3NX8A

Human camp dependent protein kinase in complex with phenol
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDINHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental and computational active site mapping as a starting point to fragment-based lead discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 106
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nx8A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nx8A02
4XG8A 4XX9A 2GPHA 3PXFA 2CKQA 4EK5A 5LCJA 3VHKA 4I1ZA 1Z5MA 5AV4A 2XK9A 3A61A 3R9NA 3QALE 2IO6A 2ITTA 3LVPA 5BPYA 1PJKA 3QQJA 4H3PA 4JDKA 4C4HA 2YN8A 4ZJVA 3S0OA 2WNTA 3R00A 2A2AA 3FAAA 3QUDA 4FV5A 2E9OA 2OH4A 4XCUA 2PE2A 3PJ8A 4FNZA 3ANRA 2FSOX 4UXLA 4AT4A 2C5YA 3VULA 3RPSA 2RFEA 3PVUA 2BMCA 3D15A 4IW0A 4QTEA 4PPAA 4B8MA 4G2FA 4TZRA 3LFAA 4C8BA 3HX4A 3RNIA 3AMAA 3GCVA 1Q8TA 4BFMA 5I9XA 4I6FA 1WAKA 4N70A 5ETIA 4O7SA 3AC4A 3H9RA 3QTQA 4KA3A 2VTRA 1Y8YA 5FRIA 4G9CA 4XV2A 5EG3A 3OWJA 1GJOA 5CEPA 2PWLA 4IZ7A 4V05A 3B2WA 4QQ5A 4O7TA 3RNYA 4ERKA 4IZAA 3FMHA 5IDNA 3CCNA 1SNXA 5H2UA 4FSRA 4DEIA 3E5AA 4FUYA 4MXAA 2YCFA 4B99A 1ZLTA 5LJJA 2QG7A 4V04A 4H36A 4ZTSA 3AD6A 3ULZA 4FKJA 4NSTA 2W5AA 3EHAA 3OS3A 4M14A 5C03A 2HIWA 2PVFA 2RKUA 4DE4A 3GC9A 4X6QC 5J8IA 4ZTQA 3QZFA 1G8SA 3TKIA 4F6UA 4RWLA 3GC0A 4Z16A 3JS2A 5EM6A 2R3JA 4WUAA 4K77A 4PPCA 1A48A 3Q2JA 2WMRA 4ZTMA 3FC1X 4KS7A 5D7AA 3VF9A 1XBAA 4K18A 4V01A 4ZEGA 3A99A 4ONAA 4FT7A 3DA6A 2J0LA 3COKA 3L8PA 4GFMA 2XM8A 5FXSA 4TW9A 1I44A 4M0ZA 5DRBA 3CE3A 3LM5A 4RWKA 3RJCA 2QOLA 5IQFA 3QLGA 4FNWA 4IB1A 3SVVA 2PVKA 1YHWA 4NTSA 1OIUA 4USDA 3V5LA 5IA2A 1UWJA 4EH5A 5I9ZA 4WG3A 1IAHA 2F7XE 1E1XA 1JWHA 2VTLA 4HNFA 3F2NA 4QP3A 5EW9A 3LQ3A 4O7LA 4CG8A 2XKCA 3KL8A 1URCA 5CVHA 5JZNA 4X3FB 1YRPA 3IW6A 3G90X 2CN5A 3NCZA 2BRMA 5JQ5A 1J7LA 2O65A 5HD7A 4FV1A 4PPBA 3FY2A 4C4JA 3ZSIA 1MUOA 2DQ7X 4H39A 4L3JA 2QR7A 4L44A 2UZUE 4E4XA 2C6LA 4AS0A 3PXRA 5CU2A 5EKOA 3QRTA 4J52A 2EXMA 3OWKA 2CLQA 3MFUA 3ZOSA 2QHMA 4GVAA 3TV7A 4A9UA 4I22A 4O82A 1Q61A 2QOHA 3FZ1A 4AG8A 3W8QA 4RX5A 3CIKA 5EDRA 3WYXA 2VTIA 2BAQA 4I93A 1OM1A 3GC8A 4EC8A 3EZRA 4FK6A 2IZTA 4GIIA 3SQQA 4KIPA 4RFZA 4CCUA 4BCOA 5FEQA 3QX2A 2VZ6A 3BWJA 5DE2A 3TN8A 1NVSA 4FE2A 4X2JA 2A0CX 3PJ1A 4DLJA 3OMVA 4FKQA 5DEWA 3FXZA 1HCKA 2A19B 3BV2A 3DY7A 3NIZA 4RJ8A 5E91A 2QO7A 3KREA 3NGAA 5EQEA 3OY1A 3ZUUA 3P7AA 5FEEA 2XCHA 3QD0A 3UODA 3WF6A 2BPMA 3OVVA 2CKOA 3LJ2A 3NYOA 5CI6A 2PE0A 1W82A 4NEUA 4ACDA 4U6RA 1H1QA 4WNOA 3Q9WA 4DGGA 4Z3VA 4FL2A 3ID6C 2QU6A 5FDPA 3OWLA 1H07A 4FTCA 1M2QA 5LCKA 3RI1A 2B7AA 3R8ZA 2VWIA 4ID7A 3RK5A 4UY9A 2PVNA 1LR4A 3VUKA 4O7WA 2Y8OA 5JSMA 4D4RA 5ETFA 5HEZA 5KMKA 5BYZA 1IG1A 4ANOA 2W1CA 3QKLA 2XKDA 1M7NA 5E8WA 5KMLA 4RSSA 4OTGA 1ZYCA 3FDNA 4C61A 3T3UA 4OR5A 4UMPA 2FSMX 4PNIA 1DAWA 2PZPA 4IANA 4O0YA 3EKNA 3R7OA 3NZ0A 3RKBA 4EK3A 4MCVA 4I5CA 2UW6A 3LFCA 4PY1A 3QHRA 1XH8A 4QPMA 2V62A 1KV1A 5AR8A 2QLUA 3BYMA 4NW6A 4DCEA 3R1SA 5LWMA 4PNKA 3WILA 4XG7A 5BUIA 3KA0A 4GCJA 1VYZA 4GUBA 5HE2A 4CFNA 5L6PA 1U54B 4NJDA 2QONA 4FTOA 3QYWA 5C8KA 2VRXA 2X6DA 4FSWA 3TEIA 3EB0A 3VIDA 2WMSA 3FL5A 5K4JA 5HIBA 5BVDA 2GFSA 2OG8A 2C47A 4RQKA 4F7JA 5C01A 5DG5A 5DI1A 1ZARA 2J0JA 4EBWA 4O22A 3LJ0A 4FIFA 5ETAA 4FKWA 3SV0A 3QQGA 1YXTA 1TQIA 3R73A 4L8MA 4U7ZA 3EZVA 1O6LA 5J95A 5C9CA 2IW6A 1WVWA 4LOQA 2BHEA 4YTFA 3QD2B 5IF1A 2WTKB 4MBJA 4RX8A 4WKQA 4FK3A 4EOQA 5IPJA 3EQGA 3W2SA 1J91A 4FC0A 1JKKA 2PE1A 5JFWA 4FICA 2WTWA 5EFQA 4BKYA 4Y95A 3LZBA 1YI3A 2CHLA 1UKHA 5CWZA 2PU8A 3KCKA 2HZIA 4QTBA 4BRXA 3KULB 3MFTA 2ZV2A 5KMOA 3DBCA 1PXLA 2EU9A 4FYNA 1SYKA 2JFMA 4XG6A 3F6XA 3VJOA 4CFVA 3A8WA 4D9TA 3ZMMA 3EYHA 5FXQA 2WKMA 3E87A 5FTQA 4OTFA 4TPTA 5AIKA 5JT2A 4DBNA 2I1MA 3HV4A 5BYYA 5GIPE 3NS9A 3EN5A 4UWYA 4IWOA 2REIA 1F3MC 3DFCB 5D7VA 3EQHA 3FZRA 4KSQA 3UZTA 2Z7QA 4XH6A 3WI6A 5I5ZA 3HEGA 3PIZA 1BI8A 4L00A 5KMMA 1PXNA 1ZMWA 4C3FA 4L67A 3COHA 1URWA 5CAOA 4FKPA 4BGQA 5KKRC 2HZ4A 1CTPE 3TL8A 4O0VA 3W32A 5ANOA 4F65A 1HCLA 5BX0A 2RFSA 2VTQA 2CSNA 2W1ZA 4K33A 2A1AB 4K6ZA 4I0RA 5HICA 1ERKA 3BHHA 3L8VA 3NX8A 5AAEA 4M69B 3BE2A 3U9NA 1J7IA 4GH2A 3QLFA 5CNOA 5AP2A 1JVPP 1T45A 2YFXA 3FI3A 3GU5A 3UBDA 2ZM4A 3B8RA 3ALOA 5AUXA 2O2UA 4E6DA 4U44A 4RWJA 3GFEA 4GU9A 5DVRA 5FM2A 5IUIA 1Q8ZA 3GGFA 2WQNA 3BI6A 1K2PA 4JT3A 4RC2A 2WMQA 5A3XA 4ALWA 5ACBC 4ACGA 5LMKA 4AGCA 2VWUA 3KN5A 4ZTHA 4AX8A 3PXZA 4Y5QA 4WRGA 3TZ8A 5KCVA 3QQLA 4XG3A 2VNWA 4HPTE 2FVDA 1PMVA 4AE9A 4CYJA 4FX3A 4L7FA 5BVOA 2VO6A 4IVDA 5J7BA 4YZ9A 5EHYA 4FKGA 4EI4A 3ZHPC 5CF8A 3G33A 3RP9A 4IJPA 4I20A 1GIIA 3EYGA 1P2AA 2VX1A 5TT7A 5AUTA 3F88A 1KE6A 2UZLA 1FGKA 3DK3A 4IH8A 4BTJA 5L8KA 2OZAA 4DCAA 3SHEA 2B4SB 4BI0A 1OBGA 4W4VA 1OL6A 2ACXA 4AAAA 3T3VA 3A60A 3DBFA 3K3IA 3MY5A 2FO0A 3G6HA 3R9HA 3NVMB 2XRWA 3CGFA 4O27B 3TXOA 3R2YA 4I5HA 4BDEA 5LVPA 1PXJA 4HOKA 2GHMA 3UGCA 2P2HA 4EH4A 4YO4A 4IHPA 4EJNA 2B52A 4JQEA 2XIZA 3VS7A 2O0UA 4KIOA 2X6EA 4AA4A 4CFWA 3TNIA 4M15A 2PVHA 2GNHA 2R3IA 3CQWA 3D9VA 2VX0A 3KU2A 4PTEA 5FEDA 5AP1A 2PTKA 2IN6A 2WTDA 4XMOA 4EZ5A 2IVTA 4XUFA 1GIHA 3I4BA 4Y72A 4ZSAA 2CLXA 2O3PA 1Q3WA 3RPRA 2ZM1A 4EH2A 4PMMA 1WBTA 1R78A 2UZDA 1WZYA 2W5BA 3GXLA 2OXDA 3E7VA 4ZTRA 3UP7A 4O21A 3LOKA 4AOTA 3ATTA 5CQWA 3LXKA 5DA3A 3ZEWA 2UZWE 4USFA 4R7BA 4ZMFA 5ACKA 2YIQA 2OSCA 4JBVA 3RK7A 5CANA 1PXOA 4FG8A 2X7OA 4IXPA 4IC7A 2YCRA 3RBWA 5HOAA 3WARA 4ACCA 4DN5A 3MVJA 4B6LA 5CU0A 5LVMA 2ITOA 2OJ9A 3CP9A 4IAIA 4QMOA 5AP5A 2C1AA 5BVWA 4CCBA 2PPQA 2WZJA 4U42A 4RC4A 3OXZA 3OFMA 4LUDA 4RRVA 4MVFA 4TWOA 3T9IA 5EM7A 5DT4A 5AV1A 3EQRA 2R3NA 1UKIA 4O96A 2XH5A 4MWHA 3R8MA 4AXAA 3H9OA 2F9GA 3NNVA 4P4CA 4BTKA 4CYIA 2XB7A 3PA5A 1BMKA 3BYVA 1UNHA 3REPA 3FQSA 4L01A 1H1PA 3KKVA 3DBDA 4OTQA 5M51A 3FQEA 3TT0A 3PPZA 2C69A 5C26A 2JBOA 4X2NA 1KUTA 4XEYA 3QCYA 5HU9A 3HA8A 5AJQA 3D7TA 5K3YA 4ZY6A 4JDJA 5CZIA 3KRLA 4BWKA 1E1VA 5J5SA 2W9FB 4RIYB 4IB5A 2C4GA 1H1RA 1OUYA 2ZAZA 4G3FA 3I1AA 5IMXA 2W05A 2E9UA 3KVXA 4WG4A 4L7SA 5E1SA 1JBPE 1PYEA 3DTWA 5KUPA 3R7GA 5CVFA 3R8VA 4O7VA 1X8BA 3WE8A 5TE0A 2HZ0A 2WD1A 4I0SA 3HLLA 4BBFA 4F9YA 4IB0A 4LUEA 5DR6A 2JAMA 4YZBA 4DH1A 1H4LA 3IW4A 2Z7SA 4X6RA 2YERA 3C9WA 3HUBA 4E5BA 5CSXA 2JDOA 2VO7A 5DNRA 1M7QA 4V0GA 4EEVA 4U8ZA 4V0GB 5IG1A 4YJVA 4YZMA 1H27A 4EQMA 4Y5HA 3DV3A 3EFJA 3NW7A 5FWKK 3MJ2A 5LMKC 5I9VA 2OLCA 1NA7A 3QRJA 3QA0A 4LV5A 3MYGA 4W9WA 3UC3A 3UZRA 3DJ7A 4D2VA 5CEQA 2YDIA 5CSVA 5AP6A 4PP7A 2PULA 5E8XA 4JRVA 1FOTA 5LVOA 4FIGA 4FTIA 1JOWB 2YA9A 2HOGA 4GG5A 3R7IA 3CXWA 4O1PA 4AW2A 4BDGA 4F0IA 4D1ZA 2GTNA 2UZTA 4U45A 1MP8A 5CY3A 5HGIA 5BVKA 5IA4A 3TKHA 4IX4A 4PTGA 3ZC6A 4RG0A 4C59A 4FGRA 4CRSA 3MA3A 3OTUA 1OMWA 1SMHA 2X8DA 2NNWB 3IGGA 5CT7A 5EYCA 2WPAA 5AX3A 5IU2A 3MDYA 1GY3A 3NUPA 4EOMA 4AQCA 5L2SA 2WHBA 3R8UA 4DC2A 3TCPA 3R7YA 5M4UA 4QP7A 4FL3A 3FLYA 1J7UA 5AR3A 5KHXA 4RVKA 3OTVA 4QMZA 1RQQA 2BZJA 4FZDB 4IEBA 1VJYA 4ZLYA 3JR1A 2KTYA 2J51A 5CVGA 4AWIA 4KKGA 1BI7A 2OW3A 3HV3A 1Z57A 4FTTA 1PXPA 2HCKA 4UMTA 1ZAOA 4GW8A 1Y8GA 2C0IA 3O7LB 3PPJA 4QYYA 4WNKA 3R83A 3QL8A 2RFNA 3RMFA 3MB6A 3QTIA 2P3GX 3ZLXA 4O7YA 2BTSA 5KMNA 4FEUA 3FL4A 4A7CA 2C6TA 2BZHB 2ETMA 4XV9A 2YM3A 3EH9A 5D10A 3WOWA 4BN1A 4EH9A 1IRKA 2WQEA 4GT3A 3HDMA 5CZHA 1R39A 4ACHA 3CJGA 4IVAA 4K9YA 3D5XA 3QZHA 4IFCA 3TJCA 3RHKA 4JX3A 3GENA 1YKRA 5HCYA 3CEKA 5I3OA 4CKJA 3SC1A 5CENA 4YC3A 2WQBA 4BKZA 2J2IB 5J79A 5HG9A 2PVYA 4QP1A 2X81A 2Z60A 2F57A 3VO3A 1L8TA 3D2KA 2LAVA 3E3BX 4ZY4A 2JC6A 4L68A 4S31A 4DTKA 5CEOA 4CLJA 4AP7A 1MQ4A 4CZTA 3QCQA 3NUYA 4IAFA 5FBOA 1RE8A 4ZAUA 3RAKA 3G0EA 5EOBA 3BYOA 3F5GA 3UYTA 1SNUA 3NSZA 3VUHA 3CD8A 4HGSA 3AC5A 1VEBA 4U41A 1P4OA 4JDIA 4WUNA 3V5PA 4S2ZA 4BCQA 3I7CA 1KOBA 2VD5A 3Q5ZA 4FTQA 4TYHB 3A2CA 3OCGA 3COIA 1QPEA 3NR9A 4ERWA 3QWJA 4EUTA 4FSTA 1LP4A 2YWPA 3PJ2A 5L3AA 2FSLX 3QQKA 2J0IA 2PZ5A 3E62A 3UNJA 5IH5A 2R3KA 5DGZA 4OUCA 4BCJA 4DFYA 4CG9A 2R3OA 4M69A 4YJRA 4U0IA 2UZBA 3BHYA 2P0CA 3AD5A 3C4CA 4C4FA 3R0TA 4IDTA 5A4TA 3UOJA 5DOSA 2GNFA 4KBCA 2UZOA 2HW7A 4GG7A 3EIDA 3BBWA 3VBQA 4IB3A 5T6KA 1EH4A 4EH7A 5M06A 3BGQA 3O17A 3VQHA 3ZO3A 3W16A 2XZSA 1WCCA 1BKXA 1OVEA 3I7BA 4HGLA 4RVTA 5DN3A 5AA8A 3GQIA 5BNJA 3QC9A 4HYSA 3ULIA 3KB7A 1TVOA 3ZBXA 3ORLA 5HX6A 3CPCA 4BTFA 2BDFA 3EQPA 3U6HA 3BRBA 3LFBA 4R7IA 3TIZA 5LMAA 4JLCA 4DEDA 2OJGA 4ACMA 5FP6A 5GINE 3E8CA 5EK7A 3R1QA 4FL1A 2VTTA 3CY3A 4YTCA 4G6NA 3RM7A 1UU9A 5AV2A 3SOCA 5F9EA 4HVDA 4OBOA 5DR9A 2BDJA 5DBXA 3TNWA 4EONA 3G15A 3NUUA 4PTCA 4GKHA 1H24A 4BCGA 4ITHA 1Q24A 2XS0A 4DGMA 5EI6A 2W96B 4WNMA 4QO9A 1U59A 4J1RA 2PY3A 3TZ7A 4R3CA 1FBNA 3UPXA 2JIVA 3PJCA 3U8WA 4MK0A 5HG5A 3N51A 4L53A 2R7BA 4E5WA 2XEZA 4LI5A 2JKKA 3W2OA 3IW8A 5DRDA 3GUBA 3AMBA 4LL0A 4PRJA 4CKIA 4PV0A 1GZOA 2YACA 3VRZA 1BLXA 4E6AA 5M09A 4PL4A 4QTCA 4J98A 1HOWA 1PMUA 3OUKA 5HI2A 3N4UA 1Q99A 2UW0A 5DR2A 5DT0A 2C3JA 4CMTA 4BWPA 2B9IA 4C35A 2I0YA 4ZZMA 2B0QA 4BTMA 4AACA 2RSVA 4KINA 3O8PA 4QQJA 2AC5A 3QCSA 3W55A 3IDPA 3QRIA 1W8CA 3ROYA 1IASA 2CPKE 2VWBA 4YHFA 3R04A 5KE0A 4MD8E 3S95A 2PUUA 4PL5A 4O1OA 4GK3A 4CV8A 3G0FA 3IS5A 4R6VA 2J5FA 3PJ3A 4Y73A 3FLSA 2WTVA 4XYFA 3CR0A 4E4LA 5I4NA 1WBVA 3PZEA 3EQFA 4GJ2A 3WZDA 1PKDA 3PRIA 4XV3A 4R3PA 5CQUA 4Q9ZA 3DAKA 2W9ZB 4U3ZA 5TOZA 3OD6X 4ZSEA 4J99A 1GZKA 4ZJIA 1NT2A 3P9JA 1ZYJA 4YJSA 5LMBA 4DFZE 2X7GA 3EFLA 4YO6A 2PZYA 4ZMEA 4CQGA 4DA5A 3ODZX 2R9SA 2XM9A 2XKFA 3DZQA 5KZ0A 4G3GA 1RDQE 1CKIA 3MPMA 2PMLX 5EYKA 4HYHA 5HZNA 3SGCA 2SRCA 3MTFA 3CTJA 2OFUA 4IMYA 4U43A 4EHVA 3L8SA 5J5TA 4YC8A 4YJQA 3PP1A 5B2LA 4GL9A 4KNBA 2PUPA 3D94A 4D2TA 3MI9A 1MRUA 3LFDA 4I92A 2HY81 3KF7A 1OPJA 3AD4A 1OIYA 2C3LA 1YW2A 1KV2A 2JDTA 2JLDA 3D14A 3SXFA 1Q97A 3TNQB 4BF2A 1DAYA 3P1AA 3C0GA 3IONA 4C34A 3BGPA 4Z9LA 4UBAA 3P0MA 3VUGA 2HY0A 3HNGA 4K2RA 4XLVA 4EOKA 1JAMA 1V0OA 2Y6MA 4TT7A 3UP2A 1JSUA 2ZDUA 5KMIA 1U5RA 3HMNA 4FKSA 5CU3A 3GC7A 2C3IB 4I94A 4LRMA 4HCTA 3HP5A 1A9UA 2GS2A 4ITIA 4E7WA 3PSCA 4CMUA 3F66A 4IM0A 1TKIA 3OOMA 5CTPA 4CT1A 3MFRA 1H0VA 5CXHA 3HZTA 2X2MA 5IDPA 1F0QA 5CYIA 2PZRA 3IDCA 5GHVA 4AFJA 5A14A 2XBAA 3LIJA 4XNEA 4GT5A 5HBHA 3UZPA 4FEVA 4MQ2A 2I40A 4C58A 4UZHA 2X39A 2BRBA 3K5VA 4QMMA 3AC3A 4R7HA 1ZMUA 3QXOA 4BBMA 4G6OA 3C1XA 4TYJA 2C5NA 5E7RA 5CS6A 3UJGA 5GZ8A 3LLAA 4W8DA 2W1FA 2JAVA 1XH5A 4M97A 3UOLA 4D2PA 4JRNA 4HYUA 2YHVA 2Y4IC 3P23A 2OIQA 2UW8A 2QOQA 4IWPA 5E92A 3V5TA 5CI7A 5F95A 4BDDA 1H25A 4W4WA 4F64A 3U9CA 2PUIA 1UNLA 4O0WA 3R1NA 5KHWA 4OAVB 2HW6A 4NL0A 2YCQA 4QP6A 3MVLA 3W2QA 1VYWA 3LM0A 1FVTA 4YZCA 3Q3BA 5HE0A 2ZJWA 4YR8A 2XK3A 3MS9A 2I0HA 3BHTA 3UG2A 1SM2A 4ENYA 4ZLOA 3HAVA 4FA2A 4FVRA 4E6QA 4MXYA 4OTDA 4Y83A 4NYEA 1ZRZA 3OXIA 1WBNA 4ZTLA 3QZIA 1P4FA 2V22A 3OOGA 4PL3A 4FKOA 2Z2WA 2H34A 2WAJA 5B2MA 4RIXA 4XRJA 2ZB0A 3Q4CA 4JQ7A 5H8EA 1H26A 3VNTA 1KSWA 2XNGA 3HDNA 2W1HA 2UZNA 3FSFA 2R2PA 3KF4A 2BALA 4RX7A 3WF8A 3HRBA 3WYYA 3OHTA 3PPKA 4PDPA 5E90A 4RJ4A 3A4OX 4QMVA 3ZO2A 5C8NA 3E88A 4P90A 4TRLA 2B54A 4D1SA 4RIOA 1U54A 3SRVA 1KE5A 3F3UA 4G1WA 5LQFA 5AEPA 2EB3A 2GHGA 3QQFA 4G9RA 3VC4A 3BHVA 5IQEA 5HCZA 3ENHA 4HVSA 2IZUA 2WB8A 2W99B 3DT1A 4U79A 3D5WA 3GP0A 2H8HA 3ZTXA 3E8EA 4L45A 2X8IA 4FT5A 4JIAA 4MKCA 4QYEA 5D9HA 1ATPE 4IAZA 4WNPA 4DG3E 5A9UA 2XUUA 4FKUA 4F4PA 3GQLA 3QWKA 2F49A 3Q53A 1W84A 3UNKA 3TDWA 3UIUA 1JNKA 3A7HA 2V0DA 2J7TA 4TWPA 3MSSA 5BYLA 3ZLWA 3HKOA 2IW9A 3V51A 2YAKA 2UUEA 1GZ8A 3UTOA 4C4GA 4C3RA 5JGDA 1V0BA 3KVWA 4UYNA 3F7ZA 4FIIA 5I0BA 4QT1A 4D58A 3O8TA 5JMSA 4AA0A 5CXZA 3LFNA 3A7GA 3I0QA 2I0VA 2B9JA 5FQDC 2BVAA 4QYFA 1YVJA 5HG7A 3Q9YA 4FEQA 4I23A 4X7QA 5D1JA 5EM5A 4ANNA 1NW1A 4HJOA 2PSQA 2QOKA 2XBJA 4OBQA 2YABA 5DIAA 3JY9A 3ZZEA 1PRYA 3QGYA 4IJ9A 4F6SA 2XNNA 3NEWA 4D5KA 1OL5A 4EL9A 2W4KA 3NNXA 2GQSA 4PUZA 5LWNA 4L52A 3KN6A 2ONLC 3FSKA 4GS6A 4GRBA 4KBKA 4NM7A 1OKZA 3LMHA 3RALA 3R28A 4JX7A 4MD9E 4EKLA 2B55A 5HBEA 2X4ZA 4YHJA 4RIXB 3DXQA 4NM5A 3M42A 3UO4A 2XKEA 2DS1A 2BFXA 3DDPA 4EH3A 3KMWA 4X0MA 5EYDA 4JI9A 3FMJA 2IW8A 4DFUA 3G9NA 3AQVA 4LL5A 4AZWA 4JOAA 2BZIB 3KRRA 1YHVA 3TUCA 1ZOGA 4XOZA 1Q4LA 2XF0A 3Q2MA 4FKTA 2WTKC 4I5PA 3EOCA 1DI8A 1MRVA 2CJMA 4HZRA 3GEQA 4RIWA 1FINA 4X21A 5DWRA 5HKMA 2QHNA 3O96A 4U81A 1BL7A 3ZBFA 4BDJA 4J96A 4K0YA 3FBVA 3FXWA 2XNMA 2G9XA 4X2GA 4CD0A 5K9IA 1UU3A 4BIDA 2XA4A 5GNKA 3V01A 4H1JA 3TM0A 1PHKA 3MH0A 4AGUA 3A4PA 4NCTC 2OZOA 3RPYA 3UPZA 5J9LA 3QD4A 1P14A 2WU6A 2Q0BA 2OJIA 2A4LA 3EQCA 4RPVA 3V8TA 4BIEA 3PG1A 4BZNA 4F6WA 3G9LX 3S3IA 2X0GA 3ZU7A 4RJ6A 5AP0A 4BGHA 4CSVA 4JG8A 5H8GA 4D1XA 3MB7A 4QOXA 4X3FA 2DWBA 1XO2B 4TYEA 4FT3A 5AUZA 5M55A 4CLIA 3ZSGA 3MH1A 3CKWA 4JDHA 2ONLA 3SD0A 3HMIA 1LUFA 1WBOA 4DT9A 3ETAA 3BE9A 3C5UA 3MFSA 3ZDIA 3QX4A 5JK3A 3R01A 5EQYA 3DZOA 1NXKA 2QOBA 5DHJA 4QTDA 3R22A 5IQCA 3R7UA 5CF6A 4DH7A 4IC8A 1GZNA 5B0XA 4E6CA 3MBLA 3LE6A 4AZVA 3I5NA 3BHUA 3ORNA 3PIYA 2HXQA 4FTAA 2ZMDA 4QP9A 4EC9A 3VUDA 3RPVA 4FV8A 3NNWA 4KIQA 2JKOA 3CPBA 4IFGA 3ZFYA 3ZM4A 3MJ1A 4C2VA 1BYGA 4CQEA 4GSBA 4B8LA 2CKEA 3D2IA 5T3QA 3C4EA 2FUMA 3BLRA 5M08A 2RFDA 5HESA 4K1BA 3NUXA 2AYPA 2NRYA 4ASEA 4F0FA 2YZLA 4F0GA 1XWSA 3BU3A 4G3EA 5K0XA 4R77A 3PSBA 2JFLA 4RIWB 5CALA 3LW0A 4IDVA 3UG1A 4BGGA 3DK7A 4EHEA 1FGIA 2CN8A 4BDKA 3ITZA 4NJ3A 2GHLA 3D0EA 3PIXA 1YDRE 1STCE 4YLJA 3DQXA 5HORA 2UW4A 3VW6A 4AZSA 5CAUA 1FQ1B 2C6MA 2ITQA 4LG4A 2ZYBA 1TQMA 2XJ0A 5FGKA 3PFQA 3GU8A 2OO8X 3CD3A 1UU7A 5IQDA 1YI6A 2ZVAA 4N4SA 5KO1A 1PXKA 4KABA 4IAYA 4YHTA 1VZOA 2XCKA 5ANGA 3W8LA 1Q8WA 2ZM3A 2VTAA 4WT6A 4HGEA 3IOPA 2XNEA 4G34A 4PP9A 1OBDA 2CGUA 1Y57A 1W0XC 3KXZA 5CAQA 4GT4A 3WZKA 2V7AA 2VTJA 2YM7A 4F09A 2JEDA 2R5TA 3K5UA 4JG6A 4L42A 4U97A 5L6WL 4BCHA 3F61A 3G5DA 4HVGA 4QRCA 4ZOGA 5EI2A 2W4JA 2YLEA 2IZRA 4Q9SA 3D7ZA 5IQAA 3GCQA 4NM0A 5AUYA 3E7OA 1WMKA 3AC8A 3MVHA 4DFXE 5EM8A 4ASZA 2BRGA 4A9YA 4LMNA 1FMOE 1Q5KA 3R8PA 1XJDA 2BAJA 1GOLA 3AT2A 3VS6A 1YI4A 4FV2A 4RA4A 3JVSA 3R9OA 3UO5A 2VX3A 3BKBA 3FWQA 4FR4A 2EXEA 3P7CA 3UOKA 2YZAA 4YZDA 4ZJJA 2NRUA 5IA0A 3FE3A 4AW1A 3HYHA 4NH1A 3VS3A 4TL0A 5CSPA 4NW5A 4NZWB 4B7TA 5KMJA 2Q83A 3MH3A 1FVRA 2ITWA 4YJNA 1OUKA 2BIYA 1YWRA 3BEAA 4RQVA 4YSMA 4FEXA 3BBTB 3HUCA 3NAYA 5EI8A 4DFLA 4ZS0A 5M56A 5BUEA 1U4DA 3OC1A 4BB4A 3AOXA 4Y85A 3QCXA 4R1VA 3FHRA 4F1OA 5CASA 5C1QB 4LFIA 4WBOA 3KULA 4LMUA 2RG5A 4L3PA 1QPJA 5HO7A 4L46A 4BICA 3EN7A 3ACJA 2GDOA 4OTHA 4ANMA 2J5EA 2UVXA 4U5JA 5JH6A 1OZ1A 3UIXA 1YOMA 4EUUA 4O84A 3B2TA 4WOVA 5F1ZA 4ASDA 3DKFA 4FODA 5DT3A 3H0YA 5AR7A 4NU1A 4BI2A 3AT4A 5K5NA 4MBIA 3O23A 3QQHA 3NIEA 5E8SA 2RGPA 4O7NA 2I7QA 2GNGA 3PY3A 3F69A 3V8SA 2B53A 3GCPA 3AC2A 4AU8A 3SXSA 4BIBA 3EFKA 1JKTA 3Q5IA 4L3LA 4XHKB 4XV1A 1H1WA 3RHXA 4C2WA 3LPBA 2NO3A 3TV6A 3R71A 3FKNA 2PVRA 3KRJA 1KE9A 2ZOQA 4IBMA 4G3CA 5L2TA 2GS7A 4F70A 3BYSA 2GSFA 2QODA 4DAWA 3DKGA 5E8ZA 5IMEA 4UMUA 4M13A 3S4QA 4MXOA 3TTJA 4RX9A 3RK9A 3TKUA 4HVHA 4O2PA 4O6EA 4JR3A 1YXUA 3COMA 4YJOA 5GJDA 1IA9A 1FMKA 3H30A 4E93A 1PXMA 3Q4ZA 4W4YA 4I6HA 1Z9XA 2PK9A 3L1SA 4FKVA 3RCDA 4F63A 1OPLA 3FEGA 4M7IA 1PKGA 2C68A 2QOFA 4NK9A 2VTPA 3HRFA 3R30A 3LHJA 2VGOA 2VN9A 4O0TA 2Z7LA 3OEFX 3OF0A 3FI2A 2VTSA 5L2QA 3L8XA 2OXYA 2J50A 2EWAA 5EH0A 4ZXTA 4QD6A 2OGVA 4FIEA 4F9BA 2C6DA 4LRJA 4RFMA 4I4EA 5A4LA 4I0TA 3R02A 5FP5A 4CZUA 4G5PA 4F9CA 4ZTNA 5DYJA 3FZPA 4MD7E 2XJ1A 2PMIA 5M53A 2F2CB 2BZKB 4CTBA 4DEBA 3NMUF 1OIRA 5M4IA 4WSQA 4R3RA 4W9XA 4EOOA 3WF7A 1JQHA 2X9FA 4D0XA 4RJ5A 1OKYA 1ZY5A 2UW9A 4J97A 1J3HA 1E9HA 1W7HA 4MQ1A 3KC3A 4FV7A 3QA8A 4QP4A 3IW7A 3MA6A 4Z55A 4HNIA 3FMLA 4QPSA 3UE4A 2CNUA 2CNQA 2ITUA 3FPQA 4CFFA 2ITVA 3V8WA 2FGIA 2PZIA 2QLQA 2R7IA 3CTHA 5EW3A 2IWIA 3TNHA 3GU6A 2WIPA 3JY0A 3O2MA 5I3RA 3QTWA 4EYJA 2QQ7A 4M67A 5CF4A 4DEAA 3KGAA 3BX5A 1J1CA 4J95A 3O51A 4APCA 2HENA 2XNPA 3V04A 5J1VA 1ZOEA 4FUXA 2BCJA 4U9AA 4W4XA 3TWJA 4NKAA 2OWBA 4I6BA 4M12A 1VR2A 4CNHA 3GT8A 4F7NA 2X9EA 3IO7A 3MH2A 3MESA 4EK8A 5IH6A 5HQ0A 3O7LD 3OW3A 3LLTA 2Y7JA 4WBBB 4APPA 2BKZA 5IA5A 3I0OA 3NUNA 4RJ7A 3OCSA 2XIXA 4QMUA 4CKRA 3LCDA 4BDAA 5JZJA 5G1XA 2ITYA 4XG4A 3DB6A 4G31A 3UMWA 2W1DA 1CKPA 5BVNA 3C4WA 4PQNA 4RC3A 3F2AA 3R8LA 3VAPA 1YDSE 5I9WA 4IE9A 5FXRA 2P55A 3PVBA 4MBLA 1UVRA 3KXHA 5FBNC 4FTUA 4O86A 2ETRA 4D9UA 2XK7A 2C5VA 4IZ5A 4TNDA 2RG6A 4PX6A 4E73A 2Z02A 3Q6UA 4QYGA 4NKSA 3MV5A 3RAIA 2G01A 2GTMA 2ZV8A 3IDBA 3OG7A 4G16A 4PMSA 2QO2A 4GK4A 3E3PA 2F2UA 3B8QA 3PVGA 4PMTA 5FM3A 4JQ8A 3TACA 4CFUA 4D2RA 4FSMA 4G17A 3TUBA 1DM2A 3Q96A 2O5KA 1UV5A 4YPSA 4AGDA 1A06A 4OBPA 3ZXZA 4CZYB 2G2FA 4IX5A 4MF1A 2X7FA 1UU8A 2WMAA 5IUHA 2YDJA 1GIJA 3PRFA 3ENMA 4ZZNA 1BUHA 4NM3A 3U4UA 4TYGA 2XEYA 4MTAA 3RAWA 2XNBA 2QVSE 3DFAA 5AAFA 2KULA 3QBNA 4YURA 4TKSA 3PDTA 4JR7A 2YDKA 1XBBA 3F3TA 4LQMA 2UW7A 3EN4A 5BMMA 3HV7A 2ZB1A 5IUGA 3LCKA 4GJ3A 3NUAA 5I9YA 4BKJA 3DCVA 3QHWA 4ANSA 5L6OA 1BX6A 4ORKA 4Q5HA 5DEYA 4A06A 5HVJA 3FMDA 5HVKA 1XH7A 2YLFA 2HZNA 2QG5A 4IWDA 4C62A 4ALUA 2YJSA 5DPVA 5I9UA 1AGWA 3D5VA 4AT3A 3GFWA 3QF9A 2R3LA 3W18A 3EL7A 4O0UA 1XQZA 1YOLA 2Y6OA 1R1WA 3VS4A 3R6XA 2QU5A 4N57A 3V6RA 4YPDA 5AIRA 4RFYA 5M07A 3DBQA 3H0ZA 5AR2A 4ZSJA 2HWOA 5C4KA 4ZY5A 4DG0E 3LKMA 3N4TA 3MGYA 4OTPA 1XH9A 4ALVA 3NVKI 5IEVA 3IK3A 1YXXA 4NTTA 3ZFXA 4O2ZA 4PMPA 4H3QA 5CX9A 1J1BA 2WGJA 1ZZLA 4YJPA 4ARKA 3W2PA 4MNEA 2NPQA 2C5XA 4QMSA 2QURA 4OT6A 4DEGA 4FZAB 4YBKA 3ZYAA 5IEXA 4NCTA 2UZEA 1SVHA 2JDVA 2XJ2A 4PDOA 3EN6A 1S9IA 3C50A 3ORZA 3KXXA 5EHLA 4DEHA 4UMRA 2WELA 3NAXA 1Q41A 5HNGA 2CNVA 4KIKB 4BCMA 3I6UA 3OW4A 4FMQA 3WZJA 3KEXA 5H9BA 1YWNA 3DB8A 3KXGA 2X4FA 3KXNA 4CRLA 4UWCA 3FI8A 3QTXA 4X2FA 3BYUA 2WMXA 3UYSA 4DH3A 4EOPA 4D4SA 4FGBA 4FIJA 4IM2A 3L9MA 4FTRA 3ERKA 4P5QA 4CT2A 4JAJA 4GVJA 4YMJA 4FV0A 3BELA 1M2PA 2EUFB 1MRYA 3FZSA 4JXFA 4OGRA 4BDFA 4PDYA 4JS8A 2XP2A 2H9VA 1R3CA 2OIBA 3FI4A 4I41A 4KRDA 1OITA 4BDCA 2VWXA 4QMNA 4IAKA 4IADA 4J7BA 4IWQA 4FOBA 1PYXA 3F82A 5FDXA 1G8AA 4DBXA 3QTUA 5HVYA 3SRVB 3NUSA 1Q8YA 2QKWB 4QNAA 4JBOA 4RGJA 4TNBA 1R0PA 2AC3A 3GNIB 5HO6A 2BIKB 2VTOA 4XP2A 3DXPA 1IAJA 4Q2AA 2Y0AA 5D12A 2WTIA 3CJFA 2OF4A 2UV2A 2DYLA 4CFMA 2OKRA 5A6OA 3IG7A 4JAIA 4YTIA 5HLWA 3Q9ZA 3KMUA 3JUHA 1H01A 3PA3A 2XK4A 5HG8A 4IIRA 4TN6A 4BDBA 5CF5A 2GFCA 3UQFA 4GEOA 2C3KA 1KWPA 2ERZE 4ZZOA 4U3YA 2QR8A 4MNEB 3BQCA 2WOTA 2DUVA 2XNOA 2OIDA 3KRXA 3QTSA 4GIHA 1H00A 4E8AA 3E64A 4EZ3A 2H6DA 5CAVA 4FV6A 3JPVA 3PA4A 3RPOA 4O7ZA 4WHZA 3P5KA 5LARA 5A4QA 1KOAA 3ZC5A 4XJ0A 2YIWA 2A27A 4YJUA 3VBXA 2V55A 3HP2A 3FYJX 4FTKA 3E8NA 4MXZA 1V1KA 2QD9A 4XP3A 4BZDA 3PVWA 3R21A 2J6MA 4FNXA 3FY0A 3VUIA 3QGWA 4KAOA 4EH6A 5GIOE 1OKWA 3WF9A 2AUHA 4HPUE 1Y6BA 1ZOHA 3LXPA 3A7IA 3DGKA 4WG5A 3UOHA 3V6SA 3V5JA 4DITA 1YXSA 5HBJA 3ZXTA 3MN3A 3UQCA 3IW5A 3C4ZA 3PG3A 1I09A 4DTBA 4EWQA 3EL8A 2PVLA 4CXAA 4DYMA 2CGXA 5ETCA 3FXXA 1ZMVA 5KX8A 5BUJA 3Q4UA 4QMPA 3VUMA 2YM8A 4C4IA 1YOJA 4FOCA 2H96A 3SKCA 2WMTA 4DGOA 4D55A 2QC6A 2CGWA 3HAMA 5EW8A 2LGCA 5F20A 3C13A 5FUTA 1NVQA 4LM5A 4ITJA 3BGZA 5HTBA 2E9VA 3P7BA 3OUNB 5F94A 2W1EA 4EORA 4IM3A 3PXYA 2WTCA 3RVGA 1WVYA 4IAAA 3Q60A 1WFCA 1Q62A 5ANEA 3F7WA 3MVMA 4BZOA 4E20A 3TI1A 3OT3A 2Z8CA 4RZVA 5TR6A 1M52A 4QMYA 3F5PA 3HV6A 4RLLA 5C27A 3DU8A 3C4XA 3CQUA 4KWPA 4A4XA 3N9XA 4TXCA 5A46A 3WE4A 3GOKA 3ZO4A 2HK5A 5AUWA 5TO8A 3K2LA 3DQWA 5ANKA 4JG7A 4DTAA 3EQDA 4CVAA 4OTIA 1NVRA 4H3BA 3ZUVA 3KK9A 1JPAA 3PXQA 3SW4A 1CSNA 1JSTA 1PXIA 2FYSA 5CSWA 3O71A 1IEPA 2BRHA 3CKXA 5HIDA 4A9SA 4C37A 2P2IA 3QUPA 5J87A 3M1SA 3AGMA 4MHAA 4DF3A 2HYYA 4FTNA 2BR1A 5GZAA 3FJQE 2UZVA 3MPAA 4M0YA 4GMYA 3RM6A 4AOIA 4C3PA 5HTIA 4QP8A 1DI9A 2OICA 4GUEA 4LGGA 3FMMA 1H8FA 4AOJA 2BTRA 2X1NA 3LXNA 4FYOA 3BLHA 4O91A 3AMYA 3FLZA 3JVRA 4L6QA 4QP2A 5E8YA 4GFGA 3IKAA 3RWPA 2VWZA 1H0WA 3OP5A 5EKNA 4QQCA 1XBCA 3R2BA 5AWMA 4LOOA 1QMZA 2PUNA 2R0IA 4A4LA 5IQGA 4DFBA 4C0TA 4X2KA 2WEIA 3F9NA 4O0XA 4ZSLA 2I6LA 4A07A 4BCKA 3O50A 5ANIA 2ETKA 5L4QA 2XMYA 2HXLA 3HMOA 3VBYA 4R78A 1U46A 1OB3A 2WQMA 3BWFA 3U6JA 1ZYSA 5HNBA 3PE2A 3ZONA 4DH5A 4JL9A 3AT3A 3EQIA 2BROA 2JDRA 2R64A 3R63A 3PXKA 3PWDA 3ZRMA 4ANBA 5CAPA 4FSYA 3IECA 4FTMA 4WO5A 4NIFA 3V5QA 3VVHA 3NRMA 5M4FA 5M57A 4NIFB 3QUEA 2BKKA 4R5YA 3Q52A 1B39A 5HE1A 3TJDA 2PHKA 4OLIA 3PSDA 4E5AX 5J7HA 5HO8A 4HW7A 4EQUA 3ACKA 3R7EA 1T46A 5CT0A 3ANQA 3ZFMA 4UMQA 2HAKA 4W8EA 5HLNA 4DT8A 3VBVA 4KD1A 4FKRA 2C6KA 5DMZA 4F9WA 2GNIA 3Q4TA 5IA3A 4UWBA 4DFNA 5KNJA 3U55A 1PMEA 2XIRA 4TWNA 3VF8A 4DHFA 5LVNA 5LXMA 4JBPA 1G3NA 1WVXA 2ITPA 2OJJA 4IX6A 5AA9A 5BVFA 3HGKA 5JFXA 4IACA 5E9EA 2UVZA 5JGBA 3VS2A 1WBWA 2C6EA 3R9DA 3S00A 3CTQA 3OWPA 5K5XA 3UDBA 2W1IA 4JNWA 4I6QA 3FLQA 4OAUC 4AE6A 4CV9A 3A7JA 4H05A 2R3RA 3G6GA 5KBRA 3I6WA 3AC1A 5DFPA 3FUPA 4ZIMA 2XVDA 5IQBA 3ELJA 4RMZA 5AFVA 3DK6A 2W4OA 3OEZA 3IPHA 1JSVA 1RJBA 4XBUA 2G1TA 1CKJA 3FLWA 4ASXA 3FHIA 3DJ5A 3MIYA 4YNEA 3RINA 4C4EA 3POOA 4NUSA 3SOAA 2IVUA 1NY3A 2X2KA 1F5QA 3UVRA 2RL5A 3KFAA 4HCVA 3UVQA 3VRYA 4RBLA 4C7TA 4EWHA 3VUTA 3ORTA 3TNPC 4FBXA 3T9TA 3D83A 3PZHA 5TF9A 3VS5A 2YIRA 3VQUA 3GOPA 3FV8A 3OY3A 2XIKA 4S32A 5T68A 3U51A 3O0GA 2GCDA 4K11A 4LV8A 4RT7A 2PMNX 3Q32A 3U4WA 3W2CA 5M44A 3R9RA 3CS9A 5IZFA 4D0WA 4XOYA 1ZZ2A 5AM7A 2OJFE 2GU8A 3QZGA 3IOKA 4EHZA 4J53A 5FG8A 3R7VA 4AA5A 4BHNA 4F7LA 3ROCA 4YLKA 1M14A 2JITA 5HU3A 2XRUA 2NP8A 2VO3A 3DTCA 3MW1A 4CEGA 5JN2A 4IVBA 3HL7A 3C7QA 3ATSA 2RIOA 4FV9A 3PLAE 4F08A 5HIEA 2VNYA 3E92A 5E4HA 2VTMA 4ZK5A 3QRKA 5E1EA 4YLLA 4FVPA 3GI3A 3ZSHA 4IX3A 5IEYA 3NLBA 4H58A 5KKRB 4GYIA 3UIMA 2VU3A 4TTHB 2WXVA 4UXQA 5E8UA 5DLSA 2JDSA 3HECA 4O6LA 1O6YA 2EB2A 3D5UA 3MWUA 4NFMA 3SG8A 1SZMA 4RIYA 4G3DA 5BQ0A 4FNYA 4FIHA 3BU6A 3P78A 4MXCA 2R3GA 4J8MA 2C6IA 3DDQA 3LFFA 3LFEA 4U80A 4AZTA 4GYGA 1APME 3CBLA 4XG2A 1OI9A 4ANQA 2JIUA 2GMXA 2UVYA 5CLPA 2UW5A 3V3VA 3A62A 4KKEA 3ZH8A 4AN3A 1FPUA 3SG9A 4WIHA 4BC6A 1KE8A 4AZFA 3EKKA 1Q3DA 3FMNA 3W10A 3P4KA 1CM8A 4AGWA 5ICPA 4FKLA 4NFNA 2R3MA 4QMQA 3N4VA 3QQUA 5BMSA 5GJGA 3C0HA 4U40A 4CTCA 1DS5A 2B1PA 2J9MA 2WMVA 3PUPA 5M4CA 4Z7GA 1QCFA 3SW7A 2PVJA 4YNOA 4AN2A 3HMMA 3LAUA 2ITXA 2YISA 4N6ZA 4I24A 2YWVA 3VBWA 2IVVA 2YIYA 3NCGA 4AFEA 3FKLA 4A9RA 3BPRA 3KK8A 2VWWA 4FZ7A 5AAGA 4D2SA 2GQRA 5EDPA 4GU6A 5E8VA 4FSZA 1K9AA 4MNFA 4UYAA 3NYXA 1Y91A 1BL6A 3DKCA 4L43A 4QMWA 3UVPA 2ESMA 3A7FA 3FMEA 3FYKX 1UA2A 3FMKA 4LRKA 3DXNA 4H1MA 1K3AA 1WBPA 3ORIA 2C1BA 1YWVA 4HGTA 3R1YA 4MYGA 4BCNA 5AUUA 5HLPA 3BCEA 2P4IA 3KMMA 4FKIA 5HCXA 3GU4A 1Y6AA 5IKWA 4E4NA 3U6IA 4N0SA 3OBJA 3LMIA 3LJ1A 2ZV7A 5EQPA 4QMTA 2ITZA 3NYVA 5AR5A 2J4ZA 2OFVA 4YTHA 5FTOA 4O38A 3U54A 5AADA 5IISA 3QD3A 2ITNA 4FTLA 4G6LA 4LYNA 3SA0A 5JKGA 2BHHA 3DS6A 3BQRA 4I3ZA 3RZBA 1ZYDA 2BDWA 4WA9A 2CKPA 1ZY4A 4AW5A 2WU7A 3QU0A 3I81A 4FTJA 4QNYA 3MIAA 1UWHA 3DAEA 3F3WA 5BVEA 4X3JA 2CDZA 1JKLA 3EN9A 3LFSA 3OBGA 5AX9A 3THBA 2QI8A 3GCSA 3KXMA 4XBRA 3LCSA 4B4LA 5A4CA 3ALNA 1B6CB 2G2IA 4GK2A 3TIYA 4UX9A 2W06A 4YC6A 3G51A 4J8NA 3RZFA 2WOUA 4R5SA 3I5ZA 2BAKA 3POZA 4FV4A 4HYIA 1AD5A 2OZAB 4UV0A 4BI1A 4F7SA 3BLQA 4KBAA 2CCHA 3RTPA 3Q04A 3P08A 2O63A 3BIZA 3VW8A 5L8JA 4M68A 3RCJA 3VWAA 2G2HA 4YSJA 1G5SA 2VTHA 4EOJA 1IR3A 4OTRA 3TV4A 5B2KA 1OL2A 4MXXA 4BWXA 4GFOA 2EXCX 5AR4A 3LFQA 5AV0A 2O64A 4CFXA 4ZLZA 2E2BA 3EJ1A 2FH9A 4PF4A 3FZOA 3ODYX 4OW8A 5JFVA 3C5IA 4DLIA 3K54A 1LEZA 4C33A 3FPMA 3QKMA 4M3QA 2OXXA 2QOOA 3FKOA 5HHWA 2UW3A 2JD5A 3S1HA 2BILB 5C8MA 4TYIA 3HA6A 2PL0A 4D4VA 4TYHA 1FVVA 4ZSGA 5AV3A 4O0SA 3EQBA 4KUJA 3I60A 4CMOA 1UNGA 4EOLA 3ZO1A 1OIQA 3LXLA 1H08A 2OF2A 2W0JA 3OXTA 3QTZA 3RWQA 3QAME 2R0UA 3QYZA 4M8TA 3U87A 1MQBA 3TZMA 5G6VA 1CMKE 2GQGA 1GNGA 2X8EA 3ORXA 5JQ8A 4ZS4A 2C30A 3ZRKA 4UEUA 2YJRA 4DG2E 4KSPA 3OCTA 3OCBA 3CQEA 3DKOA 4FSUA 4XG9A 3UO6A 3ZLSA 4P2KA 4L9IA 4O83A 2ZMCA 4GV1A 4RVLA 5EYMA 4N6YA 3H9FA 4NWMA 2V7OA 4JJRA 2IJMA 3FQHA 4MH7A 5AM6A 2JGZA 3SXRA 2QOCA 5J1WA 4X3FC 1YXVA 2VTNA 4Q5EA 4YU2A 3F5UA 4RZWA 3ZM9A 1OL7A 2F4JA 2GNLA 3K3JA 3C51A 1WBSA 3L9NA 2WMWA 3KY2A 3Q9XA 2Y4PA 4RJ3A 3DLZA 3KQ7A 4XRLA 3F5XA 2IVSA 5JFSA 5KZIA 3DBEA 4EJ7A 4QQTA 2GS6A 4S33A 3UC4A 3H4JA 3JXWA 2R3FA 3DPKA 3MTLA 3LQ5A 3PP0A 4II5A 4JIKA 4P7EA 4EOSA 4EQCA 1SVEA 4FI1A 2R3HA 1O9UA 2R3QA 1QL6A 3QFVA 2FA2A 4KS8A 3AG9A 5FTGA 4O0RA 1L3RE 2W5HA 5EDQA 3WIGA 1OPKA 3NW5A 2BFYA 3ZRLA 4EOIA 1REJA 4QYHA 1ZWSA 2V5QA 3GU7A 3II5A 4E1ZA 4B9DA 4FG9A 2WO6A 3AGLA 2QOIA 4OTWA 3KCFA 2VGPA 3QRUA 1LPUA 2G15A 4LGHA 2VAGA 3GVUA 5C4LA 1R0EA 5ITAA 3DOGA 3TUDA 5A54A 1PF8A 3E8DA 4IQ6A 4NT4A 2VWYA 4AF3A 4KKHA 4E4MA 3WZUA 3T8OA 2OU7A 3HVCA 3PTGA 2YM5A 2YITA 3LMGA 4XLIA 4R1YA 4P5ZA 2XK8A 3E63A 4F1MA 1JLUE 5HTCA 4OT5A 3QC4A 3NYNA 2W7XA 3VS1A 3GB2A 2YM4A 5LVLA 2E9PA 4D28A 4FZ6A 2OK1A 3ZS5A 2J90A 3L9PA 4Y8DA 5CNNA 3M11A 3NNUA 3ZDUA 4IZYA 4QTAA 1YDTE 2VV9A 2ZDTA 2X2LA 3HV5A 4BBEA 3TZ9A 1YHSA 4AW0A 4YGAA 5LOHA 5JRSA 2F7EE 4BCIA 2VO0A 4YJTA 5AUVA 4O7RA 2YIXA 1YQJA 4M84A 4MF0A 2WEVA 3F3VA 2QCSA 5HD4A 3F3ZA 1AQ1A 5JRQA 2VWVA 4FZFB 3CLYA 4BDHA 3GCUA 4I5MA 3KRWA 2QNJA 3C0IA 4YUQA 3CGOA 3C4FA 3EFWA 4QMLA 5DH3A 4RA5A 5GJFA 2XIYA 4PDSA 4TWCA 3DLSA 5K4IA 5KBQA 3VS0A 2B9FA 4EH8A 1H28A 3UMXA 3ET7A 3UNZA 5F4NA 2FSTX 3D7TB 3PY0A 4BR3A 2Z7RA 4YP8A 3BEGA 5AP4A 4E26A 4ENXA 3HRCA 5ANDA 2YM6A 2HWPA 4AT5A 4EKKA 3E93A 5H8BA 3VJNA 5HX8A 3NPCA 3S2PA 1O6KA 2WMBA 3AXWA 1XKKA 3PWYA 5CEIA 5H3QA 3W2RA 1OGUA 4A9TA 1M17A 5HNIX 4BHZA 3TG1A 4FG7A 2YCSA 4PWNA 4IVCA 3BZ3A 3I79A 3LCOA 4FSQA 5TKDA 2O8YA 4DGLC 1ZYLA 2XK6A 3CC6A 5CEMA 5CU6A 3SAYA 1OKVA 3FZTA 4KB8A 1ZXEA 3EMGA 2Y4IB 1P5EA 4J71A 4D5HA 5IQIA 5AMNA 4MEDA 3NWWA 4TY1A 2XYNA 2WQOA 1ND4A 4F1TA 5GZ9A 5K0KA 2P33A 2WMUA 4UN0C 4I4FA 1H1SA 3UIBA 2BUJA 1KE7A 1PW2A 4EZ7A 5ANJA 3PE1A 2E9NA 3ZCLA 4ZP5A 1M2RA 4UB7A 4FT0A 4RWIA 1PMNA 3PY1A 4WD5A 5A4EA 1B38A 4QMXA 3IGOA 3JYAA 4UALA 4BY9E 2FB8A 3O8UA 3ORMA 3W33A 1CDKA 4RLKA 3DNDA 5CU4A 4BL1A 3ORPA 3PLSA 2BRNA 4JVGA 3BV3A 3OZ6A 2JBPA 4S30A 2Q0NA 3HMPA 1XH6A 4E3CA 3DAJA 1TQPA 4GKIA 4FF8A 3SX9A 3QTRA 5JGAA 2PYWA 3G2FA 4Y46A 4C02A 3ZUTA 3RAHA 3DJ6A 2ERKA 2CCIA 3VN9A 5JEBA 4EHGA 1XR1A 3WZEA 5AP7A 2QKRA 1IA8A 4KIKA 3P79A 5CSHA 4BVUA 3A8XA 4DGNA 4EK6A 5IH4A 3OT8A 4MX9A 3H10A 2JIIA 2WTJA 5D41A 3V5WA 3M2WA 5A6NA 3ZLYA 4AN9A 4WSYA 3DNEA 2JKQA 4YBJA 4AZEA 4BYIA 2J0KA 5L2WA 3VHEA 4BCPA 1JKSA 1OL1A 1W83A 3MY1A 3ZEPA 4HZSA 3SDJA 2B9HA 2CGVA 3Q6WA 4DINA 2W1GA 3WIKA 2F7ZE 5E8TA 4FSNA 1REKA 4C38A 4HVIA 2C0TA 2YEXA 4M66A 2EVAA 3ORKA 4FV3A 4AUAA 2QO9A 3NDMA 4S34A 4CGAA 3RGFA 5CEKA 1Q8UA 3EWHA 5L8LA 4G5JA 4DH8A 2IZSA 4XP0A 3ZZWA 5IA1A 5IQHA 1S9JA 2JKMA 4F9AA 2C5OA 1LEWA 4B0GA 4JBQA 4RVMA 2J0MB 4R8QA 2R4BA 4BDIA 5AP3A 1PY5A 1W98A 4EYMA 2GNJA 4F99A 5L2IA 4EBVA 3QXPA 5FLFA 4FVQA 4D2WA 3W1FA 4I21A 2OBJA 3LCTA 4XS2A 4LOPA 4K8AA 2R3PA 2IPXA 2W17A 5EHOA 2ZV9A 5FD2A 2HELA 5EOLA 5D11A 4Z7HA 2I0EA 3QKKA 4FT9A 2PMOX 4KRCA 2PVMA 4D4YA 4DEEA 3LQ8A 3CY2A 4O81A 1XH4A 2OH0E 3WF5A 4HCUA 3D4QA 3L9LA 4MAOA 1GAGA 5HE3A 5J9YA 1U5QA 3OROA 1OECA 3BU5A 4UZDA 2C0OA 4FEWA 3IQ7A 4C57A 4EK4A 3TDVA 3UQGA 4USEA 1QPCA 3NW6A 4QPAA 3PYYA 2XYUA 1SVGA 3MY0A 1V0PA 2VUWA 4BCFA 4MWIA 5B7VA 4YZNA 3VBTA 3FLNC 3H3CA 2C6OA 5J9ZA 3TTIA 3MPTA 1QPDA 3WBLA 1XHAA 2RF9A 3SLSA 2WFYA 2CMWA 2Y9QA 2OI4X 4WRSA 4A4OA 2IG7A 3F2RA 4ANLA 3CSVA 4BYJA 4LGDA 3FC2A 4C36A 1RW8A 3P86A 2YAAA 3GBZA 2WIHA
chains in the Genus database with same CATH superfamily
4XG8A 4XX9A 2GPHA 3PXFA 2CKQA 4EK5A 5LCJA 3VHKA 4I1ZA 1Z5MA 5AV4A 2XK9A 3A61A 3R9NA 3QALE 2IO6A 2ITTA 3LVPA 5BPYA 1PJKA 3QQJA 4H3PA 4JDKA 4C4HA 2YN8A 4ZJVA 3S0OA 2WNTA 3R00A 2A2AA 3FAAA 3QUDA 4FV5A 2E9OA 2OH4A 4XCUA 2PE2A 3PJ8A 4FNZA 3ANRA 2FSOX 4UXLA 4AT4A 2C5YA 3VULA 3RPSA 2RFEA 3PVUA 2BMCA 3D15A 4IW0A 4QTEA 4PPAA 4B8MA 4G2FA 4TZRA 3LFAA 4C8BA 3HX4A 3RNIA 3AMAA 3GCVA 1Q8TA 4BFMA 5I9XA 4I6FA 1WAKA 4N70A 5ETIA 4O7SA 3AC4A 3H9RA 3QTQA 4KA3A 2VTRA 1Y8YA 5FRIA 4G9CA 4XV2A 5EG3A 3OWJA 1GJOA 5CEPA 2PWLA 4IZ7A 4V05A 3B2WA 4QQ5A 4O7TA 3RNYA 4ERKA 4IZAA 3FMHA 5IDNA 3CCNA 1SNXA 5H2UA 4FSRA 4DEIA 3E5AA 4FUYA 4MXAA 2YCFA 4B99A 1ZLTA 5LJJA 2AEGA 2QG7A 4V04A 4H36A 4ZTSA 3AD6A 3ULZA 4FKJA 4NSTA 2W5AA 3EHAA 3OS3A 4M14A 5C03A 2HIWA 2PVFA 2RKUA 4DE4A 3GC9A 4X6QC 5J8IA 4ZTQA 3QZFA 1G8SA 3TKIA 4F6UA 4RWLA 3GC0A 4Z16A 3JS2A 5EM6A 2R3JA 4WUAA 4K77A 4PPCA 1A48A 3Q2JA 2WMRA 4ZTMA 3FC1X 4KS7A 5D7AA 3VF9A 1XBAA 4K18A 4V01A 4ZEGA 3A99A 4ONAA 4FT7A 3DA6A 2J0LA 3COKA 3L8PA 4GFMA 2XM8A 5FXSA 4TW9A 1I44A 4M0ZA 5DRBA 3CE3A 3LM5A 4RWKA 3RJCA 2QOLA 5IQFA 3QLGA 3UDTA 4FNWA 4IB1A 3SVVA 2PVKA 1YHWA 4NTSA 1OIUA 4USDA 3V5LA 5IA2A 1UWJA 4EH5A 5I9ZA 4WG3A 1IAHA 2F7XE 1E1XA 1JWHA 2VTLA 4HNFA 3F2NA 4QP3A 5EW9A 3LQ3A 4O7LA 3TYKA 4CG8A 2XKCA 3KL8A 1URCA 5CVHA 5JZNA 4X3FB 1YRPA 3IW6A 3G90X 2CN5A 3NCZA 2BRMA 5JQ5A 1J7LA 2O65A 5HD7A 4FV1A 4PPBA 3FY2A 4C4JA 3ZSIA 1MUOA 2DQ7X 4H39A 1ST4A 4L3JA 2QR7A 4L44A 2UZUE 4E4XA 2C6LA 4AS0A 3PXRA 5CU2A 5EKOA 3QRTA 4J52A 2EXMA 3OWKA 2CLQA 3MFUA 3ZOSA 3UDSA 2QHMA 4GVAA 3TV7A 4A9UA 4I22A 4O82A 1Q61A 2QOHA 3FZ1A 4AG8A 3W8QA 4RX5A 3CIKA 5EDRA 3WYXA 2VTIA 2BAQA 4I93A 1OM1A 3GC8A 4EC8A 1ST0A 3EZRA 4FK6A 2IZTA 4GIIA 3SQQA 4KIPA 4RFZA 4CCUA 4BCOA 5FEQA 3QX2A 2VZ6A 3BWJA 5DE2A 3TN8A 1NVSA 4FE2A 4X2JA 2A0CX 3PJ1A 4DLJA 1G8JA 3OMVA 4FKQA 5DEWA 3FXZA 1HCKA 2A19B 3BV2A 3DY7A 3NIZA 4RJ8A 5E91A 2QO7A 3KREA 3NGAA 5EQEA 3OY1A 3ZUUA 3P7AA 5FEEA 2XCHA 3QD0A 3UODA 3WF6A 2BPMA 3OVVA 2CKOA 3LJ2A 3NYOA 5CI6A 2PE0A 1W82A 4NEUA 4ACDA 4U6RA 1H1QA 4WNOA 3Q9WA 4DGGA 4Z3VA 4FL2A 3ID6C 2QU6A 5FDPA 3OWLA 1H07A 4FTCA 1M2QA 5LCKA 3RI1A 2B7AA 3R8ZA 2VWIA 4ID7A 3RK5A 4UY9A 2PVNA 1LR4A 3VUKA 4O7WA 2Y8OA 5JSMA 4D4RA 5ETFA 5HEZA 5KMKA 5BYZA 1IG1A 4ANOA 2W1CA 3QKLA 2XKDA 1M7NA 5E8WA 5KMLA 4RSSA 4OTGA 1ZYCA 3FDNA 4C61A 3T3UA 4OR5A 4UMPA 2FSMX 4PNIA 1DAWA 2PZPA 4IANA 4O0YA 3EKNA 3R7OA 3NZ0A 3RKBA 4EK3A 4MCVA 4I5CA 2UW6A 3LFCA 4PY1A 3QHRA 1XH8A 4QPMA 2V62A 1KV1A 5AR8A 2QLUA 3BYMA 4NW6A 4DCEA 3R1SA 5LWMA 4PNKA 3WILA 4XG7A 5BUIA 3KA0A 4GCJA 1VYZA 4GUBA 5HE2A 4CFNA 5L6PA 1U54B 4NJDA 2QONA 4FTOA 3QYWA 5C8KA 2VRXA 2X6DA 4FSWA 3TEIA 3EB0A 3VIDA 2WMSA 3FL5A 5K4JA 5HIBA 3ML1A 5BVDA 2GFSA 2OG8A 2C47A 4RQKA 4F7JA 5C01A 5DG5A 5DI1A 1ZARA 2J0JA 4EBWA 4O22A 3LJ0A 4FIFA 5ETAA 4FKWA 3SV0A 3QQGA 1YXTA 1TQIA 3R73A 4L8MA 4U7ZA 3EZVA 1O6LA 5J95A 5C9CA 4F78A 2IW6A 1WVWA 4LOQA 2BHEA 4YTFA 3QD2B 5IF1A 2WTKB 4MBJA 4RX8A 4WKQA 4FK3A 4EOQA 5IPJA 3EQGA 4O4DA 3W2SA 1J91A 4FC0A 1JKKA 2PE1A 5JFWA 4FICA 2WTWA 5EFQA 4BKYA 4AXEA 4Y95A 3LZBA 1YI3A 2CHLA 1UKHA 5CWZA 2PU8A 3VONA 3KCKA 2HZIA 4QTBA 4BRXA 3KULB 3MFTA 2ZV2A 5KMOA 3DBCA 1PXLA 2EU9A 4FYNA 1SYKA 2JFMA 4XG6A 3F6XA 3VJOA 4CFVA 3A8WA 4D9TA 3ZMMA 3EYHA 5FXQA 2WKMA 3E87A 5FTQA 4OTFA 4TPTA 5AIKA 5JT2A 4DBNA 2I1MA 3HV4A 5BYYA 5GIPE 3NS9A 3EN5A 4UWYA 2NYAA 4IWOA 2REIA 1F3MC 3DFCB 5D7VA 3EQHA 3FZRA 4KSQA 3UZTA 2Z7QA 4XH6A 3WI6A 5I5ZA 3HEGA 3PIZA 1BI8A 4L00A 5KMMA 1PXNA 1ZMWA 4C3FA 4L67A 3COHA 4AXFA 1URWA 5CAOA 4FKPA 4BGQA 5KKRC 2HZ4A 1CTPE 3TL8A 4O0VA 3W32A 5ANOA 4F65A 1HCLA 5BX0A 2RFSA 2VTQA 2CSNA 2W1ZA 4K33A 2A1AB 4K6ZA 4I0RA 5HICA 1ERKA 3BHHA 3L8VA 3NX8A 5AAEA 4M69B 3BE2A 3U9NA 1J7IA 4GH2A 3QLFA 5CNOA 4O4EA 5AP2A 1JVPP 1T45A 2YFXA 3FI3A 3GU5A 3UBDA 2ZM4A 3B8RA 3ALOA 5AUXA 2O2UA 4E6DA 4U44A 4RWJA 3GFEA 4GU9A 5DVRA 5FM2A 5IUIA 1Q8ZA 3GGFA 2WQNA 3BI6A 1K2PA 4JT3A 4RC2A 2WMQA 5A3XA 4ALWA 5ACBC 4ACGA 5LMKA 4AGCA 2VWUA 3KN5A 4ZTHA 4AX8A 3PXZA 4Y5QA 4WRGA 3TZ8A 5KCVA 3QQLA 4XG3A 2VNWA 4HPTE 2FVDA 1PMVA 4AE9A 4CYJA 4FX3A 4L7FA 5BVOA 2VO6A 4IVDA 5J7BA 4YZ9A 5EHYA 4FKGA 4EI4A 3ZHPC 5CF8A 3G33A 3RP9A 4IJPA 4I20A 1GIIA 3EYGA 1P2AA 2VX1A 5TT7A 5AUTA 1KE6A 3F88A 2UZLA 1FGKA 3DK3A 4IH8A 4BTJA 5L8KA 2OZAA 4DCAA 3SHEA 2B4SB 4BI0A 1OBGA 4W4VA 1OL6A 2ACXA 4AAAA 3T3VA 3A60A 3DBFA 3K3IA 3MY5A 2FO0A 3G6HA 3R9HA 3NVMB 2XRWA 3CGFA 4O27B 3TXOA 3R2YA 4I5HA 4BDEA 5LVPA 1PXJA 4HOKA 2GHMA 3UGCA 2P2HA 4EH4A 4YO4A 4IHPA 4EJNA 2B52A 4JQEA 2XIZA 3VS7A 2O0UA 4KIOA 2X6EA 4AA4A 4CFWA 3TNIA 4M15A 2PVHA 2GNHA 2R3IA 3CQWA 3D9VA 2VX0A 3KU2A 4PTEA 5FEDA 5AP1A 2PTKA 2IN6A 2WTDA 4XMOA 4EZ5A 2IVTA 4XUFA 1GIHA 3I4BA 4Y72A 4ZSAA 2CLXA 2O3PA 1Q3WA 3RPRA 2ZM1A 4EH2A 4PMMA 1WBTA 1R78A 2UZDA 1WZYA 2W5BA 3GXLA 2OXDA 3E7VA 4ZTRA 3UP7A 4O21A 3LOKA 4AOTA 3ATTA 5CQWA 3LXKA 5DA3A 3ZEWA 2UZWE 4USFA 4R7BA 4ZMFA 5ACKA 2YIQA 2OSCA 4JBVA 3RK7A 5CANA 1PXOA 4FG8A 2X7OA 4IXPA 4IC7A 2YCRA 3RBWA 5HOAA 3WARA 4ACCA 4DN5A 3MVJA 4B6LA 5CU0A 5LVMA 2ITOA 2OJ9A 3CP9A 4IAIA 4QMOA 5AP5A 2C1AA 5BVWA 4CCBA 2PPQA 2WZJA 4U42A 4RC4A 3OXZA 3OFMA 4LUDA 4RRVA 4MVFA 4TWOA 3T9IA 5EM7A 2AQXA 5DT4A 5AV1A 3EQRA 2R3NA 1UKIA 4O96A 2XH5A 4MWHA 3R8MA 4AXAA 3H9OA 2F9GA 3NNVA 4P4CA 4BTKA 4CYIA 2XB7A 3PA5A 1BMKA 3BYVA 1UNHA 3REPA 3FQSA 4L01A 1H1PA 3KKVA 3DBDA 4OTQA 3NFFB 5M51A 3FQEA 3TT0A 3PPZA 2C69A 5C26A 2JBOA 4X2NA 1KUTA 4XEYA 3QCYA 5HU9A 3HA8A 3W0RA 5AJQA 3D7TA 5K3YA 4ZY6A 4JDJA 5CZIA 1TZDA 3KRLA 4BWKA 1E1VA 5J5SA 2W9FB 4RIYB 4IB5A 2C4GA 1H1RA 1OUYA 2ZAZA 4G3FA 3I1AA 5IMXA 2W05A 2E9UA 3KVXA 4WG4A 4L7SA 5E1SA 1JBPE 1PYEA 3DTWA 5KUPA 3R7GA 5CVFA 3R8VA 3BL7A 1X8BA 3WE8A 5TE0A 4O7VA 2HZ0A 2WD1A 4I0SA 3HLLA 4BBFA 4F9YA 4IB0A 4LUEA 5DR6A 2JAMA 4YZBA 4DH1A 4JMQA 1H4LA 3IW4A 2Z7SA 4X6RA 2YERA 3C9WA 3HUBA 4BJJB 4E5BA 5CSXA 2JDOA 2VO7A 5DNRA 1M7QA 4V0GA 4EEVA 4U8ZA 4V0GB 5IG1A 4YJVA 4YZMA 1H27A 4EQMA 4Y5HA 3DV3A 3EFJA 3NW7A 5FWKK 3MJ2A 5LMKC 5I9VA 2OLCA 1NA7A 3QRJA 3QA0A 4LV5A 3MYGA 4W9WA 3UC3A 3UZRA 3DJ7A 4D2VA 5CEQA 2YDIA 5CSVA 5AP6A 4PP7A 2PULA 3BL9A 5E8XA 4JRVA 1FOTA 5LVOA 4FIGA 4FTIA 1JOWB 2YA9A 2HOGA 4GG5A 3R7IA 3CXWA 4O1PA 4AW2A 4BDGA 4F0IA 4D1ZA 2GTNA 2UZTA 4U45A 1MP8A 5CY3A 5HGIA 5BVKA 5IA4A 3TKHA 4IX4A 4PTGA 3ZC6A 4RG0A 4C59A 4FGRA 4CRSA 3MA3A 3OTUA 1OMWA 1SMHA 2X8DA 2NNWB 3IGGA 5CT7A 5EYCA 2WPAA 5AX3A 5IU2A 3MDYA 1GY3A 3NUPA 4EOMA 4AQCA 5L2SA 2WHBA 3R8UA 4DC2A 3TCPA 3R7YA 5M4UA 4QP7A 4FL3A 3FLYA 1J7UA 5AR3A 5KHXA 4RVKA 3OTVA 4QMZA 1RQQA 2BZJA 4FZDB 4IEBA 1VJYA 4ZLYA 3JR1A 2KTYA 2J51A 5CVGA 4AWIA 4KKGA 1BI7A 2OW3A 3HV3A 1Z57A 4FTTA 1PXPA 2HCKA 4UMTA 1ZAOA 4GW8A 1Y8GA 2C0IA 3O7LB 3PPJA 4QYYA 4WNKA 3R83A 3QL8A 2RFNA 3RMFA 3MB6A 3QTIA 2P3GX 3ZLXA 4O7YA 2BTSA 5KMNA 4FEUA 3FL4A 4A7CA 2C6TA 2BZHB 2ETMA 4XV9A 2YM3A 3EH9A 5D10A 3WOWA 4BN1A 4EH9A 1IRKA 2WQEA 4GT3A 3HDMA 5CZHA 1R39A 4ACHA 3CJGA 4IVAA 4K9YA 3D5XA 3QZHA 4IFCA 3TJCA 3RHKA 4JX3A 3GENA 1YKRA 5HCYA 3CEKA 5I3OA 4CKJA 3SC1A 5CENA 4YC3A 2WQBA 4BKZA 2J2IB 5J79A 5HG9A 2PVYA 4QP1A 2X81A 2Z60A 2F57A 3VO3A 1L8TA 3D2KA 2LAVA 3E3BX 4ZY4A 2JC6A 4L68A 4S31A 4DTKA 5CEOA 4CLJA 4AP7A 1MQ4A 4CZTA 3QCQA 3NUYA 4IAFA 5FBOA 1RE8A 4ZAUA 3RAKA 3G0EA 5EOBA 3BYOA 3F5GA 3UYTA 1SNUA 3NSZA 3VUHA 3CD8A 4HGSA 3AC5A 1VEBA 4U41A 1P4OA 4JDIA 4WUNA 3V5PA 4S2ZA 4BCQA 3I7CA 1KOBA 2VD5A 3Q5ZA 4FTQA 4TYHB 3A2CA 3OCGA 3COIA 1QPEA 3NR9A 4ERWA 3QWJA 4EUTA 4FSTA 1LP4A 2YWPA 3PJ2A 5L3AA 2FSLX 3QQKA 2J0IA 2PZ5A 3E62A 3UNJA 5IH5A 2R3KA 5DGZA 4OUCA 4BCJA 4DFYA 4CG9A 2R3OA 4M69A 4YJRA 4U0IA 2UZBA 3BHYA 2P0CA 3AD5A 3C4CA 4C4FA 3R0TA 4IDTA 5A4TA 3UOJA 5DOSA 2GNFA 4KBCA 2UZOA 2HW7A 4GG7A 3EIDA 3BBWA 3VBQA 4IB3A 5T6KA 1EH4A 4EH7A 5M06A 3BGQA 3O17A 3VQHA 3ZO3A 3W16A 2XZSA 1WCCA 1BKXA 1OVEA 3I7BA 4HGLA 4RVTA 5DN3A 5AA8A 3GQIA 5BNJA 3QC9A 4HYSA 3ULIA 3KB7A 1TVOA 3ZBXA 3ORLA 5HX6A 3CPCA 4BTFA 2BDFA 3EQPA 3U6HA 3BRBA 3LFBA 4R7IA 4QDEA 3TIZA 5LMAA 4JLCA 4DEDA 2OJGA 4ACMA 5FP6A 5GINE 3E8CA 5EK7A 3R1QA 4FL1A 2VTTA 3CY3A 4YTCA 4G6NA 3RM7A 1UU9A 5AV2A 3SOCA 5F9EA 4HVDA 2IEWA 4OBOA 5DR9A 2BDJA 5DBXA 3TNWA 4EONA 3G15A 3NUUA 4PTCA 4GKHA 1H24A 4BCGA 4ITHA 1Q24A 2XS0A 4DGMA 5EI6A 2W96B 4WNMA 4QO9A 1U59A 4J1RA 2PY3A 3TZ7A 4R3CA 1FBNA 3UPXA 2JIVA 3PJCA 3U8WA 4MK0A 5HG5A 3N51A 4L53A 2R7BA 4E5WA 2XEZA 4LI5A 2JKKA 2X0OA 3W2OA 3IW8A 5DRDA 3GUBA 1W2FA 3AMBA 4LL0A 4PRJA 4CKIA 1XMLA 4PV0A 1GZOA 2YACA 4DHIB 3VRZA 1BLXA 4E6AA 3W0SA 5M09A 4PL4A 4QTCA 4J98A 1HOWA 1PMUA 1W2CA 3OUKA 5HI2A 3N4UA 1Q99A 2UW0A 5DR2A 5DT0A 2C3JA 4CMTA 4BWPA 2B9IA 4C35A 2I0YA 4ZZMA 2B0QA 4BTMA 4AACA 2RSVA 4KINA 3O8PA 4QQJA 2AC5A 3QCSA 3W55A 3IDPA 3QRIA 1W8CA 3ROYA 1IASA 2CPKE 2VWBA 4YHFA 3R04A 5KE0A 4MD8E 3S95A 2PUUA 4PL5A 4O1OA 4GK3A 4CV8A 3G0FA 3IS5A 4R6VA 2J5FA 3PJ3A 4Y73A 3FLSA 2WTVA 4XYFA 3CR0A 4E4LA 5I4NA 1WBVA 3PZEA 3EQFA 4GJ2A 3WZDA 1PKDA 3PRIA 4XV3A 4R3PA 5CQUA 4Q9ZA 3DAKA 2W9ZB 4U3ZA 5TOZA 3OD6X 4ZSEA 4J99A 1GZKA 4ZJIA 1NT2A 3P9JA 1ZYJA 4YJSA 5LMBA 4DFZE 2X7GA 3EFLA 4YO6A 4AXCA 2PZYA 4ZMEA 4CQGA 4DA5A 3ODZX 2R9SA 2XM9A 2XKFA 3DZQA 5KZ0A 4G3GA 1RDQE 1CKIA 3MPMA 2PMLX 5EYKA 4HYHA 5HZNA 4FJVA 3SGCA 2SRCA 3MTFA 3CTJA 2OFUA 4IMYA 4U43A 4EHVA 3L8SA 5J5TA 4YC8A 4YJQA 3PP1A 5B2LA 4GL9A 4KNBA 2PUPA 3D94A 4D2TA 3MI9A 1MRUA 3LFDA 4I92A 2HY81 3KF7A 1OPJA 3AD4A 1OIYA 2C3LA 1YW2A 1KV2A 2JDTA 2JLDA 3D14A 3SXFA 1Q97A 3TNQB 4BF2A 1DAYA 3P1AA 3C0GA 3IONA 4C34A 3BGPA 4Z9LA 4UBAA 3P0MA 3VUGA 2HY0A 3HNGA 4K2RA 4XLVA 4EOKA 1JAMA 1V0OA 2Y6MA 4TT7A 3UP2A 1JSUA 2ZDUA 5KMIA 1U5RA 3HMNA 4FKSA 5CU3A 3GC7A 2C3IB 4I94A 4LRMA 4HCTA 3HP5A 1A9UA 2GS2A 4ITIA 4E7WA 3PSCA 4CMUA 3F66A 4IM0A 1TKIA 3OOMA 5CTPA 4CT1A 3MFRA 4QEBA 1H0VA 5CXHA 3HZTA 2X2MA 5IDPA 1F0QA 5CYIA 2PZRA 3IDCA 5GHVA 4AFJA 5A14A 2XBAA 3LIJA 4XNEA 4GT5A 5HBHA 3UZPA 4FEVA 4MQ2A 2I40A 4C58A 4UZHA 2X39A 2BRBA 3K5VA 4QMMA 3AC3A 4R7HA 1ZMUA 3QXOA 4BBMA 4G6OA 3C1XA 4TYJA 2C5NA 5E7RA 5CS6A 3UJGA 5GZ8A 3LLAA 4W8DA 2W1FA 2JAVA 1XH5A 4M97A 3UOLA 4D2PA 4JRNA 4HYUA 2YHVA 2Y4IC 3P23A 2OIQA 2UW8A 2QOQA 4IWPA 5E92A 3V5TA 5CI7A 5F95A 4BDDA 1H25A 4W4WA 4F64A 3U9CA 2PUIA 1UNLA 4O0WA 3R1NA 5KHWA 4OAVB 2HW6A 4NL0A 2YCQA 4QP6A 3MVLA 3W2QA 1VYWA 3LM0A 1FVTA 4YZCA 3Q3BA 5HE0A 2ZJWA 4YR8A 2XK3A 3MS9A 2I0HA 3BHTA 3UG2A 1SM2A 4ENYA 4ZLOA 3HAVA 4FA2A 4FVRA 4E6QA 4MXYA 4OTDA 4Y83A 4NYEA 1ZRZA 3OXIA 1WBNA 4ZTLA 3QZIA 1P4FA 2V22A 3OOGA 4PL3A 4FKOA 2Z2WA 2H34A 2WAJA 5B2MA 4RIXA 4XRJA 2ZB0A 4O4BB 3Q4CA 4JQ7A 5H8EA 1H26A 3VNTA 1KSWA 2XNGA 3HDNA 2W1HA 2UZNA 3FSFA 2R2PA 3KF4A 2BALA 4RX7A 3WF8A 3HRBA 3WYYA 3OHTA 3PPKA 4PDPA 5E90A 4RJ4A 3A4OX 4QMVA 3ZO2A 5C8NA 1XMMA 3E88A 4P90A 4TRLA 2B54A 4D1SA 4RIOA 1U54A 3SRVA 1KE5A 3F3UA 4G1WA 5LQFA 5AEPA 2EB3A 2GHGA 3QQFA 4G9RA 3VC4A 3BHVA 5IQEA 5HCZA 3ENHA 4HVSA 2IZUA 2WB8A 2W99B 3DT1A 4U79A 3D5WA 3GP0A 2H8HA 3ZTXA 3E8EA 4L45A 2X8IA 4FT5A 4JIAA 4MKCA 4QYEA 5D9HA 1ATPE 4IAZA 4WNPA 4DG3E 5A9UA 2XUUA 4FKUA 4F4PA 3GQLA 3QWKA 2F49A 3Q53A 1W84A 3UNKA 3AKJA 3TDWA 3UIUA 1JNKA 3A7HA 2V0DA 2J7TA 4TWPA 3MSSA 5BYLA 3ZLWA 3HKOA 2IW9A 3V51A 2YAKA 2UUEA 1GZ8A 3UTOA 4C4GA 4C3RA 5JGDA 1V0BA 3KVWA 4UYNA 3F7ZA 4FIIA 5I0BA 4QT1A 4D58A 3O8TA 5JMSA 4AA0A 1OGYA 5CXZA 3LFNA 3A7GA 3I0QA 2I0VA 2B9JA 5FQDC 2BVAA 4QYFA 1YVJA 5HG7A 3Q9YA 4FEQA 4I23A 4X7QA 5D1JA 5EM5A 4ANNA 1NW1A 4HJOA 2PSQA 2QOKA 2XBJA 4OBQA 2YABA 5DIAA 3JY9A 3ZZEA 1PRYA 3QGYA 4IJ9A 4F6SA 2XNNA 3NEWA 4D5KA 1OL5A 4EL9A 2W4KA 3NNXA 2GQSA 4PUZA 5LWNA 4L52A 3KN6A 2IF8A 2ONLC 3FSKA 4GS6A 4GRBA 4KBKA 4NM7A 1OKZA 3LMHA 3RALA 3R28A 4JX7A 4MD9E 4EKLA 2B55A 5HBEA 2X4ZA 4YHJA 4RIXB 3DXQA 4NM5A 3M42A 3UO4A 2XKEA 2DS1A 2BFXA 3DDPA 4EH3A 3KMWA 4X0MA 5EYDA 2X0PA 3FMJA 4JI9A 2IW8A 4DFUA 3G9NA 3AQVA 4LL5A 4AZWA 4JOAA 2BZIB 3KRRA 1YHVA 3TUCA 1ZOGA 4XOZA 1Q4LA 2XF0A 3Q2MA 4FKTA 2WTKC 4I5PA 3EOCA 1DI8A 1MRVA 2CJMA 4HZRA 3GEQA 4RIWA 1FINA 4X21A 5DWRA 5HKMA 2QHNA 3O96A 4U81A 1BL7A 3ZBFA 4BDJA 4J96A 4K0YA 3FBVA 3FXWA 2XNMA 2G9XA 4X2GA 4CD0A 5K9IA 1UU3A 4BIDA 2XA4A 5GNKA 3V01A 4H1JA 3TM0A 1PHKA 3MH0A 4AGUA 3A4PA 4NCTC 2OZOA 3RPYA 3UPZA 5J9LA 3QD4A 1P14A 2WU6A 2Q0BA 2OJIA 2A4LA 3EQCA 4RPVA 3V8TA 4BIEA 3PG1A 4BZNA 4F6WA 3G9LX 3S3IA 2X0GA 3ZU7A 4RJ6A 5AP0A 4BGHA 4CSVA 4JG8A 5H8GA 4D1XA 3MB7A 4QOXA 4X3FA 2DWBA 1XO2B 4TYEA 4FT3A 5AUZA 5M55A 4CLIA 3ZSGA 3MH1A 3CKWA 4JDHA 2ONLA 3SD0A 3HMIA 1LUFA 1WBOA 4DT9A 3ETAA 2ZFYA 3BE9A 3C5UA 3MFSA 3ZDIA 3QX4A 5JK3A 3R01A 5EQYA 3DZOA 1NXKA 2QOBA 5DHJA 4QTDA 3R22A 5IQCA 3R7UA 5CF6A 4DH7A 4IC8A 1GZNA 5B0XA 3W0NA 4E6CA 3MBLA 3LE6A 4AZVA 3I5NA 3BHUA 3ORNA 3PIYA 2HXQA 4FTAA 2ZMDA 4QP9A 4EC9A 3VUDA 3W0OA 3RPVA 4FV8A 3NNWA 4KIQA 2JKOA 3CPBA 4IFGA 3ZFYA 3ZM4A 3MJ1A 4C2VA 1BYGA 4CQEA 4GSBA 4B8LA 2CKEA 3D2IA 5T3QA 3C4EA 2FUMA 3BLRA 5M08A 2RFDA 5HESA 4K1BA 3NUXA 2AYPA 2NRYA 4ASEA 4F0FA 2YZLA 4F0GA 1XWSA 3BU3A 4G3EA 5K0XA 4R77A 3PSBA 2JFLA 4RIWB 5CALA 3LW0A 4IDVA 3UG1A 4BGGA 3DK7A 4EHEA 1FGIA 4BJJA 2CN8A 4BDKA 3ITZA 4NJ3A 2GHLA 3D0EA 3PIXA 1YDRE 1STCE 4YLJA 3DQXA 5HORA 2UW4A 3VW6A 4AZSA 5CAUA 1FQ1B 2C6MA 2ITQA 4LG4A 2ZYBA 1TQMA 2XJ0A 5FGKA 3PFQA 3GU8A 2OO8X 3CD3A 1UU7A 5IQDA 1YI6A 2ZVAA 4N4SA 5KO1A 1PXKA 4KABA 4IAYA 4YHTA 1VZOA 2XCKA 5ANGA 3W8LA 1Q8WA 2ZM3A 2VTAA 4WT6A 4HGEA 3IOPA 2XNEA 4G34A 4PP9A 1OBDA 2CGUA 1Y57A 1W0XC 3KXZA 5CAQA 4GT4A 3WZKA 2V7AA 2VTJA 2YM7A 4F09A 2JEDA 2R5TA 3K5UA 4JG6A 4L42A 4U97A 5L6WL 4BCHA 3F61A 3G5DA 4HVGA 4QRCA 4ZOGA 5EI2A 2W4JA 2YLEA 2IZRA 4Q9SA 3D7ZA 5IQAA 3GCQA 4NM0A 5AUYA 3E7OA 1WMKA 3AC8A 3MVHA 4DFXE 5EM8A 4ASZA 2BRGA 4A9YA 4LMNA 1FMOE 1Q5KA 3R8PA 1XJDA 2BAJA 1GOLA 3AT2A 3VS6A 1YI4A 4FV2A 4RA4A 3JVSA 3R9OA 3UO5A 2VX3A 3BKBA 3FWQA 4FR4A 2EXEA 3P7CA 3UOKA 2YZAA 4YZDA 4ZJJA 2NRUA 5IA0A 3FE3A 4AW1A 3HYHA 4MUQA 4NH1A 3VS3A 4TL0A 5CSPA 4NW5A 4NZWB 4B7TA 5KMJA 2Q83A 3MH3A