2XCHA

Crystal structure of pdk1 in complex with a pyrazoloquinazoline inhibitor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
278
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSNFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
publication title Structure-Based Optimization of Potent Pdk1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 278
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xchA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xchA01
2R3OA 5LMKC 3DV3A 2YHVA 3O8UA 2JITA 3EZVA 1NVRA 1IAJA 3DT1A 4PUZA 1IG1A 4IVBA 2PVLA 1MRVA 4R77A 3DK7A 5CT7A 5HQ0A 2X2LA 4DGOA 3OCGA 3U8WA 2H96A 5KBRA 2C6KA 4QYFA 3VC4A 3DK6A 3AD6A 3EIDA 4EUUA 3EB0A 3QALE 2R3HA 5HX6A 5DH3A 3E7VA 1M2RA 1Q8WA 4NCTA 4M15A 5FGKA 1YDSE 3R8UA 3ZTXA 4P5QA 3ZSIA 4QMNA 3NYOA 4MH7A 1A9UA 4RA5A 4UMPA 5LJJA 5BUEA 3AGMA 1YKRA 2CPKE 2C5OA 4N4SA 2C6TA 5AP3A 4FTAA 5HCYA 1H1PA 4IW0A 2I1MA 3EFWA 1Q5KA 3DBQA 4KIPA 3GU6A 3S95A 3UJGA 5FDXA 5BVNA 4L67A 4Q9ZA 4U41A 5AUYA 4U8ZA 4DGGA 5AUWA 4RZVA 4U81A 4IADA 2ITWA 5AV2A 4DC2A 2WMQA 2W06A 2CGXA 5FLFA 3WIKA 4BYJA 3QL8A 4XV2A 4LOPA 4L7FA 3Q3BA 5CVGA 4XG7A 5C4LA 2XK6A 3E88A 4DT8A 4FT0A 5E9EA 2JBOA 2OZAB 1IR3A 1YDRE 2WOTA 3R7YA 4QMQA 1URCA 4FYNA 2RFNA 2VX3A 2QHMA 2WMVA 3BQRA 3ETAA 3P9JA 4F4PA 4LUDA 5JRSA 4GT4A 4YJVA 3SLSA 3A7IA 2HZNA 2GNFA 4GCJA 4ZSLA 4QYGA 4TL0A 3C9WA 4QQ5A 3OY1A 1K2PA 3ET7A 5IQAA 3PLAE 2WKMA 4EHZA 4IVCA 3FMMA 3RK9A 4CV9A 1UKIA 4FC0A 3O7LD 1HOWA 5HGIA 3ZZWA 5JRQA 5A46A 3SW7A 3UZPA 2CGUA 2IWIA 4QP2A 1PMEA 3HUCA 1FBNA 5HD7A 5ICPA 4OTPA 5I3OA 3WARA 1LEZA 5J8IA 2J2IB 4GL9A 4FT5A 5EQEA 4DT9A 3UNKA 4JX3A 5EQYA 4FSNA 4IC7A 4PDPA 4F99A 5CAQA 4JI9A 4MXYA 1KSWA 1H25A 2XVDA 2FSMX 3ZRLA 3VUHA 4L3JA 3VJOA 3NW7A 4XG6A 4IVAA 4AZSA 3KXMA 3D14A 3CJFA 4FKPA 2YACA 3JY0A 3T3UA 4FKVA 4X2FA 5JMSA 2F9GA 4D28A 4M13A 2HELA 3LXNA 4ZZOA 4YTCA 5GZ9A 1OUKA 3FPMA 3ORIA 5CU6A 3GU8A 3PXFA 4MXCA 5DE2A 5JGBA 4C3FA 4YHJA 5HNGA 3V8TA 1ZY5A 2OJGA 3KMWA 1JVPP 4Z7GA 2GS6A 3ERKA 5AA8A 3P7BA 4XBUA 2E9UA 5HO8A 5L6WL 3D94A 5CSVA 3F69A 2W0JA 4MF0A 4BDHA 4G5PA 2ITPA 3DDQA 3PWDA 1T46A 1OECA 1H1QA 3UVRA 3FLZA 4DFYA 3PXYA 4FSWA 3BGPA 4K9YA 4DFUA 4YLKA 4U44A 3A7GA 5IISA 4DGMA 4PQNA 4J96A 1QPEA 1XH5A 1SVHA 3BZ3A 4FICA 3ZLSA 3Q4ZA 3FMNA 2REIA 3KB7A 4D9TA 4F9CA 2JIUA 4DGLC 4EOIA 3HZTA 5JFWA 2BZJA 3LJ0A 3AT4A 3CXWA 4WNMA 4FNXA 1Y91A 4OTWA 5HTIA 1ZARA 4I94A 4P2KA 1LP4A 1H8FA 4RZWA 3BYOA 4DH1A 5IUGA 2JLDA 3HEGA 4Z9LA 4YZMA 4Q9SA 5DRDA 1NVSA 4HVIA 4YO4A 5DYJA 3W16A 1UNLA 3GU5A 3IGGA 3R1NA 1R0PA 1H1RA 4OUCA 5L6OA 2ERZE 5ANDA 2VTQA 3H3CA 3E5AA 3QXOA 4FTLA 4F7JA 3SV0A 5IQGA 1WFCA 2W1EA 1IA8A 4BBFA 4LI5A 2OXDA 4K2RA 5AA9A 1Q8ZA 5JZJA 2JFMA 3ITZA 4EKKA 2NRUA 3MV5A 3U87A 2UZOA 3N4VA 4KS8A 4USDA 4UWYA 4C33A 4CFUA 3FLSA 4MXAA 2LAVA 5CT0A 4DCEA 3HMNA 5IPJA 4PX6A 5GZ8A 5AP1A 2FUMA 2WQOA 3TJDA 4ASZA 4F64A 4O0XA 4Y46A 3ZEWA 1XBCA 5FP6A 3ACJA 4NTTA 2QU6A 5BMMA 4F70A 4LOOA 2ETKA 5AV0A 4ERWA 3QCXA 3FUPA 4QYYA 2QOFA 5TT7A 4FKLA 3DBFA 2BRHA 4GFOA 4UZDA 5AMNA 3VS5A 4ZXTA 4ALWA 4I6BA 2UV2A 3RPOA 4TRLA 1YWVA 2XNMA 3PY1A 1JSTA 5E8XA 4XOZA 5KBQA 5E1SA 4FSYA 4TN6A 4DEHA 5HZNA 3GC0A 3P7CA 2BALA 3I81A 3S2PA 2F4JA 3I79A 4AWIA 2XNNA 5DR2A 4S31A 5EI6A 4EH8A 3D5WA 5HI2A 3SW4A 5LVNA 4XX9A 3GB2A 4X2KA 3G15A 1W83A 2FSLX 1L3RE 4F7SA 5HCZA 2ESMA 2WD1A 3FZTA 4G3FA 2P55A 4O96A 4WRGA 5DIAA 3TTIA 3ZRMA 5F9EA 4O7VA 4JRVA 4YTFA 3GCSA 3EN4A 3I6WA 4A9TA 4DF3A 4XP3A 1KOAA 3AC2A 2WMXA 1OM1A 2IZRA 3H0YA 3MBLA 3MB6A 4JR7A 4PF4A 2I0EA 3DLSA 4LYNA 3QQUA 3DZOA 3PA5A 5HOAA 4V04A 4YTIA 4MBJA 4EOMA 2JGZA 2ERKA 2XZSA 3PE1A 3R7VA 2X4FA 3UGCA 1Y57A 3UQCA 4V01A 3ZC6A 3OTVA 3I0QA 5GJGA 3LHJA 4HYUA 2YLEA 1ZMUA 1B6CB 3WBLA 2Y6MA 2P33A 2P2IA 2QO9A 3HUBA 1KE9A 2QKRA 4Y8DA 4FV9A 3SRVA 5HIEA 4YSJA 4FTMA 3HA8A 3KCKA 4BCJA 4EH4A 1YXXA 3SX9A 3W32A 3K2LA 2B9IA 3BYSA 5IKWA 2IN6A 3ORLA 5IDPA 3DTWA 3VS7A 5H3QA 5HVJA 4Q2AA 4BCFA 3UMXA 4A4LA 4LUEA 1JWHA 5EYCA 4N70A 3LE6A 2QHNA 4QP3A 3EYGA 3DLZA 4PPCA 4XV1A 4J53A 3PZEA 3R6XA 4MVFA 4O21A 4UXQA 4E26A 4FEVA 2CKOA 2ZJWA 2VUWA 3HECA 4ALVA 4WKQA 5EYKA 2ZDTA 3Q5IA 1QPDA 4Y83A 3RVGA 4BIDA 4EHVA 2HY0A 3O71A 4HZSA 4GKIA 3CCNA 2FB8A 2C5YA 1M7NA 5FG8A 3F9NA 4R8QA 3UP2A 2BHEA 2UZUE 1P4OA 3FHRA 2X6EA 4RX7A 3TN8A 4BWPA 4FA2A 4GEOA 3LQ5A 1PXMA 1GIHA 2XM9A 2WAJA 3QGWA 3RKBA 4IWOA 4BCQA 2WHBA 3QF9A 2OKRA 3KF4A 1W8CA 1OBDA 4L3LA 1V0BA 3CJGA 4LOQA 4OBPA 4XRLA 4RQKA 1TKIA 5HX8A 4W4WA 5JFSA 5ANJA 2ONLA 2OFVA 2OW3A 3LFCA 5HE2A 2PULA 3ANQA 4Z16A 4ZY5A 2HXQA 5HE3A 3TZ8A 3KMMA 3ZBFA 2Z7SA 3SXSA 4IZ5A 4O38A 4R7HA 3IO7A 4O7NA 4Y5QA 3VS0A 2PUIA 5J1WA 1QMZA 2UW7A 1OKWA 4FV0A 3HL7A 3AC5A 1ZXEA 3FZ1A 5DR6A 2YM6A 5C03A 3ZLXA 2OJFE 2WTKB 3FKNA 4S2ZA 2PVMA 5CTPA 1YDTE 4I93A 4YJOA 3SDJA 3V5PA 3DTCA 3R9RA 1URWA 2WZJA 4O0YA 5L8JA 4RVTA 5KMKA 1KOBA 2I40A 3ZEPA 3D2IA 4P90A 4AZVA 2ZDUA 3ZXTA 4X7QA 3QAME 4E4LA 4KA3A 3QCQA 4GMYA 3QQJA 1W98A 4X3FA 2XKCA 3PDTA 4IB0A 5HLNA 2J0LA 3AC1A 1F5QA 3HV6A 3SVVA 5CVHA 1WBWA 2R3KA 3QGYA 5EDRA 2VWUA 3TKIA 4C62A 5ANIA 4IFGA 4L46A 4USFA 1BLXA 2A4LA 3GGFA 4K77A 4QT1A 5AAFA 4B6LA 1RW8A 1U54B 2DQ7X 5HG8A 3RM7A 2WMBA 5CF6A 4O22A 4DLIA 2W1GA 4C2VA 4WT6A 1J3HA 1XH7A 2PVNA 3C0IA 3DPKA 3V5LA 3VUGA 1PKGA 3V3VA 4FL2A 3CIKA 3OP5A 5AIRA 4YJQA 1OL1A 3BV3A 2C3KA 1XH4A 5B2LA 1PXKA 3EQHA 3HRFA 2BDFA 3G6GA 4GUEA 4CFMA 3P08A 3HRCA 4K6ZA 2IJMA 2WB8A 3TZ9A 4EH9A 2AC5A 2XK7A 5HE0A 4GK3A 4GV1A 3MVMA 2UZNA 4U9AA 3ZBXA 1CSNA 5IMXA 5AV1A 3TDWA 3BU5A 1QCFA 4GT5A 5JFVA 1JNKA 5M51A 4FKWA 5KMNA 3DAJA 4NYEA 4I4FA 2VTLA 3O2MA 1YRPA 3QYZA 2XF0A 4RC3A 4BGHA 3SGCA 4W9WA 2Q0BA 1NA7A 1Q3DA 2J51A 3OD6X 4JT3A 3D5UA 5KE0A 4PY1A 5CI7A 3UODA 5M55A 5CU2A 1FMKA 1Q8YA 4RJ3A 2WU7A 1Q8UA 4W9XA 5BPYA 4YHTA 4XG4A 2HW7A 3SKCA 3DQWA 4FOBA 2FSOX 5FEDA 2Z8CA 2QC6A 2IO6A 4E1ZA 4RWLA 2X2MA 4FZ6A 4QYEA 2HW6A 4J1RA 2B7AA 3TWJA 3WF6A 3MY1A 3ANRA 4N6YA 3ODZX 1DAYA 4BCKA 3O51A 2P0CA 1ZMVA 4ASEA 4GVAA 4OGRA 3VBXA 5CY3A 5GJDA 5IA2A 4BCPA 2C47A 3CTHA 3UIXA 3ZU7A 1QPCA 3FMEA 4FK3A 2JDOA 3QKMA 3Q9ZA 4PPBA 3OG7A 3PA3A 4RA4A 5K5NA 4MD7E 2J9MA 3UOJA 1OZ1A 2BZHB 3BKBA 4ANLA 3C51A 3BBTB 1BL6A 3SG9A 5FM3A 1TQPA 4MXXA 3PP0A 4M3QA 4NH1A 5DLSA 3UZTA 4N57A 3ATTA 4PDSA 5HG7A 2G2IA 2Q0NA 4ZY4A 5A4LA 3KQ7A 2X2KA 4WG5A 4KNBA 4UWCA 3R8LA 3MJ1A 4LG4A 2RSVA 3OXIA 4HYSA 4W4VA 4EOSA 1I09A 5J9ZA 2OO8X 3OWJA 1FINA 4PTCA 3AXWA 4IAAA 4USEA 4WSQA 2VWWA 3FYJX 4QNAA 5L8LA 4QRCA 3LCDA 1QL6A 2GSFA 4ANOA 1Z5MA 4IWDA 4RX8A 5KZ0A 4ZMEA 3LFQA 2VTSA 3ZDUA 4UV0A 5AUZA 3C4FA 3EQGA 4FV5A 4C35A 2KULA 1UWJA 2XJ2A 5CXZA 3KC3A 4YJUA 1XWSA 5EW9A 1S9JA 3WE8A 3S0OA 4BZNA 2GHLA 3D7TB 3OZ6A 3CP9A 4C57A 2XMYA 3UVQA 3F3WA 2VAGA 4K18A 1LR4A 1WVWA 3GQIA 5FBNC 5LWMA 3I0OA 3CY3A 3KULA 3ZO4A 4ZEGA 4D2PA 1OVEA 4DEDA 3OT3A 5HEZA 4EUTA 5IMEA 5BVEA 4D5HA 2YM3A 1JSUA 1XH6A 4ZZMA 4JG6A 1RQQA 3UBDA 4O1OA 4XNEA 4RG0A 4FSTA 2PMIA 3FE3A 1DM2A 2PWLA 3S3IA 1GIJA 5I4NA 2YIYA 4Y72A 3DFAA 4DEEA 1M52A 5EQPA 3RM6A 2AUHA 4ALUA 3HAVA 1ZMWA 1H27A 5HESA 4DEIA 4E4NA 2IVSA 3ZUVA 2WMTA 3LCOA 4A9YA 4E5WA 4I4EA 5HICA 4NFMA 4EOLA 3BPRA 5HHWA 4DE4A 1SMHA 4KKGA 3A4OX 1VR2A 3BI6A 3E63A 4MK0A 2BROA 4GG7A 5AUUA 5AM6A 5TE0A 4M8TA 5D9HA 5JFXA 5EOBA 2F7EE 4NZWB 3RTPA 4AT3A 4A4XA 2W9FB 3VN9A 3EQBA 4EOOA 5JH6A 3QD3A 3DCVA 5K3YA 5DA3A 3JUHA 3OT8A 4MD8E 5FXQA 4RFMA 4CLJA 5AR7A 3TT0A 3ZCLA 3R8ZA 2P4IA 2Z7QA 4IWPA 4L45A 3NCGA 4TNDA 3QRTA 3NUYA 1OKVA 4HGEA 4Y85A 3OWPA 3BYVA 4AE6A 5A54A 2WTJA 3VS1A 2RIOA 4YBJA 4NM3A 3RAKA 4FTCA 4GIHA 3DXQA 2E9NA 3DK3A 4WIHA 4EH3A 4E73A 3Q9WA 3SAYA 5IEYA 4KUJA 4ITHA 4FTOA 4FZAB 4QP7A 2CKQA 2B53A 3QQGA 5EDQA 5AUTA 2PE2A 4XH6A 5D41A 4GW8A 4KABA 3F5PA 2CN5A 1KV1A 3I4BA 3I7CA 1H24A 3N4TA 4GK4A 5KHXA 3MVLA 3RCJA 5FUTA 4TXCA 3LPBA 5ANEA 3Q60A 4NUSA 3W18A 4DEAA 3H9OA 3PRFA 3QYWA 4Q5EA 5KHWA 4IDVA 4AZTA 4YUQA 3GFEA 3DAKA 3GBZA 4JVGA 5DR9A 3MFRA 4HVGA 1W0XC 3F2NA 2OFUA 3RALA 2X8IA 2UW9A 3NUPA 3DKGA 4YZDA 3ELJA 3L8PA 3L8XA 2F7ZE 3NS9A 3DJ6A 4J71A 4M66A 4MKCA 4FV6A 5CLPA 5EK7A 4ZY6A 1O6YA 3BE2A 3BLHA 2CLQA 2XH5A 3ORPA 5LVMA 1B39A 2QLUA 4I5CA 3THBA 3EQFA 2C3LA 5FWKK 4RBLA 4DLJA 4CKJA 2GHGA 2VD5A 1OL7A 5DN3A 3W55A 1OBGA 4BY9E 4FNZA 1H01A 1NXKA 5B0XA 3R73A 3PPJA 5EDPA 5J9LA 5AX9A 4XRJA 3U55A 1KUTA 2RKUA 5H8BA 4OTDA 2W17A 3DBCA 2OG8A 4JBVA 4UYAA 2PMLX 3EYHA 2YN8A 3OFMA 4BKJA 5CEPA 5K4JA 4RFYA 1BX6A 3W2PA 2Z7RA 5KX8A 1H28A 3LOKA 4RFZA 3D0EA 3KCFA 3BU6A 3Q04A 4TW9A 2YIRA 1H0VA 3C1XA 3FMKA 4MF1A 3CGFA 2UW6A 2W1ZA 2XIKA 3QC4A 4IZYA 2QI8A 5A4TA 3CPBA 2OIDA 3COMA 4S30A 4BRXA 3CLYA 1U46A 4FTTA 4FT3A 4B0GA 3R7OA 4BGGA 5J5SA 3ROCA 1PMVA 4O82A 3FV8A 3CTQA 1KWPA 4LM5A 1E1XA 2PZ5A 2E9OA 3QA8A 2O63A 5JEBA 4AGUA 3UO6A 1ZOGA 4MWHA 4RJ6A 4QMSA 5A6NA 4BICA 2GDOA 5EM7A 4WOVA 3HLLA 3F82A 1OKZA 4L53A 1WVYA 1PXOA 3TIZA 2W5AA 3BHTA 2BRBA 3L9LA 4OR5A 2WQNA 4CTCA 3CQUA 4I3ZA 4O0RA 4KIKB 2XM8A 1Y8GA 3BELA 3R7GA 2HOGA 3HGKA 2FYSA 4FIEA 2XK3A 3RBWA 4FG9A 4EQUA 5IH5A 2ZOQA 2EXEA 4BDBA 1ZAOA 2FO0A 5AP4A 2KTYA 4AA5A 2PUNA 1PMUA 5J79A 4J8NA 1OIYA 3O8TA 2JKMA 2VGOA 4FEQA 2GHMA 2OIQA 5FM2A 2HZ4A 5IA5A 4HYIA 5J7BA 3GFWA 4QMZA 5CSWA 5DT3A 5EKNA 2WTDA 2VTOA 1OL2A 3PJCA 1REKA 4E4MA 3CGOA 2BUJA 3VS4A 3RNIA 3MH3A 4F09A 1JLUE 3RJCA 3E64A 1W82A 3WF7A 3VBVA 4AP7A 4NJDA 4GK2A 5A14A 5BYZA 3PXRA 5J9YA 1JAMA 2GS7A 2PMNX 4JXFA 3D15A 4XCUA 4F6WA 2NRYA 2OK1A 2UZEA 2ZB0A 3AGLA 3V6RA 4EBWA 2HWOA 2PL0A 2QQ7A 3PXQA 5EW8A 4AAAA 1ATPE 2V5QA 5J1VA 1P5EA 4L52A 3GT8A 4U43A 1ND4A 3W2CA 4E6AA 3EKNA 4YSMA 2JDVA 3OOMA 4R3RA 4ZZNA 4D9UA 2JAVA 2VTNA 1TVOA 3L9PA 3R28A 3PP1A 5KKRC 4WRSA 2VTHA 3S4QA 4RIOA 5DT0A 4RLLA 4ZSAA 2Y8OA 1PF8A 1WBVA 2UW3A 4A9UA 4BCIA 4G2FA 4BBMA 4RIWB 4YBKA 2GTNA 3K3JA 3OC1A 1J1BA 4EEVA 4RWJA 3ODYX 5BUIA 4FUYA 4LFIA 4P7EA 4CZYB 3VS6A 2OGVA 3NUAA 4HPTE 4JQEA 2C0OA 3DAEA 1Q97A 5KUPA 3N4UA 4ZLOA 1CDKA 2QOLA 4NCTC 4AZWA 2R3JA 3BLRA 2PSQA 2PYWA 3LFDA 3PG3A 3WE4A 2J0MB 2QNJA 2C6OA 5GJFA 2B0QA 3U6HA 2YABA 2GCDA 3CEKA 2PZPA 3ZXZA 2G1TA 4OAUC 2R3IA 3UZRA 3FXWA 2XNOA 4WA9A 1H0WA 3LMGA 3QWKA 4BDCA 3UYSA 2JFLA 4MWIA 3N9XA 3JYAA 2OJ9A 4GJ3A 4UB7A 3MGYA 4B99A 2VNWA 3AC4A 4FSZA 3BYUA 3QRIA 5L2QA 4HVSA 3ZONA 3IW5A 2I0HA 4I41A 5FRIA 2JIIA 3QKLA 4AZEA 2R64A 3QZGA 4L7SA 4BVUA 1WBNA 1STCE 1XJDA 3OTUA 1O6LA 4NKAA 1G8SA 2GNJA 3SG8A 3Q52A 2W4OA 3PXKA 3GCUA 3UO4A 3FPQA 3QQKA 5FQDC 1ZYCA 3ALOA 4HGTA 4RJ5A 2X39A 4ARKA 1FOTA 3FQEA 4PP9A 3VS2A 3WYYA 4AUAA 1JQHA 3KMUA 3ZM4A 3LCSA 3NIZA 4DEBA 3K5UA 2YA9A 2Y9QA 1LUFA 1UA2A 3R1YA 3TZMA 4EWQA 2CN8A 2WQMA 3ZFXA 5I9UA 3JPVA 2Q83A 3RPYA 4UX9A 4NW5A 5HLPA 5GZAA 3IKAA 4G34A 4NIFB 4M69A 5HVYA 4D1SA 4YPDA 5AM7A 4FX3A 4EJ7A 4E93A 4FKRA 3AC3A 2W4JA 3QD0A 4FV2A 4UBAA 3IOPA 4O83A 3SXFA 4E3CA 2VU3A 4JX7A 5CYIA 4TTHB 3KY2A 5AIKA 5IZFA 4GU9A 5K9IA 4GYGA 3G33A 2W5HA 3KU2A 4YJRA 2J4ZA 5C9CA 4NM5A 5L2TA 4KRCA 4EQMA 1UU8A 2ZM3A 2FA2A 2YERA 3CY2A 2G01A 3PLSA 3QD2B 2WTVA 4FKTA 4AE9A 5M57A 4PNKA 3REPA 3I6UA 4W8DA 3D2KA 3D9VA 5CAPA 5A4CA 2R3FA 3HVCA 4A9SA 2YLFA 3HYHA 2WTCA 4AG8A 2Y0AA 3GVUA 3KRLA 4G17A 5LVLA 4CFFA 4F9BA 4FEXA 4E5AX 4DG2E 3U4WA 3RK7A 4EOQA 4F6UA 4DGNA 5DBXA 5HORA 4EZ5A 1TQMA 2C5VA 5LWNA 1WZYA 4CZUA 1NVQA 3F3UA 4OW8A 3VQHA 4JIAA 3LLAA 1G5SA 4FIJA 2XJ1A 4CFNA 1M14A 2A2AA 3E92A 1SNUA 3POZA 4N6ZA 4RC2A 5J7HA 4D2TA 3DKFA 4O27B 4WBOA 5KZIA 5A6OA 5A4EA 2BKKA 1PYXA 2UZBA 3BWJA 4H3PA 4FEWA 1M7QA 3RHXA 5AR8A 2XIXA 4U42A 4LV5A 3ZC5A 4F0FA 3ORNA 4NM7A 1Q99A 2X7OA 4JG7A 5HTCA 4XLIA 3DOGA 3OVVA 2OZAA 1DS5A 4KSQA 2G2FA 1R1WA 4UMQA 2BFYA 3BGQA 5CU0A 3PVGA 4XG2A 5K0XA 2UVZA 3LQ3A 4YTHA 4IEBA 3EN6A 2ZM1A 4NM0A 4EYJA 2GQGA 1GZ8A 2LGCA 3VW6A 3IDCA 5IDNA 5BVFA 4RVMA 3HKOA 3NX8A 4IIRA 5CSPA 1CKPA 4IX5A 2ZVAA 3JXWA 3NSZA 1XKKA 4MAOA 3II5A 4HNFA 1FVVA 4EONA 2ITYA 3TKHA 5EOLA 2W1HA 3CE3A 3ENMA 3BGZA 4ZTLA 2X0GA 3R21A 3UPZA 4MNEB 4EZ7A 1W7HA 5E91A 4AOTA 2Z7LA 1YWNA 1J7UA 1IAHA 5IH4A 3R63A 3LLTA 2BIKB 2YM4A 4FI1A 3IK3A 1UWHA 5D1JA 4J7BA 5HBEA 3U6JA 4JG8A 2VO7A 3LFFA 2EWAA 4Z7HA 4EH2A 1PXPA 5FTGA 3IDBA 1MRUA 2R0IA 3FXXA 4IAYA 3HX4A 3QD4A 4JDIA 4L3PA 3RHKA 4BDIA 5JT2A 3RWPA 1E9HA 3QHRA 3C4XA 4RJ4A 4TWOA 2RG5A 3HV7A 4FTQA 4ZK5A 4BC6A 4TT7A 1JSVA 4YZ9A 3ZFMA 3FC1X 3TDVA 3M2WA 1L8TA 4DINA 2OXXA 4MBLA 3B2TA 4D0XA 3FKOA 2A0CX 2Y6OA 4I0SA 4EH6A 3CD3A 2VTMA 3OHTA 3G5DA 5T68A 5BNJA 3MTLA 4KWPA 4HPUE 3G9NA 5LCKA 2IW6A 3VRZA 4F1TA 3GU4A 5HCXA 2A19B 3CQWA 4WUAA 3DBDA 3AMBA 4QQJA 5CI6A 4ZSJA 3DB6A 4H1JA 5DOSA 1UNGA 2JDRA 3G0EA 3RI1A 4AN9A 2EXMA 5HNBA 1Y8YA 4G6LA 2GNIA 4LV8A 4AZFA 3M11A 1K3AA 4F0IA 5DWRA 1GAGA 1OKYA 2WTIA 3MSSA 3QZHA 1WAKA 5DRBA 4I23A 4F65A 2O8YA 3D7ZA 4MQ1A 4GH2A 3ALNA 1V1KA 5EM6A 2OJIA 3W10A 3UIUA 4DFLA 5LCJA 4FSUA 2FH9A 4K11A 3UOHA 4C0TA 4R6VA 2ZV2A 1AD5A 1OI9A 2R3PA 3EWHA 3P23A 4MYGA 3R83A 2CGWA 3V5WA 4FKGA 3Q9YA 5CU3A 3VHEA 2ITOA 5ANKA 5C01A 4DYMA 4YJSA 3R8MA 3PSBA 2OIBA 4RX9A 4M67A 2C69A 4ZSEA 4M0YA 1IRKA 4GKHA 1HCLA 4A7CA 4BDAA 2QD9A 3TIYA 3R30A 4BCMA 5CSXA 3E93A 3OS3A 2GNLA 2IZSA 2C68A 4PDOA 4FYOA 4J97A 2RGPA 4BBEA 4R1VA 3DZQA 4C3RA 5CANA 4XOYA 4M84A 4C58A 2W1DA 2UUEA 4CFWA 4F63A 2ZAZA 4FV1A 4D55A 4IX6A 2JEDA 4JOAA 1SM2A 3RCDA 5DEYA 4U45A 1JKSA 2BTRA 3AD4A 4NU1A 2UZTA 3QQFA 3VUIA 2ONLC 2W4KA 3ORXA 3T9IA 4BYIA 3OCTA 5B2KA 5L2WA 4H05A 3LM0A 4XYFA 2PUPA 2HXLA 2F57A 2VWXA 4TYHB 4CXAA 4FIFA 4CFXA 2V22A 4C3PA 4ASXA 2PHKA 3PIYA 4CKIA 4OT5A 4QP6A 3C5UA 3OWLA 3DY7A 3LQ8A 3KRJA 3F2AA 4I6HA 1VZOA 4FL1A 4WG3A 4EHGA 3C13A 2J0JA 3MS9A 4TWPA 5C1QB 2BMCA 1OPJA 4APCA 1OL6A 1BMKA 1UU3A 2VRXA 4V0GB 4CMUA 4ONAA 5E8YA 4AA0A 3RMFA 3RINA 2UW0A 3WZDA 3F5GA 3JY9A 2WMAA 4JBOA 4EC9A 4R7BA 2C6MA 4FEUA 2YIWA 1ZLTA 1BKXA 4XG8A 4HVDA 2YZLA 2WMRA 3QTQA 2VX0A 4ZJJA 4X3FC 3O17A 4AN2A 2QODA 1RDQE 3MA3A 3KVXA 3LFAA 4XMOA 3TV6A 2I6LA 3E62A 3FLQA 3EN5A 4M14A 3E7OA 4DTBA 1CTPE 3KXZA 5C8MA 2YDIA 5AP2A 5IF1A 1NW1A 3PWYA 4DFZE 2BKZA 2OJJA 5LVPA 1J1CA 5E7RA 1UNHA 1X8BA 2VWVA 3LVPA 3U4UA 3BYMA 3NNVA 2BRGA 5M4CA 3W8LA 5KMLA 2V55A 4AW0A 3KULB 2ITVA 3HV4A 1U5RA 4RVLA 1Z9XA 3QHWA 4PDYA 4DFNA 3SD0A 2CNVA 4RQVA 4OTHA 5CASA 2J0KA 4U5JA 4QPAA 1OMWA 4CG8A 4I20A 3ATSA 3BU3A 3TZ7A 4FG8A 3BX5A 3QZFA 2ITQA 3F66A 4G3GA 4MEDA 4UMTA 2IW8A 3RAHA 4O0TA 5IQCA 3FSKA 2PMOX 1DAWA 2BILB 4YZNA 3F2RA 3F5UA 5EYMA 4C59A 5TKDA 4O7RA 5ETCA 3NUUA 3QLFA 5BYYA 4QTCA 3R7UA 4F1MA 2OU7A 3FHIA 4BCNA 4K8AA 2QOBA 4I92A 2PE1A 3NAYA 4BI1A 4B9DA 2HZ0A 3D5XA 3ZH8A 3TG1A 2PUUA 2YIXA 3GCVA 3KN6A 4FTNA 5TR6A 2YCSA 1YWRA 5FDPA 2YZAA 5CWZA 3FWQA 2WXVA 4YLJA 2XRUA 5CX9A 5H9BA 3TNHA 2BAQA 2VWYA 4YNEA 4BDFA 1R39A 4CYIA 1XR1A 5E8VA 3ORTA 2JDTA 3NAXA 4CLIA 3F6XA 2ZYBA 5AADA 2VGPA 2XYUA 2PTKA 1PHKA 3BEAA 3PY0A 3IS5A 3Q6UA 4QMLA 2JD5A 5LMBA 2HY81 4IAZA 1OGUA 4QO9A 4A4OA 1YI3A 3EL8A 3DQXA 4D0WA 2VO6A 1FVRA 4O7WA 3NIEA 2W7XA 3P0MA 3VVHA 3VS3A 1WBSA 4IB5A 3W2SA 4IDTA 3WI6A 4KIOA 1W84A 2H9VA 3ROYA 4O81A 3GCPA 2W05A 3P79A 2QR8A 4O0VA 5KCVA 4KAOA 4YC8A 1Q8TA 2NPQA 2P2HA 4QPMA 2XEZA 4GJ2A 3UIBA 5BQ0A 3K54A 5IA4A 5DG5A 4UY9A 3W2OA 2I0YA 3DNEA 4LMNA 5E8WA 4CT2A 3ZMMA 1PW2A 4TPTA 3BCEA 1H00A 3O8PA 4O2PA 5FXSA 4TYIA 2R3LA 4F9AA 3HMOA 3FKLA 4JRNA 4ACCA 4E4XA 5ETIA 3FY0A 2DWBA 4O0UA 3QTZA 5EHYA 3Q53A 4RIXB 3C0HA 4WSYA 4ZTNA 3SQQA 3RGFA 1MRYA 5K4IA 2XS0A 1G3NA 4FKJA 4RMZA 5GINE 4KS7A 2B9FA 5BVDA 5I9WA 1OITA 3VF9A 3NYNA 4BTKA 3LKMA 4BKZA 2OZOA 2J5FA 3ORZA 4LGHA 4PMMA 2GQRA 5I3RA 2UZDA 5DVRA 3OW4A 3ZO1A 2OH0E 3C5IA 2UVYA 4HOKA 3MPAA 2ZMDA 3HV3A 2YAAA 2QG5A 3PTGA 3HV5A 3U6IA 4IANA 2G9XA 2CNQA 1TQIA 5T6KA 3BHHA 3G51A 4LGGA 5IQHA 3FMDA 1I44A 2UZVA 3KFAA 2W96B 1ZYJA 4FV4A 4EOJA 4P5ZA 3A60A 1PJKA 3U51A 3LFBA 1ZZ2A 4ZAUA 4ZSGA 1FPUA 4BHNA 3V51A 2ZMCA 1PMNA 3DKCA 4PV0A 2BHHA 1YOLA 1V0OA 4W8EA 4DH3A 4CVAA 1PXIA 3OF0A 3ZZEA 3E8DA 3IPHA 1KE5A 4ZS4A 2O65A 5M4IA 4BGQA 1WMKA 4L43A 4QD6A 4NKSA 2A27A 3OUKA 3IW7A 4L68A 2XIYA 3COIA 4ZTHA 2ZV7A 3LCTA 1ZRZA 2W1CA 5M56A 3BE9A 4IFCA 3ZUTA 2OF2A 5GHVA 2JKKA 3TNWA 4JLCA 3G2FA 4DFXE 5I9ZA 1OB3A 4PRJA 1M2QA 2JKQA 1LPUA 3F7ZA 2PVJA 4IC8A 4X3JA 1M2PA 5HKMA 4BCHA 1MP8A 2WU6A 1VYZA 2A1AB 2WO6A 3FLWA 3HMIA 2HIWA 4DCAA 3GC8A 4FKQA 3RPVA 4YURA 2O2UA 3CSVA 2I0VA 4OTGA 4TYJA 4AU8A 3E87A 3PYYA 2VWZA 5IA3A 1U4DA 2UW5A 1JPAA 2B9JA 4I1ZA 4IACA 2XIZA 5EH0A 4BF2A 4FSMA 5AX3A 4C8BA 5DFPA 3SOCA 4PL5A 3MPTA 1PXNA 4G9RA 4XP2A 2R3MA 4BDGA 4MQ2A 4RT7A 4E6DA 3FL4A 5GIPE 2YEXA 3G6HA 3QTRA 4UZHA 3R22A 4TWNA 3GUBA 4H39A 4AT4A 2CLXA 3KGAA 3EHAA 4CD0A 1SNXA 2JIVA 3UOKA 4EBVA 4BN1A 3EFLA 3QZIA 4ITJA 4U3YA 3EQRA 2GNHA 3OEFX 4EK8A 3LMHA 1NT2A 3Q5ZA 4HCUA 1P4FA 1JKKA 5E8ZA 4FTIA 4CTBA 4O86A 3PPKA 4BDJA 4J52A 3UO5A 2XIRA 4A06A 2XCHA 5FTOA 4ZMFA 3IDPA 4FZDB 4PL4A 3BBWA 4XUFA 4C4IA 2HENA 4AGWA 4FIGA 5L4QA 2OBJA 3TI1A 4JDKA 3V8WA 3KN5A 4EYMA 4O7LA 3MDYA 3NCZA 4MNFA 2V7AA 3D7TA 1WBPA 4ZIMA 5KKRB 4FT7A 1Q24A 3V04A 1BUHA 1SZMA 3PIZA 3PPZA 3LZBA 4IMYA 2QOIA 2PK9A 4OTFA 3L8VA 4IZ7A 4JL9A 4V05A 2NNWB 4GFMA 1UU7A 1Z57A 5AUVA 4O91A 5IUHA 4HJOA 1BL7A 1ZYDA 2Y4PA 4GRBA 2PVHA 4AA4A 3R1QA 2GU8A 3KKVA 1K9AA 2WOUA 3EOCA 2WTWA 5FBOA 3TUDA 3H0ZA 4O84A 2PPQA 4DTKA 4IXPA 2R2PA 3IECA 4YJPA 3UYTA 5CS6A 4F1OA 1J91A 4O7SA 4AQCA 3JR1A 4D2VA 4I0TA 3HNGA 1YHWA 2VO0A 4FIHA 4G6NA 2X7FA 3AC8A 4HZRA 4QYHA 5HVKA 3DXNA 3KK9A 3PVBA 3HAMA 3LW0A 4NSTA 5CSHA 4ZJVA 4W4YA 3GNIB 5CF8A 3PFQA 2IG7A 4XV9A 2YWVA 1FMOE 2BAKA 4L9IA 1WBTA 3EZRA 3VJNA 3C4EA 3PG1A 3SC1A 3T8OA 1XBAA 2CKPA 1YQJA 3PIXA 1GZNA 3I60A 4QPSA 1H07A 4E7WA 4M7IA 2HYYA 4ANQA 4C4JA 5LQFA 1PRYA 3GC9A 3GCQA 4C37A 4CMTA 1XO2B 3LFEA 3KF7A 3C7QA 4PTEA 2JBPA 4XBRA 1CKJA 4QMMA 3B8RA 4ASDA 3H30A 4DBXA 3AT3A 3R00A 3V01A 5IUIA 3I1AA 4RVKA 3FLNC 3NNWA 5G6VA 3A7FA 4FUXA 5AV3A 3FLYA 4YMJA 5I0BA 4FTUA 4BFMA 3BQCA 3B8QA 3VUMA 1OIRA 3K5VA 4CFVA 2PVYA 3Q4TA 4C2WA 5JGDA 3KXNA 3HRBA 3BLQA 3BV2A 5JQ5A 1P14A 4LGDA 4WNPA 4YU2A 3AMAA 4UYNA 3DKOA 2BIYA 3KRXA 3NR9A 2P3GX 4MXZA 3HDMA 1V0PA 2CCHA 2CCIA 3RAIA 1J7LA 3ZM9A 4WO5A 2VTRA 4TKSA 4C38A 5C26A 5EHOA 4Y95A 4HGLA 2R3QA 4D1XA 3VUTA 2UVXA 4DTAA 1NY3A 2HZIA 3FMJA 3RZBA 5CEKA 3DA6A 3BRBA 4G5JA 4FNYA 3UG1A 2RL5A 4KBCA 3R71A 1Q41A 2B52A 4H3QA 4XJ0A 2C6LA 4HW7A 1IEPA 4UALA 4IH8A 4X0MA 5HG5A 3RPRA 5I9XA 3KRWA 3PRIA 3LMIA 1SVGA 5LMKA 2XK9A 2C3IB 4KKEA 5ACKA 5JGAA 5D12A 4PMTA 4IVDA 2XYNA 5EFQA 1ERKA 4ANBA 4ENYA 2VV9A 4QMPA 5JZNA 4F7NA 2YCFA 3ULZA 2PZYA 4MBIA 3WIGA 1XQZA 4OBQA 3Q4CA 4NW6A 3VF8A 2FVDA 3MIAA 2XJ0A 3JS2A 5TF9A 3FL5A 5J5TA 1SVEA 3O50A 2YM7A 3WZKA 5EHLA 3R0TA 2Z2WA 4FSQA 5ACBC 4GUBA 3VW8A 3OBJA 4CMOA 3DJ7A 5HBJA 3M1SA 4MD9E 3ENHA 3ULIA 2BRNA 2QVSE 4BHZA 1VYWA 1GY3A 4CV8A 4AN3A 2BVAA 3MW1A 3W8QA 4AXAA 1Q3WA 2HK5A 4EQCA 3IONA 4QQTA 3CS9A 1A48A 1FGIA 4I5PA 2X7GA 2ZB1A 1HCKA 2ITNA 4TNBA 3E8CA 2QOHA 1AGWA 4I24A 2GNGA 3ZHPC 3Q6WA 3ACKA 1YI6A 4EOPA 3TM0A 5JSMA 4TYEA 2C6DA 4FTKA 4CSVA 3QCYA 4OTQA 4BKYA 5CNNA 5E92A 4FL3A 5IA0A 4IWQA 5HTBA 2QOQA 3P86A 3R2YA 2Y4IC 5GNKA 1PXLA 2QO7A 3WZEA 1YOJA 3W2RA 3R7EA 5AP0A 3BEGA 5HE1A 2OH4A 2B55A 1YHVA 3TJCA 4EK4A 3ZFYA 5CEMA 2HCKA 4RC4A 3QTSA 4LL0A 3MY0A 3QQHA 1GOLA 4GS6A 2NP8A 3LAUA 5E8UA 3TV7A 1OUYA 4ACMA 5L8KA 1S9IA 3CC6A 2C0TA 4AW1A 5KMOA 3GU7A 3TV4A 5TOZA 1OL5A 1UU9A 4JBPA 3KEXA 3I7BA 4CCUA 4NL0A 1E1VA 4QNYA 2FSTX 2O0UA 4WHZA 4KIKA 5A4QA 1Q62A 2C1BA 3FI4A 4XV3A 4JDJA 4CQGA 4QP8A 4BWKA 5HIDA 5F1ZA 5DT4A 4FVQA 3F3ZA 1VEBA 5ANOA 3V5TA 1WVXA 5B2MA 4L44A 4EH5A 1IA9A 4TYGA 3VUKA 2EU9A 2C4GA 3MI9A 4FG7A 5C27A 2J6MA 2XUUA 3F3TA 2GTMA 1GZOA 2WMSA 3PVUA 5D11A 3VHKA 5H8EA 4KB8A 1PY5A 4CQEA 3OWKA 1F3MC 2WEVA 4ZOGA 4C4FA 4C7TA 4DG0E 1J7IA 3B2WA 3EN7A 4LRKA 4R3PA 2F7XE 4B4LA 2EB3A 2WIHA 3R9NA 4HYHA 2YISA 3HDNA 4IAKA 4IQ6A 4Y5HA 5L6PA 3VAPA 4QMOA 4R5YA 4RIYA 2IVUA 4C4EA 4U3ZA 2W5BA 3L1SA 3QRKA 1YXSA 1H4LA 3FQSA 4GSBA 4S32A 3FZSA 2GFSA 2QLQA 2YITA 3FAAA 4O7YA 2J5EA 4FV3A 5CAVA 2C30A 2VTAA 3BHVA 3H9RA 2R3RA 3KVWA 2QU5A 2YDJA 1ZY4A 4FTRA 4YJNA 5HU3A 1U5QA 4L6QA 4BTJA 1JBPE 2AC3A 2OF4A 1QPJA 3S00A 2CDZA 1PKDA 2C1AA 4ORKA 2YM8A 3MTFA 5M4UA 3FI3A 3E3PA 2XP2A 3NUNA 4WUNA 5IQFA 3C4ZA 5J95A 2OXYA 5HO7A 2ZV8A 5FXRA 3NEWA 2YWPA 3R9HA 2VTTA 4JDHA 3TCPA 5M44A 3CBLA 4RIWA 2WEIA 2VWBA 4TZRA 3SRVB 5CNOA 3IGOA 5B7VA 4F7LA 1UKHA 2YJRA 2RF9A 3NNXA 1WCCA 5KMMA 4IM0A 4FODA 5AWMA 3NGAA 5J87A 3HA6A 3KK8A 1FVTA 3MA6A 4CT1A 4LQMA 4M97A 1ZOHA 5HO6A 3MYGA 4RJ8A 4R78A 2IPXA 4RLKA 5CXHA 4UWBA 2OI4X 3FQHA 4KBAA 3WF8A 2VTIA 5C4KA 3FXZA 2DS1A 1ZWSA 3ID6C 2VN9A 3TXOA 4QP1A 4HGSA 3UC4A 4KRDA 4EOKA 2WNTA 3NDMA 2PZIA 4XG9A 4CCBA 1R0EA 2AYPA 5EM5A 3SOAA 3FI8A 3LXPA 5EKOA 1R78A 4C34A 4G3DA 4PTGA 3VQUA 5IH6A 3WILA 2QURA 1OPKA 3C0GA 3QCSA 2C6EA 2YCQA 4FVRA 3VBYA 5I9VA 3UOLA 2WIPA 4O7TA 3FZPA 5ANGA 3NW5A 5E1EA 4BIEA 5BUJA 2PVFA 3NVMB 5F95A 3R1SA 4JBQA 4DEGA 4YR8A 2X1NA 3PXZA 4EWHA 3FJQE 2BZIB 2IZTA 4U79A 2F49A 4A9RA 4F0GA 3QWJA 4YP8A 5CEOA 3FBVA 1XHAA 2BR1A 2VTPA 3DFCB 5AFVA 2B54A 1GNGA 1Q4LA 2QOKA 3HMMA 2ITZA 4H58A 1BI8A 4ANMA 3AOXA 3HMPA 2YM5A 5AAEA 4E5BA 3DB8A 3L9MA 3VIDA 3JVRA 4FR4A 4UXLA 3C4WA 4IAIA 4AW5A 2XA4A 5EI2A 4D2WA 5DNRA 5CF5A 4ZP5A 4GU6A 2R0UA 4NIFA 1KE6A 3G9LX 4O0WA 3UP7A 4BI2A 4EC8A 4BZDA 4QTAA 4D2SA 4Y73A 2XCKA 4IJPA 4FV7A 4O6LA 4X3FB 3EFKA 2VNYA 3LCKA 4U40A 3VNTA 4EORA 3OXZA 1UV5A 4KINA 2CNUA 2VX1A 5HBHA 3AD5A 4FVPA 4FV8A 4G9CA 4I5MA 4TY1A 4WBBB 4AS0A 2W9ZB 4QTDA 5D7VA 3F5XA 1VJYA 4JQ8A 3I5NA 4XLVA 4I0RA 3UQFA 3FSFA 2B4SB 3D5VA 4MCVA 4AF3A 5C8NA 1MQ4A 2QONA 5HD4A 1UVRA 3QC9A 3FMLA 3ZLWA 4B7TA 3DGKA 4OTRA 3EQIA 3OCSA 4EZ3A 1YXUA 3QBNA 3PJ3A 3U9CA 4AACA 3WYXA 2Z60A 4EKLA 4AT5A 4QP4A 3QTIA 3HP5A 3W1FA 4H1MA 4AFEA 3FZOA 3NUXA 4O0SA 2C5NA 4CYJA 5CVFA 5AR4A 5AP5A 2QR7A 4G6OA 3VBTA 5M09A 1XH9A 3PJ1A 4XP0A 4LL5A 3TNIA 4IE9A 1ZOEA 3V5JA 4BDDA 4IM3A 3ZS5A 3DNDA 3IW6A 4J98A 4D4YA 4EK6A 4QMYA 3QTXA 3Q4UA 4CRLA 2XBAA 5FP5A 4S33A 3ZYAA 4BR3A 2BDJA 4C36A 4C4GA 3W33A 5EI8A 3RZFA 4YC6A 5FEQA 4FKIA 3WF5A 4DITA 4KKHA 1P2AA 3R8VA 1SYKA 3D4QA 3BWFA 4FNWA 2PY3A 3P7AA 5E4HA 3QXPA 3QUPA 2SRCA 2ETMA 2O5KA 5H2UA 2PVRA 3FEGA 2PZRA 3CTJA 2J50A 2XK8A 2XB7A 3A99A 3H4JA 3MN3A 4QMXA 2BCJA 2OLCA 5E8TA 5D10A 3EFJA 5JKGA 2W1IA 4FZFB 3ZO2A 1Y6AA 4XEYA 1KV2A 2O64A 4ZLZA 3FYKX 2QCSA 5C8KA 5AJQA 4MNEA 4ZTRA 3RAWA 5L2IA 3CPCA 4LRMA 3FI2A 4WNKA 2R7IA 4D58A 4EJNA 3NZ0A 4YC3A 3MESA 3EJ1A 4IX4A 3ZO3A 5IQDA 4DBNA 2GFCA 5A3XA 3E8EA 3IQ7A 3U9NA 3EN9A 3V6SA 3ZUUA 3PUPA 2HAKA 4L42A 3F3VA 1PXJA 2VTJA 2OICA 2YDKA 3KXGA 4Z3VA 2PVKA 3EL7A 5DPVA 2JDSA 3WZUA 3IOKA 4J99A 3R8PA 2YAKA 1A06A 4H3BA 4BIBA 5JN2A 1ZZLA 4XHKB 3MFSA 5ITAA 1CMKE 1O6KA 2C3JA 5F94A 5K5XA 5BVWA 2ACXA 3HP2A 3NLBA 5AP7A 4X2NA 3POOA 2GPHA 4HCVA 4L01A 3OMVA 2F2UA 2R3GA 3UIMA 2XKFA 3KXXA 3P1AA 5BYLA 4G1WA 2XK4A 3FY2A 3EQDA 2XRWA 4BI0A 3ORMA 1YHSA 3TKUA 5DMZA 4QMUA 3N51A 3L9NA 1R3CA 4DH5A 2B9HA 4N0SA 4C4HA 1OIUA 4NTSA 4M68A 4DAWA 3DXPA 3R9DA 5JK3A 1FGKA 4G31A 2W99B 2YIQA 3O23A 4QOXA 3GC7A 1B38A 4KBKA 2JC6A 1YXVA 3PY3A 4L00A 2X4ZA 3UMWA 1ZYLA 2W1FA 4U97A 2QOOA 2ZM4A 2J0IA 3W2QA 5GIOE 2YCRA 2ITXA 3MFTA 2H34A 2ETRA 2UZLA 4U7ZA 5LMAA 4ACGA 3E3BX 3MFUA 2IVTA 4CRSA 3A8WA 1EH4A 4FMQA 4HNIA 4UMRA 4EHEA 3F88A 3KXHA 4ZTQA 4AOJA 3COHA 1KE7A 3IW4A 4JNWA 4YO6A 2XNBA 4F6SA 3AT2A 4PWNA 3EMGA 4EK3A 5BVKA 1H08A 1IASA 2B1PA 3F7WA 2DUVA 3RK5A 1JKLA 4IZAA 4RWIA 4EK5A 1DI8A 2X8DA 4M12A 4RWKA 3NUSA 4Q5HA 4YJTA 3T9TA 5AAGA 2XKEA 4D1ZA 5E90A 4JIKA 4NT4A 3OCBA 3QU0A 5CEQA 2QOCA 3L8SA 5M4FA 4HVHA 3QUDA 4MXOA 1CKIA 4DA5A 2QO2A 3LXLA 3P4KA 4D4VA 1GZKA 2OWBA 4OT6A 3OROA 1PYEA 3OUNB 3PSCA 3OOGA 5DEWA 5CAOA 4EL9A 3OEZA 3NYXA 4FTJA 3LJ1A 4IJ9A 5IEVA 3OW3A 4C02A 4ENXA 4QTBA 4HCTA 4NEUA 5BMSA 1APME 4TYHA 5G1XA 4AGDA 1OIQA 4MTAA 4O2ZA 5AR2A 4IAFA 3O96A 3UNJA 3RNYA 1MQBA 2Z02A 4JJRA 2C5XA 5K0KA 5CENA 4GT3A 3MPMA 2V62A 4AGCA 5CQUA 5D7AA 4V0GA 4IBMA 3MY5A 2WTKC 1YW2A 3QQLA 4ZTSA 2BDWA 1U54A 3F61A 4TWCA 5HNIX 4DHFA 2BZKB 1AQ1A 5BVOA 4D2RA 4ACDA 1F0QA 3SHEA 5HIBA 1O9UA 5M07A 2BRMA 3U54A 4FKOA 5DI1A 4CG9A 4IX3A 5DHJA 3NRMA 2BPMA 4CGAA 3MIYA 1OPLA 2WQEA 4OLIA 3UVPA 3QUEA 4UN0C 4UMUA 4RPVA 4WNOA 5TO8A 4NFNA 3TEIA 5EG3A 3IW8A 4E8AA 3DJ5A 4ERKA 2WQBA 2C0IA 2CSNA 2EVAA 3PZHA 4J8MA 3MH2A 4O7ZA 3DDPA 2BFXA 4PP7A 1YXTA 2CKEA 4QMWA 4RJ7A 4II5A 4U0IA 5EM8A 3MH1A 5F4NA 2F2CB 3CKXA 5FEEA 2JKOA 5HLWA 5I5ZA 3NNUA 2RFSA 3R9OA 4CEGA 4NJ3A 4BZOA 4R5SA 3AG9A 5I9YA 1RJBA 5E8SA 4FGBA 3I5ZA 3PVWA 3MWUA 3PSDA 3ZSHA 4D4SA 3CKWA 3A2CA 4IB3A 2CJMA 4A07A 3QX4A 2UW8A 3Q2JA 3UDBA 3FZRA 5EW3A 4IB1A 3TACA 4B8MA 4F9WA 4RRVA 5IEXA 2EXCX 2X8EA 3CD8A 3KL8A 4IM2A 4R7IA 3Q32A 3M42A 3V8SA 4OAVB 5AR3A 2O3PA 2QG7A 2EB2A 1CM8A 2X9EA 3UTOA 3VRYA 3QTWA 4BB4A 3KRRA 1JKTA 3VBWA 4PMSA 3Q2MA 3S1HA 4AX8A 4DH7A 5T3QA 4FGRA 3TL8A 4F9YA 4DFBA 4OBOA 5FD2A 3OY3A 3COKA 4MX9A 2WPAA 2JAMA 4JAJA 2E9PA 3IG7A 3ORKA 4YLLA 3TTJA 5LOHA 2NO3A 2ZV9A 4FF8A 3TNPC 5LXMA 3G0FA 1YOMA 5A9UA 2XNGA 1H1SA 4FSRA 4YNOA 2XEYA 3LM5A 3P5KA 3ZRKA 2CMWA 3WZJA 2XNEA 4X2JA 5CAUA 1KE8A 2R3NA 5HG9A 1LEWA 4YZBA 4EH7A 2DYLA 3QLGA 5AR5A 4GYIA 2FGIA 3VUDA 4PPAA 3LJ2A 4BTMA 2G2HA 2GMXA 2ITTA 3DU8A 1MUOA 2EUFB 2UZWE 3QRJA 3R2BA 4KD1A 4QTEA 4FKUA 3C50A 4G3CA 3R7IA 4BDKA 4ZLYA 5LVOA 3R04A 5DGZA 4CKRA 3R01A 4R1YA 4DH8A 4K0YA 3O7LB 2C6IA 4ITIA 1G8AA 2VO3A 3PJ2A 3RWQA 2WFYA 2YJSA 2H8HA 3A4PA 4LRJA 5IA1A 2OSCA 4NK9A 1T45A 4YGAA 5ETAA 1YVJA 5IQEA 2J7TA 2R7BA 2RG6A 3NYVA 4GG5A 4ANNA 3EQPA 4GFGA 4BDEA 3FC2A 4D5KA 5KMIA 4ANSA 3DBEA 4WG4A 5CQWA 5M08A 5IG1A 2E9VA 3BHUA 3PA4A 1BI7A 1H1WA 3WF9A 4EI4A 3BHYA 4D4RA 4Z55A 3TUBA 3MVJA 4RGJA 2R5TA 1Q61A 4ID7A 4RIXA 4I6QA 2VZ6A 2X81A 4UEUA 2WGJA 2PU8A 3RPSA 3EKKA 4FKSA 1XH8A 3JVSA 4BCGA 3QA0A 2H6DA 3A7HA 4YHFA 3VO3A 4WD5A 4AFJA 5CF4A 3UG2A 3D83A 2XNPA 5CZIA 3ZDIA 3ZSGA 3KA0A 4MHAA 4ACHA 3QFVA 1Y6BA 3QTUA 5BX0A 1H26A 4AOIA 1DI9A 3QRUA 2WMWA 5M53A 5CEIA 4E6CA 1XBBA 4DG3E 4CNHA 5CZHA 4X6RA 1GJOA 1ZYSA 3GI3A 3TUCA 3GEQA 5FTQA 5AEPA 5HU9A 5IQIA 4GVJA 4X6QC 3NWWA 4QQCA 5AUXA 3KREA 3LIJA 2GS2A 4QMVA 3LFNA 4S34A 3NPCA 1YI4A 3DS6A 3OBGA 2R9SA 3VULA 3RP9A 2UW4A 3NMUF 4FIIA 3C4CA 3GXLA 4GIIA 2IVVA 4M0ZA 3GENA 5KO1A 4RX5A 2Y4IB 2CHLA 4JQ7A 2XKDA 4FT9A 3UE4A 3VWAA 4J95A 1REJA 2G15A 3CQEA 4W4XA 3A61A 3O0GA 2V7OA 4JS8A 5EYDA 4I5HA 4JR3A 2VWIA 4O1PA 1RE8A 3UPXA 3BIZA 5L3AA 3FDNA 3LFSA 3QKKA 4I6FA 2J90A 2R4BA 4F08A 3G90X 4L8MA 2WMUA 4FK6A 4APPA 3A8XA 5H8GA 3SXRA 2BAJA 4YPSA 4BL1A 3ZLYA 4H36A 4QP9A 3EH9A 5ETFA 5CU4A 4PNIA 2RFEA 3UQGA 4FZ7A 4KIQA 5LARA 4U80A 4IHPA 2V0DA 4X2GA 4FOCA 2X6DA 4KSPA 4PMPA 5IQBA 3K3IA 3QX2A 4ZJIA 2RFDA 3H10A 2HWPA 2QKWB 3GOPA 3GQLA 3MB7A 3MH0A 4E6QA 1WBOA 5KMJA 3AMYA 3T3VA 4K1BA 5IU2A 3V5QA 3OXTA 1M17A 4QMTA 1GIIA 3GOKA 4XG3A 3FMHA 3NVKI 3WOWA 4B8LA 2YFXA 4PL3A 4R3CA 4C61A 3R02A 4U6RA 2XBJA 4AW2A 4ZTMA 4RSSA 5M06A 4YZCA 3ZOSA 3MJ2A 3GP0A 4G3EA 4XS2A 1U59A 1BYGA 3PJ8A 1JOWB 4G16A 2WELA 3LXKA 3A7JA 3NW6A 3Q9XA 3UC3A 5JQ8A 3UNZA 5CALA 5KNJA 5F20A 4BCOA 4BTFA 4P4CA 4FBXA 4FE2A 4X21A 4ZS0A 3E8NA 3Q96A 2PE0A 3AQVA 4I21A 5AP6A 5L2SA 2IW9A 4I22A 1FQ1B 4E20A 4LMUA 4JAIA 4NWMA 4OTIA 3P78A 4M69B 4DN5A 3MVHA 2BTSA 3H9FA 2Y7JA 2X9FA 3TNQB 3EQCA 5AV4A 3SA0A 3A62A 3VBQA 4BWXA 4O6EA 3CR0A 4RIYB 2E2BA 3PE2A 2I7QA 2GQSA 2ITUA 2CGVA 4CZTA 2IZUA 4K33A
chains in the Genus database with same CATH superfamily
2R3OA 5LMKC 3DV3A 2YHVA 3O8UA 2JITA 3EZVA 1NVRA 1IAJA 3DT1A 4PUZA 1IG1A 4IVBA 2PVLA 1MRVA 4AQKA 4R77A 3DK7A 5CT7A 5HQ0A 2X2LA 4DGOA 3OCGA 3U8WA 2H96A 5KBRA 2C6KA 4QYFA 3VC4A 3DK6A 3AD6A 3EIDA 4EUUA 3EB0A 3QALE 2R3HA 5HX6A 5DH3A 3E7VA 1M2RA 1Q8WA 4NCTA 4M15A 5FGKA 1YDSE 3R8UA 3ZTXA 4P5QA 3ZSIA 4QMNA 3NYOA 4MH7A 1A9UA 4RA5A 4UMPA 5LJJA 5BUEA 3AGMA 1YKRA 2CPKE 2C5OA 4N4SA 2C6TA 5AP3A 4FTAA 5HCYA 1H1PA 4IW0A 2I1MA 3EFWA 1Q5KA 3DBQA 4KIPA 3GU6A 3S95A 3UJGA 5FDXA 5BVNA 4L67A 4Q9ZA 4U41A 5AUYA 4U8ZA 4DGGA 5AUWA 4RZVA 4U81A 4IADA 2ITWA 5AV2A 4DC2A 2WMQA 2W06A 2CGXA 5FLFA 3WIKA 4BYJA 3QL8A 4XV2A 4LOPA 4L7FA 3Q3BA 5CVGA 4XG7A 5C4LA 2XK6A 3E88A 4AXCA 4DT8A 4FT0A 5E9EA 2JBOA 2OZAB 1IR3A 1YDRE 2WOTA 3R7YA 4QMQA 1URCA 4FYNA 2RFNA 2VX3A 2QHMA 2WMVA 3BQRA 3ETAA 3P9JA 4F4PA 3O5AA 4LUDA 5JRSA 4GT4A 4YJVA 3SLSA 3A7IA 2HZNA 2GNFA 4GCJA 4ZSLA 4QYGA 4TL0A 3C9WA 4QQ5A 3OY1A 1K2PA 3ET7A 5IQAA 3PLAE 2WKMA 4EHZA 4IVCA 3FMMA 3RK9A 4CV9A 1UKIA 4FC0A 3O7LD 1HOWA 5HGIA 3ZZWA 5JRQA 5A46A 3SW7A 3UZPA 2CGUA 2IWIA 4QP2A 1PMEA 3HUCA 1FBNA 5HD7A 5ICPA 4OTPA 5I3OA 3WARA 1LEZA 5J8IA 2J2IB 4GL9A 4FT5A 5EQEA 4DT9A 3UNKA 4JX3A 5EQYA 4FSNA 4IC7A 4PDPA 4F99A 5CAQA 4JI9A 4MXYA 1KSWA 1H25A 2XVDA 2FSMX 3ZRLA 3VUHA 4L3JA 3VJOA 3NW7A 4XG6A 4IVAA 4AZSA 3KXMA 3D14A 3CJFA 4FKPA 2YACA 3JY0A 3T3UA 4FKVA 4X2FA 5JMSA 2F9GA 4D28A 4M13A 2HELA 3LXNA 4ZZOA 4YTCA 5GZ9A 1OUKA 3FPMA 3ORIA 5CU6A 3GU8A 3PXFA 4MXCA 5DE2A 5JGBA 4C3FA 4YHJA 5HNGA 3V8TA 1ZY5A 2OJGA 3KMWA 1JVPP 4Z7GA 2GS6A 3ERKA 5AA8A 3P7BA 4XBUA 2E9UA 5HO8A 5L6WL 3D94A 5CSVA 3F69A 2W0JA 4MF0A 4BDHA 4G5PA 2ITPA 3DDQA 3PWDA 1T46A 1OECA 1H1QA 3UVRA 3FLZA 4DFYA 3PXYA 4FSWA 3BGPA 4K9YA 4DFUA 4YLKA 4U44A 3A7GA 5IISA 4DGMA 4MUQA 4PQNA 4J96A 1QPEA 1XH5A 1SVHA 3BZ3A 4FICA 3ZLSA 3Q4ZA 3FMNA 2REIA 3KB7A 4D9TA 4F9CA 2JIUA 4DGLC 4EOIA 3HZTA 5JFWA 2BZJA 3LJ0A 3AT4A 3CXWA 4WNMA 4FNXA 1Y91A 4OTWA 5HTIA 1ZARA 4I94A 4P2KA 1LP4A 1H8FA 4RZWA 3BYOA 4DH1A 5IUGA 2JLDA 3HEGA 4Z9LA 4YZMA 4Q9SA 5DRDA 1NVSA 4HVIA 4YO4A 5DYJA 3W16A 1UNLA 3GU5A 3IGGA 3R1NA 1R0PA 1H1RA 4OUCA 5L6OA 2ERZE 5ANDA 2VTQA 3H3CA 3E5AA 3QXOA 4FTLA 4F7JA 3SV0A 5IQGA 1WFCA 2W1EA 1IA8A 4BBFA 4LI5A 2OXDA 4K2RA 5AA9A 1Q8ZA 5JZJA 2JFMA 3ITZA 4EKKA 2NRUA 3MV5A 3U87A 2UZOA 3N4VA 4KS8A 4USDA 4UWYA 3UDSA 4C33A 4CFUA 3FLSA 4MXAA 2LAVA 5CT0A 4DCEA 3HMNA 5IPJA 4PX6A 5GZ8A 5AP1A 2FUMA 2WQOA 3TJDA 4ASZA 4F64A 4O0XA 4Y46A 3ZEWA 1XBCA 5FP6A 3ACJA 4NTTA 2QU6A 5BMMA 4F70A 4LOOA 2ETKA 5AV0A 4ERWA 3QCXA 3FUPA 4QYYA 2QOFA 5TT7A 4FKLA 3DBFA 2BRHA 4GFOA 4UZDA 5AMNA 3VS5A 4ZXTA 4ALWA 4I6BA 2UV2A 3RPOA 4TRLA 1YWVA 2XNMA 3PY1A 1JSTA 5E8XA 4XOZA 5KBQA 5E1SA 4FSYA 4TN6A 4DEHA 5HZNA 3GC0A 3P7CA 2BALA 3I81A 3S2PA 2F4JA 3I79A 4AWIA 2XNNA 5DR2A 4S31A 5EI6A 4EH8A 3D5WA 5HI2A 3SW4A 5LVNA 4XX9A 3GB2A 4X2KA 3G15A 1W83A 2FSLX 1L3RE 4F7SA 5HCZA 2ESMA 2WD1A 3FZTA 4G3FA 2P55A 4O96A 4WRGA 5DIAA 3TTIA 3ZRMA 5F9EA 4O7VA 4JRVA 4YTFA 3GCSA 3EN4A 3I6WA 4A9TA 2NYAA 4DF3A 4XP3A 1KOAA 3AC2A 2WMXA 1OM1A 2IZRA 3H0YA 3MBLA 3MB6A 4JR7A 4PF4A 2I0EA 3DLSA 4LYNA 3QQUA 3DZOA 3PA5A 5HOAA 4V04A 4YTIA 4MBJA 4EOMA 2JGZA 2ERKA 2XZSA 3PE1A 3R7VA 2X4FA 3UGCA 1Y57A 3UQCA 4V01A 3ZC6A 3OTVA 3I0QA 5GJGA 3LHJA 4HYUA 2YLEA 1ZMUA 1B6CB 3WBLA 2Y6MA 2P33A 2P2IA 2QO9A 3HUBA 1KE9A 2QKRA 4Y8DA 4FV9A 3SRVA 5HIEA 4YSJA 4FTMA 3HA8A 3KCKA 4BCJA 4EH4A 1YXXA 3SX9A 3W32A 3K2LA 2B9IA 3BYSA 5IKWA 2IN6A 3ORLA 5IDPA 3DTWA 3VS7A 5H3QA 5HVJA 4Q2AA 4BCFA 3UMXA 4A4LA 4LUEA 1JWHA 5EYCA 4N70A 3LE6A 2QHNA 4QP3A 3EYGA 3DLZA 4PPCA 4DDGA 4XV1A 4J53A 3PZEA 3R6XA 4MVFA 4O21A 4UXQA 4E26A 4FEVA 4F78A 2CKOA 2ZJWA 2VUWA 3HECA 4ALVA 4WKQA 5EYKA 2ZDTA 3Q5IA 1QPDA 4Y83A 3RVGA 4BIDA 4EHVA 2HY0A 3O71A 4HZSA 4GKIA 3CCNA 2FB8A 2C5YA 1M7NA 5FG8A 3F9NA 4R8QA 3UP2A 2BHEA 2UZUE 1P4OA 3FHRA 2X6EA 4RX7A 3TN8A 4BWPA 4FA2A 4GEOA 3LQ5A 1PXMA 1GIHA 2XM9A 2WAJA 3QGWA 3RKBA 4IWOA 4BCQA 2WHBA 3QF9A 2OKRA 3KF4A 1W8CA 1OBDA 4L3LA 1V0BA 3CJGA 4LOQA 4OBPA 4XRLA 4RQKA 1TKIA 5HX8A 4W4WA 5JFSA 5ANJA 2ONLA 2OFVA 2OW3A 3LFCA 5HE2A 2PULA 3ANQA 4Z16A 4ZY5A 2HXQA 5HE3A 3TZ8A 3KMMA 3ZBFA 2Z7SA 3SXSA 4IZ5A 4O38A 4R7HA 3IO7A 1W2FA 4Y5QA 3VS0A 2PUIA 5J1WA 4O7NA 1QMZA 2UW7A 1OKWA 4FV0A 3HL7A 3AC5A 1ZXEA 3FZ1A 5DR6A 2YM6A 5C03A 3ZLXA 2OJFE 2WTKB 3FKNA 4S2ZA 2PVMA 5CTPA 1YDTE 4I93A 4YJOA 3SDJA 3V5PA 3DTCA 3R9RA 1URWA 2WZJA 4O0YA 5L8JA 4RVTA 5KMKA 1KOBA 2I40A 3ZEPA 3D2IA 4P90A 4AZVA 2ZDUA 3ZXTA 4X7QA 3QAME 4E4LA 4KA3A 3QCQA 4GMYA 3QQJA 1W98A 1ST4A 4X3FA 2XKCA 3PDTA 4IB0A 5HLNA 2J0LA 3AC1A 1F5QA 3HV6A 3SVVA 5CVHA 1WBWA 2R3KA 3QGYA 5EDRA 2VWUA 3TKIA 4C62A 5ANIA 4IFGA 4L46A 4USFA 1BLXA 2A4LA 3GGFA 4K77A 4QT1A 5AAFA 4B6LA 1RW8A 1U54B 2DQ7X 5HG8A 3RM7A 2WMBA 5CF6A 4O22A 4DLIA 2W1GA 4C2VA 4WT6A 1J3HA 1XH7A 2PVNA 3C0IA 3DPKA 3V5LA 3VUGA 1PKGA 3V3VA 4FL2A 3CIKA 3OP5A 5AIRA 4YJQA 1OL1A 3BV3A 2C3KA 1XH4A 2X0PA 5B2LA 1PXKA 3EQHA 3HRFA 2BDFA 3G6GA 4GUEA 4CFMA 3P08A 3HRCA 4K6ZA 2IJMA 2WB8A 3TZ9A 4EH9A 2AC5A 2XK7A 5HE0A 4GK3A 4GV1A 3MVMA 2UZNA 4U9AA 3ZBXA 1CSNA 5IMXA 5AV1A 3TDWA 3BU5A 1QCFA 4GT5A 5JFVA 1JNKA 5M51A 4FKWA 5KMNA 3DAJA 4NYEA 4I4FA 2VTLA 3O2MA 1YRPA 3QYZA 2XF0A 4RC3A 4BGHA 3SGCA 4W9WA 2Q0BA 1NA7A 1Q3DA 2J51A 3W0OA 3OD6X 4JT3A 3D5UA 5KE0A 4PY1A 5CI7A 3UODA 5M55A 5CU2A 1FMKA 1Q8YA 4RJ3A 2WU7A 1Q8UA 4W9XA 5BPYA 4YHTA 4XG4A 2HW7A 3SKCA 3DQWA 4FOBA 2FSOX 5FEDA 2Z8CA 2QC6A 2IO6A 4E1ZA 4RWLA 2X2MA 4FZ6A 3BLAA 4QYEA 2HW6A 4J1RA 2B7AA 3TWJA 3WF6A 3MY1A 3ANRA 4N6YA 3ODZX 1DAYA 4BCKA 3O51A 2P0CA 1ZMVA 4ASEA 4GVAA 4OGRA 3VBXA 5CY3A 5GJDA 5IA2A 4BCPA 2C47A 3CTHA 3UIXA 3ZU7A 1QPCA 3FMEA 4FK3A 2JDOA 3QKMA 3Q9ZA 4PPBA 3OG7A 3PA3A 4RA4A 5K5NA 4MD7E 2J9MA 3UOJA 1OZ1A 2BZHB 3BKBA 4ANLA 3C51A 3BBTB 1BL6A 3SG9A 5FM3A 1TQPA 4MXXA 3PP0A 4M3QA 4NH1A 5DLSA 3UZTA 4N57A 3ATTA 4PDSA 5HG7A 2G2IA 2Q0NA 4ZY4A 5A4LA 3KQ7A 2X2KA 4WG5A 4KNBA 4UWCA 3R8LA 2AQXA 3MJ1A 2RSVA 3OXIA 4HYSA 4LG4A 4W4VA 1I09A 4EOSA 5J9ZA 2OO8X 3OWJA 1FINA 4PTCA 3AXWA 4IAAA 4USEA 4WSQA 2VWWA 3FYJX 4QNAA 5L8LA 4QRCA 3LCDA 1QL6A 2GSFA 4ANOA 1Z5MA 4IWDA 4RX8A 5KZ0A 4ZMEA 3LFQA 2VTSA 3ZDUA 4UV0A 5AUZA 3C4FA 3EQGA 4FV5A 4C35A 2KULA 1UWJA 2XJ2A 5CXZA 3KC3A 4YJUA 1XWSA 5EW9A 1S9JA 3WE8A 3S0OA 4BZNA 2GHLA 3D7TB 3OZ6A 3CP9A 4C57A 2XMYA 3UVQA 3F3WA 2VAGA 4K18A 1LR4A 1WVWA 3GQIA 5FBNC 5LWMA 3I0OA 3CY3A 3KULA 3ZO4A 4ZEGA 4D2PA 1OVEA 4DEDA 3OT3A 5HEZA 4BJJA 4EUTA 5IMEA 5BVEA 4D5HA 2YM3A 1JSUA 1XH6A 4ZZMA 4JG6A 1RQQA 3UBDA 4O1OA 4XNEA 4RG0A 4FSTA 2PMIA 3FE3A 1DM2A 2PWLA 3S3IA 1GIJA 5I4NA 2YIYA 4Y72A 3DFAA 4DEEA 1M52A 5EQPA 3RM6A 2AUHA 4ALUA 3HAVA 1ZMWA 1H27A 5HESA 4DEIA 4E4NA 2IVSA 3ZUVA 2WMTA 3LCOA 4A9YA 4E5WA 4I4EA 5HICA 4NFMA 4EOLA 3BPRA 5HHWA 4DE4A 1SMHA 4KKGA 3A4OX 1VR2A 3BI6A 3E63A 4MK0A 2BROA 4GG7A 5AUUA 5AM6A 5TE0A 4M8TA 5D9HA 5JFXA 5EOBA 2F7EE 4NZWB 3RTPA 4AT3A 4A4XA 2W9FB 3VN9A 3EQBA 4EOOA 5JH6A 3QD3A 3DCVA 5K3YA 5DA3A 3JUHA 3OT8A 4MD8E 5FXQA 4RFMA 4CLJA 5AR7A 3TT0A 3ZCLA 3R8ZA 2P4IA 2Z7QA 4IWPA 4L45A 3NCGA 4TNDA 3QRTA 3NUYA 1OKVA 4HGEA 4Y85A 3OWPA 3BYVA 4AE6A 5A54A 2WTJA 3VS1A 2RIOA 4YBJA 4JMQA 4NM3A 3RAKA 4FTCA 4GIHA 3DXQA 2E9NA 3DK3A 4WIHA 3KIOC 4EH3A 4E73A 3Q9WA 3SAYA 5IEYA 4KUJA 4ITHA 4FTOA 4FZAB 4QP7A 2CKQA 2B53A 3QQGA 5EDQA 5AUTA 2PE2A 4XH6A 5D41A 4GW8A 4KABA 2ZFYA 3F5PA 2CN5A 1KV1A 3I4BA 3I7CA 1H24A 3N4TA 4GK4A 5KHXA 3MVLA 3RCJA 5FUTA 4TXCA 3LPBA 5ANEA 3Q60A 4NUSA 3W18A 4DEAA 3H9OA 3PRFA 3QYWA 4O4CA 4Q5EA 5KHWA 4IDVA 4AZTA 4YUQA 3GFEA 3DAKA 3GBZA 4JVGA 5DR9A 3MFRA 4HVGA 1W0XC 3F2NA 2OFUA 3RALA 2X8IA 2UW9A 3NUPA 3DKGA 4YZDA 3ELJA 3L8PA 3L8XA 2F7ZE 3NS9A 3DJ6A 4J71A 4M66A 4MKCA 4FV6A 5CLPA 5EK7A 4ZY6A 1O6YA 3BE2A 3BLHA 2CLQA 2XH5A 3ORPA 5LVMA 1B39A 2QLUA 4I5CA 3THBA 3EQFA 2C3LA 5FWKK 4RBLA 4DLJA 4CKJA 2GHGA 2VD5A 1OL7A 5DN3A 3W55A 1OBGA 4BY9E 4FNZA 1H01A 1NXKA 5B0XA 3R73A 3PPJA 5EDPA 5J9LA 5AX9A 4XRJA 3U55A 1KUTA 2RKUA 5H8BA 4OTDA 2W17A 3DBCA 2OG8A 4JBVA 4UYAA 2PMLX 3EYHA 2YN8A 3OFMA 4BKJA 5CEPA 5K4JA 4RFYA 1BX6A 3W2PA 2Z7RA 5KX8A 1H28A 3LOKA 4RFZA 3D0EA 3KCFA 3BU6A 3Q04A 4TW9A 2YIRA 1H0VA 3C1XA 3FMKA 4MF1A 3CGFA 2UW6A 2W1ZA 2XIKA 3QC4A 4IZYA 2QI8A 5A4TA 3CPBA 2OIDA 3COMA 4S30A 4BRXA 3CLYA 1U46A 4FTTA 4FT3A 4B0GA 3R7OA 4BGGA 5J5SA 3ROCA 1PMVA 4O82A 3FV8A 3CTQA 1KWPA 4LM5A 1E1XA 2PZ5A 2E9OA 3QA8A 2O63A 5JEBA 4AGUA 3UO6A 1ZOGA 4MWHA 4RJ6A 4QMSA 5A6NA 4BICA 2GDOA 5EM7A 4WOVA 3HLLA 3F82A 1OKZA 4L53A 1WVYA 1PXOA 3TIZA 2W5AA 3BHTA 2BRBA 3L9LA 4OR5A 2WQNA 4CTCA 3CQUA 4I3ZA 4O0RA 4KIKB 2XM8A 1Y8GA 3BELA 3R7GA 2HOGA 3HGKA 2FYSA 4FIEA 2XK3A 3RBWA 4FG9A 4EQUA 5IH5A 2ZOQA 2EXEA 4BDBA 1ZAOA 2XARA 2FO0A 5AP4A 2KTYA 2X0OA 4AA5A 1PMUA 5J79A 4J8NA 2PUNA 4QEBA 1OIYA 3O8TA 2JKMA 2VGOA 4FEQA 2GHMA 2OIQA 5FM2A 2HZ4A 5IA5A 4HYIA 5J7BA 3GFWA 4QMZA 5CSWA 5DT3A 5EKNA 2WTDA 2VTOA 1OL2A 3PJCA 1REKA 4E4MA 3CGOA 2BUJA 3VS4A 3RNIA 3MH3A 4F09A 1JLUE 3RJCA 3E64A 1W82A 3WF7A 3VBVA 4AP7A 4NJDA 3UDZA 4GK2A 5A14A 5BYZA 3PXRA 5J9YA 1JAMA 2GS7A 2PMNX 4JXFA 3D15A 4XCUA 4F6WA 2NRYA 2OK1A 2UZEA 2ZB0A 3AGLA 3V6RA 4EBWA 2HWOA 2PL0A 2QQ7A 3PXQA 5EW8A 4AAAA 1ATPE 2V5QA 5J1VA 1P5EA 4L52A 3GT8A 4U43A 1ND4A 3W2CA 4E6AA 3EKNA 4YSMA 2JDVA 3OOMA 4R3RA 4ZZNA 4D9UA 2JAVA 2VTNA 1TVOA 3L9PA 3R28A 3PP1A 5KKRC 4WRSA 2VTHA 3S4QA 4RIOA 5DT0A 4RLLA 4ZSAA 2Y8OA 3TYKA 1PF8A 1WBVA 2UW3A 4A9UA 4BCIA 4G2FA 4BBMA 4RIWB 4YBKA 2GTNA 3K3JA 3OC1A 1J1BA 4EEVA 4RWJA 3ODYX 5BUIA 4FUYA 4LFIA 4P7EA 4CZYB 3VS6A 2OGVA 3NUAA 4HPTE 4JQEA 2C0OA 3DAEA 1Q97A 5KUPA 3N4UA 4ZLOA 1CDKA 2QOLA 4NCTC 4AZWA 2R3JA 3BLRA 2PSQA 2PYWA 3LFDA 3PG3A 3WE4A 2J0MB 2QNJA 2C6OA 5GJFA 2B0QA 3U6HA 2YABA 2GCDA 3CEKA 1W2CA 2PZPA 3ZXZA 2G1TA 4OAUC 2R3IA 3UZRA 3FXWA 2XNOA 4WA9A 1H0WA 3LMGA 3QWKA 4BDCA 3UYSA 2JFLA 4MWIA 3N9XA 3JYAA 2OJ9A 4GJ3A 4UB7A 3MGYA 4B99A 2VNWA 3AC4A 4FSZA 3BYUA 3QRIA 5L2QA 4HVSA 3ML1A 3ZONA 3IW5A 2I0HA 4I41A 5FRIA 2JIIA 3QKLA 4AZEA 2R64A 3QZGA 4L7SA 4BVUA 1WBNA 1STCE 1XJDA 3OTUA 1O6LA 4NKAA 1G8SA 2GNJA 3BL7A 3Q52A 2W4OA 3SG8A 3PXKA 3GCUA 3UO4A 3FPQA 3QQKA 5FQDC 1ZYCA 3ALOA 4HGTA 4RJ5A 2X39A 4ARKA 1FOTA 3FQEA 4PP9A 3VS2A 3WYYA 4AUAA 1JQHA 3KMUA 3ZM4A 3LCSA 3NIZA 4DEBA 3K5UA 2YA9A 2Y9QA 1LUFA 1UA2A 3R1YA 3TZMA 4EWQA 2CN8A 2WQMA 3ZFXA 5I9UA 3JPVA 2Q83A 3RPYA 4UX9A 4NW5A 5HLPA 5GZAA 3IKAA 4G34A 4NIFB 4M69A 5HVYA 4D1SA 4YPDA 5AM7A 4FX3A 4EJ7A 4E93A 4FKRA 3AC3A 2W4JA 3AKLA 3QD0A 4FV2A 4UBAA 3IOPA 4O83A 3SXFA 4E3CA 2VU3A 4JX7A 5CYIA 4TTHB 3KY2A 5AIKA 5IZFA 4GU9A 5K9IA 4GYGA 3G33A 2W5HA 3KU2A 4YJRA 2J4ZA 5C9CA 4NM5A 5L2TA 4KRCA 4EQMA 1UU8A 2ZM3A 2FA2A 2YERA 3CY2A 2G01A 3PLSA 3QD2B 2WTVA 4FKTA 4AE9A 5M57A 4PNKA 3REPA 3I6UA 4W8DA 3D2KA 3D9VA 5CAPA 5A4CA 2R3FA 3HVCA 4A9SA 2YLFA 3HYHA 2WTCA 4AG8A 2Y0AA 3GVUA 3KRLA 4G17A 5LVLA 4CFFA 4F9BA 4FEXA 4E5AX 4DG2E 3U4WA 3RK7A 4EOQA 4F6UA 4DGNA 5DBXA 5HORA 4EZ5A 1TQMA 2C5VA 5LWNA 1WZYA 4CZUA 1NVQA 3F3UA 4OW8A 3VQHA 4JIAA 3LLAA 1G5SA 4FIJA 2XJ1A 4CFNA 1M14A 2A2AA 3E92A 1SNUA 3POZA 4N6ZA 4RC2A 5J7HA 4D2TA 3DKFA 4O27B 4WBOA 5KZIA 5A6OA 5A4EA 2BKKA 1PYXA 2UZBA 3BWJA 4H3PA 4FEWA 1M7QA 3RHXA 5AR8A 2XIXA 4U42A 4LV5A 3ZC5A 4F0FA 3ORNA 4NM7A 1Q99A 2X7OA 4JG7A 5HTCA 4XLIA 3DOGA 3OVVA 2OZAA 1DS5A 4KSQA 2G2FA 1R1WA 4UMQA 4QDVA 2BFYA 3BGQA 5CU0A 4AXDA 3PVGA 4XG2A 5K0XA 2UVZA 3LQ3A 4YTHA 4IEBA 3EN6A 2ZM1A 4NM0A 4EYJA 2GQGA 1GZ8A 2LGCA 3VW6A 3IDCA 5IDNA 3W0QA 5BVFA 4RVMA 3HKOA 3NX8A 4IIRA 5CSPA 1CKPA 4IX5A 2ZVAA 3JXWA 3NSZA 1XKKA 4MAOA 3II5A 4HNFA 1FVVA 4EONA 2ITYA 3TKHA 5EOLA 2W1HA 3CE3A 3ENMA 3BGZA 4ZTLA 2X0GA 3R21A 3UPZA 4MNEB 4EZ7A 1W7HA 5E91A 4AOTA 3NFGB 2Z7LA 1YWNA 1J7UA 1IAHA 5IH4A 3R63A 3LLTA 2BIKB 2YM4A 4FI1A 3IK3A 1UWHA 5D1JA 4J7BA 5HBEA 3U6JA 4JG8A 2VO7A 3LFFA 2EWAA 4Z7HA 4EH2A 1PXPA 5FTGA 3IDBA 1MRUA 2R0IA 3FXXA 4IAYA 3HX4A 3QD4A 4JDIA 4L3PA 3RHKA 4BDIA 5JT2A 3RWPA 1E9HA 3QHRA 3C4XA 4RJ4A 4TWOA 2RG5A 3HV7A 4FTQA 4ZK5A 4BC6A 1W2DA 1JSVA 4TT7A 4YZ9A 3FC1X 3ZFMA 3TDVA 3M2WA 1L8TA 4DINA 2OXXA 4MBLA 3B2TA 4D0XA 3FKOA 2A0CX 2Y6OA 4I0SA 4EH6A 3CD3A 2VTMA 3AKJA 3OHTA 3G5DA 5T68A 5BNJA 3MTLA 4KWPA 4HPUE 3G9NA 5LCKA 2IW6A 3VRZA 4F1TA 3GU4A 5HCXA 2A19B 3CQWA 4WUAA 3DBDA 3AMBA 4QQJA 5CI6A 1TZDA 3DB6A 4H1JA 5DOSA 1UNGA 2JDRA 3G0EA 4ZSJA 3RI1A 4AN9A 2EXMA 5HNBA 1Y8YA 4G6LA 2GNIA 4LV8A 4AZFA 3M11A 1K3AA 4F0IA 5DWRA 1GAGA 1OKYA 2WTIA 3MSSA 3QZHA 1WAKA 5DRBA 4I23A 4F65A 2O8YA 3D7ZA 4DHIB 4MQ1A 4GH2A 3ALNA 1V1KA 5EM6A 2OJIA 3W10A 3UIUA 4DFLA 5LCJA 4FSUA 2FH9A 4K11A 3UOHA 4C0TA 4R6VA 2ZV2A 1AD5A 1OI9A 2R3PA 3EWHA 3P23A 4MYGA 3R83A 2CGWA 3V5WA 4FKGA 3Q9YA 5CU3A 3VHEA 2ITOA 5ANKA 5C01A 4DYMA 4YJSA 3R8MA 3PSBA 2OIBA 4RX9A 4M67A 2C69A 4ZSEA 4M0YA 1IRKA 4GKHA 1HCLA 4A7CA 4BDAA 2QD9A 3TIYA 3R30A 4BCMA 5CSXA 3E93A 3OS3A 2GNLA 2IZSA 2C68A 4PDOA 4FYOA 4J97A 2RGPA 4BBEA 4R1VA 3DZQA 4C3RA 5CANA 4XOYA 4M84A 4C58A 2W1DA 2UUEA 4CFWA 4F63A 2ZAZA 4FV1A 4D55A 4IX6A 2JEDA 4JOAA 1SM2A 3RCDA 5DEYA 4U45A 1JKSA 2BTRA 3AD4A 4NU1A 2UZTA 3QQFA 3VUIA 2ONLC 2W4KA 3ORXA 3T9IA 4BYIA 3OCTA 5B2KA 5L2WA 4H05A 3LM0A 4XYFA 2PUPA 2HXLA 2F57A 2VWXA 4TYHB 4CXAA 4FIFA 4CFXA 2V22A 4C3PA 4ASXA 2PHKA 3PIYA 4CKIA 4OT5A 4QP6A 3C5UA 3OWLA 3DY7A 3LQ8A 3KRJA 3F2AA 4I6HA 1VZOA 4FL1A 4WG3A 4EHGA 3C13A 2J0JA 3MS9A 4TWPA 5C1QB 2BMCA 1OPJA 4APCA 1OL6A 1BMKA 1UU3A 2VRXA 4V0GB 4CMUA 4ONAA 5E8YA 4AA0A 3RMFA 3RINA 2UW0A 3WZDA 3F5GA 3JY9A 2WMAA 4JBOA 4EC9A 4R7BA 2C6MA 4FEUA 2YIWA 1ZLTA 1BKXA 2IEWA 4XG8A 4HVDA 2YZLA 2WMRA 3QTQA 2VX0A 4ZJJA 4X3FC 3O17A 4AN2A 2QODA 1RDQE 3MA3A 3KVXA 3LFAA 4XMOA 3TV6A 2I6LA 3E62A 3FLQA 3EN5A 4M14A 3E7OA 3W0NA 4DTBA 1CTPE 3KXZA 5C8MA 2YDIA 5AP2A 5IF1A 1NW1A 3PWYA 4DFZE 2BKZA 2OJJA 5LVPA 1J1CA 5E7RA 1UNHA 1X8BA 2VWVA 3LVPA 3U4UA 3BYMA 3NNVA 2BRGA 5M4CA 3W8LA 5KMLA 2V55A 4AW0A 3KULB 2ITVA 3HV4A 1U5RA 4RVLA 1Z9XA 3QHWA 4PDYA 4DFNA 3SD0A 2CNVA 4RQVA 4OTHA 5CASA 2J0KA 4U5JA