6A 3KKVA 2CPKE 3QTIA 2JKKA 4JR3A 4U3YA 4M66A 4DG3E 4PQNA 4XP0A 4KIQA 2I6LA 3E5AA 4L7FA 4AWIA 4ZTMA 3P4KA 3EJ1A 5EH0A 3CQUA 4JRNA 4I5HA 3RHKA 4CFFA 3HUCA 2R3RA 3NYOA 4GG7A 1I09A 5DR6A 5LVOA 2QOHA 2CGVA 3ERKA 3SOAA 4CT2A 1YXSA 4FV4A 2WAJA 5HE1A 4X21A 4TYGA 5AUTA 4UMQA 4BTMA 4DHFA 2FSOX 3LCTA 4QMXA 4N4SA 3KFAA 5BYLA 2WMSA 5JRQA 2OBJA 1PMUA 4JR7A 2JBPA 3R73A 4NL0A 5L2TA 4H05A 4I23A 4FL3A 4ZJIA 4BFMA 2YA9A 4ANMA 5JT2A 1FPUA 1OMWA 5E7RA 3UVPA 5M4UA 2ITWA 2VWXA 1ZYDA 3E88A 2EWAA 1FOTA 3OCTA 4KBAA 4ANQA 1OB3A 3NMUF 1ZMUA 4PL4A 4ZY6A 5FEEA 5CAOA 5KMIA 1YWRA 2VTPA 3N9XA 3O7LD 3MJ2A 2VZ6A 3NRMA 3F5UA 4AT3A 4GCJA 2X9FA 3IOKA 4FIHA 4U97A 2R3JA 5IA2A 2XYNA 5HE3A 4YP8A 3C0HA 3QTUA 4I5MA 5HVJA 4BCMA 3RCJA 1L3RE 4WRGA 1XH8A 3WIKA 2YDKA 5DFPA 3E8CA 1FGIA 2OW3A 5AUUA 4CG9A 5I9ZA 3UE4A 3TACA 4CFWA 2IVVA 2Y6OA 3GB2A 4FK3A 4BIDA 3R01A 3PG3A 4RLKA 4QMWA 4MWHA 4DFYA 5AP6A 4PTCA 5DHJA 3NDMA 2XF0A 4H1JA 5LMKC 3IG7A 3HMNA 4IDTA 5CANA 2OKRA 2IN6A 3SD0A 4AZTA 3P7BA 3JYAA 4CKRA 3D4QA 3A99A 2QOIA 4TNDA 2F7ZE 4RFYA 1LUFA 5FUTA 1H01A 4NM3A 3S0OA 4F70A 4FKPA 1NT2A 2ZB1A 1Q4LA 2YWPA 1SYKA 1X8BA 4YO4A 4NYEA 1WFCA 3R83A 3HDNA 3RWQA 3RZBA 3BU5A 3OCSA 2G15A 3OT8A 4JNWA 4W9WA 5L2SA 4NJ3A 3TZ9A 5TT7A 5HO7A 5J7BA 2R3PA 3C51A 4CTCA 3QTZA 3IKAA 5DG5A 5F1ZA 4ZJJA 5LVNA 3PYYA 4MCVA 1ZAOA 2VWWA 3U8WA 3BKBA 4FKTA 1FVVA 4QP9A 1W8CA 4PPAA 5DOSA 2PWLA 3NYVA 3V5JA 3VRZA 2RKUA 5DYJA 2B9JA 5E8SA 2V55A 3P5KA 4D4RA 3OT3A 1GY3A 2W17A 3F3ZA 3RAKA 4E6DA 3LJ0A 3LXPA 3GU5A 2UW3A 3NVMB 4BDHA 3EQFA 2BIYA 2Z8CA 2Z7LA 4FZDB 4ENYA 3VUDA 4E4MA 3VS7A 3QQJA 3RNYA 1AQ1A 3CIKA 1H1RA 3PA5A 4YJRA 4L42A 4QMYA 3KC3A 2HOGA 2Y8OA 4DEHA 3TNIA 4MYGA 3G6GA 5KHXA 3DU8A 4U40A 3QA0A 2WMQA 4FV3A 4CZUA 3KRLA 5ITAA 3KRJA 4O86A 1J7LA 2ZMDA 3W55A 5E1EA 3GC8A 3LFSA 4KBCA 4UYAA 4RWJA 3ZO1A 1L8TA 3OBGA 4YZNA 3H9OA 5EDQA 4XNEA 1ZYSA 4V0GB 3IECA 2P3GX 4FSZA 2EB3A 5D10A 2WU6A 1XH4A 3RMFA 4BCOA 1PJKA 4O82A 1Y91A 2VTOA 4XG4A 4CG8A 4FG7A 4G31A 3KRWA 1CSNA 1FQ1B 2XJ0A 3Q4CA 3BBTB 4FTTA 5M56A 3ZUUA 4UXQA 3TZ7A 4PMTA 4M14A 2UVXA 1OL7A 2YERA 3Q6WA 4WG3A 3RPRA 1XBAA 5I5ZA 2XB7A 4PDYA 4TY1A 4G6NA 3GQIA 2W06A 3AC1A 4CRSA 5CEIA 4DGMA 2R3NA 3VBQA 4LL0A 4JAIA 2HYYA 5FTQA 2QG5A 1OIYA 4IADA 3WILA 3H30A 4HW7A 4WNMA 3BI6A 2X7OA 3E7VA 5ANDA 5HG7A 3ATTA 3T3UA 3IDBA 3W32A 2V7AA 3MJ1A 4DC2A 3A8WA 5F9EA 4O0VA 4AN2A 3EQPA 3TV7A 3W2OA 5KMKA 2QR8A 3C5IA 2WTWA 3FXZA 3NUXA 3QCSA 1F3MC 3G51A 4M97A 3ZZEA 5F94A 5HLPA 2O5KA 1M52A 3PWYA 5AR7A 3VN9A 2HXQA 4QQ5A 3SX9A 4D1SA 4RZWA 1QMZA 4FTRA 5A6NA 2Z02A 4PPCA 3QLFA 4DLJA 4QP3A 3A8XA 5HLWA 2G2FA 3Q4TA 4QYGA 5CZHA 3P7AA 2YM4A 3ACKA 4C35A 4CTBA 2PTKA 1KOAA 1RDQE 2R3MA 3B8RA 5CZIA 1NXKA 4O6LA 3QQFA 4JQ7A 5IF1A 3QTQA 4CMOA 2WB8A 2XK7A 2YIXA 4PWNA 1GIHA 5HD7A 3FL5A 4QT1A 3LZBA 4AT4A 4Z55A 4DAWA 1IG1A 2B55A 3CSVA 4B4LA 1ZY5A 5L6PA 4EI4A 2UZEA 3OP5A 3AC4A 4EOLA 3GT8A 3PXRA 4AACA 1PKGA 2C6MA 3RHXA 3C4ZA 3O8TA 3WZKA 2BFYA 3FQEA 3JY0A 3ORNA 4OTPA 4XLIA 5E8WA 4M15A 3R8VA 2IZSA 5IUHA 4R3RA 5KBRA 2GNHA 1Q8YA 3W2CA 4RSSA 4RT7A 4M67A 4DG2E 4BWKA 4L53A 4JX3A 3GC9A 4UMRA 2F2UA 3P23A 3NNVA 1PMNA 4QTBA 3R63A 4P2KA 1LR4A 1G8AA 2ACXA 3UODA 3P1AA 4BC6A 4CFMA 4TWOA 3KB7A 4EC8A 1OM1A 2XCHA 3GU8A 5HX6A 2VTQA 3ID6C 4W4XA 4OAUC 5I9WA 2ETRA 3WBLA 3LXKA 4L3JA 5AR5A 4LRJA 4ASDA 5F4NA 2VGOA 1XR1A 1E1XA 3PVWA 4GJ3A 4KD1A 4YBJA 4YJTA 3NNXA 1NVRA 2WMRA 1W84A 5BVEA 3VBXA 3IW4A 3ULIA 4FA2A 4DT8A 4Y5HA 5EM8A 3QCQA 5BVKA 4APPA 4DFLA 5M57A 1JSVA 3BLHA 1JAMA 3A4PA 3QZFA 5L6WL 4HYSA 4X3FA 5D12A 3FLWA 3F69A 5A54A 2NNWB 2UZVA 4FE2A 3CS9A 2RG6A 4GT4A 2GHLA 4FIFA 4K1BA 3BGZA 2WO6A 3QD0A 4IANA 3FL4A 3TTJA 4CFXA 4F6WA 3D5UA 3QGWA 3VQUA 3TM0A 4NT4A 4BI2A 2W1FA 2QOBA 4IW0A 2P33A 3FY2A 3IPHA 3AG9A 5FDPA 4DBXA 4EHZA 1RJBA 2YIRA 5H8GA 3UBDA 4W4VA 4JLCA 1UNHA 4A9TA 4YSJA 3R1NA 4DGOA 4ZTRA 3L9NA 4P90A 1SNXA 4O91A 4XG3A 4WBBB 4DE4A 3SXFA 3C7QA 3FQSA 3KULA 3RALA 3CP9A 3NW7A 5C1QB 5HVKA 2C6KA 2PZYA 3BU6A 3GU7A 1OGUA 5H8EA 5A4CA 2C47A 5BUIA 5FBOA 4L01A 5HVYA 3V04A 4QPAA 4RIXA 3MIAA 3NAXA 2I0EA 4FICA 2GHMA 2C1BA 4E8AA 4H3QA 3U4WA 1Q62A 3GUBA 4L00A 2HXLA 1FGKA 1GIJA 2QO9A 5AIKA 2RFDA 4APCA 1OI9A 3LOKA 4AGDA 4EH6A 4EOMA 5BNJA 1G5SA 5EYKA 4IAFA 2C5VA 3GCSA 2Y9QA 4ZSAA 1NY3A 3TI1A 4RWKA 4XV2A 3O7LB 3UZTA 4ZZMA 3OXIA 4AS0A 4HCTA 4P5ZA 3QZIA 3FZOA 2BRMA 1PXIA 4WRSA 4FYOA 3RPVA 2OFUA 4OTFA 3ODYX 4BIBA 3UC4A 3V5LA 3IDCA 3LW0A 1YI6A 3LHJA 3H4JA 2CSNA 4V01A 4F7SA 5DT0A 3ZCLA 2YIWA 3VS6A 3O71A 5DT4A 3CQEA 4D9TA 3L8SA 1Y8YA 2VTNA 5FG8A 5LCJA 3ZONA 2EU9A 2WOUA 4GUBA 3CE3A 5EYCA 5CSPA 4XYFA 2XIRA 2V7OA 1MQBA 2XIZA 5FWKK 3EQBA 5FD2A 3NGAA 4BCQA 2ITQA 1GAGA 4GS6A 3DXNA 4BBFA 5J9ZA 2QLQA 3ORXA 3QQGA 4DEIA 4EH7A 3VUGA 4F1MA 5B2MA 5KX8A 4O7NA 2I0VA 3VS4A 2X4ZA 4MQ1A 3PVUA 4I94A 4GRBA 1IA8A 5HX8A 5JRSA 2EB2A 2JEDA 3UP7A 2GQSA 4NTSA 4BYIA 4TWNA 4A4LA 1J1BA 3EYHA 2UW7A 3PVGA 4HZRA 2OJ9A 5JFWA 2UVZA 3TDVA 3D7ZA 4LG4A 4E6CA 4U9AA 3HA6A 2RFNA 4GFOA 4XH6A 4ZIMA 3TIZA 1IAJA 3R21A 4PDPA 2O65A 4G3CA 5AV1A 4ZK5A 2KULA 3O8UA 3FLQA 5DI1A 5AUWA 4FOBA 3MY5A 4DLIA 4CT1A 3EWHA 3P78A 3TDWA 3MV5A 3AMAA 3OG7A 1Q5KA 3PJ2A 4FI1A 4G5JA 2E9UA 1Q8TA 2H96A 4M12A 3A7HA 4OT5A 1SM2A 4XOYA 5IA3A 1REKA 2B54A 2VWIA 3COIA 3PZHA 2R5TA 1SVHA 3DFCB 5GZ8A 4B8LA 4TPTA 5A14A 2C6EA 4RG0A 5CU3A 4EORA 2GQRA 4X0MA 2UZLA 1ZMWA 5IQHA 3QQHA 4IACA 4Z7HA 4YC3A 2O3PA 4D5HA 4XUFA 3VWAA 2PZPA 4EUUA 1JVPP 2XUUA 4FV7A 2YACA 2O63A 3LJ1A 3CBLA 4UZDA 5EFQA 5KMLA 3DJ6A 1R3CA 2UZWE 4XG2A 4ANBA 3H3CA 4FEUA 4GIIA 5HBEA 1IASA 2W5HA 1H28A 3C0GA 5AFVA 4ITHA 4FT3A 4FTUA 4QMMA 3FZSA 3V01A 3NS9A 4F7LA 4FOCA 2XIKA 5HG9A 3FKLA 2WMVA 3Q04A 4S33A 5IH5A 5J9LA 2XVDA 4G16A 4AF3A 3R7GA 5AUZA 4EH9A 3BYOA 5A4QA 1U4DA 4D2WA 4GSBA 1U5RA 4OBQA 4XS2A 4QYFA 3R6XA 5KZIA 2W4OA 3DBDA 4EBVA 3QRUA 5FQDC 2C1AA 5JQ5A 3FHIA 4CMTA 1WAKA 5LVPA 4RIOA 5EQYA 4LUDA 5M4IA 2C0TA 2PVJA 3KGAA 3MA3A 4GT5A 4O1PA 3QX2A 5HE2A 5C4KA 3U6JA 4RIYB 2OF2A 2YM3A 3GCPA 3RKBA 3RM7A 2QHMA 4FKUA 3UPZA 5M09A 4IE9A 1H8FA 3P08A 2UW8A 4LMNA 3SQQA 4USEA 4FSMA 1SZMA 3F6XA 1WBNA 2XBAA 4HCVA 1R39A 3QWKA 1MRUA 2CGWA 4O2ZA 4BCGA 4D1ZA 4ANNA 4D4VA 4E5BA 3IDPA 1OBDA 4JAJA 3OW3A 3W16A 5AP0A 5CI6A 1R0EA 1WVXA 3ZSHA 2WELA 2QC6A 4M13A 4KKGA 1J7IA 1FMKA 1IEPA 2F49A 1ATPE 2J6MA 3F5GA 3QWJA 5T3QA 3TV4A 4LM5A 3VF9A 3VIDA 1QPCA 3ZXZA 3AC8A 3JY9A 3MFUA 4BDCA 3SW7A 3FE3A 4HNFA 5I0BA 1U59A 1H08A 4FVQA 2ONLA 4JI9A 4XLVA 3UDBA 5AP1A 1W98A 4UZHA 5DGZA 5HNBA 4MEDA 2XM8A 3VULA 5HO8A 4IH8A 1XBBA 4UBAA 3NSZA 5HO6A 4G34A 1QPJA 3NUYA 3EH9A 3HLLA 3UVQA 3ZC6A 5AIRA 1U5QA 4HJOA 4IZAA 4MWIA 3DK6A 2CCIA 3CR0A 4DCEA 3IW7A 3UC3A 4ZEGA 3A7FA 4JBPA 3M11A 3L8VA 3PZEA 5HORA 3LM5A 3GU4A 4R78A 2QOQA 4ZY5A 5DA3A 3WF5A 1O6KA 4AZFA 4DH7A 4I6QA 2XK6A 2HELA 4ANLA 3IO7A 5CVHA 2A1AB 2G2HA 3R8MA 1Y8GA 5EK7A 2Y6MA 4AXAA 1JSUA 4D4SA 4K11A 4O0TA 5ETCA 2BAKA 2CNVA 1UKHA 1YWVA 4HNIA 4U43A 5K5NA 4BRXA 2OICA 5IA5A 3QU0A 2X9EA 3FSKA 4XEYA 3BWJA 3VHEA 3PY3A 2WTDA 3EQIA 3OZ6A 1JPAA 3ORMA 3QXOA 3DZOA 3COMA 4HYUA 4HYHA 4J8MA 3LLAA 3RNIA 3PE1A 4UEUA 3OCGA 2PL0A 3P79A 3D94A 3DDPA 3FV8A 2BDWA 4WSYA 2E9OA 4EHVA 3AD6A 4ALUA 4HVIA 5IDNA 4YMJA 4XG7A 2JKQA 5A4TA 1KE8A 1ZYLA 4BR3A 4RJ8A 3F5PA 3TZ8A 4J99A 4BDKA 4C0TA 1TQPA 1M7NA 4YTCA 5IG1A 2C3LA 3IONA 3L9LA 5I3RA 3EKNA 3R7UA 3PLSA 4QP4A 3ZO2A 2Y0AA 2XIXA 4QP2A 5CASA 5LARA 1M7QA 3I6UA 4AW5A 3ANQA 2PUIA 4XG6A 2IWIA 2GPHA 2YLFA 5HICA 5L3AA 4QMNA 2Y4IC 4GUEA 4YHJA 3RK7A 3PJ3A 3OTUA 4NFNA 4O7LA 1B6CB 3U6HA 4FVPA 4EH8A 4U79A 3FBVA 5B2KA 3TXOA 2LGCA 5IQGA 5BPYA 3S2PA 3F7ZA 3ZXTA 3O23A 4NEUA 4TXCA 4FT7A 1VZOA 4UWCA 3FI3A 1P14A 5GIPE 4J96A 3GFWA 3VUKA 3OWJA 3WE4A 5IKWA 5HTBA 3SVVA 4EHEA 1ZY4A 4FV2A 3U9CA 3FI4A 3ZBXA 4GVAA 5H3QA 3R2YA 4EUTA 5IMXA 5JFXA 4L9IA 2R3HA 3E64A 4O83A 1J1CA 4MAOA 3V5PA 3WIGA 5GZ9A 4E1ZA 1H24A 2X0GA 4F64A 2C6TA 2XRWA 4YUQA 4O6EA 4C38A 2W1CA 5CS6A 4OGRA 5CNOA 4EWHA 3O8PA 2RFSA 5HEZA 4C59A 1J3HA 3NW6A 4TRLA 2WEIA 4GMYA 1ZOHA 2SRCA 2WFYA 3P9JA 4M0YA 2Y4IB 5CVGA 3R8ZA 3SRVA 4LGDA 4PDOA 4ASEA 4CNHA 5LQFA 5LWNA 2C30A 3OCBA 1PYEA 3P7CA 3GC0A 5KUPA 2P0CA 3O96A 4I93A 4AE9A 2R3OA 4Q5EA 4E26A 5EI2A 3RAIA 5E1SA 4EZ5A 4KIPA 5IPJA 1UU7A 3CJGA 4LRMA 3Q32A 3DV3A 2JKOA 2XMYA 3LKMA 4YZBA 2VWYA 5HG8A 4YTIA 2G2IA 5B7VA 3PG1A 3EN7A 1ZLTA 2X2KA 1RW8A 5HBJA 4R1YA 4XX9A 4HVSA 4U42A 2CCHA 4BZOA 5JEBA 1BX6A 1Q61A 3U4UA 3C5UA 3DTCA 3ORLA 3QD4A 4FUYA 4WG4A 3VF8A 2BIKB 3DB6A 4O0XA 2W9FB 2RF9A 1E9HA 3H9RA 5DR2A 5HLNA 2PE1A 1OUKA 3BZ3A 4U80A 4EOKA 5M44A 4N70A 4DITA 4FKVA 2WQMA 4KABA 4A9UA 4QP8A 2BKZA 4E5WA 4FODA 4NH1A 2ZAZA 4GJ2A 4RX7A 1V0OA 2DWBA 4DGGA 4UWBA 4NW5A 5L8JA 2GHGA 4YPDA 3EIDA 3WYYA 4BTJA 1NW1A 3NZ0A 2C4GA 4IZ5A 3PXFA 4AFJA 4O7RA 4DH3A 4CQGA 3CQWA 4JBVA 4PV0A 4AT5A 4CCBA 4UY9A 5LJJA 2I0YA 4RC4A 2I40A 2J0KA 3QTRA 5EI8A 2QHNA 4NK9A 1H1PA 2H9VA 4DYMA 2C5YA 3ZRLA 4I24A 2VWUA 3LQ8A 5AM7A 4O27B 4MKCA 4USFA 3KL8A 4DH8A 2EXCX 2I0HA 2VTIA 4Y8DA 3CJFA 4BDGA 4EKKA 5IQBA 4YJOA 3MIYA 2WMAA 2G01A 3PWDA 4ANOA 5AWMA 4ASXA 4L43A 2OLCA 4L44A 4CQEA 2VO6A 2QKRA 3CY3A 4ZTQA 5F95A 3ZUTA 3ZLSA 4R77A 4RIWB 4U0IA 4E6QA 4ZAUA 5ICPA 2BZIB 2FSTX 4R5YA 5AADA 2HW6A 1OZ1A 3FDNA 3R28A 4YLLA 4B99A 4CVAA 3LFFA 2RIOA 1H0WA 2BRNA 4RJ3A 5AP3A 4I0RA 5G1XA 2GNLA 4QTAA 5AR4A 4U8ZA 3PE2A 3BGPA 3HVCA 1HOWA 3VBTA 4DFZE 4I4FA 3E93A 2HWOA 4ACCA 3HP5A 4KA3A 3DFAA 4FSRA 5L8KA 3EN4A 3K5UA 4EEVA 5EYMA 3W10A 4HYIA 3AC2A 5HI2A 3V6RA 3KXNA 3DAJA 1Y57A 3W18A 4IJPA 4IVBA 2WTKC 2BUJA 3SAYA 3SV0A 4NM5A 4C34A 4NIFA 4A9YA 2XKDA 4UV0A 3Q5ZA 4MH7A 5CWZA 3O2MA 3EN6A 4C4EA 5DIAA 4QYHA 4EZ3A 4Y83A 2V0DA 3EFWA 3G33A 3UTOA 4ACGA 5KMOA 4LGHA 1B39A 4E3CA 3UNZA 1K3AA 5EHYA 5L4QA 4L68A 4WKQA 4IMYA 4BI1A 4RVTA 2Z60A 3FJQE 4IX5A 4H39A 3LAUA 5CSXA 4BDEA 3O50A 2OI4X 3MFRA 4DINA 5CAVA 4D2TA 2C5XA 3A61A 3IQ7A 3R1YA 4OTWA 5DT3A 4FX3A 2UZBA 2WTVA 4Y5QA 4O21A 4KB8A 2WTKB 4F1OA 3ZU7A 1SNUA 5C8NA 4E4NA 3V3VA 4ITJA 4ZLOA 3C4WA 2ERZE 1PMVA 4WSQA 3VS1A 4FKOA 3PUPA 3DBCA 2RL5A 2XKFA 4FKLA 3HMOA 4FTLA 4K9YA 4UMPA 2OSCA 4HVGA 3UQFA 2BROA 3KF7A 1VJYA 2VN9A 2XNGA 3ENMA 3FZPA 4IBMA 4IVCA 4TW9A 4L3LA 4V0GA 3JXWA 4E6AA 3QXPA 4O0SA 3ZSIA 3LMHA 5FM2A 1OL6A 3P86A 3NYNA 4DBNA 5IEYA 5CALA 2QVSE 2R3GA 4X2FA 3ZDIA 4UMTA 2YCRA 1LEZA 3VS3A 3QRTA 3A7GA 3K3IA 3R1QA 1GZ8A 2F9GA 4BY9E 1OPKA 4GL9A 5M53A 2ERKA 2XZSA 3PTGA 3W2SA 4GG5A 5K4JA 1S9IA 2PVLA 4A07A 3TUCA 3ZDUA 2ZDTA 3W1FA 4IC7A 3DBQA 4NZWB 4FZAB 2ZM3A 5FXSA 1G8SA 1IA9A 2OIDA 3E92A 2OGVA 4NWMA 3KRXA 5HIBA 1WBPA 4ASZA 2NRUA 4FNWA 2XKCA 5LXMA 4FTJA 4ZMEA 3IW6A 2JDTA 2X2LA 4U45A 5HCZA 1YOMA 3MW1A 3ZEWA 3RPOA 3OTVA 3NCGA 4GT3A 4M69B 4KINA 3DLSA 3OD6X 4RVKA 5AP5A 4C58A 4EK4A 5JGBA 5KHWA 4II5A 2VV9A 4I0TA 2V5QA 4YHFA 2PVMA 3HX4A 4TYIA 4F0FA 5DH3A 2ITXA 4BGHA 2YISA 4RPVA 3ZO3A 3U55A 2XK9A 3WF9A 4M7IA 3BU3A 1CMKE 1QPEA 3NLBA 3S3IA 4LQMA 3A7JA 3ANRA 4NTTA 4QTEA 2GDOA 3PRFA 2EXMA 5D7VA 3KREA 3MFTA 3O17A 1ZYJA 5CLPA 3VBYA 4QNYA 4RX8A 2W5AA 3Q96A 4QTCA 4Z9LA 4DTBA 3BEAA 4JG6A 5EM6A 4F99A 4PTGA 4QQTA 1PXKA 2J0LA 3LCKA 4RFMA 2VWVA 2HZ4A 5AR8A 2FVDA 3FZTA 2B9IA 3F61A 5IQFA 2HCKA 2B53A 4W8DA 5A4LA 4EOQA 1KWPA 2ZV9A 1PXMA 3HV7A 3D5WA 4NW6A 3EYGA 5G6VA 4C3RA 1G3NA 4YTFA 1W7HA 4BCFA 1RQQA 3UIUA 4YURA 2RFEA 5BVDA 1E1VA 3FAAA 3F3UA 4YNEA 4AA4A 3PP0A 1ERKA 3QC9A 4XJ0A 2FA2A 4AN3A 4RX5A 3AMBA 3EL8A 2QNJA 4P7EA 4NUSA 1RE8A 4IQ6A 1PXPA 1ZWSA 5CU2A 4FSUA 5CX9A 3QHRA 1H1WA 4Y72A 4ZOGA 3QA8A 4GFMA 3GCVA 4NSTA 1MQ4A 4G6LA 4C02A 5AAEA 5JGDA 2Z2WA 1H1SA 1PXLA 2H8HA 4RA4A 4U81A 4WUNA 5DNRA 5LWMA 4J97A 3UG1A 2UZNA 3C1XA 3FEGA 5GJGA 3DB8A 4JG8A 1KSWA 5HBHA 4BCPA 3MBLA 4ONAA 4ZLYA 2CLQA 4BCHA 3ELJA 5M55A 2HIWA 3FYKX 1Q41A 3KVXA 5LMAA 4PNKA 3CLYA 4JQEA 1Z5MA 2CNUA 4E73A 1MRYA 5BVNA 1YW2A 5TR6A 3UNKA 5L2IA 4KS7A 4D4YA 1Y6AA 3G15A 3A60A 4F7JA 3FUPA 2XJ2A 3GFEA 2B52A 3D5VA
chains in the Genus database with same CATH superfamily
4ZZNA 3HDMA 4BIEA 4QDVA 2GFSA 4FEXA 4FKQA 1Q24A 3ORPA 5AR3A 1ZZ2A 4AZVA 4A4OA 4KS8A 1YDTE 5IH4A 3Q9YA 3UZPA 4D2RA 1H25A 3QKMA 5BX0A 1WBOA 2X4FA 1J91A 2XK3A 4Y95A 1YI3A 4P4CA 2WTIA 2PZ5A 4ZSGA 3W0NA 4DFBA 3DT1A 2B9FA 3FMHA 3G9NA 3HGKA 2JDOA 4IWDA 2YCSA 3R02A 2JKMA 4DEBA 2JAVA 2JDRA 4UX9A 1M17A 1P2AA 3ZFMA 4BB4A 2QD9A 4D5KA 4A9RA 1URWA 4JDKA 2W1ZA 4AW0A 3FZ1A 3NUAA 3HECA 2JBOA 4M0ZA 2CKPA 4D0XA 1MUOA 2W4JA 4ACMA 3ZTXA 4KAOA 4HPTE 5K3YA 4BCJA 4X6QC 3E8EA 4C3PA 4E93A 1O6LA 3HMMA 2Q0BA 3PSBA 5GJFA 1OIRA 4B6LA 4BYJA 5A6OA 3LFNA 4ZTNA 2H34A 3ZYAA 3BE2A 4YJSA 4B9DA 4EQCA 3FMKA 3AQVA 4PL3A 4I0SA 3DAKA 3ATSA 4DTAA 1ZYCA 4PMSA 5CU0A 1O6YA 2WTJA 5AUXA 4AP7A 4L67A 2YJSA 4HGTA 5CT0A 5HCXA 3R7YA 3U51A 2CKQA 2J90A 3DA6A 2PYWA 3KU2A 4MNEB 2OIQA 4GIHA 1WCCA 2C6LA 1M2PA 4KUJA 3R30A 4FTMA 4CXAA 2GQGA 5IA1A 3HAVA 3EN5A 1BL6A 4L3PA 4TYEA 5ETAA 5FTOA 2GNFA 4DEAA 4OAVB 3MB7A 2X8IA 1JKKA 3AT3A 3OVVA 2J0MB 3PXKA 3VAPA 5KKRC 1Q99A 3D0EA 1DI8A 4NU1A 3MPAA 5CT7A 5H2UA 2XNNA 3R8PA 4GK3A 5EDPA 3KXZA 4O0RA 4LYNA 3TEIA 4EJNA 4FIEA 2ETKA 3BHUA 3QF9A 4ERWA 3R7EA 1R0PA 1Y6BA 2VTLA 4BVUA 3QD3A 2UUEA 4FL1A 3KF4A 4YZ9A 3H10A 3ZUVA 4E5AX 2W1IA 5HIEA 4FZ6A 3R00A 5AP7A 2BTRA 3FXWA 3NR9A 2XYUA 3KQ7A 1MP8A 3OF0A 5AP2A 4AW2A 4DFXE 3F2RA 3HRBA 2I1MA 3PJ1A 5CAPA 1F5QA 3VNTA 3IK3A 1FBNA 4MXXA 3R9HA 4XBRA 3LFDA 3QTXA 4Y85A 4QEBA 1S9JA 3NNUA 5E8YA 5KKRB 2X8EA 3K5VA 4LL5A 4AAAA 2AC3A 2VX3A 3EL7A 1PXOA 3L8PA 2QI8A 1OL5A 2JLDA 2YWVA 2DS1A 2WIHA 4PNIA 3W0RA 4PP9A 3DXQA 1TVOA 1YXVA 5I4NA 3FQHA 5JZJA 4PDSA 3LIJA 4P5QA 3EQHA 1FMOE 4LFIA 4DEGA 2R64A 4FUXA 3GQLA 3MESA 3MFSA 3TZMA 3BPRA 3NUUA 1PHKA 3NW5A 4WBOA 4LV8A 3SA0A 1OKVA 4RGJA 3CGFA 2W9ZB 3EMGA 3I6WA 3LQ3A 3SW4A 5KZ0A 4C4GA 2C5NA 3KULB 3ZH8A 4X2GA 4TL0A 2IVTA 5E4HA 3QUEA 4C37A 2OFVA 4O0YA 4M84A 3VBWA 1Q8WA 2VTJA 3W33A 4EL9A 2CHLA 1NVQA 3GU6A 4BICA 2UZUE 4BCIA 4C2VA 4FT0A 1HCKA 4TTHB 3ZBFA 3OW4A 3VHKA 4GK4A 3EQGA 4WNOA 4UXLA 3OXTA 4EOSA 3FZRA 4TYHA 2YM6A 4XP3A 4KIKB 2XK8A 2YAKA 5BQ0A 2BZKB 4EQUA 4FTKA 3MY0A 1WVWA 1XQZA 4RWLA 3E8NA 1NVSA 4I4EA 1ZRZA 1SVEA 3PFQA 4HGSA 4LV7A 2GS7A 3BE9A 4LOQA 3FMJA 2CN5A 2OZOA 1OL2A 5CF4A 3HV3A 4IAKA 4QRCA 5ACKA 2J5EA 5HU9A 3JPVA 3NVKI 4YTHA 3B2WA 4ERKA 1UWJA 1XH5A 2A4LA 2PVYA 4Q2AA 3JVRA 5E8XA 3KXXA 3QUDA 3OC1A 4F08A 2X7FA 2ZV2A 1VYWA 3IGOA 4OTIA 4F9BA 4UMUA 4BCNA 4AGWA 3UOJA 3R2BA 3FLSA 3HP2A 1NA7A 4N57A 1CDKA 4ORKA 3W2RA 2YM7A 4RWIA 5CEKA 4ITIA 5C03A 3BV2A 1PYXA 4TWCA 4R3CA 2CN8A 3DAEA 2W96B 3ZRKA 4OUCA 4FTAA 5E8VA 3I79A 4YPSA 2A19B 3LMGA 3THBA 4AA0A 4F65A 2XAOA 5C4LA 3JS2A 2P55A 5BUEA 5J1WA 1YI4A 2YM8A 1WBSA 1CKPA 3R9DA 5DBXA 5BMMA 3LCOA 2J7TA 3UNJA 4BKZA 3UDTA 3ML1A 4M68A 5E91A 2OXDA 3MH0A 3NUPA 1VYZA 5FM3A 2OXXA 5CF8A 3TIYA 2XA4A 2F4JA 4ALVA 4G2FA 4MD7E 1UVRA 3OROA 4GEOA 3UIMA 4H3PA 2C69A 3UIXA 3H0YA 4EOJA 1LEWA 3RWPA 3RJCA 2JFLA 3MPTA 4J7BA 3SGCA 4MXYA 2WQOA 4FBXA 4OBOA 2B7AA 2CGUA 4FSQA 5TOZA 4C2WA 3QZGA 1OIUA 2QOCA 2WNTA 4HVHA 3T8OA 5J7HA 1T45A 5EHLA 2J51A 3Q3BA 3LE6A 2AUHA 3HUBA 2J0JA 2XIYA 5AUVA 3AC5A 3NCZA 1GJOA 2EXEA 4IJ9A 4WO5A 2VD5A 4FG8A 4WT6A 5AR2A 2YN8A 3OWKA 4PP7A 5AP4A 4QMTA 3SXRA 2CLXA 3KA0A 3DKCA 4JBOA 5J79A 4MXZA 3L9PA 1QL6A 1VEBA 1KOBA 3VQHA 5EKOA 3OUNB 2XBJA 3EOCA 2EVAA 1BLXA 4IDVA 3QCYA 3LXLA 1LPUA 1JLUE 2R7IA 1H4LA 4H3BA 4OW8A 3OS3A 5C8MA 1QPDA 2VTMA 4IB5A 4WIHA 4HVDA 3Q4UA 2C6IA 2VU3A 4IFGA 4F9YA 4OTQA 4FKSA 3C50A 1XWSA 3BCEA 3FXXA 4OT6A 3EQRA 3ALOA 4BBMA 3W0SA 5GINE 2ZV8A 2QCSA 2QU5A 5CENA 4BZNA 4OLIA 4O7VA 3TNPC 4S31A 4O38A 2FGIA 3Q9ZA 1KUTA 3F9NA 1ZMVA 2PK9A 4PPBA 3NUNA 4DN5A 3K3JA 3BELA 4CEGA 4DH1A 5ETIA 1CKIA 1Q97A 3OMVA 3AKJA 3V8TA 3BYVA 4I41A 3OY1A 5HTIA 2XNEA 1OPLA 3BHTA 3HEGA 4GW8A 2YABA 2YITA 3QLGA 2ONLC 3PA4A 3NWWA 4G3FA 5D41A 4BHZA 3I81A 3WZJA 5JN2A 4J52A 4I22A 2JFMA 4CRLA 4D1XA 1WBWA 2X7GA 2BCJA 3HV6A 2W5BA 5FBNC 3P5JC 3I0OA 1JWHA 4XP2A 4XHKB 1WZYA 4QNAA 3G6HA 4U41A 4FV9A 3F3VA 3Q53A 3BX5A 5EG3A 5H8BA 1YDRE 4F0IA 4GKHA 4JS8A 5CQUA 3ZO4A 3N4VA 3UP2A 2ITNA 2BRHA 3TV6A 1U54A 4KKHA 3TWJA 3OFMA 3BYMA 3KN5A 3QD2B 4L8MA 1APME 2QLUA 2BAQA 4D9UA 3LFAA 3MVMA 3R7IA 2BPMA 3IW5A 1WMKA 3POOA 5EHOA 2OH0E 2VWBA 5KO1A 3VUTA 4LRKA 5KMNA 5CU6A 4YO6A 4EK6A 3ZFYA 5I3OA 5KMJA 4WG5A 4FNYA 4AGCA 1OL1A 2V62A 3D15A 3D7TA 3F3TA 2IW9A 5I9XA 1ZOEA 4XG9A 2W05A 3CPBA 3RTPA 3VUIA 1ST0A 3QUPA 5KCVA 3C4FA 4HZSA 4NKAA 3ORIA 4FSTA 3O51A 4EBWA 4JRVA 4HGEA 5J8IA 2HK5A 3GCQA 4BDDA 3N4UA 3CPCA 4IAAA 5J95A 5FDXA 4FSYA 2YZAA 5IQEA 4ZSEA 1H26A 4NJDA 3BRBA 4I5CA 4DFUA 3ORTA 3CD3A 4IZ7A 5F20A 3TUBA 2BDFA 5CEQA 4YJVA 4IWQA 3F88A 4ZJVA 3F7WA 2UW4A 3I0QA 2OZAA 5ACBC 5EOBA 3R7OA 3PY1A 2ZFYA 4R5SA 4DF3A 3DDQA 3FI2A 2B9HA 4Y73A 2XKEA 3PIYA 3QYWA 4UYNA 4IEBA 4IWPA 5FEQA 4AQKA 3SG9A 3ZEPA 2A0CX 3UOLA 3BYUA 3PSCA 3EFLA 4YC6A 3T9IA 5BMSA 3F5XA 2HY0A 1WVYA 4DEDA 3OOMA 3RINA 4EWQA 5FXRA 4O7YA 3RK5A 4WA9A 4TKSA 1FVTA 5FP5A 3BLQA 3U54A 2CKOA 2WMWA 2IZUA 3FLYA 1ST4A 2R4BA 4H1MA 4YLKA 4E4XA 1VR2A 4O1OA 4LUEA 1PKDA 3P0MA 5AX9A 5B0XA 4NCTC 3CXWA 2A2AA 3OUKA 5E8ZA 3KCKA 3QTSA 1REJA 1U46A 4FKRA 4USDA 5HTCA 5K4IA 4XV3A 5M4CA 5T68A 4UB7A 4QTDA 2ZV7A 5CQWA 4U6RA 3RPYA 2H6DA 1I44A 3C4XA 5K9IA 4MHAA 3UMXA 5M07A 3QFVA 2CJMA 2GCDA 5BVOA 2W1GA 5EYDA 3RI1A 3PDTA 1Q8ZA 2JDSA 4RJ7A 2PSQA 5ANIA 3C13A 4BGGA 3D2IA 1B38A 4FKWA 4K18A 4PMPA 5HQ0A 3DQXA 4RIWA 3LCSA 4XV9A 3UPXA 5CEMA 3PVBA 5BYZA 2DUVA 3Q60A 3W2PA 3WZEA 4EOIA 4FV8A 4M3QA 1XKKA 2UW0A 4GU6A 4IFCA 4YC8A 1O9UA 1T46A 2BMCA 5CEPA 3TT0A 4S34A 4W9XA 5C01A 2DYLA 2FYSA 2G1TA 3U9NA 3VS5A 3UJGA 1GZKA 2PZRA 2W7XA 4U44A 4GKIA 1OITA 2YAAA 3A4OX 2YFXA 5TO8A 4Z16A 1XO2B 4GYGA 5D1JA 2W4KA 3MY1A 2VX1A 2OH4A 2PULA 4DDIA 3HMIA 3VJNA 3A7IA 5CXZA 4ZSJA 4XBUA 5BVFA 3ZRMA 4X3JA 3VW8A 4F6SA 2OJGA 3FMDA 1V0BA 3DQWA 3LLTA 3OEFX 4B0GA 4J98A 3DPKA 2BRGA 4JVGA 3DBFA 4BWPA 3GNIB 4E20A 4O7SA 3MB6A 4S30A 2O0UA 2R3LA 2ZDUA 3DZQA 3NYXA 4EZ7A 3PRIA 4R3PA 5ANGA 3FMNA 4Y46A 3AGMA 2PVHA 1KE9A 3AD4A 3FMEA 4IVAA 5C9CA 3AD5A 2BAJA 3Q2MA 4FZ7A 4R6VA 1MRVA 4BDFA 3SRVB 3VJOA 3MH3A 4FEWA 4D58A 1K9AA 1YHSA 3IS5A 4LOOA 5AA9A 4X2JA 3AKKA 2JC6A 2BDJA 4YBKA 3W0QA 3F82A 3IGGA 3QYZA 4KSQA 3CTHA 2J0IA 2BFXA 4C61A 2VTSA 2JITA 3DXPA 5AAFA 3SHEA 4FV1A 3FMMA 3Q4ZA 4TYJA 3HV5A 2OIBA 4BWXA 2VUWA 2VTHA 4IAYA 5A4EA 4AZEA 4JJRA 3EHAA 5AX3A 4F1TA 2XM9A 4QMOA 3VS0A 1YXTA 2NPQA 3HYHA 2IW8A 3F2AA 3ZS5A 2Z7SA 2IG7A 4AE6A 2BRBA 4IXPA 2AYPA 4QD6A 3T3VA 2J2IB 3F2NA 5BVWA 3WZDA 4AOIA 4OTGA 4EH3A 4QYEA 2JAMA 3UGCA 3VVHA 5J1VA 4O81A 2E9PA 3BWFA 1ZXEA 4YSMA 4EK5A 4DA5A 5HCYA 1W83A 4XCUA 4ALWA 4BTFA 3QCXA 5E90A 3I7CA 5LMKA 4XRLA 1EH4A 3BIZA 2GTMA 2WD1A 4MBLA 4F9AA 2IVSA 4KWPA 4RC2A 2PMLX 5HNIX 3D14A 3QRJA 1BUHA 5E8UA 3QRKA 4AXDA 4G5PA 3I60A 2QO7A 4UN0C 5C26A 5HKMA 4AXFA 4I92A 5JKGA 3KCFA 3K2LA 1ZZLA 3LXNA 2BKKA 3JUHA 5EW9A 4ARKA 4C4IA 5HD4A 4F78A 4DTKA 3NIZA 1OPJA 2HZIA 2PVRA 3KY2A 3KXMA 4L52A 4MNFA 5DE2A 3DKGA 1ND4A 1PF8A 3IW8A 3ROYA 2WKMA 3KVWA 5CF5A 1UWHA 2QONA 4BKYA 4CKJA 3ZSGA 5J5TA 2PE2A 2C0OA 3QQUA 5AV2A 3UG2A 2GNIA 5HIDA 4YZDA 3NUSA 3OWPA 5K0KA 1GIIA 3F66A 2QOLA 3DJ5A 3KXGA 4M69A 5EM5A 4B7TA 5J5SA 3UZRA 3TKUA 2FUMA 2VTAA 3MVLA 4EK3A 3HRCA 1W0XC 4FGBA 4FMQA 4QMLA 2PU8A 4Z3VA 2UV2A 3PP1A 3PPJA 5IQDA 2J50A 2NP8A 3NX8A 2OXYA 5IA0A 2PVKA 3ULZA 2OO8X 5AV4A 2IPXA 3DCVA 3E3PA 4FSNA 4YJPA 1TFFA 2NO3A 1ZARA 2FH9A 4EHGA 3PXQA 2VTRA 3TCPA 1H00A 3PPZA 3R04A 3MPMA 2BTSA 4NIFB 2VNYA 4GH2A 3DGKA 4MQ2A 4QQJA 5DRDA 4JMQA 3C4EA 4QO9A 4GV1A 2F57A 3OWLA 3W2QA 1V1KA 4CV8A 1JNKA 4GK2A 1UU8A 2QU6A 3PFYA 3COKA 5ANOA 3VUHA 4R8QA 2HZNA 2UW6A 4FV6A 4O7WA 3IOPA 4FEQA 5FXQA 2X0QA 3WF8A 1F0QA 3GXLA 1BL7A 3N51A 4AA5A 2ITUA 2E9NA 2WGJA 4DDGA 3ENHA 3MH2A 4QQCA 4NKSA 4BI0A 4N0SA 4JBQA 4RA5A 4RX9A 4J8NA 3LQ5A 2PVNA 4WHZA 2WXVA 5M08A 5IEVA 4QPMA 2NYAA 2X39A 3VUMA 4G9RA 5DMZA 2C3JA 4H58A 3FY0A 3FKNA 5DN3A 4CV9A 4QP1A 3O5AA 3CKXA 2WQBA 5DR9A 5EOLA 5IQIA 3MTFA 2XK4A 5LOHA 3FKOA 4KRCA 3NPCA 3TYKA 3FPMA 3PJCA 4MBJA 4ZSLA 5GIOE 4AG8A 3LCDA 3D5XA 3QRIA 4I21A 4OR5A 4DGLC 2ZOQA 2PE0A 3HA8A 4C4JA 2BHEA 3FMLA 4DGNA 4F9WA 1UV5A 3OEZA 5CSHA 5JQ8A 4R7HA 5CF6A 4ZZOA 2QR7A 1JKSA 3ODZX 3UO4A 4YZCA 3C4CA 4IB1A 3PJ8A 3SKCA 4OTHA 4CZTA 2O8YA 5LCKA 3G0FA 2GNJA 2BALA 4C7TA 2JIIA 2XNMA 4TT7A 4AXCA 5IQAA 5K5XA 3W8QA 3FYJX 3ZM9A 3GEQA 2ITZA 4IC8A 1R1WA 2ZB0A 3GOPA 3MI9A 3GVUA 2W1HA 4FV5A 1J7UA 2P2HA 4LGGA 5H9BA 1TQMA 5GZAA 3TTIA 4XV1A 4JG7A 3S1HA 2C6OA 2BILB 2C3IB 3G0EA 4QMVA 4TWPA 4G17A 5AMNA 4BDAA 3REPA 3R22A 3JVSA 4C3FA 3GCUA 1AGWA 4C4HA 3AT2A 4IM3A 4JOAA 4E7WA 2VO7A 3E7OA 4EONA 4PL5A 4NM7A 4MTAA 5E9EA 1OKWA 3KMWA 2J4ZA 3G2FA 5TE0A 5FTGA 4PUZA 3R9OA 5HGIA 1Q3DA 2XNOA 5A3XA 5ANEA 2GS2A 4FG9A 3DS6A 2WQNA 4FIIA 4MBIA 4E4LA 2ZM1A 3EN9A 5L2QA 4O22A 4ZS0A 1KV1A 1CTPE 2W99B 4BCKA 4CLJA 4MVFA 4AGUA 2O64A 2PMNX 2GU8A 4EQMA 4DH5A 4PMMA 3Q52A 3LFQA 4IX6A 4FKJA 5I9UA 4WNKA 3ROCA 4FT9A 3FSFA 4DEEA 3LFEA 3V5TA 3ZOSA 2WMBA 4R1VA 3DLZA 5ANKA 3KIOC 3PY0A 1JBPE 2VTTA 3BQCA 2CNQA 4Q9ZA 2QKWB 3DBEA 4EJ7A 3TNHA 2BHHA 4MNEA 2ZYBA 4I6FA 4QPSA 1KE5A 1M14A 4GYIA 2PUPA 4JQ8A 5LVLA 5D11A 4K2RA 2ESMA 1QCFA 2XH5A 4PTEA 2HZ0A 4FKIA 4MX9A 5HHWA 2R3IA 1SMHA 5DWRA 2QURA 1XHAA 4XOZA 4RVLA 5CAQA 4AUAA 4FK6A 4IX3A 5EI6A 4EH4A 4JDIA 4HOKA 3Q6UA 4ZXTA 2X0OA 3EB0A 3T9TA 4W4WA 5IDPA 3MDYA 4FR4A 3I1AA 2YCQA 3BGQA 3UOKA 3WARA 3DJ7A 1OECA 4N6ZA 3BLRA 4K6ZA 4PF4A 2LAVA 4QOXA 4CFVA 3TKIA 1XJDA 4MF0A 4PY1A 4BL1A 2PZIA 3OHTA 4ID7A 4JX7A 2G9XA 3CEKA 3MGYA 4K77A 1JSTA 4K33A 1DM2A 3UYSA 3BYSA 3M42A 3ZLWA 2PUUA 3ET7A 4YJUA 2PPQA 3N4TA 5HG5A 2HWPA 4FGRA 4RLLA 2UZTA 2VO3A 3ZMMA 2FSLX 4CD0A 2R3QA 4R7BA 1BI7A 2IVUA 3AGLA 4QMUA 4UWYA 3AMYA 2XEZA 4RZVA 5ETFA 3TNWA 4RC3A 4FTIA 3RBWA 3CC6A 2OU7A 2W1DA 2YEXA 4IAZA 1ZOGA 1TKIA 3ZM4A 2WIPA 3V51A 5BV3A 4BBEA 3EKKA 3VBVA 3C0IA 1UNLA 4JIAA 2E9VA 3L8XA 2RG5A 1Q3WA 3ZC5A 4UALA 2OWBA 4Q5HA 3SC1A 5EW8A 1KE6A 3CKWA 3I5ZA 3QGYA 3WOWA 4IM0A 5JZNA 2YM5A 2XJ1A 2J9MA 3MVHA 2BVAA 5IH6A 4ZMFA 4IX4A 3R8UA 3BEGA 2ZM4A 4XRJA 2QO2A 1BKXA 5K0XA 4X3FC 2QG7A 1DAWA 4YR8A 3SDJA 2ETMA 2OJFE 3Q5IA 3TKHA 5T6KA 2R0IA 4I3ZA 3R9RA 5L8LA 2YJRA 2C68A 3M1SA 3QQKA 4ZTSA 3G5DA 3PUFC 1BI8A 4JT3A 4X6RA 3SXSA 4K0YA 4RBLA 3MH1A 4CKIA 2WQEA 1YXUA 1PXJA 2WU7A 4O7ZA 4XG8A 1OKZA 2AQXA 5KE0A 3TN8A 2PUNA 4ZY4A 3CGOA 3CCNA 3EQDA 4S2ZA 5FLFA 3RVGA 2B4SB 4D28A 2WPAA 4KIKA 4QMSA 4F0GA 5HZNA 4RMZA 4C33A 3QKLA 3RP9A 2ZJWA 3V5WA 3QX4A 3M2WA 4IAIA 4YZMA 2A27A 2HW7A 4X3FB 1OVEA 2VRXA 1PXNA 2YDJA 2OJJA 3FC2A 3UO5A 4BF2A 4M8TA 1JKLA 1XH9A 3I5NA 4F63A 3HZTA 2IZTA 2WZJA 3HMPA 4G1WA 4EK8A 4JXFA 4O0UA 4U7ZA 4TZRA 5JMSA 3SLSA 3SG8A 3EZRA 5JSMA 4IVDA 3Q2JA 4EOOA 4BGQA 4OTDA 4O84A 4IB0A 4EYJA 3HKOA 1BYGA 2ITYA 4MD9E 4ACHA 2YHVA 2ITTA 3PXYA 2R3KA 2OF4A 5JGAA 1PW2A 5EW3A 1UKIA 1OKYA 4HCUA 2WMUA 4CFUA 2Y7JA 4XMOA 1XH7A 3ZFXA 4FL2A 4J95A 3QHWA 5JFSA 2ZMCA 5DRBA 3SOCA 2RSVA 5IUIA 4BDJA 4G3EA 2GFCA 4MXAA 3RCDA 4NM0A 4FT5A 4RIXB 4G3DA 4TN6A 4IM2A 3VO3A 4C4FA 1UU9A 3DNEA 3ORKA 3OXZA 3PXZA 5GHVA 3WE8A 4I6BA 4F4PA 3PSDA 2XRUA 2OJIA 4G3GA 4IWOA 4AU8A 3H9FA 2OG8A 5IISA 4G6OA 5FP6A 4ENXA 4RIYA 5EM7A 2WHBA 4BHNA 5E92A 4DFNA 2PMIA 3QKKA 2VNWA 3E87A 1WBVA 5KMMA 3UVRA 3W0PA 3GOKA 3S95A 3UIBA 1DS5A 5CU4A 3RAHA 1PRYA 4G9CA 1Z9XA 2C3KA 4LMUA 3DK7A 4BDIA 4J71A 1V0PA 4YJQA 4RVMA 3UO6A 4L46A 3POZA 5AV0A 3ITZA 3U87A 1SVGA 2BZJA 1OUYA 3WF7A 2YLEA 3MWUA 4BDBA 5AEPA 3MA6A 4D2PA 2BZHB 4I1ZA 4R7IA 3CTQA 1G8KA 1AD5A 1IR3A 1KV2A 2HAKA 1G8JA 4C62A 2CMWA 5L6OA 1FINA 4U5JA 4JDJA 3UQGA 1Z57A 3UQCA 4X2KA 1PMEA 2CDZA 2YIQA 3CD8A 2WTCA 4NFMA 1YWNA 4L45A 3D83A 2R0UA 2X1NA 1HCLA 4YNOA 5FEDA 5A9UA 3WZUA 1CM8A 1WBTA 3DY7A 5TF9A 4ZTLA 4B8MA 4C36A 3TMOA 1KE7A 5IQCA 5J87A 4CYIA 4IIRA 2WMTA 3I4BA 3LFCA 4MK0A 4O2PA 4YGAA 4ACDA 2JIUA 5CVFA 2JD5A 3FC1X 3DKFA 4A9SA 5KNJA 5CNNA 1BMKA 3GGFA 5DEWA 4BTKA 4BZDA 2IZRA 3FLZA 4X7QA 3KXHA 1M2QA 1PY5A 1Q8UA 4FYNA 2P4IA 5EQEA 3MVJA 5AM6A 2R7BA 3E3BX 2Q83A 3QBNA 2YZLA 3BHYA 4RJ4A 3VW6A 4FV0A 5FGKA 5HESA 4EH2A 1TZDA 1DI9A 4TYHB 5I9YA 4O7TA 4RJ5A 5CEOA 2QOKA 2C6DA 2ITVA 3QQLA 4FEVA 2VO0A 1H07A 2FO0A 3D2KA 4OTRA 2XNBA 5J9YA 5AA8A 4W4YA 4U3ZA 3G9LX 5KBQA 4FSWA 3V8WA 2VWZA 4YLJA 2Y4PA 3E8DA 2YDIA 2GMXA 3CTJA 3EZVA 3TNQB 3GP0A 4WUAA 4JL9A 1A9UA 4FKGA 3II5A 2IJMA 2KTYA 3EQCA 2YIYA 5CSVA 3B8QA 3V6SA 5M51A 3E62A 1JQHA 4MXOA 4WNPA 3QALE 4QP6A 3RGFA 3UYTA 1GZNA 5L2WA 3W8LA 3EFJA 3R0TA 3MYGA 5BYYA 5CAUA 4PX6A 4CLIA 4A4XA 4A06A 1M2RA 4FTNA 3OBJA 2R9SA 4RFZA 1OIQA 4CYJA 4QYYA 3UDSA 3RAWA 1YDSE 4X2NA 3LMIA 4KIOA 3KMUA 4FNXA 2P2IA 1JOWB 3GC7A 4D2SA 4V04A 4AZSA 5LMBA 1UNGA 3HV4A 3S00A 2AC5A 2Z7QA 4QMQA 4ZLZA 4JDHA 4RJ6A 2X8DA 3ACJA 4CSVA 1YOLA 1IRKA 5AAGA 3K54A 3TG1A 3KK8A 1P4FA 3R71A 5CTPA 3ZZWA 3U6IA 5BUJA 3VC4A 3COHA 3H0ZA 3PIZA 4A7CA 1CKJA 2F7EE 4DG0E 5AUYA 2PHKA 4YU2A 1A48A 3UDZA 4JIKA 2ITPA 3DKOA 3L9MA 1LP4A 1P5EA 4OBPA 5CSWA 4AX8A 4D55A 4CGAA 3Q9XA 2ZVAA 4FIJA 4AZWA 4Z7GA 4KNBA 3EFKA 4LV5A 4MD8E 4ZP5A 4EOPA 2CKEA 5IZFA 1A06A 5M4FA 3A62A 5D9HA 3MTLA 5AV3A 1UA2A 1YHWA 5GNKA 1VLRA 2WMXA 4LI5A 1STCE 2CGXA 3AC3A 5JK3A 3AXWA 2ITOA 4ZTHA 4F6UA 3LM0A 4KSPA 5DVRA 3V5QA 4AFEA 4O0WA 3PLAE 4AQCA 2DQ7X 2F7XE 2F2CB 1YRPA 2XARA 3LVPA 2FSMX 4FC0A 4RQKA 2J5FA 5CY3A 3DOGA 1YOJA 2VGPA 3CY2A 3FLNC 4S32A 4RQVA 3R7VA 1GZOA 1YXXA 4LOPA 4F09A 4C8BA 2Z7RA 4BKJA 4AW1A 1OBGA 5E8TA 4FTQA 2HY81 4WOVA 4CMUA 4FIGA 3TUDA 5DEYA 3PPKA 3QTWA 3LJ2A 5I9VA 3LPBA 3ZLXA 5M06A 2X6EA 4I5PA 3R8LA 2E2BA 2QOFA 2C5OA 4J53A 2NRYA 2PMOX 3BBWA 3VRYA 2RGPA 2V22A 3O0GA 5CI7A 2VX0A 3KRRA 4Q9SA 3BHVA 5EKNA 2JGZA 1YHVA 4FVRA 4NCTA 5DLSA 4AAYA 4WD5A 3V8SA 4YHTA 4KRDA 4GU9A 4L7SA 3RZFA 1YKRA 3DK3A 4ANSA 2HENA 1FVRA 5EDRA 2PVFA 3RPSA 4W8EA 3DTWA 2WEVA 3ZHPC 2XANA 1XH6A 2R3FA 3S4QA 4IZYA 1JKTA 1GOLA 2C0IA 5HOAA 3JR1A 4GVJA 3ORZA