3GC8A

The structure of p38beta c162s in complex with a dihydroquinazolinone
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
347
structure length
347
Chain Sequence
GPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDSELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 11
publication title The three-dimensional structure of MAP kinase p38beta: different features of the ATP-binding site in p38beta compared with p38alpha.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3gc8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3gc8A01
4FV2A 4EH2A 3KGAA 4R5SA 4RX8A 3ITZA 3PVUA 3E8CA 1XBCA 1OECA 4GT5A 5EYDA 1H8FA 1H0VA 1OIQA 5J7BA 1MP8A 3NPCA 3HAVA 4RJ5A 3ORNA 4FTMA 2ETMA 3FLSA 3F7WA 4W9XA 1YWVA 4LQMA 3VBTA 4QMSA 3VS2A 1PXOA 2HIWA 1KE8A 3AC4A 3FKNA 2PUUA 4X2NA 4ZXTA 3FXZA 4FK3A 4CRSA 3LLTA 4XLIA 4RLLA 1DAYA 2EB3A 2OIBA 2QR7A 4U41A 3F82A 2RFEA 4I24A 3R9NA 4MD9E 5DI1A 5M57A 3TI1A 5GZ9A 3GU7A 5FXQA 3SA0A 3QTIA 4UXLA 4ITIA 3ALNA 3PPZA 2RG6A 2BKZA 2WZJA 4I0RA 3R73A 4LRKA 4QP2A 1R0PA 3CPCA 4MNEA 4EWQA 3MTFA 2UUEA 4PF4A 4XH6A 3WOWA 5KMLA 4B8MA 3R9OA 2Y0AA 3LZBA 4DH1A 3QKMA 5IDNA 4ASEA 2BTRA 3HMOA 5HVJA 2I0EA 3RAWA 4KSPA 4BCQA 2X4ZA 5A9UA 2UVZA 4O7YA 4E3CA 3I1AA 4RIWB 2IZUA 2EXEA 3CQEA 4L7FA 2ITYA 3C4FA 3ETAA 3T8OA 4E1ZA 5IQDA 2BUJA 4HCUA 2BRNA 3C50A 4I93A 4MAOA 4CNHA 3F69A 4LOPA 5EHYA 3R7IA 4I6FA 4IZAA 5IA5A 4PV0A 3UMWA 4I0SA 1YI3A 3JY9A 4BBFA 4CT1A 3MY0A 2X4FA 4QTCA 1WZYA 3ZFMA 3KK9A 5A4TA 4W4VA 5C4KA 3QCQA 2XJ2A 3EYHA 4DITA 2OF4A 2JDOA 4QNYA 2QONA 5FBNC 4JI9A 4IX4A 3QUDA 3BLQA 3ACKA 2FYSA 2XM8A 1NVSA 3VBWA 4F7JA 4F64A 2OW3A 4BCPA 4IAYA 4E7WA 3BYOA 4QP4A 4IVDA 5E1SA 2YITA 1PMUA 4V01A 4C38A 4RBLA 5H3QA 5JRQA 5AV0A 4D2RA 1QL6A 5CVHA 2ZB0A 2RL5A 4X2GA 4BCMA 2G1TA 4IIRA 4RX5A 5BVNA 3DXPA 3GVUA 2JC6A 3CKXA 2PSQA 4AQCA 1WMKA 1SVEA 2PVJA 3GCQA 3HUBA 2PZ5A 5AV3A 4GS6A 2QG5A 5HE1A 3UVQA 2F49A 1OIYA 3JUHA 3S2PA 3KXZA 3KXHA 3TV6A 5F1ZA 2YWVA 2I0HA 2YCFA 2QU6A 5CT0A 2QOLA 3IKAA 2R0IA 4FT3A 2R64A 4NM3A 3FQHA 4BF2A 5I9UA 3KRRA 2BRGA 4B99A 3LW0A 3NYOA 3OXTA 2QKRA 1R0EA 2V62A 3TNWA 1Z5MA 1ZOHA 2R3FA 3KEXA 5AR2A 5A4LA 1Q8YA 4PNIA 5HTCA 3W55A 4J53A 5D7AA 2PVKA 3LFAA 3ZBXA 3I5NA 4ZTNA 2WMBA 5JK3A 5LOHA 5AUZA 4Q5EA 2GQRA 5FDPA 5J8IA 4O2ZA 3BGQA 2QG7A 2HAKA 4FL1A 1GAGA 2GTNA 3F6XA 3NZ0A 5E8XA 3HMPA 3UP7A 5FUTA 4YZBA 5CWZA 4DN5A 3P23A 2ZV7A 3QBNA 2C5VA 4FICA 3VW6A 3PWDA 4JRVA 4EYMA 5CXZA 3DK6A 4O6EA 1YHWA 4LRJA 5I3RA 5JGBA 2QCSA 4FOBA 4LMUA 3W2PA 2A0CX 3DAJA 4BCFA 2VWIA 1H1PA 3CTQA 3KULB 4CQEA 3NR9A 1OBGA 3PY0A 4FE2A 4MBLA 3CY2A 2UVYA 5IMXA 5JFWA 4S31A 4FKJA 4MXYA 1SMHA 3NUNA 4RX7A 2IVUA 2DWBA 4H3PA 4GFMA 4CV8A 3HV6A 4PP9A 2X39A 3V8SA 2XNOA 2W17A 2YM3A 4OTDA 4QP8A 4ERKA 5KUPA 4ID7A 3QYWA 5CU0A 4U43A 4PL5A 4EHZA 1SZMA 1O6LA 3OD6X 3OTVA 3UNZA 4L9IA 4UZDA 4CZYB 3DLZA 3R8VA 3TCPA 4YGAA 1YWRA 4CLIA 4DBNA 2BIYA 2YM4A 3SQQA 4TNDA 1VYWA 3NLBA 3QX2A 5JMSA 3FY0A 5DHJA 3HP2A 3PY3A 2Z7RA 3TJCA 4MNFA 3DQWA 4FTKA 3UOHA 4NFMA 3P1AA 3PSBA 4W4WA 2B7AA 3VUHA 4C37A 4WG4A 3P9JA 2FGIA 2G2FA 5HE2A 4JQEA 2JDSA 3OMVA 4NU1A 2Z7SA 3NCZA 3KMUA 3PJ3A 4GKHA 5CXHA 2W4KA 3TNIA 3MW1A 4CFNA 3Q9ZA 3FMKA 4H39A 5HO7A 4FA2A 3OROA 4FL3A 4GKIA 4S33A 4OTHA 4RJ8A 3QQHA 5BYYA 4P5ZA 4QYEA 3R7OA 3CGOA 2WTWA 2JDVA 2W4JA 2YFXA 3BV2A 4AN2A 5EW8A 4XG3A 3U6HA 1CKIA 4OAVB 2XIZA 4JT3A 5AUTA 4PRJA 3VBQA 4XG4A 1Y6BA 5GHVA 4GVAA 5I9XA 4A9YA 3R6XA 4RVMA 1W83A 3RNYA 3VQHA 4ZLOA 2ZMCA 4GSBA 5CAOA 4F99A 2B9IA 4CEGA 2O5KA 1K3AA 2ITWA 3RVGA 3SDJA 5IA2A 5I5ZA 2XRWA 2ITTA 5FEQA 2CPKE 1YXSA 5AMNA 1FQ1B 4FKWA 4FMQA 4Y95A 3MB7A 3ZMMA 5DG5A 5LJJA 4FV8A 5CALA 2XKCA 3DLSA 3FHRA 3VHEA 3VJOA 3E8NA 4IFCA 3W2QA 4EORA 1BI7A 2VO7A 1OL6A 4U81A 3SOAA 5IA0A 5KNJA 1A48A 4O81A 2ZDUA 4RLKA 4DEIA 2BZKB 3A99A 5IZFA 2VV9A 1NVQA 1OUYA 3NYXA 1CM8A 2ETRA 2ITVA 3VUKA 5BVEA 4UALA 5IUIA 2Q0BA 5HNIX 4FC0A 3FXWA 3GNIB 5KZIA 5AV1A 3PXYA 2BMCA 4MWHA 4XBRA 4DC2A 5C8NA 4ACCA 5ICPA 3QD4A 4OLIA 2JEDA 3LM5A 5CSXA 5CU6A 5CZHA 4IVAA 3W18A 5AA8A 4O83A 3OWKA 5M4CA 3HA6A 4ANSA 3W2CA 3O96A 3ZLSA 3D5VA 3QU0A 4FODA 3AD4A 4TWPA 2F2UA 4U97A 2R2PA 3ZRLA 3V6SA 2XCKA 4IBMA 4ZLZA 2UZDA 4ZK5A 4BBMA 2XP2A 1BL7A 2HZ4A 1R78A 5I4NA 2CKPA 2VTAA 2XH5A 4NKAA 3MFUA 4V0GA 4FNXA 5E1EA 5L8JA 3UG2A 3G2FA 4N4SA 3ZRKA 1BYGA 2IVSA 3D5XA 4E4XA 1KV1A 4L68A 4E6QA 3LMGA 5B2MA 4FYNA 4WIHA 1SVHA 2VTIA 4U5JA 3WE8A 4F7LA 1GNGA 4NEUA 2CLQA 1ZY5A 3NNVA 3TV4A 2BAKA 4R8QA 3ZEWA 1FPUA 4G3CA 5D12A 4FK6A 4EK6A 3CQUA 4K11A 2B9JA 4I20A 3LXPA 1PMVA 4L42A 2ERZE 2EXCX 3M42A 4AF3A 2IZTA 2YN8A 2X7FA 3NNXA 2QO9A 3WE4A 3LLAA 5FWKK 3IW7A 3R83A 5CAVA 3RZFA 4AE9A 4N57A 5IQCA 4XG8A 2C5YA 2WTCA 1REJA 3FMMA 3QTQA 1PKDA 4XRJA 3T3VA 2GSFA 2P2HA 2R3HA 2R5TA 5C03A 3U8WA 5ETIA 4KBKA 2GNFA 2JITA 3R04A 4NCTA 4XP0A 4RRVA 3KN6A 2CLXA 1XH8A 3KN5A 4K33A 4JRNA 1OKWA 5H2UA 3BELA 3JYAA 3QAME 4ZSLA 3DXNA 3QKKA 3MN3A 4OBOA 1JLUE 3HYHA 3I81A 3ZZWA 2G01A 2JIIA 3E3BX 1GZNA 4BWKA 5L2SA 5HCYA 4G6NA 4WOVA 3DPKA 2B52A 3TZMA 5FBOA 5KCVA 2XNNA 2PUPA 2P2IA 3ZBFA 2VWZA 3TN8A 1RDQE 1J1CA 4ACMA 3COHA 5FDXA 3FQSA 1BL6A 3R8ZA 4ZS4A 4IX3A 4C33A 1YKRA 1NY3A 4MTAA 4U3YA 4F6SA 3VNTA 1Q5KA 3KB7A 3Q96A 4MXXA 1FMKA 2XJ1A 1ZYDA 3OC1A 4Y83A 4WUAA 5AP4A 3RJCA 4C62A 4CTCA 2CN8A 2HYYA 5IMEA 4AN3A 2H9VA 3KXXA 3QRTA 4WNOA 2XS0A 3TNPC 3QWJA 3RK5A 3ZC5A 4Z7HA 5EYKA 2QC6A 3QTUA 4BVUA 3NUUA 2CHLA 3LM0A 5HESA 2RF9A 4JLCA 4KKEA 4QQTA 3BWFA 3QWKA 4FTJA 5E91A 4RQVA 4CMTA 3UZTA 3Q60A 3ZSHA 5EKNA 5H9BA 5HD7A 5A54A 1JPAA 1Z57A 1W84A 5E8ZA 4WUNA 3WF6A 4C4IA 3EN5A 2J2IB 3HUCA 2WTJA 3MYGA 4EC9A 4OTGA 1U54A 3R1SA 4EOMA 3DBEA 1QPDA 4R3PA 4QMMA 5ACKA 5T3QA 3TM0A 3LE6A 2W1GA 3C7QA 1E1VA 1GZ8A 4JG6A 1H08A 1KV2A 1ZXEA 2H34A 2VNWA 3DAEA 4L45A 2IG7A 1EH4A 3D94A 4E20A 3LVPA 4OTPA 4QMXA 3CGFA 2WTKC 3MFSA 3Q3BA 4YJVA 5CI7A 4QTEA 2RIOA 3PSCA 2R3PA 4EQMA 3PLSA 2CKEA 3CCNA 4RJ6A 4GYGA 4EOKA 2PHKA 4RFMA 4HVHA 5AUWA 3E8EA 3R8PA 2HZNA 4FKPA 3T9IA 2GNHA 3O71A 3QHWA 3NRMA 4CKIA 4F4PA 1FVVA 2PVNA 3ANQA 3EHAA 4NK9A 3HV3A 1Y91A 4D0WA 4D5KA 3VJNA 4M66A 4OTFA 3C4ZA 3ET7A 4K9YA 1UNLA 4CMOA 1ZOGA 5ANJA 2R3OA 4A7CA 5HICA 1J3HA 4RC4A 3ZFYA 5TF9A 3FYKX 3T9TA 3G5DA 4AZFA 2QNJA 2O63A 3EYGA 3U9NA 2F4JA 4X2KA 4BHNA 4ORKA 4L8MA 3A7JA 3L9MA 3GOKA 3TWJA 4HPTE 1T46A 2W7XA 3FUPA 4KKGA 4FV4A 4ZTQA 4BDEA 4GK3A 3UIBA 5FLFA 4DGMA 2V22A 4OBPA 2ZV9A 3FZ1A 2YM7A 4QMYA 4E5BA 5AAGA 3GU5A 3MA6A 4FG9A 5CAQA 2A27A 2IW6A 4O22A 1UVRA 3MH0A 5C8MA 4D2PA 3K2LA 4WNKA 4QYHA 4FSUA 4O2PA 5HG5A 2PZPA 3CKWA 3A8WA 2GS7A 5FP5A 5I9WA 4I23A 5K5NA 2GTMA 2UZLA 4ALWA 4M0ZA 4BIEA 2UZEA 2V0DA 4X2FA 2OBJA 4FZFB 4PTGA 4WNPA 2Y6OA 4W4XA 3MPMA 4AA4A 4HYUA 4M13A 4D55A 4G3EA 4W8DA 3KF7A 1OL2A 1TKIA 3N9XA 4JS8A 4ZIMA 3V01A 4JBPA 4EKKA 1UA2A 4X3FA 3RWPA 2QOHA 1U59A 3S00A 2FSMX 5AP0A 3ORLA 5DH3A 3SRVB 3OP5A 4F1OA 3LQ5A 3H0ZA 4FNZA 3GCPA 2B54A 4QRCA 2GNLA 4MQ2A 5LARA 4AGUA 3L8SA 4YZDA 5AP6A 5L8LA 5AAFA 1MQ4A 5L6WL 1L3RE 2V7OA 1WAKA 4NFNA 2PE0A 5HHWA 3H9FA 4W8EA 3VRZA 3IDPA 4RZVA 4F9WA 3FLQA 4QPAA 5K4IA 4FX3A 3QZHA 4FGBA 4ONAA 4EOLA 3LFDA 3PE1A 3W10A 3R2YA 3UZRA 2R3IA 3D15A 2WU6A 4AU8A 4E4MA 1R1WA 1YOLA 2BDWA 2AYPA 3BPRA 3KFAA 3G6GA 3PXZA 3O8TA 1SM2A 3RM7A 2VD5A 3A7FA 4BTMA 1FVRA 5AP2A 2A2AA 2F7EE 2R3QA 2W9ZB 2YAKA 3MY1A 3KRJA 4Z3VA 5CF8A 2GHGA 4FL2A 2WMQA 4IH8A 3VBXA 2E9UA 5ETAA 3W32A 3WIGA 5L4QA 3ODZX 1M2PA 4RJ4A 1WBNA 2F7XE 3PXKA 4FTTA 3GQIA 2R3NA 2C6KA 5EK7A 3LFFA 4E6AA 4BFMA 4OTIA 3E87A 3KCKA 3ULIA 4D4YA 1PF8A 3PTGA 3QKLA 2BKKA 4YTIA 3RP9A 3D14A 3SOCA 1IEPA 4OGRA 3UVRA 4XOZA 3EKNA 1OPLA 4D2SA 3TEIA 3RBWA 4G16A 4GRBA 3JVRA 3GQLA 4EK3A 1LR4A 3W2SA 2DS1A 3K5VA 3FPMA 3CPBA 4UWBA 5F20A 2YHVA 3IGOA 3PP0A 2WNTA 4PTEA 4FG8A 1UV5A 2HW6A 4NW6A 3BBWA 5IH4A 5KMIA 4M97A 5EQEA 2C4GA 4DGNA 4AWIA 2FH9A 3EWHA 4DTKA 4RWIA 2VTPA 4U44A 4Q9SA 5DT4A 5J9ZA 4PL4A 5HE0A 1Q24A 2Z2WA 2G2HA 4JBVA 1ZWSA 2XNMA 1CDKA 4YJQA 4LV5A 3ZFXA 5F94A 4FKLA 3ANRA 2OK1A 3MVMA 3QC4A 3OUKA 3OWLA 5EFQA 5HBEA 3F9NA 2C6LA 2XNEA 4TY1A 4BICA 3R7EA 3BHUA 4GYIA 5FM2A 4QMWA 2CNUA 1AQ1A 4NM5A 4IB3A 2J7TA 3AOXA 3CE3A 4DEHA 4DTAA 2WELA 3D83A 3LMIA 3C9WA 4R78A 5G6VA 3ZXTA 5JN2A 4QMOA 4AW2A 1UU3A 5HG9A 1XR1A 2PVMA 4MBJA 3MSSA 4JDHA 2JKQA 2ONLA 2XYUA 5AUVA 4PNKA 3QX4A 3TKIA 5HEZA 2CNVA 4CGAA 5ANOA 2JIVA 1SNUA 3GC7A 3O7LB 3ZDIA 4YC3A 3DFAA 4JR3A 5A4EA 4DE4A 5CF6A 1XH4A 2JAMA 3MVJA 2QOCA 4KRCA 2IPXA 2OSCA 4M69A 3A61A 3CTHA 4EH9A 2XF0A 5IG1A 3IECA 2E9NA 1OUKA 4F6UA 3AC2A 2YISA 3R8MA 5CTPA 2IJMA 1WBWA 2FSOX 3HRCA 3FSFA 5M06A 3FSKA 4WSYA 2ITXA 3V8WA 5EHLA 4BI1A 3SKCA 3IW6A 3EQIA 2V7AA 1W8CA 4FVQA 3DQXA 5IF1A 1YOJA 3GI3A 2YIQA 3CR0A 4O38A 3HP5A 4I94A 4I1ZA 2VWUA 5CX9A 5E8YA 1ZRZA 3C0HA 3JVSA 3G33A 2J5FA 4ZTRA 4CFXA 5CAUA 3SXSA 3QQFA 4O0WA 5TOZA 3TUDA 2YIWA 3WI6A 3AQVA 3BU5A 3TTJA 4HYSA 2W5AA 3PA5A 3QLGA 4NW5A 4WD5A 3DS6A 3EQCA 3SVVA 4E5AX 4FR4A 4HGTA 4OTWA 4NZWB 5FEEA 3BGPA 3O17A 2VAGA 5EOBA 3NWWA 4WRGA 4L43A 1K9AA 1E1XA 2BILB 2C0TA 3QCXA 2OWBA 3GBZA 4K18A 4L3JA 4ENXA 3BHYA 4BZOA 4YSJA 3PSDA 2ZAZA 3PRIA 4RPVA 2EXMA 4I4FA 1H27A 3AXWA 5EYMA 3L1SA 3ODYX 5KKRC 2UW9A 3REPA 3A60A 4WKQA 4YO6A 3TXOA 3QYZA 1NT2A 3AGMA 1J7IA 4EOIA 3I7CA 4LG4A 3EJ1A 3CIKA 4JR7A 3PG3A 2CN5A 2WXVA 3Q2MA 3QA8A 4IB0A 5L2QA 4BCNA 4DFZE 5CAPA 2QLQA 4NIFB 1P4OA 2UZOA 4LRMA 5HGIA 4FSRA 3Q9XA 2JIUA 3OF0A 2YCSA 1L8TA 2P55A 3KC3A 4O7RA 3BU6A 4FNWA 3QA0A 4LGDA 1KOAA 4HOKA 5JFSA 1GIJA 3LCDA 3RKBA 4O1PA 3S3IA 2YLEA 3DK3A 3HLLA 2GFCA 5E8VA 2BR1A 5B7VA 1ZLTA 4XOYA 3N4UA 2ACXA 3RPSA 3P0MA 4XMOA 4PMMA 3GOPA 4V05A 4DG2E 3ZEPA 5E7RA 4XBUA 2JBOA 4ZZOA 4A9UA 2J0MB 4RJ7A 4NL0A 3BEGA 4MXOA 5JQ5A 5BUEA 3M1SA 5ANDA 4FIHA 4CYJA 2CKQA 1ZMWA 1H01A 3D7TA 3VS7A 2F9GA 1JSVA 1YOMA 4AACA 4C3PA 4M12A 2C3JA 4UZHA 3RK7A 4JBQA 4JAIA 3TACA 3E5AA 4F9BA 2VWBA 1Y8GA 2BDJA 4RG0A 2QQ7A 4GU9A 2W1ZA 5GINE 1Y57A 2C1BA 4AZSA 2HWOA 4QP3A 4DEAA 4BC6A 3VS3A 1W82A 4HPUE 4R5YA 3M2WA 5BVDA 1OL5A 1URWA 3H0YA 3AC1A 3EFWA 5KMOA 2VN9A 3TIZA 4A07A 4IJ9A 4S34A 3R00A 5EM6A 5DRDA 4L52A 3V5PA 4JAJA 4F1TA 3BCEA 1HCLA 4FSNA 5F95A 2BVAA 3PXRA 3ZO3A 4K2RA 4BCKA 2B53A 4R7BA 4S32A 3O8UA 3QRKA 4BN1A 3OEFX 4CFVA 5KMNA 1J1BA 1TQIA 4XYFA 3EN7A 4GVJA 4JVGA 5DPVA 3PJCA 3QRJA 2WPAA 2PVHA 1WBPA 4Y72A 1Q8UA 4QNAA 4DFXE 2XRUA 3U6JA 4UMRA 4R6VA 3RPYA 3VBYA 2C6EA 3L8VA 3UIUA 2IZSA 2W5HA 3GP0A 3H4JA 3F3UA 1IR3A 2OH0E 2Z02A 4IC8A 4CFUA 1FBNA 3FMJA 3EL8A 3KF4A 1RW8A 4HGSA 3AGLA 3EFJA 4BYJA 4RC3A 5F9EA 5I0BA 4EOPA 5HBJA 4KD1A 2Y7JA 3VS5A 2QO2A 2BPMA 1W7HA 3FL5A 4IM3A 4O0UA 4MCVA 3VBVA 4C2VA 4EK5A 3PG1A 2WTIA 3FMEA 4F08A 5HNBA 3CD8A 5CEQA 4E93A 1XWSA 2OH4A 4XV3A 4X3FC 2OJ9A 4CXAA 3OS3A 2BZIB 2JBPA 3H9RA 2FO0A 2V55A 2YERA 5E92A 3R63A 4IWDA 3RM6A 4CKJA 3LKMA 4M8TA 4CTBA 2BRBA 2VTMA 3K5UA 4AZEA 2I0YA 5HLWA 4YR8A 3UIXA 3KY2A 3C5UA 5BVKA 3V5TA 4B6LA 1Q61A 3HECA 4XP2A 1K2PA 3WILA 4DA5A 3PVWA 3RPOA 2J0KA 2P3GX 2QHMA 3CQWA 3F61A 3ORMA 4PDOA 4FT7A 1O6YA 5M4IA 2W1FA 3CP9A 3FJQE 4F9AA 3SG8A 1QPEA 3RNIA 5LVOA 4DBXA 2R3GA 1BKXA 2G2IA 3K3IA 4HYIA 3QQUA 5HU3A 3UIMA 5AAEA 4RVTA 3BHHA 5J7HA 4DCEA 3UODA 2WD1A 3VN9A 4S30A 1YI4A 2FVDA 1ERKA 4X6RA 4MQ1A 2AUHA 1SYKA 4HVGA 3FZSA 1XH5A 4RSSA 2YDKA 4X3JA 4RT7A 2PZIA 5HO6A 4BIDA 4NSTA 3LCSA 3RAKA 3QTWA 5IUHA 3NCGA 2XK4A 3WZKA 4HVSA 1PXNA 2QD9A 4FV0A 3VWAA 1H26A 2UZTA 5KMJA 4E4NA 3ORPA 4N6ZA 5LVNA 4ZTLA 2AC3A 3OHTA 2VTHA 3FY2A 3Q6UA 5EKOA 4ZEGA 5CQUA 2CNQA 1PXIA 4NTTA 3O7LD 2OU7A 2XK3A 1OI9A 1RJBA 2CDZA 4FEQA 5E4HA 4PMSA 4XP3A 5FXSA 1UKIA 2IWIA 3DB8A 3LXLA 4ZY4A 3PUPA 4DT9A 5IA1A 5CZIA 1PMEA 1OKVA 2BRMA 2WTDA 3E3PA 5D7VA 3G90X 3QZFA 3IGGA 3ROYA 3UJGA 4KUJA 4WA9A 3TDVA 3R7GA 1GOLA 3ENMA 4MKCA 5M07A 2OGVA 4IEBA 5H8BA 1R3CA 2V5QA 2QKWB 5FTOA 1H1SA 5AWMA 2VX1A 3MA3A 4NM0A 4AOJA 1Q8WA 2C68A 2W0JA 2XKDA 3PJ2A 4WT6A 4NH1A 5AR3A 5IA3A 5DEYA 4Z55A 3R8UA 4MEDA 3ZUTA 4AAAA 3HRFA 1KE5A 2OJJA 3JXWA 3LHJA 5K0KA 1F0QA 3IOKA 3CXWA 4FKQA 3EN9A 3HL7A 5HLPA 4MHAA 4GH2A 4J8NA 5T6KA 1MRUA 3DCVA 5A46A 4V04A 4MH7A 4F7NA 4CZTA 4KS7A 4GFGA 4PY1A 4QQ5A 4U9AA 4FZDB 3F2RA 5GZAA 1B39A 5M09A 3OBJA 3NUXA 2G15A 4EUUA 4KS8A 4X0MA 2DYLA 5E9EA 3FYJX 4JX7A 3IONA 3IS5A 4YU2A 4RIXA 1O6KA 4CRLA 4U7ZA 5M51A 3ENHA 2WTKB 3ZLWA 5DRBA 5KZ0A 5J1WA 3ELJA 2VTJA 2ZDTA 3V6RA 1ZMVA 4S2ZA 2OJIA 3ZCLA 3V5QA 3PY1A 3OCSA 4H1MA 4KAOA 1GZOA 3AT4A 5BNJA 4FKOA 3Q32A 2ZB1A 2QOQA 3LFEA 4AW5A 4U40A 2J0JA 2VWYA 2A4LA 2G9XA 3A4OX 1PYXA 3H10A 3GCUA 5IKWA 4CT2A 4YLJA 3G9LX 4QPSA 1H00A 4F70A 2WIHA 2Y4IC 4PMTA 3W2OA 5LMKC 4X2JA 2WB8A 2GDOA 4BWXA 4C36A 4GIIA 3MJ1A 4JNWA 5E8UA 4KWPA 2X6EA 4IX6A 4I5PA 4ZTSA 5IA4A 5DWRA 3CSVA 1KE9A 4FIJA 2WIPA 5J79A 5FM3A 3O2MA 4BWPA 1XHAA 4O84A 2PVYA 3COKA 3LFCA 4LI5A 4NM7A 3FZOA 4IDTA 3R0TA 4FTLA 2Z7LA 4MD7E 2UVXA 4BGHA 4FIEA 1M14A 4AZWA 3THBA 5IH5A 4J97A 4N6YA 3C5IA 3EQHA 4KINA 4RQKA 3QD2B 4DH3A 5KMKA 2BALA 2ZV2A 4ASXA 1B6CB 3FAAA 3E63A 4EI4A 2J50A 4U42A 3R7UA 3NDMA 3ORTA 2CMWA 3BGZA 3F5XA 2YM6A 4YTHA 5KBRA 4JIAA 4RC2A 2NPQA 3LQ3A 5C9CA 2DQ7X 3MFTA 5CNNA 2C3KA 1J91A 1KWPA 5EHOA 2CGUA 1IA8A 4Z9LA 2BAJA 5FEDA 3RTPA 4QMZA 2BHEA 5FRIA 4D5HA 4G9RA 4EZ5A 2I6LA 4TTHB 2DUVA 3F2AA 4EJNA 3LXKA 4UBAA 4O6LA 3MB6A 2E9PA 4PL3A 2O65A 1U4DA 3QXPA 2QHNA 2CGXA 3ZSGA 4O7ZA 3PJ1A 3LPBA 3VVHA 4EJ7A 4AP7A 3V5LA 3VUIA 2IZRA 5ETCA 3COMA 4EONA 5BVOA 3VF9A 4HW7A 4K1BA 2CCIA 1GZKA 2JGZA 3B2WA 1APME 3WZEA 3OY1A 5DN3A 4TL0A 3R8LA 1H1WA 3QTSA 4Z7GA 2WQEA 3F66A 4ARKA 3SGCA 2UZVA 3HMNA 4XEYA 5AM6A 4EH3A 4L3LA 2Y6MA 4Y73A 5A3XA 3UC3A 4ZY6A 4F63A 4M0YA 5HNGA 4DEGA 3RINA 4D28A 4D4RA 5DBXA 3ZLXA 1WVWA 2O8YA 2P4IA 4FTRA 4FOCA 1P2AA 2YIXA 4RVLA 2UW0A 3EQBA 2O2UA 3FI2A 4FTOA 1YXXA 5HX8A 3VS6A 4BBEA 3SC1A 2WAJA 4H3BA 4P4CA 2HWPA 3KL8A 4GV1A 4PPBA 4JXFA 5AP3A 3ORIA 4USEA 3DZOA 4YJSA 4TN6A 2HCKA 2UZUE 3FZPA 4MBIA 3VUGA 4L00A 3NAXA 1BMKA 1GY3A 3HKOA 3KXNA 5D9HA 4DH7A 4F0FA 2W1DA 4RA4A 4XS2A 3HVCA 3B8RA 1H1RA 3P7CA 1SVGA 3P4KA 1CMKE 4L46A 1OKZA 3VIDA 4IMYA 3LMHA 4C4FA 1CSNA 3BU3A 4FKIA 4I5MA 4TYEA 2GHLA 3CJGA 4H36A 4TZRA 4AOTA 4BL1A 4F9CA 3PDTA 4TYIA 3NGAA 2ZV8A 2BCJA 2XK6A 3ZDUA 2YAAA 4G6LA 4MF1A 4TWNA 3I4BA 2YM8A 4KABA 4Y46A 3SG9A 3U4WA 3HNGA 3KCFA 4FUXA 1Q41A 3VUDA 2YCRA 3KRWA 4PQNA 4O27B 3BWJA 4OR5A 4XV2A 4YO4A 3W8QA 3OOMA 1JBPE 3E62A 2UZWE 3PWYA 5CNOA 4ZSEA 4ASDA 5C8KA 4B7TA 4ANQA 5HLNA 4AUAA 2QOFA 2GPHA 1XQZA 3AG9A 5FTQA 5JFXA 2UW4A 3QGYA 4F7SA 5A6OA 1UWJA 5J9LA 3KU2A 4IM2A 4BIBA 1FOTA 3HA8A 3MDYA 2WEVA 4WSQA 4H3QA 2BFXA 4ZOGA 3CLYA 2ZOQA 4DTBA 2A1AB 3KVXA 4JG7A 3DNDA 4I3ZA 2FA2A 4YZ9A 4EH6A 1P4FA 1H24A 5CEIA 4R3CA 4ZMFA 1YW2A 2XK7A 3BE9A 2PWLA 4J71A 4PP7A 3ZSIA 3E7VA 2X8EA 5DR2A 2PMLX 4NKSA 1VZOA 3DTCA 3BIZA 5J5TA 3QLFA 2WEIA 5LVPA 3ZHPC 4LL0A 1CKPA 3FLZA 4B8LA 4QQJA 4LV8A 4USDA 3VC4A 2B0QA 3P79A 3PXQA 3KRLA 4X21A 3R7YA 4G3FA 2VX0A 2WMSA 3GT8A 2J90A 4UY9A 5AP5A 3UBDA 2WQOA 3BYSA 4M68A 3SAYA 4WBBB 3TG1A 3LCOA 4ANNA 4I6HA 5GIOE 3F5UA 2Y8OA 4UXQA 3ZC6A 1A06A 5DVRA 4RWKA 4WHZA 4IAKA 4H1JA 3I0OA 3ZUVA 4D9UA 5JZJA 4G9CA 2VTNA 4FNYA 4PDYA 3OWJA 2OZOA 3S1HA 3MH3A 3WYXA 3ZO2A 4BZDA 5AUYA 3G15A 3AMYA 3BHTA 4QTBA 1OMWA 2W5BA 4TW9A 4A4OA 3MY5A 3DKGA 3LFNA 4H58A 4MVFA 5T68A 3RMFA 3AC8A 3M11A 4KB8A 5L2IA 2E2BA 4TWOA 4BCGA 2C0IA 2VTOA 3QHRA 4OT6A 4I5HA 4EH8A 1S9JA 4I22A 4IWQA 4FV3A 4G31A 4TT7A 5K3YA 5C1QB 2Z7QA 5KKRB 1XH7A 4QYGA 1JAMA 2XIKA 5DR9A 4QQCA 4RFYA 3R9DA 4YTCA 2PY3A 1H1QA 4OUCA 2QU5A 1M2RA 2SRCA 4FVRA 1OGUA 2WMAA 2XVDA 3FHIA 4JG8A 2OJFE 4JJRA 5IQBA 4R7HA 4FV1A 3R22A 4J8MA 3Q4UA 5EOLA 2ZM3A 3PYYA 4DFNA 5LXMA 3OZ6A 4AFJA 4U0IA 3WARA 5AFVA 3ACJA 4O91A 5A4QA 1M17A 4HVIA 2XA4A 4FIGA 4QTAA 3IO7A 4I6BA 5ANIA 3EN6A 4ITJA 3E8DA 4C34A 4BRXA 2W1EA 2WQNA 3LFSA 5FP6A 4CV9A 2R9SA 3DKFA 2NP8A 1FMOE 3R7VA 5LVLA 4ZJVA 1YQJA 5K0XA 5LCKA 4YHTA 3PPKA 2PZRA 3BV3A 4RA5A 4BYIA 4AGWA 2WQMA 4HCVA 4QP1A 1U54B 4O1OA 4ACGA 4O96A 3AC5A 3UNKA 5EQPA 3GC0A 3Q4ZA 5CEOA 2HW7A 5EW3A 5EM7A 4F9YA 4DLJA 3FBVA 5AV2A 5GJFA 1QMZA 3EQDA 1YDRE 4AFEA 2YZLA 3NNUA 4JDIA 2JLDA 2X81A 3PPJA 4UEUA 2IW8A 3G6HA 4BDGA 3EZRA 3POZA 3V3VA 2X2LA 2ZM1A 4D2VA 3F5GA 3MVLA 3S95A 4FV6A 3F3ZA 3G0FA 3NIZA 3FI3A 4Y5QA 5HKMA 4BCJA 1GIIA 3IDCA 2RSVA 2PUNA 1W98A 5HU9A 3QD3A 3AC3A 2JKOA 4YJRA 1FVTA 1OPJA 1R39A 4NYEA 3NAYA 1ZYJA 4OTQA 2PVLA 4QOXA 5CI6A 3S0OA 3IOPA 3EFKA 4KBCA 4W9WA 3LJ1A 4YC6A 4H05A 4O7TA 1QCFA 4CLJA 3OT3A 1V0BA 3R71A 4E6DA 4QP9A 4U79A 3WYYA 3N4VA 4FKTA 4KA3A 4MYGA 3LFBA 4PUZA 1CTPE 3U6IA 4M14A 5A4CA 3MWUA 2A19B 3A8XA 3I6UA 2OO8X 4HJOA 3COIA 3EQFA 1A9UA 4G2FA 4J99A 1Y8YA 2XEZA 2J6MA 4QMPA 4B4LA 4E4LA 1KE6A 4IW0A 1XO2B 4F6WA 2UW3A 3UG1A 4XG7A 4UMUA 2CCHA 3IDBA 4G3DA 4ANOA 1I44A 3PP1A 2ZYBA 3D5UA 4TYGA 4FUYA 5FD2A 3FLYA 4CQGA 3Q52A 4QYYA 3GCSA 4FF8A 2R3MA 4G3GA 3VUMA 4ZAUA 2QOKA 1LP4A 2XMYA 3EN4A 4GCJA 3UE4A 5KO1A 4GL9A 3ATTA 4FT9A 1IAJA 4QMLA 3CEKA 2C30A 3DY7A 2IN6A 4X3FB 3NW7A 3CS9A 3FLNC 2NO3A 4IWPA 3JPVA 2VWXA 2HZ0A 4KIKB 4E73A 2HZIA 3GUBA 3KK8A 3MIAA 4D58A 1YRPA 3C4XA 4UB7A 5IH6A 5CSWA 5HE3A 4MD8E 3SV0A 3FI8A 3TIYA 2PTKA 3DBCA 4GT3A 4RIYA 1FGKA 4BKJA 3ORXA 3ULZA 4CFMA 2O64A 4M15A 4JX3A 4ZJIA 2W1CA 2ZJWA 3EMGA 3ORKA 4AZVA 1NW1A 1Q62A 2J0IA 3NX8A 5IEXA 1QPCA 3BQRA 1LEZA 3D2KA 3ZM4A 3LCTA 4LUEA 4FSTA 4DH8A 4XLVA 2C47A 2W4OA 4FBXA 3AD5A 3FI4A 4FV9A 4GK4A 5HOAA 2C5NA 4YMJA 4TWCA 5JGDA 4AT3A 2WMRA 3C4EA 1PHKA 3HV4A 4D1SA 3HEGA 4IM0A 5CU2A 2X2KA 3DDQA 3KA0A 1I09A 4NWMA 5J5SA 5IEYA 3IQ7A 3OUNB 2J9MA 2C3LA 5EQYA 2CKOA 5LQFA 1MQBA 2WMUA 1ZY4A 2WU7A 3POOA 4IQ6A 4C4GA 5L3AA 3QCYA 2OZAB 5KX8A 3NUAA 1UNGA 2XJ0A 3QUEA 5DE2A 2PVFA 4AA5A 1OZ1A 4TYHB 2YCQA 4EH5A 3O0GA 4IZ5A 1LEWA 4C02A 3VHKA 3OG7A 3R01A 2OF2A 2X1NA 4NCTC 4JQ7A 2BZJA 3FLWA 4YLLA 4RX9A 5CU4A 1WBOA 3RPVA 5JKGA 3TJDA 2VWWA 4C35A 4IX5A 2H96A 2B9FA 5AM7A 1V1KA 3OT8A 2Z60A 1G8AA 4D4SA 1FINA 1MRYA 2F57A 2X2MA 4LM5A 3DFCB 4XV9A 1QPJA 4FI1A 4G1WA 4NUSA 4FTIA 4EQUA 3QF9A 5GIPE 3LAUA 4AT4A 3C51A 3R2BA 4A9SA 1OL1A 3RHXA 3SW4A 4CD0A 5D1JA 4DF3A 4EH4A 4GG7A 4QMTA 2R3LA 5L2WA 1UWHA 3UGCA 1DAWA 4EKLA 2GU8A 5A6NA 4KNBA 3DNEA 2JDTA 3MI9A 2YABA 4NT4A 3R9RA 3QQKA 4IAIA 4RWJA 4BGQA 3IK3A 3A4PA 4UX9A 5EI8A 5JSMA 4FEXA 4II5A 1Y6AA 4TPTA 4AZTA 3F3TA 4YBKA 4DFYA 1WBVA 3OBGA 1PKGA 3U51A 4C3FA 5CU3A 2BFYA 2J4ZA 1KE7A 5JFVA 3IPHA 4LGGA 3ID6C 3EH9A 1ZMUA 2JAVA 4DT8A 4A9TA 3RAIA 4RIWA 2VO3A 2WOUA 2XUUA 3OFMA 4L6QA 2YIRA 4FTQA 2O0UA 2Y4IB 2JFLA 4PPCA 3RI1A 2REIA 3NS9A 4JOAA 5DT0A 5CSHA 5I9VA 3ZLYA 3FXXA 5IDPA 4CCUA 1YHVA 4BI0A 2BAQA 5BUIA 4CZUA 5JRSA 5JH6A 4O7NA 3PVBA 5LCJA 5HI2A 2VTTA 4JDJA 4EC8A 5JT2A 2YWPA 2HXLA 2PE2A 2R4BA 3MH2A 1IA9A 2OIDA 5E8SA 2GMXA 4ANMA 4KSQA 5LMAA 4BDIA 5BQ0A 2QLUA 2YIYA 4GJ2A 5H8EA 4N70A 3VUTA 1WCCA 3QGWA 1KOBA 4GMYA 3D5WA 2HY0A 2ZM4A 3QFVA 3E92A 2IO6A 4PPAA 5L6OA 1IRKA 5IQAA 4HVDA 4BGGA 3MESA 2HY81 4YJPA 3K3JA 5ITAA 2VZ6A 5FQDC 4O7SA 4DFBA 3W33A 2B4SB 3PIXA 2GNJA 3B2TA 3PIZA 4M67A 4O0YA 5BUJA 3V04A 4HYHA 3UQGA 1AGWA 5IQGA 2XM9A 4IANA 2YZAA 4UMQA 4C57A 1IASA 4FZ6A 1GIHA 4EUTA 4YNEA 2B1PA 2WGJA 4GU6A 1F3MC 2I7QA 3UP2A 3UQCA 3T3UA 2RFSA 3VRYA 2OIQA 4XG6A 4GJ3A 5M08A 3FMDA 4KIPA 5AX3A 4E5WA 4ZTMA 3QCSA 3OOGA 2W1HA 3MGYA 4WO5A 2OI4X 3NUSA 3PJ8A 3LFQA 3DXQA 1OPKA 3D7ZA 3D9VA 2J51A 3QUPA 1NVRA 4O0XA 2R3KA 5DT3A 1Q3DA 4UV0A 3ZUUA 4F1MA 2EU9A 3ZOSA 3ZU7A 5HG7A 3MV5A 5HTBA 3A7HA 2PVRA 1PY5A 4OTRA 3FC1X 3RWQA 4D2TA 2WHBA 5AEPA 1B38A 3IW4A 4EL9A 3EZVA 4BCIA 4BDDA 3Q6WA 4W4YA 1H0WA 4BI2A 4HGLA 1HCKA 3DBFA 4LFIA 4O7WA 4M84A 4MF0A 1XBAA 3EB0A 5DGZA 1YDTE 2R3JA 5EH0A 3H3CA 4E8AA 5E8TA 4XUFA 3DBQA 4FSWA 4MXCA 2VO0A 4YBJA 5J9YA 2VWVA 5GZ8A 4JDKA 2QODA 4M3QA 1WBSA 4XV1A 4YJNA 2WMWA 3D7TB 3Q9WA 2CGWA 1Z9XA 2X7OA 3RCDA 4AXAA 3DA6A 1PW2A 4HZSA 5B0XA 4EQCA 2QO7A 4EHEA 5CSPA 4JQ8A 4F09A 5HCXA 3K54A 3GEQA 3OWPA 2QR8A 4FGRA 2PULA 3N4TA 3KULA 2BZHB 2GNGA 5K4JA 2PMNX 4YTFA 4XG2A 1H07A 4QTDA 2ZVAA 3WF5A 5HIDA 2YJSA 4YNOA 4Q9ZA 4BDBA 5B2KA 5M55A 5CASA 4DG0E 3B8QA 4O0RA 2Z8CA 5DEWA 3P7AA 5CT7A 2XZSA 3ZM9A 3L8PA 4A4LA 4MNEB 3FEGA 1V0PA 2BHHA 1O9UA 5C27A 2QOBA 3ZH8A 5CEPA 3QTZA 5L2TA 4K77A 3FV8A 3W8LA 4RWLA 3PFQA 1F5QA 4QD6A 5HX6A 3C0GA 4L01A 3AMBA 5DOSA 3AMAA 4UYAA 4FIFA 1WVXA 4C4EA 3O23A 4UWYA 5JZNA 5GJGA 3HMMA 2UZBA 2I40A 4DEDA 4GG5A 5HD4A 3AT2A 3GC9A 3NSZA 1ZYSA 5TKDA 4P2KA 3NEWA 4L67A 4QT1A 3Q2JA 3DKCA 1OIRA 5I9ZA 3VF8A 4C59A 4EOSA 3KXGA 2CJMA 2FUMA 4RVKA 4U8ZA 4FKSA 1YHSA 3WZJA 4YZNA 3IW5A 1ZOEA 4FKUA 4MXAA 4C4JA 3G9NA 4U6RA 2OXYA 3PRFA 2X6DA 5AP7A 3H30A 2UV2A 3NIEA 5CANA 4CMUA 5AA9A 4DLIA 3CBLA 1M7NA 5BX0A 3QALE 3BHVA 4FZAB 1DM2A 3I79A 3RK9A 4QP6A 3U4UA 2XEYA 3QL8A 2RFDA 4LL5A 3DGKA 3R1QA 4BTFA 3QXOA 1ATPE 4F0GA 1MRVA 3DBDA 4Z16A 4X6QC 3HDNA 2VX3A 3BBTB 4FEVA 2ONLC 1OM1A 1TVOA 2X7GA 4ZP5A 3BX5A 4R1YA 2RG5A 3SX9A 2O3PA 4TNBA 3RAHA 3LIJA 4G5JA 4AW1A 1CKJA 3FQEA 4HZRA 5CEMA 3FMNA 4IZYA 4AG8A 2JD5A 1P14A 2Y9QA 4O0TA 3HDMA 3TZ8A 3F7ZA 4PTCA 4C2WA 4CG8A 4PDPA 4WBOA 3F5PA 4I0TA 3FKLA 4LYNA 2PYWA 3OXZA 3O8PA 2X0GA 3ZXZA 4MWIA 4E26A 4MX9A 4IC7A 3TZ7A 3KREA 4KRDA 1J7UA 3U87A 2XIYA 2YM5A 2C1AA 1URCA 3LOKA 4KIQA 4RZWA 5HORA 1KSWA 5DR6A 3A7GA 5F4NA 4EOQA 2HXQA 4YZCA 2WO6A 2J5EA 2XK9A 4K6ZA 4AGCA 5HVYA 3PE2A 3BZ3A 3A7IA 3BI6A 4HNIA 3OTUA 1Q8TA 1VR2A 4ACDA 4G17A 5M4FA 2Q0NA 3R30A 5IQIA 2R0UA 2NRYA 4BDJA 2VNYA 4XNEA 4ZTHA 1VJYA 3AT3A 3Q5ZA 2C6OA 4GEOA 1PXKA 3RCJA 4QMNA 3I0QA 4F65A 3UPZA 1JKSA 3UDBA 4CVAA 5J95A 5C01A 4DGOA 5I3OA 4IXPA 2E9OA 3MPTA 3MBLA 3UYSA 4BCOA 2QOIA 1LUFA 3KVWA 5J87A 3UO4A 4FT0A 4J95A 3RGFA 2WOTA 4DYMA 4NJDA 3HX4A 3I5ZA 4PX6A 4BKZA 3QTRA 4IAFA 1WBTA 4FSYA 4Y8DA 1S9IA 4YUQA 2BRHA 2JFMA 2W06A 5ANGA 2CGVA 3G0EA 3WF9A 3KKVA 3MS9A 3HGKA 4C4HA 4PMPA 2C0OA 4RIXB 4IWOA 2GS2A 3F88A 2QI8A 3II5A 5CVGA 3C4CA 4FKGA 1OBDA 1UU9A 4R1VA 4Y5HA 3UZPA 2WFYA 1ZZLA 3F3WA 1YWNA 3BQCA 2UW7A 1G5SA 2XBAA 3ZO1A 5BPYA 5CF5A 3DK7A 1Q99A 3VO3A 4BR3A 5DFPA 3EKKA 3NW6A 4RGJA 3QRIA 2R7IA 2BIKB 4FSQA 3EL7A 3WBLA 3CY3A 2C69A 4RIOA 5AUXA 2VO6A 3VULA 3UQFA 4OAUC 3IG7A 3W1FA 4WNMA 3V5JA 1LPUA 4AW0A 2IVVA 4EEVA 5EYCA 1REKA 4XX9A 3NNWA 4BCHA 3P7BA 2ITQA 4ALUA 4O0VA 1OITA 5EDQA 4X7QA 5TT7A 4U80A 4G6OA 4NJ3A 1PXMA 4LOQA 3W16A 2OFVA 4ANLA 3FL4A 3KRXA 5AUUA 4DCAA 4RMZA 4U3ZA 4YHJA 4ZJJA 2C6TA 3Q5IA 5AP1A 3GFWA 4WG3A 3R1YA 4QP7A 3ROCA 5M53A 5LWNA 5AR4A 2RFNA 2BTSA 3D4QA 2WTVA 5TO8A 3RALA 1JSUA 4G34A 2ETKA 4FKVA 5I9YA 3LJ2A 4AGDA 1TQMA 2C5OA 3OCTA 4KBAA 4WG5A 4ZSJA 5HCZA 5HQ0A 4BDKA 3BYVA 1JOWB 4CFWA 5DNRA 3NYVA 4DHFA 4TXCA 4EHVA 4JL9A 2W1IA 3PZEA 2XK8A 4TRLA 4AS0A 5HIEA 1PJKA 1OL7A 5L6PA 3EQPA 4FV7A 2GHMA 4OW8A 4IVCA 4IJPA 3TV7A 3BYMA 4GUBA 5HIBA 3Q53A 5C26A 2ESMA 4K0YA 2ITNA 2YEXA 4YSMA 4C3RA 3CD3A 1XJDA 3OVVA 2HOGA 2PPQA 5IPJA 5C4LA 2YDJA 2QURA 3VQUA 4I92A 3RZBA 4MK0A 3O51A 1KUTA 5ANKA 2GS6A 3OCGA 4KIOA 4A9RA 1T45A 1E9HA 1XKKA 3TKUA 2C6IA 3E88A 4HNFA 3SXFA 3KXMA 1G8SA 3UVPA 3CC6A 4PDSA 4FEUA 4A4XA 4GFOA 3GENA 4P90A 3PZHA 3W2RA 4CKRA 1J7LA 2UW8A 4J52A 4UWCA 3FDNA 4V0GB 4QMVA 4YURA 1ZYCA 2B9HA 3ZZEA 2KULA 4XCUA 2HELA 2YJRA 5HBHA 3O50A 3OW3A 2GQSA 3U54A 3FC2A 4ANBA 3DZQA 5IISA 5EM5A 4FV5A 2GCDA 1BUHA 3S4QA 5KMMA 3FZTA 4DEBA 5AIRA 3WF7A 4EBWA 4EYJA 4ZSGA 2NNWB 5AR5A 4YHFA 5L8KA 2R7BA 2H8HA 2JKKA 2OG8A 1IG1A 3F2NA 3MPAA 4LGHA 4D0XA 3H9OA 1FGIA 4J7BA 4O7VA 3JS2A 2AC5A 5D41A 3E7OA 4YZMA 1Q97A 4IFGA 4O86A 4G5PA 4HCTA 2W05A 1M7QA 1VYZA 2WMTA 3R1NA 5M4UA 5KHXA 4AA0A 5CSVA 3TZ9A 4YJTA 3LCKA 3HV5A 1NXKA 2PE1A 1OIUA 3IW8A 4OBQA 4FEWA 3QZIA 4I4EA 3GXLA 3PA3A 4FT5A 3VS1A 3WZUA 2BDFA 3ZYAA 4ACHA 5H8GA 2C3IB 2IW9A 3AD6A 4QMQA 2UW5A 1BX6A 4BZNA 4IADA 1AD5A 1OVEA 2OLCA 3TDWA 3NUPA 4O21A 2VU3A 3OCBA 4FTUA 4Q2AA 2OICA 5CY3A 3MH1A 1YI6A 3P08A 5TE0A 1V0OA 3SRVA 4B0GA 4ZLYA 2OJGA 5EW9A 2PZYA 4C61A 4GK2A 3U55A 4P5QA 2H6DA 3KMWA 4EHGA 4FVPA 3UPXA 3NUYA 4NTSA 3U9CA 2QOOA 4FKRA 4UMTA 2XNGA 4WRSA 5AADA 2I0VA 2IVTA 3QQGA 1MUOA 4YPDA 2EUFB 3G51A 3MVHA 1X8BA 4IE9A 2OXDA 2LAVA 5EI2A 1XBBA 3UOKA 1YXUA 3SW7A 3NW5A 3GCVA 3FWQA 2LGCA 3C4WA 3E64A 3DJ7A 4D1XA 1PYEA 5DA3A 3PVGA 3UYTA 4CSVA 4BTKA 4ZZMA 3DB6A 3OW4A 2XKEA 3C13A 3TT0A 2XNBA 2UZNA 2X8DA 2XBJA 5G1XA 4YC8A 3NVMB 1JNKA 1W0XC 4B9DA 3R02A 2GQGA 3PLAE 2EWAA 4L7SA 3GC8A 1YXVA 2PMIA 5ANEA 3ORZA 4D2WA 3A2CA 2ITPA 3PA4A 2ZMDA 2VTQA 2PUIA 5BMSA 4FZ7A 5CLPA 5FTGA 4C58A 3PIYA 3BLRA 2ITOA 4BY9E 3OY3A 4J1RA 4BDCA 3TL8A 4QO9A 1JQHA 3Q4TA 5CEKA 3VW8A 3WF8A 1U5QA 3DDPA 4DAWA 2WMXA 4XJ0A 4YP8A 4L53A 3FMLA 2YA9A 4ZZNA 2WMVA 3EOCA 4IVBA 3L9NA 1YVJA 5LWMA 2R3RA 5IQHA 3CTJA 4IHPA 3A62A 4QYFA 2ITZA 3BKBA 4DEEA 4K8AA 3DU8A 3MIYA 2FB8A 5IEVA 5KHWA 2I1MA 2F7ZE 3VAPA 1SNXA 5CF4A 4YPSA 3HRBA 3VS4A 1VEBA 3GB2A 4EZ3A 4GUEA 4OT5A 4Q5HA 1JSTA 4J98A 3VS0A 4KIKA 3LJ0A 3NYNA 3TKHA 3V51A 1OKYA 4BDFA 4EH7A 1H4LA 3Q9YA 4CCBA 4MXZA 5AJQA 3I6WA 4ZS0A 4P7EA 3UMXA 3UOLA 2OKRA 4AOIA 3HAMA 2E9VA 1M52A 5AV4A 5KBQA 2P33A 4O7LA 4LUDA 2WQBA 3MJ2A 3FPQA 4ALVA 5FG8A 4JBOA 4FYOA 3QZGA 1ZARA 4DG3E 2PL0A 5BYLA 4DFUA 5CQWA 1P5EA 5JQ8A 4EK4A 4FSZA 5IQFA 1YXTA 1ZZ2A 3TUBA 2YDIA 5DLSA 3QTXA 3ZS5A 4EWHA 3SD0A 3Q4CA 4EOJA 4ASZA 2RGPA 4M7IA 3FMHA 3DAKA 4DFLA 2ERKA 5IQEA 2OXXA 2XKFA 3QQLA 2RKUA 2W96B 3N51A 1JWHA 4I6QA 3UC4A 5E8WA 2Y4PA 4O0SA 3ZO4A 4ZSAA 4CFFA 3C1XA 2X9EA 5D11A 2VUWA 3UOJA 1YDSE 5FGKA 5CENA 1Q3WA 4XHKB 3DTWA 3BEAA 2X9FA 4YJUA 2KTYA 4C8BA 4DGGA 4DH5A 4UN0C 1ND4A 1JKKA 3I60A 2QVSE 3I7BA 5IU2A 2W99B 1UKHA 2JKMA 4GIHA 5HTIA 4C0TA 3LXNA 4AN9A 2OZAA 3D0EA 4L44A 4R7IA 5LVMA 3NVKI 1DI8A 1G3NA 2FSLX 3DOGA 3Q04A 4I21A 4Y85A 5AIKA 4TYHA 4TYJA 4IAZA 3SXRA 2JDRA 3C0IA 3EFLA 4LMNA 3OXIA 2XIRA 3MTLA 2PK9A 3UO6A 5DMZA 5JGAA 4FG7A 3GFEA 3GGFA 4RJ3A 4AE6A 2W9FB 4FTNA 1IAHA 5AX9A 3SLSA 3LQ8A 3FZRA 4D4VA 4XRLA 3TNQB 2C6DA 3EQRA 1XH6A 5K5XA 2XCHA 3TNHA 1ZYLA 1JVPP 4BHZA 5EM8A 4KKHA 3EIDA 3BE2A 1RE8A 1JKLA 3FKOA 3ZRMA 5ETFA 2YLFA 3L8XA 4USFA 3R28A 5GJDA 4UMPA 3WIKA 5FXRA 2VRXA 3E93A 4PWNA 3TTIA 5LMBA 2Q83A 2BROA 4O82A 4ITHA 3PXFA 4HGEA 4D9TA 4IB1A 4TKSA 1BI8A 4DGLC 4NIFA 2J0LA 4FTCA 3UO5A 1H28A 5J1VA 4L3PA 3SHEA 5GNKA 4GW8A 1PXPA 4CYIA 2GFSA 4FIIA 5AR8A 5HO8A 2VGPA 2XIXA 1WVYA 3ALOA 3FE3A 5BVFA 1GJOA 4XG9A 2VTLA 4EZ7A 3JR1A 4RFZA 1PRYA 2EVAA 2B55A 1U5RA 4R77A 2X8IA 2NRUA 5EDPA 2YACA 4AT5A 5IUGA 4UYNA 3L9LA 4QMUA 3KMMA 3TUCA 5ACBC 5KE0A 3OEZA 1ZAOA 3KQ7A 1DS5A 3F3VA 1PXJA 5M56A 4EK8A 1M2QA 3ZTXA 4BTJA 5EDRA 5AR7A 4C7TA 3BRBA 3HV7A 2FSTX 5HG8A 5E90A 4D1ZA 4AX8A 5LMKA 2HENA 3DV3A 4IB5A 1UU8A 1HOWA 2PMOX 3DJ6A 1WFCA 3GU6A 1JKTA 4FTAA 2CSNA 4DINA 3V8TA 3R9HA 4F0IA 2XYNA 1DI9A 5B2LA 3WZDA 4BKYA 3ATSA 4ZMEA 1RQQA 2P0CA 5CVFA 1BLXA 2XB7A 4RIYB 4EBVA 3JY0A 3ZONA 2C5XA 3QRUA 5DIAA 4YLKA 4J96A 1TQPA 4APCA 2GNIA 4EOOA 4YJOA 4FSMA 2PU8A 5BYZA 1XH9A 3RPRA 2WKMA 4I41A 5CYIA 4CG9A 2C6MA 5BVWA 3P78A 4IAAA 3QC9A 4QPMA 5EG3A 3UTOA 5JEBA 3V5WA 1PXLA 3D2IA 3HMIA 4IACA 2ITUA 4R3RA 3P5KA 3GU8A 3R21A 3GU4A 2HK5A 1U46A 4LOOA 2F2CB 2VTSA 1Q8ZA 2OFUA 4U45A 4APPA 4M69B 5DYJA 1H25A 4JIKA 3MFRA 4IDVA 4BDAA 5A14A 4ERWA 3NMUF 4ZY5A 1UNHA 5CS6A 5M44A 1Q4LA 5EI6A 2UW6A 3L9PA 1PMNA 4ENYA 3HZTA 3DKOA 2XNPA 4A06A 3CJFA 3DT1A 5HZNA 3EQGA 1NA7A 5TR6A 3ERKA 3BLHA 1OB3A 4IZ7A 4GT4A 5HVKA 3BYUA 1UU7A 5D10A 3QQJA 4N0SA 5K9IA 4BDHA 5BMMA 3QD0A 4I5CA 1STCE 3RHKA 3UNJA 4E6CA 2VGOA 2VTRA 4BB4A 2EB2A 3DJ5A 3P86A
chains in the Genus database with same CATH superfamily
4FV2A 4EH2A 3KGAA 4R5SA 4RX8A 3NFGB 3ITZA 3PVUA 3E8CA 1XBCA 1OECA 4GT5A 5EYDA 1H8FA 1H0VA 1OIQA 5J7BA 1MP8A 3NPCA 3HAVA 4RJ5A 3ORNA 4FTMA 2ETMA 3FLSA 3F7WA 4W9XA 1YWVA 4LQMA 3VBTA 4QMSA 3VS2A 1PXOA 2HIWA 1KE8A 3AC4A 3FKNA 2PUUA 4X2NA 4ZXTA 3FXZA 4FK3A 4CRSA 3LLTA 4XLIA 4RLLA 1DAYA 2EB3A 2OIBA 2QR7A 4U41A 3F82A 2RFEA 4I24A 3R9NA 4MD9E 5DI1A 5M57A 3TI1A 5GZ9A 3GU7A 5FXQA 3SA0A 3QTIA 4UXLA 4ITIA 3ALNA 3PPZA 2RG6A 2BKZA 2WZJA 4I0RA 3R73A 4LRKA 4QP2A 1R0PA 3CPCA 4MNEA 4EWQA 3MTFA 2UUEA 4PF4A 4XH6A 3WOWA 5KMLA 4B8MA 3R9OA 2Y0AA 3LZBA 4DH1A 3QKMA 5IDNA 4ASEA 2BTRA 3HMOA 5HVJA 2I0EA 3RAWA 4KSPA 4BCQA 2X4ZA 5A9UA 2UVZA 4O7YA 4E3CA 3I1AA 4RIWB 2IZUA 2EXEA 3CQEA 4L7FA 2ITYA 3C4FA 3ETAA 3T8OA 4E1ZA 5IQDA 2BUJA 4HCUA 2BRNA 3C50A 4I93A 4MAOA 4CNHA 3F69A 4LOPA 5EHYA 3R7IA 4I6FA 4IZAA 5IA5A 4PV0A 3UMWA 4I0SA 1YI3A 3JY9A 4BBFA 4CT1A 3MY0A 2X4FA 4QTCA 1WZYA 3ZFMA 3KK9A 5A4TA 4W4VA 5C4KA 3QCQA 2XJ2A 3EYHA 4DITA 2OF4A 2JDOA 4QNYA 2QONA 5FBNC 4JI9A 4IX4A 3QUDA 3BLQA 3ACKA 2FYSA 2XM8A 1NVSA 3VBWA 4F7JA 4F64A 2OW3A 4BCPA 4IAYA 4E7WA 3BYOA 4QP4A 4IVDA 5E1SA 2YITA 1PMUA 4V01A 4C38A 4RBLA 5H3QA 5JRQA 5AV0A 4D2RA 1QL6A 5CVHA 2ZB0A 2RL5A 4X2GA 4BCMA 2G1TA 4IIRA 4RX5A 5BVNA 3DXPA 3GVUA 2JC6A 3CKXA 2PSQA 4AQCA 1WMKA 5IQHA 1SVEA 2PVJA 3GCQA 3HUBA 2PZ5A 5AV3A 4GS6A 2QG5A 5HE1A 3UVQA 2F49A 1OIYA 3JUHA 3S2PA 3KXZA 3KXHA 3TV6A 5F1ZA 2YWVA 2I0HA 2YCFA 2QU6A 5CT0A 2QOLA 3IKAA 2R0IA 4FT3A 2R64A 4NM3A 3FQHA 4BF2A 5I9UA 3KRRA 2BRGA 4B99A 3LW0A 3NYOA 3OXTA 2QKRA 1R0EA 2V62A 3TNWA 1Z5MA 1ZOHA 2R3FA 3KEXA 5AR2A 5A4LA 1Q8YA 4PNIA 5HTCA 3W55A 4J53A 5D7AA 2PVKA 3LFAA 3ZBXA 3I5NA 4ZTNA 2WMBA 5JK3A 5LOHA 5AUZA 4Q5EA 2GQRA 5FDPA 5J8IA 4O2ZA 3BGQA 2XARA 2QG7A 2HAKA 4FL1A 1GAGA 2GTNA 3F6XA 3NZ0A 5E8XA 3HMPA 3UP7A 5FUTA 3UDSA 4YZBA 5CWZA 4DN5A 3P23A 2ZV7A 3QBNA 2C5VA 4FICA 3VW6A 3PWDA 4JRVA 4EYMA 5CXZA 3DK6A 4O6EA 1YHWA 4LRJA 5I3RA 5JGBA 2QCSA 4FOBA 4LMUA 3W2PA 2A0CX 3DAJA 4BCFA 2VWIA 1H1PA 3CTQA 3KULB 4CQEA 3NR9A 1OBGA 3PY0A 4FE2A 4MBLA 3CY2A 2UVYA 5IMXA 5JFWA 4S31A 4FKJA 4MXYA 5BV3A 1SMHA 3NUNA 4RX7A 2IVUA 2DWBA 4H3PA 4GFMA 4CV8A 3HV6A 4PP9A 2X39A 3V8SA 2XNOA 2W17A 2YM3A 4OTDA 1W2FA 4QP8A 4ERKA 5KUPA 4ID7A 3QYWA 5CU0A 4U43A 4PL5A 4EHZA 1SZMA 1O6LA 3OD6X 3OTVA 3UNZA 4L9IA 4UZDA 4CZYB 3DLZA 3R8VA 3TCPA 4YGAA 1YWRA 4CLIA 4DBNA 2BIYA 2YM4A 4AAYA 3SQQA 4TNDA 1VYWA 3NLBA 3QX2A 5JMSA 3FY0A 5DHJA 3HP2A 3PY3A 2Z7RA 3TJCA 4MNFA 3DQWA 4FTKA 3UOHA 4NFMA 3P1AA 3PSBA 4W4WA 2B7AA 3VUHA 4C37A 4WG4A 3P9JA 2FGIA 2G2FA 5HE2A 4JQEA 2JDSA 3OMVA 4NU1A 2Z7SA 3NCZA 3KMUA 3PJ3A 4GKHA 5CXHA 2W4KA 3TNIA 3MW1A 4CFNA 3Q9ZA 3FMKA 4H39A 5HO7A 4FA2A 3OROA 4FL3A 4GKIA 4S33A 4OTHA 4RJ8A 3QQHA 5BYYA 4P5ZA 4QYEA 3R7OA 3CGOA 2WTWA 2JDVA 2W4JA 2YFXA 3BV2A 4AN2A 5EW8A 4XG3A 3U6HA 1CKIA 4OAVB 2XIZA 4JT3A 5AUTA 4PRJA 3VBQA 4XG4A 1Y6BA 5GHVA 4GVAA 5I9XA 4A9YA 3R6XA 4RVMA 1W83A 3RNYA 3VQHA 4ZLOA 2ZMCA 4GSBA 5CAOA 4F99A 2B9IA 4CEGA 2O5KA 1K3AA 2ITWA 3RVGA 3SDJA 5IA2A 5I5ZA 2XRWA 2ITTA 5FEQA 2CPKE 1YXSA 5AMNA 1FQ1B 4FKWA 4FMQA 4Y95A 3MB7A 3ZMMA 5DG5A 5LJJA 4FV8A 5CALA 2XKCA 3DLSA 3FHRA 3VHEA 3VJOA 3E8NA 4IFCA 3W2QA 4EORA 1BI7A 2VO7A 1OL6A 4U81A 3SOAA 5IA0A 5KNJA 1A48A 4O81A 2ZDUA 4RLKA 4DEIA 2BZKB 3A99A 5IZFA 2VV9A 1NVQA 1OUYA 3NYXA 1CM8A 2ETRA 2ITVA 3VUKA 5BVEA 4UALA 5IUIA 2Q0BA 5HNIX 4FC0A 3FXWA 3GNIB 5KZIA 5AV1A 3PXYA 2BMCA 4MWHA 4XBRA 4DC2A 5C8NA 4ACCA 5ICPA 3QD4A 4OLIA 2JEDA 3LM5A 5CSXA 5CU6A 5CZHA 4IVAA 3W18A 5AA8A 4O83A 3OWKA 5M4CA 3HA6A 4ANSA 3W2CA 3O96A 3ZLSA 3D5VA 3QU0A 4FODA 3AD4A 4TWPA 2F2UA 4U97A 2R2PA 3ZRLA 1XMLA 3V6SA 2XCKA 4IBMA 4ZLZA 2UZDA 4ZK5A 4BBMA 2XP2A 1G8KA 1BL7A 2HZ4A 1R78A 5I4NA 2CKPA 2VTAA 2XH5A 4NKAA 3MFUA 4V0GA 4FNXA 5E1EA 5L8JA 3UG2A 3G2FA 4N4SA 3ZRKA 1BYGA 2IVSA 3D5XA 4E4XA 1KV1A 4L68A 4E6QA 3LMGA 5B2MA 4FYNA 4WIHA 1SVHA 2VTIA 4U5JA 3WE8A 4F7LA 1GNGA 4NEUA 2CLQA 1ZY5A 3NNVA 3TV4A 2BAKA 4R8QA 3ZEWA 1FPUA 4G3CA 5D12A 4FK6A 4EK6A 3CQUA 4K11A 2B9JA 4I20A 3LXPA 1PMVA 4L42A 2ERZE 2EXCX 3M42A 4AF3A 2IZTA 2YN8A 2X7FA 3NNXA 2QO9A 3WE4A 3LLAA 5FWKK 3IW7A 3R83A 5CAVA 3RZFA 4AE9A 4N57A 5IQCA 4XG8A 2C5YA 2WTCA 1REJA 3FMMA 3QTQA 1PKDA 4XRJA 3T3VA 2GSFA 2P2HA 2R3HA 2R5TA 5C03A 3U8WA 5ETIA 4FJVA 4KBKA 2GNFA 2JITA 1XMMA 3R04A 4NCTA 4XP0A 4RRVA 3KN6A 2CLXA 1XH8A 3KN5A 4K33A 4JRNA 1OKWA 5H2UA 3BELA 3JYAA 3QAME 4ZSLA 3DXNA 3QKKA 3MN3A 4OBOA 1JLUE 3HYHA 3I81A 3ZZWA 2G01A 2JIIA 3E3BX 1GZNA 4BWKA 5L2SA 5HCYA 4G6NA 4WOVA 3DPKA 2B52A 3TZMA 5FBOA 5KCVA 2XNNA 2PUPA 2P2IA 3ZBFA 2VWZA 3TN8A 1RDQE 1J1CA 4ACMA 3COHA 5FDXA 3FQSA 1BL6A 3R8ZA 4ZS4A 4IX3A 4C33A 1YKRA 1NY3A 4MTAA 4U3YA 4F6SA 3VNTA 1Q5KA 3KB7A 3Q96A 4MXXA 1FMKA 2XJ1A 1ZYDA 3OC1A 4Y83A 4WUAA 5AP4A 3RJCA 4C62A 4CTCA 2CN8A 2HYYA 5IMEA 4AN3A 2H9VA 3KXXA 3QRTA 4WNOA 2XS0A 3TNPC 3QWJA 3RK5A 3ZC5A 4Z7HA 5EYKA 2QC6A 3QTUA 4BVUA 3NUUA 2CHLA 3LM0A 5HESA 2RF9A 4JLCA 4KKEA 4QQTA 3BWFA 3QWKA 4FTJA 5E91A 4RQVA 4CMTA 3UZTA 3Q60A 3ZSHA 5EKNA 5H9BA 5HD7A 5A54A 3AKLA 1JPAA 1Z57A 1W84A 5E8ZA 4WUNA 3WF6A 4C4IA 3EN5A 2J2IB 3HUCA 2WTJA 3MYGA 4EC9A 4OTGA 1U54A 3R1SA 4EOMA 3DBEA 1QPDA 4R3PA 4QMMA 5ACKA 5T3QA 3TM0A 3LE6A 2W1GA 3C7QA 1E1VA 1GZ8A 4JG6A 1H08A 1KV2A 1ZXEA 2H34A 2VNWA 3DAEA 4L45A 2IG7A 1EH4A 3D94A 4O4CA 4E20A 3LVPA 4OTPA 4QMXA 3CGFA 2WTKC 3MFSA 3Q3BA 4YJVA 5CI7A 4QTEA 2RIOA 3PSCA 2R3PA 4EQMA 3PLSA 2CKEA 3CCNA 4RJ6A 4GYGA 4EOKA 2PHKA 4RFMA 4HVHA 5AUWA 3E8EA 3R8PA 2HZNA 4FKPA 3T9IA 2GNHA 3O71A 3QHWA 3NRMA 4CKIA 4F4PA 1FVVA 2PVNA 3ANQA 3EHAA 4NK9A 3HV3A 1Y91A 4D0WA 4D5KA 3VJNA 4M66A 4OTFA 4QDEA 3C4ZA 3ET7A 4K9YA 1UNLA 4CMOA 1ZOGA 5ANJA 2R3OA 4A7CA 5HICA 1J3HA 4RC4A 3ZFYA 5TF9A 3FYKX 3T9TA 3G5DA 4AZFA 2QNJA 2O63A 3EYGA 3U9NA 2F4JA 4X2KA 4BHNA 4ORKA 4L8MA 3A7JA 3L9MA 3GOKA 3TWJA 4HPTE 1T46A 2W7XA 3FUPA 4KKGA 4FV4A 4ZTQA 4BDEA 4GK3A 3UIBA 5FLFA 4DGMA 2V22A 4OBPA 2ZV9A 3FZ1A 2YM7A 4QMYA 4E5BA 5AAGA 3GU5A 3MA6A 4FG9A 5CAQA 2A27A 2IW6A 4O22A 1UVRA 3MH0A 5C8MA 4D2PA 3K2LA 4WNKA 4QYHA 4FSUA 4O2PA 5HG5A 2PZPA 3CKWA 3A8WA 2GS7A 5FP5A 5I9WA 4I23A 5K5NA 2GTMA 2UZLA 4ALWA 4M0ZA 4BIEA 2UZEA 2V0DA 4X2FA 2OBJA 4FZFB 4PTGA 4WNPA 2Y6OA 4W4XA 3MPMA 4AA4A 4HYUA 4M13A 4D55A 4G3EA 4W8DA 3KF7A 1OL2A 1TKIA 3N9XA 4JS8A 4ZIMA 3V01A 4JBPA 4EKKA 1UA2A 4X3FA 3RWPA 2QOHA 1U59A 3S00A 2FSMX 5AP0A 3ORLA 5DH3A 3SRVB 3OP5A 4F1OA 3LQ5A 3H0ZA 4FNZA 3GCPA 2B54A 4QRCA 2GNLA 4MQ2A 5LARA 4AGUA 3L8SA 4YZDA 5AP6A 5L8LA 5AAFA 1MQ4A 5L6WL 1L3RE 2V7OA 1WAKA 4NFNA 2PE0A 5HHWA 3H9FA 4W8EA 3VRZA 3IDPA 4RZVA 4F9WA 3FLQA 4QPAA 5K4IA 4FX3A 3QZHA 4FGBA 4ONAA 4EOLA 3LFDA 3PE1A 3W10A 2XALA 3R2YA 3UZRA 2R3IA 3D15A 2WU6A 4AU8A 4E4MA 1R1WA 1YOLA 4LDTA 2BDWA 2AYPA 3BPRA 3KFAA 3G6GA 3PXZA 3O8TA 1SM2A 3RM7A 2VD5A 3A7FA 4BTMA 4AXEA 1FVRA 5AP2A 2A2AA 2F7EE 2R3QA 2W9ZB 2YAKA 3MY1A 3KRJA 4Z3VA 5CF8A 2GHGA 4FL2A 2WMQA 4IH8A 3VBXA 2E9UA 5ETAA 3W32A 3WIGA 5L4QA 3ODZX 1M2PA 4RJ4A 1WBNA 2F7XE 3PXKA 4FTTA 3GQIA 2R3NA 2C6KA 5EK7A 3LFFA 4E6AA 4BFMA 4OTIA 3E87A 3KCKA 3ULIA 4D4YA 1PF8A 3PTGA 3QKLA 2BKKA 4YTIA 3RP9A 3D14A 3SOCA 1IEPA 4OGRA 3UVRA 4XOZA 3EKNA 1OPLA 4D2SA 3TEIA 3RBWA 4G16A 4GRBA 3JVRA 3GQLA 4EK3A 1LR4A 3W2SA 2DS1A 3K5VA 3FPMA 3CPBA 4UWBA 5F20A 2YHVA 3IGOA 3PP0A 2WNTA 4PTEA 4FG8A 1UV5A 2HW6A 4NW6A 3BBWA 5IH4A 5KMIA 4M97A 5EQEA 2C4GA 4DGNA 4AWIA 2FH9A 3EWHA 4DTKA 4RWIA 2VTPA 4U44A 4Q9SA 5DT4A 5J9ZA 4PL4A 5HE0A 1Q24A 2Z2WA 2G2HA 4JBVA 1ZWSA 2XNMA 1CDKA 4YJQA 4LV5A 3ZFXA 5F94A 4FKLA 3ANRA 2OK1A 3MVMA 3QC4A 3OUKA 3OWLA 5EFQA 5HBEA 3F9NA 2C6LA 2XNEA 4TY1A 4BICA 3R7EA 3BHUA 4GYIA 5FM2A 4QMWA 2CNUA 1AQ1A 4NM5A 4IB3A 2J7TA 3AOXA 3CE3A 4DEHA 4DTAA 1G8JA 2WELA 3D83A 3LMIA 3C9WA 4R78A 5G6VA 3ZXTA 5JN2A 4QMOA 4AW2A 1UU3A 5HG9A 1XR1A 2PVMA 4MBJA 3MSSA 4JDHA 2JKQA 2ONLA 2XYUA 5AUVA 4PNKA 3QX4A 3TKIA 5HEZA 2CNVA 4CGAA 4O4FA 5ANOA 2JIVA 1SNUA 3GC7A 3O7LB 3ZDIA 4YC3A 3DFAA 4JR3A 5A4EA 4DE4A 5CF6A 1XH4A 2JAMA 3MVJA 2QOCA 4KRCA 2IPXA 2OSCA 4M69A 3A61A 3CTHA 4EH9A 2XF0A 5IG1A 3IECA 2E9NA 1OUKA 4F6UA 3AC2A 2YISA 3R8MA 5CTPA 2IJMA 1WBWA 2FSOX 3HRCA 3FSFA 5M06A 3FSKA 4WSYA 2ITXA 3V8WA 5EHLA 4BI1A 3SKCA 3IW6A 3EQIA 2V7AA 1W8CA 4FVQA 3DQXA 5IF1A 1YOJA 3GI3A 2YIQA 3CR0A 4O38A 3HP5A 4I94A 4I1ZA 2VWUA 5CX9A 5E8YA 1ZRZA 3C0HA 3JVSA 3G33A 2J5FA 4ZTRA 4I6LA 4CFXA 5CAUA 3SXSA 3QQFA 4O0WA 5TOZA 3TUDA 2YIWA 3WI6A 3AQVA 3BU5A 3TTJA 4HYSA 2W5AA 3PA5A 3QLGA 4NW5A 4WD5A 3DS6A 3EQCA 3SVVA 4E5AX 4FR4A 4HGTA 4OTWA 4NZWB 5FEEA 3BGPA 3O17A 2VAGA 5EOBA 3NWWA 4WRGA 4L43A 1K9AA 1E1XA 2BILB 2C0TA 3QCXA 2OWBA 3GBZA 4K18A 4L3JA 4ENXA 3BHYA 4BZOA 4YSJA 3PSDA 2ZAZA 3PRIA 4RPVA 2EXMA 4I4FA 1H27A 3AXWA 5EYMA 3L1SA 3ODYX 5KKRC 2UW9A 3REPA 3A60A 4WKQA 4YO6A 3TXOA 3QYZA 1NT2A 3AGMA 1J7IA 4EOIA 3I7CA 4LG4A 3EJ1A 3CIKA 4JR7A 3PG3A 2CN5A 2WXVA 3Q2MA 3QA8A 4IB0A 5L2QA 4BCNA 4DFZE 5CAPA 2QLQA 4NIFB 1P4OA 2UZOA 4LRMA 5HGIA 4FSRA 3Q9XA 2JIUA 3OF0A 4AXFA 2YCSA 1L8TA 2P55A 3KC3A 4O7RA 3BU6A 4FNWA 3QA0A 4LGDA 1KOAA 4HOKA 5JFSA 1GIJA 3LCDA 3RKBA 4O1PA 3S3IA 2YLEA 3DK3A 3HLLA 2GFCA 5E8VA 2BR1A 5B7VA 1ZLTA 4XOYA 3N4UA 2ACXA 3RPSA 3P0MA 4XMOA 4PMMA 3GOPA 4V05A 4DG2E 3ZEPA 5E7RA 4XBUA 2JBOA 4ZZOA 4A9UA 2J0MB 4RJ7A 4NL0A 3BEGA 4MXOA 5JQ5A 5BUEA 3M1SA 5ANDA 4FIHA 4CYJA 2CKQA 1ZMWA 1H01A 3D7TA 3VS7A 2F9GA 1JSVA 1YOMA 4AACA 4C3PA 4M12A 2C3JA 4UZHA 3RK7A 4JBQA 4JAIA 3TACA 3E5AA 4F9BA 2VWBA 1Y8GA 2BDJA 4RG0A 2QQ7A 4GU9A 2W1ZA 5GINE 1Y57A 2C1BA 4AZSA 2HWOA 4QP3A 4DEAA 4BC6A 3VS3A 1W82A 4HPUE 4R5YA 3M2WA 5BVDA 1OL5A 1URWA 3H0YA 3AC1A 3EFWA 5KMOA 2VN9A 3TIZA 4A07A 4IJ9A 4S34A 3R00A 5EM6A 5DRDA 4L52A 3V5PA 4JAJA 4F1TA 3BCEA 1HCLA 4FSNA 5F95A 2BVAA 3PXRA 3ZO3A 4K2RA 4BCKA 2B53A 4R7BA 4S32A 3O8UA 3QRKA 4BN1A 3OEFX 4CFVA 5KMNA 1J1BA 1TQIA 4XYFA 3EN7A 4GVJA 4JVGA 5DPVA 3PJCA 3QRJA 2WPAA 2PVHA 1WBPA 4Y72A 1Q8UA 4QNAA 4DFXE 2XRUA 3U6JA 4UMRA 4R6VA 3RPYA 3VBYA 2C6EA 3L8VA 3UIUA 2IZSA 2W5HA 3GP0A 3H4JA 3F3UA 1IR3A 2OH0E 2Z02A 4IC8A 4CFUA 1FBNA 3FMJA 3EL8A 3KF4A 1RW8A 4HGSA 3AGLA 3EFJA 4BYJA 4RC3A 5F9EA 5I0BA 4EOPA 5HBJA 4BJJB 4KD1A 2Y7JA 3VS5A 2QO2A 2BPMA 1W7HA 3FL5A 4IM3A 4O0UA 4MCVA 3VBVA 4C2VA 4EK5A 3PG1A 2WTIA 3FMEA 4F08A 5HNBA 3CD8A 5CEQA 4E93A 1XWSA 2OH4A 4XV3A 4X3FC 2OJ9A 4CXAA 3OS3A 2BZIB 2JBPA 3H9RA 2FO0A 2V55A 2YERA 5E92A 3R63A 4IWDA 3RM6A 4CKJA 3LKMA 4M8TA 4CTBA 2BRBA 2VTMA 3K5UA 4AZEA 2I0YA 5HLWA 4YR8A 3UIXA 3KY2A 3C5UA 5BVKA 3V5TA 4B6LA 1Q61A 3HECA 4XP2A 1K2PA 3WILA 4DA5A 3PVWA 3RPOA 2J0KA 2P3GX 2QHMA 3CQWA 3F61A 3ORMA 4PDOA 2X0QA 4FT7A 1O6YA 5M4IA 2W1FA 3CP9A 3FJQE 4F9AA 3UDTA 3SG8A 1QPEA 3RNIA 5LVOA 4DBXA 2R3GA 1BKXA 2G2IA 3K3IA 4HYIA 3QQUA 5HU3A 3UIMA 5AAEA 4RVTA 3BHHA 5J7HA 4DCEA 3UODA 2WD1A 3VN9A 4S30A 1YI4A 2FVDA 1ERKA 4X6RA 4MQ1A 2AUHA 1SYKA 4HVGA 3FZSA 1XH5A 4RSSA 2YDKA 4X3JA 4RT7A 2PZIA 5HO6A 4BIDA 4NSTA 3LCSA 3RAKA 3QTWA 5IUHA 3NCGA 2XK4A 3WZKA 4HVSA 1PXNA 2QD9A 4FV0A 3VWAA 1H26A 2UZTA 5KMJA 4E4NA 3ORPA 4N6ZA 5LVNA 4ZTLA 2AC3A 3OHTA 2VTHA 4QEBA 3W0RA 3FY2A 3Q6UA 5EKOA 4ZEGA 5CQUA 2CNQA 1PXIA 4NTTA 3O7LD 2OU7A 2XAMA 2XK3A 1OI9A 1RJBA 2CDZA 4FEQA 5E4HA 4PMSA 4XP3A 5FXSA 1UKIA 2IWIA 3DB8A 3LXLA 4ZY4A 3W0QA 3PUPA 4DT9A 5IA1A 5CZIA 1PMEA 1OKVA 2BRMA 2WTDA 3E3PA 5D7VA 3G90X 3QZFA 3IGGA 3ROYA 3UJGA 4KUJA 4WA9A 3TDVA 3R7GA 1GOLA 3ENMA 4MKCA 5M07A 2OGVA 4IEBA 5H8BA 1R3CA 2V5QA 2QKWB 5FTOA 1H1SA 5AWMA 2VX1A 3MA3A 4NM0A 4AOJA 1Q8WA 2C68A 2W0JA 2XKDA 3PJ2A 4WT6A 4NH1A 5AR3A 5IA3A 5DEYA 4Z55A 3R8UA 4MEDA 3ZUTA 4AAAA 3HRFA 3KIOC 1KE5A 2OJJA 3JXWA 3LHJA 5K0KA 1F0QA 3IOKA 3CXWA 4FKQA 3EN9A 3HL7A 5HLPA 4O4DA 4MHAA 4GH2A 4J8NA 5T6KA 1MRUA 3DCVA 5A46A 4V04A 4MH7A 4F7NA 4CZTA 4KS7A 4GFGA 4PY1A 4QQ5A 4U9AA 4FZDB 3F2RA 5GZAA 1B39A 5M09A 3OBJA 3NUXA 2G15A 4EUUA 4KS8A 4X0MA 2DYLA 5E9EA 3FYJX 4JX7A 3IONA 3IS5A 4YU2A 4RIXA 1O6KA 4CRLA 4U7ZA 5M51A 3ENHA 2WTKB 3ZLWA 5DRBA 5KZ0A 5J1WA 3ELJA 2VTJA 2ZDTA 3V6RA 1ZMVA 3P5JC 4S2ZA 2OJIA 3ZCLA 3V5QA 3PY1A 3OCSA 4H1MA 4KAOA 1GZOA 3AT4A 5BNJA 4FKOA 3Q32A 2ZB1A 2QOQA 3LFEA 4AW5A 4U40A 2J0JA 2VWYA 2A4LA 2G9XA 3A4OX 1PYXA 2X0PA 3GCUA 3H10A 5IKWA 4YLJA 3G9LX 4QPSA 1H00A 4CT2A 2WIHA 2Y4IC 4PMTA 3W2OA 5LMKC 4X2JA 2WB8A 2GDOA 4BWXA 4C36A 4GIIA 3MJ1A 4JNWA 5E8UA 4KWPA 2X6EA 4IX6A 4I5PA 4ZTSA 5IA4A 5DWRA 3CSVA 1KE9A 4FIJA 2WIPA 5J79A 5FM3A 3O2MA 4BWPA 1XHAA 4O84A 2PVYA 3COKA 3LFCA 4LI5A 4NM7A 3FZOA 4IDTA 3R0TA 4FTLA 2Z7LA 4MD7E 2UVXA 4BGHA 4FIEA 1M14A 4AZWA 3THBA 5IH5A 4J97A 4N6YA 2XANA 3C5IA 3EQHA 4KINA 4RQKA 3QD2B 4DH3A 5KMKA 2BALA 2ZV2A 4ASXA 1B6CB 3FAAA 3E63A 4EI4A 2J50A 4U42A 3R7UA 3NDMA 3ORTA 2CMWA 3BGZA 3F5XA 2YM6A 4YTHA 5KBRA 4JIAA 4RC2A 2NPQA 3LQ3A 5C9CA 2DQ7X 3MFTA 5CNNA 2C3KA 1J91A 1KWPA 5EHOA 2CGUA 1IA8A 4Z9LA 2BAJA 5FEDA 3RTPA 4QMZA 2BHEA 5FRIA 4D5HA 4G9RA 4EZ5A 2I6LA 4TTHB 2DUVA 3F2AA 4EJNA 3LXKA 4UBAA 4O6LA 3MB6A 2E9PA 4PL3A 2O65A 2AQXA 1U4DA 3QXPA 2QHNA 2CGXA 3ZSGA 4O7ZA 3PJ1A 3LPBA 3VVHA 4EJ7A 4AP7A 3V5LA 3VUIA 2IZRA 5ETCA 3COMA 4EONA 5BVOA 3VF9A 4HW7A 4K1BA 2CCIA 1GZKA 2JGZA 3B2WA 1APME 3WZEA 3OY1A 4DHZA 5DN3A 4TL0A 3R8LA 1H1WA 3QTSA 4Z7GA 2WQEA 3F66A 4ARKA 3SGCA 2UZVA 3HMNA 4XEYA 5AM6A 4EH3A 4L3LA 2Y6MA 4Y73A 5A3XA 3UC3A 4ZY6A 4F63A 4M0YA 5HNGA 4DEGA 3RINA 4D28A 4D4RA 5DBXA 3ZLXA 1WVWA 2O8YA 2P4IA 4FTRA 4FOCA 1P2AA 2YIXA 4RVLA 2UW0A 3EQBA 2O2UA 3FI2A 4FTOA 1YXXA 5HX8A 3VS6A 4BBEA 3SC1A 2WAJA 4H3BA 4P4CA 2HWPA 3KL8A 4GV1A 4PPBA 4JXFA 5AP3A 3ORIA 4USEA 3DZOA 4YJSA 4TN6A 2HCKA 2UZUE 3FZPA 4MBIA 3VUGA 4L00A 3NAXA 1BMKA 1GY3A 3HKOA 3KXNA 5D9HA 4DH7A 4F0FA 2W1DA 4RA4A 4XS2A 3HVCA 3B8RA 1H1RA 3P7CA 1SVGA 3P4KA 1CMKE 4L46A 1OKZA 3VIDA 4IMYA 3LMHA 4C4FA 1CSNA 3BU3A 4FKIA 4I5MA 4TYEA 2GHLA 3CJGA 4H36A 2A98A 4TZRA 4AOTA 4BL1A 4F9CA 3PDTA 4TYIA 3NGAA 2ZV8A 2BCJA 2XK6A 3ZDUA 2YAAA 4G6LA 4MF1A 4TWNA 3I4BA 2YM8A 4KABA 4Y46A 3SG9A 3U4WA 3HNGA 4DHJA 3KCFA