2XCHA

Crystal structure of pdk1 in complex with a pyrazoloquinazoline inhibitor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
278
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSNFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
publication title Structure-Based Optimization of Potent Pdk1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 278
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xchA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xchA01
4O0UA 5EG3A 4GEOA 3VJOA 3FSFA 4R1YA 4IVDA 5CEPA 3FMMA 1QPJA 2JAMA 1R1WA 2J50A 3LM5A 5DBXA 2XZSA 2P55A 1Q99A 3JXWA 4HPUE 1OVEA 4L9IA 1XO2B 3PY1A 3FMEA 4GG5A 5JMSA 2GNJA 4L45A 4EK6A 3B8RA 3OTUA 2X1NA 5AUWA 4O84A 3W10A 3RAIA 2YWPA 3PRIA 4P5QA 1FVTA 3GCSA 4YJVA 4AT5A 5GIPE 2XNMA 1Y6AA 3LKMA 1FOTA 3RI1A 3PPJA 3ZO3A 5DMZA 2IO6A 4D28A 2HZIA 2JIUA 4D2VA 3R02A 5HVYA 2B4SB 3MH3A 2A0CX 1OPJA 1YWRA 5IA1A 2GNHA 5EI2A 3NVKI 5HE0A 5BQ0A 2FA2A 3C13A 4EHVA 4CYJA 5JK3A 3WE4A 4Y85A 1G8SA 1F0QA 2XRWA 2NP8A 1U5QA 3BPRA 4U81A 4C3RA 4FODA 4HGLA 3SXFA 1BKXA 4M0ZA 5HO6A 4O7LA 3PJ3A 4JS8A 2XS0A 3Q60A 2GTNA 3ROYA 1Q8TA 3EMGA 3SAYA 1BL7A 4KAOA 2QOIA 2VWXA 2XM8A 4FV2A 3SC1A 3JY0A 3OOMA 4DG3E 4MBIA 4BCPA 5HTIA 3DXNA 3A7JA 3NSZA 5F1ZA 3DTCA 4EK3A 4N70A 1PMVA 4FTNA 3F9NA 5FEDA 2YIWA 4FSZA 3FQHA 5GINE 3C4CA 3GT8A 4ANNA 3OWJA 3K2LA 5EQPA 3OFMA 4J95A 2VTOA 3VW8A 3BHUA 2WEVA 4UWYA 3L9PA 3SX9A 3FLNC 3PG1A 4KNBA 3CXWA 4JR3A 2YM4A 4JG7A 4OTRA 3SD0A 3QKKA 4GK2A 4DBNA 3DTWA 4GKHA 1SM2A 2I1MA 3CCNA 2QR8A 1SMHA 3KXNA 3SG8A 1YXTA 2X0GA 3VBWA 4CMUA 4RJ6A 1URCA 2JKOA 4QTDA 3RWQA 5KE0A 5AM6A 4FL1A 3R63A 5DI1A 4WRSA 3N51A 3P79A 1WBOA 3TZ9A 5CTPA 2CMWA 4JBQA 2ONLA 3QWJA 3UODA 1GZOA 3TDWA 4DINA 4E6CA 1UKHA 4RMZA 4FUXA 5F4NA 1JSVA 4ID7A 5HD4A 1UU3A 4KS8A 4O0VA 4HGSA 5AUTA 2IVUA 2O2UA 2VWBA 5AV3A 4LOPA 4B4LA 3VBVA 3EKKA 3VAPA 2WZJA 2X4ZA 3V5LA 4CTCA 1OUKA 1JSUA 3HMOA 3T3VA 1H1QA 1ZYCA 5ANIA 3UZTA 4C7TA 1LUFA 2Q0BA 4M69A 2ITQA 5A6NA 3C4FA 4FIFA 5K5NA 3NPCA 2ESMA 3LJ2A 3BEGA 4AE6A 2BRNA 3EYGA 2HZ4A 2XIRA 3QZHA 1YXVA 4RVMA 3FXWA 5H2UA 4R7IA 1M17A 4RFZA 3RPSA 3DNEA 4N57A 3UOJA 5HVJA 3ZUVA 5CAVA 4JJRA 3UYTA 2X8IA 4DCAA 5D12A 2ZM4A 1PMUA 4BL1A 1J7IA 4RIXA 3V01A 1KOAA 3TG1A 4A7CA 2WTVA 4LM5A 4YHTA 5M53A 2X39A 2ITOA 2YIRA 2E9UA 5EYKA 1WFCA 2C3LA 4FSWA 4MVFA 4E6QA 4BKZA 3L9MA 2Y4IB 4YNOA 2F7EE 4FIJA 5EHLA 3ZEPA 4XG3A 4BFMA 2R3OA 1AD5A 5CNOA 2AYPA 2XNBA 4RLKA 5K3YA 3FE3A 2PUNA 5AWMA 3UQGA 5K0XA 4L68A 2JKKA 3E8EA 3NX8A 5J9LA 3AD5A 4LG4A 4AE9A 3GC0A 4RQVA 4RX8A 4CMOA 1CTPE 4IDVA 2WTIA 4QMZA 3N9XA 4A07A 1J7LA 2PL0A 2V7OA 3OHTA 4P90A 4X0MA 2R3NA 3FMJA 3RM7A 4O96A 1SNXA 3F82A 4W8EA 3Q52A 5EK7A 4EKLA 1KV1A 3ET7A 3IS5A 5F95A 1XBCA 2H6DA 4AW0A 1FMKA 4NL0A 4PDYA 3LJ1A 4W4XA 4YJSA 4O1PA 4O86A 2RG5A 3MI9A 4TT7A 4GU9A 4KIOA 2B9HA 3FLZA 4D4SA 2H9VA 4RFMA 1ZOEA 3W8LA 4BIEA 4BF2A 3CGFA 2RL5A 3RINA 4YU2A 5BUJA 4CMTA 5JKGA 4USDA 1BMKA 4GT5A 3DB6A 1UA2A 4BHZA 2PVMA 1WBTA 4KIKA 4TKSA 5HO7A 3IONA 4HZSA 4DYMA 4MEDA 2BILB 2UW9A 4FX3A 4FTIA 4JX7A 5HQ0A 5KMOA 2PY3A 4NTTA 1IAHA 3PJ1A 4KRCA 2YIXA 1OUYA 4RRVA 4WNPA 3DJ5A 3VUDA 1IR3A 4C3PA 5K9IA 5IEXA 1CKIA 3ZYAA 2XNPA 4XOZA 1K2PA 3TJDA 1REJA 2W1IA 4F09A 4U44A 4C8BA 4TXCA 2ZDTA 3JYAA 4CFNA 4N4SA 2IZTA 4EWHA 4IAKA 4AWIA 4YSMA 2XJ0A 2WQBA 3VBXA 4DH3A 1OBGA 3I60A 3BKBA 4DEDA 2YN8A 4YZMA 5IQBA 1KSWA 4TNBA 3EN6A 2UZWE 3MJ2A 5KMNA 5DGZA 3QLFA 4TZRA 5BVFA 3O23A 5CVFA 3IECA 5HOAA 2IW8A 5LWMA 1OKZA 4M15A 1M2PA 3EN7A 5AMNA 2GHMA 2CLQA 2OJFE 5J79A 2VTTA 4EOKA 4Z16A 2HY81 3GI3A 1WBVA 4RWKA 4PL3A 1JPAA 1JBPE 4QD6A 2CPKE 3IW7A 2QONA 2VO3A 3GCQA 1O9UA 3RK9A 1H8FA 3N4UA 5FM3A 3VUKA 1U5RA 4QMVA 4CT1A 3PY3A 3CY2A 4YGAA 5J87A 3EL8A 4DTKA 2JKMA 5C8MA 3UMXA 1PKDA 3ZUUA 1M2RA 4AZVA 4KA3A 4X2KA 5CASA 5IQAA 2WNTA 1ZYDA 3C7QA 3R7YA 4XBUA 3VW6A 5LQFA 2ITVA 5BX0A 1CDKA 4UBAA 1FGIA 2V7AA 3BLRA 3UIBA 4O7TA 4EONA 5HVKA 3ZRLA 4E1ZA 4JDHA 5JH6A 4OBOA 2Y0AA 1WVXA 3FDNA 2BRBA 4IAZA 4BTJA 1PKGA 3CKWA 2OO8X 4JDKA 2V0DA 4FG8A 5GJDA 4MH7A 3BU6A 1YI3A 3OT8A 3C5IA 3SDJA 3DNDA 3BBTB 5EW3A 5AR3A 5A3XA 3RCJA 4C37A 2GTMA 4NM7A 4QP3A 4IAYA 4QP8A 4XJ0A 4YP8A 4IVBA 4DEHA 4HNIA 3Q2JA 3S95A 4F9CA 2B9FA 2PVRA 3VJNA 3KMMA 4AOTA 5BUEA 4IBMA 4EYJA 4O7RA 3ORMA 3Q9ZA 3TI1A 5CZIA 3OBJA 2C6DA 2UVYA 4QTAA 4DLJA 4XG2A 3KGAA 3ENHA 3AC2A 4FMQA 4BBEA 3MVMA 4DF3A 4IZ7A 4PPCA 4A4XA 3D7TB 1BI8A 3PIZA 5I9VA 3L8PA 4KS7A 3RMFA 1H1RA 2GS7A 5JFXA 3ZBFA 5AR2A 2A2AA 2Z7RA 1GAGA 1FMOE 3FUPA 2C5OA 3RNYA 3PA3A 3HV4A 5B2MA 3V8TA 3E88A 2OJ9A 4L42A 2BUJA 2R3KA 4ZZOA 5CAUA 2EUFB 4QQJA 4QTBA 4AP7A 4OAUC 3UVQA 4AN3A 3D0EA 3HP2A 4X6QC 2PYWA 3R0TA 4MTAA 5ANOA 3H30A 3UVPA 5EFQA 4BC6A 2XBJA 2XNGA 2XJ1A 2VTMA 2HXLA 3EH9A 4DEEA 4DFZE 4FZAB 1IAJA 4BIDA 4QP6A 4D5HA 4ZAUA 2WFYA 5CF8A 3OUNB 4H1MA 5CNNA 2PUPA 3FI8A 4I24A 3CY3A 3V5WA 1MP8A 1JKTA 4NT4A 1XH5A 2JBOA 3C1XA 4UWBA 4LMNA 2OIBA 2YLEA 3COKA 2W9ZB 4AFEA 3ORXA 2QOBA 4TRLA 3DBCA 4U7ZA 2VUWA 5CU6A 5I9ZA 1H28A 4R7HA 4U79A 3CGOA 5LWNA 4BDKA 2WTJA 4EZ3A 4BWPA 4TY1A 3EQGA 5FDXA 5KHXA 3OEFX 5IDNA 1PMNA 3PXKA 2YCSA 3GCUA 3DLSA 5T6KA 3F88A 2I0YA 2E9OA 2PVJA 4L44A 2XP2A 4LFIA 2C6IA 2PVFA 1JOWB 2X9FA 4GVJA 4CLJA 3ZO2A 3NAXA 4J98A 5EQEA 4F7JA 4CFFA 1H1PA 3A8XA 5E8XA 3LCKA 3DLZA 3DZQA 4FSRA 5B2KA 3BLHA 4D4YA 3DQWA 3IW6A 5KNJA 4GT4A 2UW6A 2IVTA 3BYSA 1OBDA 3KA0A 5TE0A 3HRBA 2HWOA 5J1WA 3NDMA 2UVXA 4O81A 2Y9QA 3COHA 4ZLYA 4Y95A 3EB0A 2W17A 4YJRA 4C3FA 3VRZA 1ZMWA 5CAPA 2C1BA 5L2SA 2GFCA 3DK6A 5E8VA 4D1XA 4H1JA 3TKIA 3TV6A 4C4EA 1R3CA 1K9AA 4UMPA 1PXLA 4V0GB 3QCQA 1NVSA 4G16A 4U43A 4HW7A 5IA2A 3U54A 2WD1A 4FIHA 3OXIA 4CCBA 3HAMA 1W7HA 3WZJA 3DKOA 2R5TA 4AOJA 1OMWA 4IH8A 3D15A 2BIYA 3O2MA 4RZVA 4BKYA 1NT2A 4JG6A 4WT6A 3U51A 2CHLA 5IISA 3V04A 4H3BA 4I6FA 5DEYA 5F94A 2C3KA 3QZFA 3EFWA 4HVHA 2ZB1A 3ZCLA 2R0UA 4JBVA 2EXCX 3HKOA 1PXNA 5IA4A 2XK3A 3ELJA 5CY3A 3VUIA 4J96A 4YO4A 4ZY5A 5M06A 3BLQA 1JNKA 4GUBA 2YDJA 3IDBA 2PE0A 3G0FA 3Q04A 3UBDA 3H3CA 3ZRKA 5D7AA 5DWRA 1ZMVA 1KOBA 4YC6A 2C47A 4F08A 2A19B 3HRCA 4ZSGA 2PHKA 4CQGA 4E6DA 1YXXA 2FGIA 2WXVA 4FSYA 4TW9A 4Y83A 2X2MA 5FM2A 3MBLA 4O83A 4DFBA 4KWPA 1YXUA 4JX3A 4FEQA 4D9UA 4U80A 4BDFA 3R7IA 3EZVA 4WKQA 4RPVA 5DA3A 5AR7A 5GIOE 3P4KA 4C4FA 2XYNA 3QYWA 1G5SA 5HBHA 5LARA 2PUUA 4YLLA 3TNHA 2F9GA 4JXFA 3E92A 4MXZA 5GZAA 1BLXA 1T45A 4U5JA 3QCXA 3R9HA 3H0ZA 2IW6A 4DA5A 3JUHA 4AGDA 1HCKA 1TQIA 3ZLWA 5BMMA 3AC5A 3BBWA 2RG6A 3TZ8A 2BKZA 2HXQA 4QMWA 3PXYA 4ZSAA 4TYHA 4RIWA 4ZZNA 4F70A 3AMYA 4KBKA 2NPQA 4O0RA 3OP5A 4F9AA 5HNBA 3K3JA 4FTQA 2BMCA 3E5AA 2QI8A 2C0TA 3COMA 2JIVA 4PL5A 3QTIA 3AMAA 3H10A 2C4GA 1ZARA 4KBCA 4C61A 4I4EA 4Y5HA 3LLAA 4U6RA 5HBJA 2R0IA 3LW0A 4NK9A 1XH7A 4EH3A 2OF4A 5BYZA 5A9UA 2CNQA 4M14A 4O7SA 5A4EA 5AEPA 5GZ9A 2ZV9A 3MGYA 4U0IA 4RX7A 3SRVB 3UPXA 4HVSA 3G9NA 3IDCA 2PVHA 4C4GA 4K6ZA 5IG1A 4O82A 3VS6A 4MNEA 5I3RA 5HHWA 3C9WA 1ZLTA 3D5WA 5I4NA 3PRFA 4GFGA 3R9NA 3AC3A 2CLXA 4FV9A 4R3PA 3FI3A 4DG0E 4F4PA 2IZRA 3ANQA 3WZEA 4LQMA 3I1AA 4CNHA 5L3AA 1ZMUA 4IMYA 4NSTA 4P4CA 2HW6A 4HJOA 4PNKA 4QMOA 3G90X 4RJ7A 5L6PA 1VEBA 3Q4CA 4FOCA 5IKWA 5AV4A 4YURA 4DGGA 3PDTA 4E6AA 1MUOA 3SA0A 1XH8A 3OTVA 5AP1A 3Q4ZA 3MVLA 3HNGA 4FKOA 4AN9A 4AS0A 5CVGA 5IQDA 4EL9A 4F7SA 3HA6A 4L67A 3ZZWA 5CF4A 2OIDA 3HV6A 4IANA 5J1VA 2YDKA 4YJTA 4FL3A 2OG8A 1Q5KA 3O0GA 5CALA 3FEGA 2HAKA 3FLWA 3QZIA 4YZ9A 5DFPA 1L8TA 5FUTA 1GIJA 2I0VA 3GFEA 3NS9A 2GNIA 5CENA 5JT2A 4NIFA 2R3GA 1V0PA 4G3GA 4BCHA 3O8PA 3OXTA 3EQIA 2AC5A 3P08A 3OC1A 4JT3A 3FMNA 3P7CA 4QNYA 4QQTA 4EC9A 3POZA 4IE9A 3VS5A 4ZSEA 2HW7A 5L8KA 3ZM9A 2Q0NA 5HTCA 5FBOA 4UALA 2JC6A 3NVMB 4RWJA 5HBEA 3G6GA 3AGMA 4TWNA 3IOKA 3ZBXA 1UVRA 2BIKB 2YM7A 3ORIA 3QX2A 3UQCA 4GT3A 4MD9E 4MX9A 4BCFA 4GSBA 3C4XA 5TT7A 1J91A 5HU3A 5CEIA 3ZUTA 4GFOA 3R22A 4EOIA 4MF0A 5DYJA 4EK5A 3DKGA 3RBWA 2PK9A 2XNEA 4R3CA 3VO3A 4FV1A 4PPBA 1AQ1A 3LQ5A 4NYEA 2E9VA 2XNNA 4HVDA 3NWWA 3ZMMA 5C1QB 1JQHA 4MXAA 3GBZA 4A06A 5DN3A 1R0PA 3R21A 4DTBA 4LOOA 2QURA 4MKCA 3E64A 1DS5A 3DAEA 3SKCA 5I9XA 4QNAA 1K3AA 3LXKA 3AT4A 3SV0A 1OIUA 5E1SA 4F9BA 5KKRB 4ZS4A 3GGFA 4DG2E 3DQXA 3KVWA 5GNKA 2NRUA 3UOLA 2OZAB 4D2SA 4C33A 3GU7A 1YW2A 2BDWA 3VS3A 4FT3A 3UDBA 4NWMA 3Q3BA 2PZ5A 2CN8A 2HZ0A 4AZSA 4RJ5A 5CSXA 3QTRA 4FSUA 5CSWA 5IH5A 4GK4A 5EI6A 3PVBA 3SHEA 5HX8A 5DEWA 3E7OA 4BY9E 3W2CA 3U4WA 3EHAA 4JQEA 4ZIMA 3HMPA 3T3UA 5IA5A 3TNPC 5EQYA 1TQMA 1B6CB 2IZUA 2W5BA 3EFKA 4WG5A 5HG5A 3KEXA 5JQ5A 2YZLA 4FNXA 3UIMA 1YOJA 3KMWA 1Y6BA 1SZMA 3HP5A 4YBKA 2X81A 5KBQA 3N4VA 2PVKA 3PP0A 3EFJA 4UMUA 2C6KA 2GHGA 3OZ6A 4FTOA 3BYUA 2VTIA 2VO0A 4XBRA 3IOPA 2CCHA 1YQJA 1NXKA 4FSTA 3UG1A 3W2RA 4Y73A 5BVNA 2C5VA 4USEA 3MYGA 1ZOGA 1OL6A 4LOQA 5EDRA 5J5TA 4I22A 4BDDA 4FYOA 2EXMA 4AU8A 3NW5A 4BCIA 3GOPA 2FSLX 5A14A 3LQ3A 3HUCA 3MPAA 4NCTC 4BDBA 4ZJVA 5CSHA 3UJGA 4HVGA 1O6YA 3OUKA 2G9XA 2VNWA 4PP9A 4XV9A 4MBJA 4GKIA 3JR1A 3PE2A 2QHMA 3AGLA 4PMSA 3LAUA 5C8NA 3WOWA 5AR8A 4BYIA 4FEUA 1W83A 3DKCA 3ORZA 3ZFXA 4XG4A 3TIZA 5BNJA 5M4CA 4FZ7A 3F3UA 4G3CA 5K5XA 1M7NA 3EOCA 3ODZX 3CKXA 4FKVA 1H0VA 2VN9A 3FPMA 4FTAA 4UYNA 1SVEA 2W05A 3LCDA 1Q8UA 4S33A 2VWVA 3D83A 4U9AA 3H9OA 4CKJA 1YWVA 5BMSA 3R7GA 2CN5A 2VZ6A 5L2WA 2GCDA 1OGUA 4KSPA 4E7WA 5ITAA 3RVGA 3WF8A 5LXMA 4HCTA 3HGKA 2OH4A 4AG8A 4FKLA 2YHVA 4E4NA 4ZTNA 2CNUA 5FP6A 4O0XA 5CZHA 4IC8A 4FVRA 3R00A 2BZHB 3G6HA 2NRYA 2DWBA 2PVLA 1ZY4A 2R3QA 3HV7A 3KRWA 3DU8A 1Q8WA 3DKFA 1UWJA 5BVDA 2HYYA 3HDMA 3LXNA 4LUEA 1DI8A 4FTCA 2JDRA 2ZMDA 2XYUA 3TKUA 3MJ1A 3QYZA 1OECA 2OJIA 3ENMA 3WYXA 2R3LA 5A4CA 1SVHA 3UPZA 5C4KA 2PZPA 3EQBA 4ZJIA 4A4LA 2QO2A 3TWJA 3R30A 2YLFA 3JY9A 1BL6A 4EQCA 3TUDA 3E3BX 3GUBA 4C57A 4CKRA 3H4JA 3PSCA 2YJSA 3AD4A 3RAWA 4V01A 4EYMA 4AOIA 4FKRA 4FGRA 3KULB 1KE8A 2C6MA 3MFRA 5BVWA 4YJUA 3CPCA 3F5UA 4JRVA 4ZS0A 1GZNA 4I0RA 2PU8A 4I5PA 4QYGA 3UZPA 4ZLZA 1PXIA 2JDSA 5KCVA 3M11A 5FRIA 4IZ5A 2W4JA 4AA4A 3MW1A 4JL9A 3MA6A 3G33A 3MWUA 3UE4A 2ITZA 2UUEA 2Y7JA 4O7WA 4WSQA 2P0CA 4ASXA 1YOMA 4XEYA 3TTJA 4DITA 3TUCA 3ERKA 3HX4A 3CJGA 3GENA 4R8QA 2QO9A 4ENXA 3QC9A 3OCGA 4F1TA 3CE3A 2P33A 4BCOA 3FSKA 3D5XA 4DTAA 1XH4A 4EHEA 3DPKA 3QQFA 4UB7A 3C4WA 2I7QA 1Y57A 1RE8A 3AC8A 4G6OA 3S0OA 4WG4A 2Z7LA 3RK7A 4FZFB 1MRUA 3I5ZA 4S31A 3ZHPC 3R1QA 4UN0C 4BZNA 1PW2A 2R3RA 2YITA 5ANEA 5AR5A 4FV0A 4BKJA 1IEPA 2BFYA 5DRBA 2R3MA 2UZEA 4EH9A 5ACKA 3FHIA 4AGCA 4EC8A 5I5ZA 3V6SA 5AV2A 5I3OA 4FNYA 5FWKK 3DFCB 3I7CA 4QMPA 3M2WA 1PF8A 4ONAA 1UU8A 2QLQA 3NUYA 3F3TA 5CU4A 2QOQA 3NIZA 5AV1A 5AX3A 3U55A 2C5XA 1OIRA 3I6WA 2XK9A 2ZJWA 4K9YA 3BI6A 3DOGA 4QT1A 4AQCA 5KX8A 2QR7A 1YRPA 5ACBC 3S00A 4IACA 4J52A 4BRXA 3D94A 4MHAA 4AA0A 4DLIA 4R77A 2RKUA 4K18A 5L2QA 5L8LA 5LMKC 2VWYA 4EI4A 4YJNA 4EQUA 3PXQA 4EH8A 1KE7A 3UIUA 3R1YA 3NYOA 5EDQA 2X6DA 3CD8A 1SNUA 5FXQA 4BI2A 5HIBA 4CFUA 1ZRZA 4O38A 4LRKA 3OXZA 2RIOA 3FZRA 4PTEA 4RX9A 1KV2A 5DVRA 3BGQA 4IDTA 4IWPA 5AP2A 3UO4A 1W84A 5CEOA 3R9RA 5IZFA 3JPVA 3EN9A 4O0SA 3F2NA 4IQ6A 5HX6A 3UNKA 2QOKA 5ANGA 1WZYA 4I0TA 3OD6X 5LVOA 4U3YA 4FIGA 4WRGA 1OIQA 2QHNA 4L53A 4YZBA 3DBQA 5FDPA 5T68A 2B9IA 4AUAA 2GS6A 3CQEA 5BVEA 3ORLA 5DLSA 1JAMA 3R83A 1NA7A 4G9RA 4W4VA 3ZLXA 2WIHA 3W2SA 3KXHA 1PXJA 3C0GA 4WNKA 5HO8A 3FQSA 3BV3A 3MFSA 3L9NA 5L6WL 3PWDA 5DT4A 5E92A 4BB4A 3GVUA 2OXYA 4NU1A 2EB3A 3OCTA 5KMKA 2JD5A 2WQEA 2YISA 4M3QA 2G2IA 3CPBA 3BIZA 1J1BA 3V5JA 4CYIA 4BYJA 3RAKA 5CU0A 3QFVA 1YXSA 1CSNA 2XK7A 2OWBA 4TL0A 5A4LA 4GJ3A 4Q9SA 3SLSA 2XK4A 3U9NA 4ACHA 2VD5A 2ERZE 4FTJA 3FBVA 4FR4A 3LFNA 2Z2WA 3D7ZA 3RNIA 4XNEA 4WBOA 4ALVA 3DK7A 4I4FA 3Q4UA 4HCUA 2ZB0A 3SVVA 3I5NA 3PE1A 3LE6A 4DGLC 3LMHA 5IQCA 3REPA 2OXDA 2QD9A 3IGGA 5E91A 2RFDA 3F61A 3G2FA 1WVYA 2E2BA 3GFWA 3FV8A 5LOHA 3RPVA 3PPZA 4TYGA 1BUHA 4CZYB 3QZGA 1LPUA 1XKKA 4UXLA 5TR6A 4MF1A 5A4TA 3LFSA 3V8SA 2HZNA 3PPKA 2Y8OA 2UZVA 2XUUA 3PA4A 2PVYA 4BZDA 4BCKA 1A9UA 2CGWA 2IN6A 2VTPA 4QMNA 4FF8A 4TYIA 5FD2A 5JSMA 3QRKA 5L4QA 4JIAA 3D2KA 4CGAA 5KKRC 3BZ3A 2JFMA 4FIEA 2UZOA 3F7WA 1A06A 3E3PA 2IPXA 5LMAA 2XF0A 4F7LA 1RQQA 2CKOA 4GIHA 4FKGA 2XVDA 4Y8DA 4IZAA 3FXZA 4LRMA 2HWPA 4HGEA 5BYLA 4RIXB 1RW8A 2J9MA 1H1WA 4XG6A 2IVSA 4AZTA 1I09A 4U40A 4H58A 2BRMA 4E26A 3RHKA 3DDQA 3CJFA 2WMVA 5B7VA 4C38A 2J4ZA 2BDFA 1H4LA 2O5KA 4X3FA 4RJ8A 1OKVA 2GMXA 3MH2A 4NKAA 5D9HA 5AAEA 4F0IA 4KSQA 1H0WA 2GNGA 2QKRA 3ZDIA 4Y46A 3ZLSA 2XA4A 4GG7A 4XS2A 3SOAA 4DGMA 3A2CA 5HEZA 4A4OA 2X8DA 4FEXA 3NMUF 1FPUA 3WI6A 2ITXA 2WOTA 3GP0A 5DE2A 1H24A 1IA8A 4YTHA 1F3MC 2OXXA 4UMRA 2CKQA 1Q4LA 4OTFA 4FV4A 3LFQA 3D7TA 5HGIA 1XH9A 2XEZA 3LIJA 5HICA 4N0SA 3IW4A 4HYIA 2PSQA 4PDPA 4S30A 5CWZA 5EM8A 2BZIB 1PYEA 3RTPA 4BI0A 2J5EA 4K33A 3LVPA 3LFCA 4D2TA 4FT7A 4O7VA 2YM3A 4EUUA 4MXXA 4GU6A 2P4IA 4ZP5A 1STCE 1KWPA 4QP2A 5KMIA 3VS2A 4LI5A 4XLIA 2B55A 5H8EA 2R2PA 3PWYA 4RGJA 3FYJX 2V62A 4O0WA 3THBA 3OCSA 5E8ZA 5LVLA 2C5NA 4M7IA 2XCKA 4ZTLA 4D55A 3SGCA 3QHRA 3UQFA 3MH1A 4KIQA 1NVQA 2XKEA 5EM6A 2UV2A 3HV5A 3ITZA 3OY3A 4TWOA 5C27A 2UW4A 1H1SA 2BTSA 4FL2A 2IW9A 1YHSA 4FZ6A 3RM6A 1RDQE 4E4MA 3FAAA 2XKCA 3GU5A 3KN5A 3C51A 1OL5A 5CANA 4A9TA 2IVVA 3Q9XA 5AP6A 3KKVA 5ETCA 4R5SA 5M08A 4QMLA 2ZYBA 4PNIA 1BI7A 2OI4X 3QGWA 2YCQA 2XBAA 3NCGA 4RA5A 3OT3A 5IH4A 3BEAA 3DK3A 2WU7A 4Q2AA 1Y8YA 3FPQA 4C4HA 5FP5A 3S3IA 3PTGA 3W2PA 4OAVB 4FVQA 1XQZA 1DAYA 4EK8A 5IMEA 2YACA 2C6TA 3K5VA 4KKEA 3OBGA 1W98A 3O8UA 2LAVA 4XG9A 2HCKA 3DB8A 4YTIA 1PHKA 1DAWA 4AGWA 3LMIA 3NUXA 4X2NA 3TACA 3R8VA 4YO6A 2ETKA 4KINA 5AV0A 2OIQA 4BGQA 4J8NA 3TM0A 4PQNA 3RALA 1QPDA 2WMXA 3GU6A 3Q5ZA 5HLNA 3KK9A 2W1ZA 2OU7A 4FT9A 3R6XA 1ND4A 5HCXA 1Q3DA 3E7VA 4UZDA 3C0HA 2X7OA 3EQDA 4AF3A 2YM8A 4V0GA 2ZM3A 2OGVA 4JLCA 2BPMA 2XK6A 2OBJA 4MK0A 4F9WA 4YBJA 3UZRA 2VTJA 3VQUA 3W55A 3RPOA 2W5HA 3R7EA 4G2FA 1VR2A 1SVGA 1ZZLA 3NUPA 3I0OA 5M4FA 4Z3VA 4E73A 1P4OA 2GHLA 2YA9A 4BCNA 3PJ2A 5AAFA 1P14A 4FV3A 1G3NA 2XB7A 5HG8A 4YUQA 1JKKA 4FNWA 3QHWA 4F99A 2QOOA 5CF5A 4DE4A 4AXAA 1UU7A 4DEGA 4GMYA 3FC1X 3QTXA 3PXFA 4BDIA 4XV3A 2JFLA 5CLPA 1H01A 1GZ8A 2R3PA 3IKAA 4FKIA 3WIKA 1YDTE 1Q41A 4AZWA 4TWPA 4NM5A 4JDJA 4JI9A 5DRDA 5EYDA 1S9JA 2R9SA 4I94A 5EKOA 4IC7A 3K5UA 4O27B 3L8SA 3VS7A 5M07A 1WVWA 5JFWA 4I5HA 2ITUA 4KBAA 4MQ2A 2UVZA 5IUHA 3ORNA 4ZSJA 4C2VA 4QP7A 4GUEA 2W96B 2W7XA 4I23A 2QCSA 3EQCA 2W1DA 5IQHA 3R04A 3O50A 4NW5A 4YHFA 3L8VA 5CX9A 4BCGA 3QQKA 2CCIA 3F2RA 2VWIA 4P5ZA 5HESA 2YWVA 3EN4A 2BR1A 3WZUA 2R64A 4PMPA 1J3HA 1FQ1B 2J0MB 3OMVA 4OBQA 3U6IA 3NW6A 4JBOA 4FG7A 4A9RA 3OWLA 4PMTA 4QMMA 4FV5A 1OI9A 3GC8A 3R2BA 3CQWA 4LGDA 5ETAA 4JDIA 3TUBA 3MA3A 2YIQA 5E9EA 5HE1A 2OH0E 3RAHA 4EHGA 3MS9A 4CG8A 4BICA 4IM3A 5FXRA 5IQEA 3FZ1A 4R6VA 4FKSA 2KULA 4FKTA 2VU3A 1PXOA 4LYNA 2GNFA 5AP7A 4BWXA 4BDJA 4ZMEA 2UZNA 4DEIA 4OTDA 3A62A 4AACA 5BVKA 1EH4A 3SRVA 4FKPA 1T46A 3D9VA 5EKNA 3H9RA 4QYHA 3VS1A 4LGHA 3ORKA 3TN8A 2ZOQA 2GQGA 5LMKA 4JOAA 3ULIA 2H34A 4ASEA 3QF9A 3LOKA 1W8CA 2XEYA 1I44A 1TVOA 2RFEA 3KVXA 5DOSA 5CEQA 3ZC6A 3CQUA 3ORTA 3LM0A 3Q6UA 3W8QA 5BUIA 4C2WA 4XG8A 4G34A 5AX9A 4NFNA 4IB1A 3RKBA 3F5XA 4KUJA 4M0YA 4JR7A 4CVAA 2PZYA 3GC7A 3QKLA 4U41A 5DR9A 5K4IA 3FZSA 3CR0A 4L8MA 4Z7HA 3VHKA 4G31A 3KY2A 2UW7A 3EJ1A 3KRXA 4MNFA 2OF2A 4AZEA 1V1KA 4FIIA 2QOHA 3VN9A 2G1TA 4NH1A 4CD0A 2WMAA 2PE2A 4I6BA 4JQ7A 1R78A 3GC9A 3JS2A 4FA2A 4E5WA 1GNGA 5G1XA 2B0QA 5I9WA 2I40A 5KO1A 1PXPA 4TWCA 3QQUA 4G6LA 2BZKB 3NLBA 4IEBA 4D2WA 5EM7A 4R78A 4F1MA 1W82A 3UYSA 4C58A 3JVSA 4XRLA 3BU5A 3QTQA 4IW0A 4GH2A 3KCKA 5KZ0A 4BVUA 1J7UA 2C68A 2BRGA 4FTUA 2Z60A 2ONLC 2Y6MA 2BVAA 4D2PA 1UV5A 2IG7A 4G5JA 4WO5A 5KZIA 2OICA 3ZSIA 4USFA 5CAOA 5LVNA 1HCLA 5HNIX 2RF9A 3AD6A 2QG7A 1JKLA 4YMJA 5AIKA 4FICA 4U8ZA 4X2FA 4ZMFA 3FXXA 3SXSA 3QCSA 2XIYA 4ACGA 4DT8A 3F3VA 3MDYA 4JQ8A 3O51A 3PVGA 5JFSA 2QOLA 5JQ8A 4QTCA 3ROCA 3P5KA 4L3PA 4X21A 3MFUA 3R2YA 4MXOA 5AR4A 3ZS5A 2HK5A 3DY7A 5E8YA 4I93A 4RVKA 4DCEA 4E5AX 3MPTA 1JVPP 1Y91A 4O7ZA 4QQ5A 3QBNA 3NUSA 1JWHA 3ZH8A 2PMIA 3PIXA 1IA9A 3ZFYA 4BR3A 3FI2A 5CI7A 1Z9XA 1OM1A 3DV3A 4S2ZA 1Q61A 5HCYA 4CV8A 4KKHA 4FEWA 4ANLA 3COIA 4EH2A 4YSJA 4QP1A 4ZY6A 2J2IB 4FEVA 4Y72A 2LGCA 2ZV8A 3MB7A 4TN6A 3MH0A 1O6KA 1ZZ2A 5J9ZA 5ETFA 2X9EA 4QYYA 2OZAA 3AC4A 3PXRA 4MQ1A 4YZDA 5IDPA 2BCJA 2WTKC 1QPEA 1R0EA 4ACDA 3PZEA 3QUEA 4WG3A 5HKMA 1R39A 3E8DA 3HYHA 4B6LA 4BDCA 1PJKA 1U46A 3QQHA 4OUCA 4QRCA 5E8UA 3MY0A 5IQFA 5BYYA 4GW8A 4EZ5A 3C4EA 4QPSA 3P7AA 4U97A 1YOLA 4APCA 5FEQA 4YTCA 5GZ8A 4ZXTA 3PP1A 5IA3A 4ZTRA 4YPDA 2J7TA 4H3QA 5T3QA 4IIRA 2JLDA 3MTLA 3DBFA 2QU5A 2BZJA 4QP4A 4RVTA 5DT3A 2YEXA 2YERA 2KTYA 4J8MA 3UP2A 4YC8A 2PPQA 3LMGA 2WTWA 3F69A 3LJ0A 1YDRE 3HLLA 1V0BA 2OJJA 4OTQA 2W0JA 4UV0A 3KU2A 2XRUA 3NYXA 3RP9A 3R28A 4AN2A 4BDGA 4O6EA 1OPKA 3ZZEA 2BDJA 4UEUA 3FMHA 3MIAA 3FC2A 4BTFA 2OW3A 3QD0A 4OT5A 3HL7A 4RG0A 5AUZA 5C8KA 5A4QA 2C3JA 1PYXA 3G5DA 3I0QA 4PWNA 4RIYB 3R71A 1RJBA 4IM2A 3UP7A 5AJQA 3V5QA 4BGHA 4D0XA 2O0UA 1YI6A 3W32A 5EYMA 4IXPA 3QRJA 2GFSA 3OROA 4I92A 4M67A 1NVRA 4O2ZA 3NNVA 3T9IA 1UNGA 4L43A 5ANJA 1AGWA 1VJYA 4OTGA 4G9CA 4EH6A 2BALA 1BYGA 5IMXA 3DXPA 1B38A 4H36A 2WMRA 4HZRA 5FTOA 5HD7A 4I6QA 2VTNA 4I0SA 1CKJA 3GXLA 2CGXA 2VRXA 2WTCA 2GPHA 3FQEA 4O91A 4PV0A 3NNXA 3QX4A 4QPAA 4RC2A 5JGDA 4K2RA 2IZSA 2QODA 3IW8A 4PX6A 2FYSA 2A1AB 3CEKA 3FMLA 2O8YA 3GU4A 4JVGA 4MXCA 4EOQA 3CD3A 3P7BA 4NIFB 5DR2A 2J0KA 4E20A 4MWHA 5EDPA 2PE1A 3LXLA 3TZMA 1Q24A 3QCYA 2O3PA 2XCHA 5AP3A 2W1CA 3LZBA 4QMXA 4YTFA 4BWKA 2DS1A 2VGPA 3FZOA 3A7IA 3P23A 2PZRA 2F7ZE 3Q5IA 3QQJA 3QWKA 4GL9A 3QAME 4RLLA 4AT3A 3P0MA 4XMOA 5M57A 4IAIA 1NY3A 3VWAA 5CSVA 3QTUA 2BROA 4YLJA 4BI1A 2WELA 3Q2MA 4UZHA 5HIDA 3TL8A 3VUHA 4A9UA 2VTAA 3MFTA 3Q9YA 4X3JA 3NEWA 3R8MA 2Z8CA 4FG9A 4Q5HA 4EOMA 4ANQA 4B9DA 1WBNA 3UOKA 5I0BA 5IPJA 2YM5A 3UGCA 3MSSA 4PL4A 2V22A 4X2GA 2VTRA 2B1PA 4DH5A 4ERKA 3TZ7A 1G8AA 2XMYA 2J0JA 4CFWA 3OW3A 3SXRA 3U4UA 3KXGA 1MQ4A 2ERKA 4IWOA 3VBYA 4CT2A 4RT7A 5JN2A 3U87A 2HENA 3DJ7A 3LPBA 4NKSA 3MY5A 3NCZA 3KULA 5GHVA 2O64A 4FKQA 4FYNA 2WQNA 4O21A 2B52A 5E4HA 3WF5A 5G6VA 5AUUA 3BHTA 4QP9A 2ITNA 3FLYA 3MPMA 3LFFA 3SOCA 3Q9WA 3NR9A 4I6HA 3EKNA 3OG7A 1U54B 2ETRA 2FSTX 3AOXA 3Q53A 4RWLA 2UW5A 3DAJA 4FTTA 4PRJA 1OL1A 3BELA 4QMYA 5AA9A 3OVVA 2JDTA 1CM8A 1JLUE 4RJ3A 4RWIA 4N6ZA 4UWCA 4LMUA 4PY1A 4YPSA 3BWJA 5CQUA 3KF7A 4WIHA 4WNOA 4YZNA 3GU8A 3PVWA 5CU2A 2WQOA 3A7HA 5HG7A 2W1GA 5L8JA 4J1RA 1H25A 2VWUA 4BBFA 3DS6A 4ITIA 5LMBA 5FQDC 3CSVA 3PJCA 4XP0A 5M56A 4RC4A 5H9BA 4ACCA 1H00A 3NYNA 3BCEA 5JZJA 2OK1A 3P9JA 4ZTMA 4UX9A 4WUAA 2PMNX 3D14A 1YDSE 4MCVA 4V04A 1E1VA 4I20A 2WMSA 2O63A 4IHPA 3BYMA 3QTZA 4X2JA 5EI8A 4CXAA 4FNZA 5HNGA 3UTOA 2WOUA 3W2OA 4PF4A 2X6EA 2J0LA 4A9YA 2ZAZA 3QXOA 3Q96A 3PFQA 2VTQA 4IWDA 4FC0A 4IADA 4YJPA 4ZOGA 2X7FA 5KHWA 5J5SA 1M14A 3ZC5A 1YWNA 4IAAA 1ZYJA 4EH4A 3V5PA 3KF4A 5IUGA 3SW7A 4CFXA 2UZLA 3CBLA 2REIA 2C6LA 3ETAA 5AP4A 4DH8A 1PXMA 2PWLA 4BDHA 4M8TA 3HMNA 4RZWA 4O7NA 2BHEA 3EQRA 2IJMA 1OZ1A 1HOWA 4AW2A 3QLGA 3MESA 5LVPA 3A99A 4FTKA 2QQ7A 2B9JA 2QKWB 3O96A 3R9DA 1WBWA 3VBQA 3VS4A 4I5MA 4OTPA 2VGOA 3HV3A 4ANBA 4F64A 4BTMA 2V5QA 4EKKA 3ATTA 1GIIA 4ZY4A 4DC2A 4ZSLA 3OOGA 4ARKA 1KE5A 3D2IA 5LCJA 4DHFA 3HUBA 3FYKX 1PXKA 5HCZA 5IH6A 4S34A 4QMSA 1YI4A 4K77A 4FKUA 3PY0A 4C4IA 2C0IA 3ANRA 3HDNA 2X4FA 1Y8GA 3BGPA 4F6UA 3ZXZA 3EL7A 4Z7GA 4RFYA 3UIXA 2OZOA 1XJDA 5M09A 4RQKA 4FUYA 3TIYA 3F5GA 3Q32A 4IAFA 3R8ZA 4R3RA 4C62A 4IB5A 3ATSA 1ERKA 3ALNA 4EBWA 2I0EA 3VUMA 2WTDA 4FK6A 1PY5A 2R3JA 3MY1A 4QO9A 3R8UA 2HIWA 2J5FA 4FK3A 3TJCA 1Q97A 1YHVA 4HNFA 4L52A 2UZTA 4FKWA 4QPMA 4BHNA 3H0YA 3BHHA 3TV4A 4D9TA 4RJ4A 1FVRA 2DQ7X 4B0GA 4DT9A 4KIPA 1X8BA 1IASA 1U59A 3O17A 4DFYA 2QU6A 5AUYA 5HLWA 2CGUA 4KKGA 4V05A 2WEIA 5EW9A 3IW5A 2WMQA 3V8WA 2GS2A 2ZVAA 3PSDA 4R5YA 5FTQA 3UC3A 2W4KA 4ZJJA 2C30A 4LRJA 4J71A 2FSOX 4XV1A 2YABA 4APPA 4HGTA 3DT1A 3K54A 5FLFA 4D4RA 2R3IA 4C0TA 3P78A 3ACJA 4IM0A 2YCFA 2ZV2A 4PUZA 2UZDA 1S9IA 4P2KA 3OCBA 3JVRA 4U3ZA 4E4XA 2GQRA 5AIRA 4C02A 4DFXE 4I5CA 1ZXEA 3O7LD 5E7RA 1XH6A 2ZMCA 3CTQA 5L2TA 3VF9A 4EH5A 4LV8A 4ITJA 2FB8A 4K1BA 2YFXA 4ALUA 3LCSA 2BAJA 2P2IA 2QOFA 2PMOX 5BPYA 4M68A 5JZNA 5EYCA 3IPHA 1WBSA 4G3DA 3QALE 5LJJA 1F5QA 2XH5A 4HYHA 2H8HA 2Z7QA 4NUSA 3ZFMA 2RGPA 5HU9A 4TTHB 3WF9A 2RFSA 3D5VA 5F20A 3SW4A 4P7EA 3E87A 4UXQA 5DNRA 1OIYA 4JG8A 2JBPA 3EQPA 1H26A 4E93A 2R7BA 3MVHA 3RJCA 4TPTA 4BTKA 3NUNA 5DG5A 1ZAOA 2PVNA 3V5TA 2VX1A 3VBTA 3QUDA 4PDSA 3ODYX 2OJGA 3KRRA 1Q8YA 5HI2A 3V3VA 3O71A 2ITWA 4KABA 2R4BA 4OTWA 2GSFA 3LXPA 3NGAA 4TYJA 2FH9A 2VV9A 3QRIA 2BKKA 3A4OX 3EQFA 3QRTA 4I21A 4YJOA 4JNWA 3QQGA 4ORKA 3CP9A 2EVAA 3T8OA 3NAYA 4NFMA 5JGBA 1LEZA 2SRCA 3BRBA 4H39A 2GU8A 5M55A 4BCMA 4WNMA 3TNWA 3IG7A 3A8WA 4E5BA 4NM0A 2FUMA 3R9OA 4YC3A 3LFEA 2B53A 3KXMA 2VX0A 2XIZA 3OF0A 5HIEA 2YDIA 3HEGA 3MV5A 5J9YA 4IX3A 2E9PA 4ZZMA 3ZO1A 2CKEA 4FTRA 4M69B 3FHRA 4ERWA 4PPAA 4UYAA 3ZONA 4CFMA 3EQHA 4BDAA 4CKIA 3IQ7A 3KRLA 3QQLA 4G3FA 4CLIA 4GRBA 5CSPA 5J7BA 2R3FA 2C6OA 2VTHA 2WAJA 3HVCA 3LFDA 3P1AA 3QD2B 3QL8A 4L3LA 1QCFA 3PG3A 2G01A 4MAOA 2W9FB 3TKHA 4BCJA 3WE8A 4DFLA 3NRMA 4YZCA 4XLVA 2X2LA 5BVOA 3PLSA 4XOYA 5FXSA 3W2QA 4BZOA 5KMLA 5LVMA 4YR8A 4LL0A 5ANKA 4CCUA 3KXXA 4FVPA 2X2KA 3NNUA 4CFVA 1PRYA 5C9CA 5C26A 2ZV7A 2Q83A 1DI9A 3VUTA 5HE3A 3CLYA 3RHXA 1SYKA 2VWWA 4FI1A 4OBPA 4WD5A 3RZBA 4CG9A 1YKRA 5DH3A 5JRQA 4L01A 3WBLA 3EIDA 4G1WA 5JGAA 1UNHA 4M13A 4FSQA 4Y5QA 2VX3A 3VS0A 2WTKB 2EU9A 2C0OA 4B8LA 4ZTSA 3DJ6A 2ITPA 5E8SA 3KB7A 2Y4PA 5FGKA 3HMIA 3BWFA 5IQGA 1GY3A 1CMKE 2HY0A 3BE9A 5C01A 4X6RA 4B7TA 2WIPA 3A4PA 4W4YA 3WARA 1Z57A 1JKSA 3POOA 3DCVA 2CKPA 2W1EA 4UMTA 2BTRA 4OTHA 4GJ2A 3PZHA 3E62A 1YHWA 2NO3A 4QYEA 5L6OA 2XJ2A 4XX9A 1H07A 2JITA 4GS6A 4E8AA 4CTBA 4CZUA 3D4QA 5IA0A 2F57A 2XKDA 4NM3A 3VHEA 3DBEA 5FBNC 2WPAA 4XP3A 1V0OA 3VRYA 1Q8ZA 1U4DA 4H05A 3FKOA 4C35A 5IUIA 4NJDA 5H8BA 4KIKB 4FV7A 1XBBA 2JAVA 4B8MA 4DEBA 2F49A 4O0TA 3ZM4A 2EB2A 4AZFA 3O7LB 3FMKA 3RZFA 1UNLA 4OR5A 3IK3A 5ETIA 3G51A 4NCTA 4ANMA 3FMDA 3IO7A 2F2UA 5AM7A 2OKRA 4EWQA 2OFUA 3RCDA 4D1ZA 5CYIA 3R8LA 4IVCA 4OW8A 2FVDA 4O0YA 1WCCA 3R7OA 4AT4A 2QO7A 3DDPA 3L8XA 5H3QA 4D1SA 4OGRA 2I0HA 3U6JA 5KBRA 4D5KA 3OY1A 2VWZA 1APME 2W1HA 4RC3A 5FEEA 4XH6A 3K3IA 4X3FB 3UNZA 3BYVA 3F3ZA 2J51A 1H08A 4J99A 4AGUA 4MYGA 4NEUA 4F7NA 3E63A 4O6LA 3GEQA 5B0XA 3LQ8A 3FWQA 4DEAA 3HMMA 5JFVA 5EHOA 2W06A 4FV6A 2C6EA 2QVSE 4DBXA 4L6QA 2BAKA 3BQRA 3GCVA 5AUVA 2G2HA 3UMWA 3ACKA 3VUGA 5L2IA 3S4QA 1LP4A 4X7QA 3ZU7A 3U8WA 3I81A 2QC6A 4XHKB 4XCUA 5EHYA 2WU6A 4GK3A 1XBAA 4GYGA 4WBBB 2BRHA 3A61A 4RIOA 1TQPA 2EXEA 2UW0A 1W0XC 1MRVA 3H9FA 1OITA 1URWA 4LV5A 4F9YA 4EJ7A 5HE2A 5KMJA 4E3CA 5AA8A 4J97A 1JSTA 3NYVA 4K8AA 3QXPA 5AADA 2PUIA 1ZYLA 3L9LA 2YAKA 1TKIA 3BHVA 4JIKA 4D2RA 1P5EA 2FO0A 3D5UA 1ZYSA 1CKPA 4C34A 5KUPA 2WMUA 4DN5A 4A9SA 1FBNA 4AFJA 1KUTA 3QUPA 3CTJA 4BBMA 4BGGA 4RVLA 3MN3A 4GVAA 3RK5A 1GJOA 2XNOA 2ZDUA 3LFAA 3M42A 3PJ8A 3M1SA 4AAAA 5A54A 3RGFA 2XIKA 5CU3A 1DM2A 3RPYA 4DFNA 2ETMA 3LFBA 4FTMA 5ANDA 3MB6A 3SQQA 4DGNA 5DR6A 5I9UA 3OEZA 3R7VA 2VNYA 5I9YA 3BX5A 3PIYA 3Q4TA 3Q6WA 4OT6A 3DAKA 2JDOA 2WGJA 2WHBA 3ZLYA 3BYOA 1IRKA 3DA6A 5D10A 4O22A 3I6UA 2ACXA 2ITTA 5M4UA 2XIXA 2F4JA 2BAQA 1IG1A 2UW3A 2VAGA 3F66A 4FTLA 4AA5A 3ZTXA 4FE2A 2CJMA 3PVUA 4EUTA 4ENYA 1Q62A 4O2PA 5CT7A 1GOLA 4L7SA 4CRLA 2C3IB 2W4OA 3AMBA 4XV2A 3UVRA 4EHZA 4JBPA 3GOKA 1NW1A 4RA4A 3AT3A 2JGZA 3QGYA 4Q5EA 4EH7A 3WF7A 4F6SA 4G5PA 3PXZA 2QOCA 1BX6A 4MBLA 5LCKA 5HLPA 2CNVA 4GFMA 1ATPE 1OKWA 1OL7A 4R1VA 4NZWB 3MTFA 2B7AA 3OS3A 5FTGA 3I7BA 1FINA 2E9NA 4FGBA 4EOPA 3F6XA 3FY2A 3QD4A 4W9WA 2JEDA 2R7IA 3VVHA 3NW7A 4BN1A 4AW1A 4ANSA 3KRJA 5AAGA 4IX4A 4F1OA 2XK8A 3T9TA 3DZOA 3DFAA 3LCOA 3R7UA 4L3JA 4TYEA 4F0FA 4B99A 3WYYA 5TKDA 5D1JA 3FI4A 1E9HA 5D11A 4E4LA 5F9EA 2J6MA 3C5UA 4YNEA 2X7GA 3EYHA 5AFVA 5B2LA 3UO6A 3PLAE 2WQMA 5CS6A 3W18A 4MWIA 5HZNA 3S1HA 4H3PA 5CVHA 3I4BA 4ANOA 5E90A 3R1SA 3FLQA 3C4ZA 4I41A 3TNQB 4BDEA 3NUAA 3FY0A 3KC3A 4PP7A 4QTEA 1XHAA 3EWHA 4W8DA 5EH0A 1M2QA 2A27A 4ZEGA 3LHJA 3MIYA 5TOZA 3ZRMA 2YZAA 2FSMX 3A7GA 2PMLX 5TF9A 3VF8A 5EOLA 2F2CB 4DGOA 1UU9A 4L7FA 3ZXTA 4U45A 2I6LA 4Q9ZA 4AW5A 1REKA 3RWPA 4ALWA 3QD3A 3WILA 3QTSA 1VYZA 5TO8A 2GQSA 4HCVA 2R3HA 3NUUA 5E8WA 3OWKA 4ZTQA 3U9CA 5J7HA 2JIIA 1FGKA 1M7QA 3FL4A 4CZTA 3ID6C 3FZTA 3GQIA 3G0EA 5CI6A 4CV9A 4WHZA 5D7VA 4IWQA 3QU0A 5DHJA 1H27A 4XYFA 4ZTHA 2CDZA 3UO5A 2HELA 2YJRA 2Y4IC 3II5A 2EWAA 3NNWA 3R01A 4U42A 5IEVA 1KE6A 3FZPA 4RBLA 5A46A 3E93A 4W4WA 1OB3A 4XP2A 2BFXA 4EZ7A 3W1FA 3QTWA 3ZEWA 2YCRA 3UC4A 1OL2A 2JDVA 4XRJA 3LLTA 3KMUA 3CC6A 3ULZA 2QNJA 3KCFA 1OKYA 2VTSA 5K4JA 4JAJA 5ICPA 3NZ0A 2YIYA 4PTGA 2X8EA 2PZIA 4FV8A 4EOJA 3DXQA 4KRDA 3VNTA 4MD7E 4NJ3A 5CEKA 4GCJA 4C4JA 2UW8A 3ZO4A 3W33A 4EEVA 4DH7A 3BE2A 3KN6A 3TTIA 4ACMA 5CAQA 3U6HA 1MRYA 3BV2A 4KD1A 4FBXA 4AX8A 3CIKA 5DIAA 2DYLA 3O8TA 4DH1A 5HG9A 5AP5A 3AQVA 1FVVA 4FZDB 3FJQE 4I1ZA 2AUHA 4EOLA 4S32A 2NNWB 2WKMA 2WMTA 4HOKA 2QLUA 4LL5A 3N4TA 2XKFA 3HZTA 4FSMA 3BQCA 4L00A 4EK4A 3C50A 4Z55A 4JAIA 3TCPA 2PTKA 3KXZA 3QKMA 2Y6OA 3AC1A 3KFAA 4RIYA 5AP0A 5GJGA 1OPLA 3UG2A 4F6WA 1KE9A 5CQWA 5AUXA 5H8GA 3BGZA 2VO7A 4EOOA 3QRUA 5A6OA 2G15A 4TYHB 4RIWB 3B2TA 4WSYA 4WUNA 2P3GX 3V51A 3QC4A 4IJPA 3VC4A 3FKLA 1WMKA 3ORPA 4EJNA 2OSCA 5IU2A 2C69A 4EORA 3FKNA 5CEMA 4PDOA 4CSVA 2RSVA 4EOSA 4IX6A 5E8TA 1QL6A 4M12A 3TXOA 3UNJA 4HVIA 4ASDA 4QMTA 4NTSA 3TV7A 4QQCA 3KK8A 4RSSA 2C1AA 2XM9A 4ASZA 4M84A 2WMBA 3E8CA 4IB3A 3HAVA 4R7BA 3AT2A 4WOVA 1QMZA 3CTHA 4L46A 4C59A 4F63A 4MNEB 3DBDA 4G6NA 5CXZA 4DAWA 5M51A 5K0KA 3B8QA 4G3EA 4OLIA 4IZYA 2V55A 2OFVA 3BU3A 4IFCA 4YLKA 4IFGA 5DPVA 4BCQA 3TDVA 5C4LA 3GNIB 4GV1A 2A4LA 2ITYA 3LCTA 4QMQA 4K0YA 1XWSA 2WO6A 4HYSA 2P2HA 3A7FA 3PSBA 2UZBA 3CS9A 3KQ7A 3QA0A 2C5YA 4J7BA 4PTCA 5M44A 4HPTE 2IWIA 3B2WA 4FT0A 3UOHA 5HORA 4MXYA 5IEYA 4ZLOA 3EFLA 3TEIA 3SG9A 4UY9A 2YAAA 1E1XA 1VYWA 3HECA 1LEWA 2RFNA 5JEBA 2YM6A 1QPCA 3E8NA 3WZDA 3V6RA 5KMMA 2CGVA 3PYYA 2BHHA 3NIEA 3TT0A 4M97A 4EBVA 4FT5A 4D4VA 3F2AA 5EW8A 3EZRA 3TNIA 3VQHA 3W16A 3OW4A 4I3ZA 2AC3A 2CSNA 1UKIA 4FOBA 4IJ9A 3VIDA 3ZOSA 4NW6A 5EOBA 1P4FA 2JKQA 3FL5A 4X3FC 5J8IA 3IGOA 4BIBA 4CQEA 3L1SA 3KREA 3A60A 4YHJA 2GDOA 3IDPA 3P86A 4MD8E 4C36A 3GQLA 4M66A 2H96A 5IQIA 4XUFA 1U54A 4LGGA 4D0WA 2W99B 4F0GA 5M4IA 3F3WA 4KB8A 2Z7SA 4O1OA 4JRNA 5IF1A 1M52A 1Q3WA 3G9LX 4IVAA 4CRSA 5GJFA 5E1EA 3GCPA 4LUDA 4OTIA 2ZM1A 4UMQA 2W1FA 5J95A 3WF6A 3G15A 5EM5A 4N6YA 2G2FA 1P2AA 2W5AA 2O65A 3F7ZA 2PULA 1GZKA 3HRFA 2GNLA 3S2PA 4FKJA 5DT0A 3R73A 5C03A 1LR4A 2B54A 3VULA 2VTLA 3EN5A 3ALOA 1A48A 4II5A 4DFUA 1B39A 3HA8A 4PMMA 5FG8A 4HYUA 4TNDA 3C0IA 2QG5A 3MVJA 4QMUA 2J0IA 4XG7A 4CEGA 1GIHA 3QA8A 1YVJA 3AG9A 4QYFA 1WBPA 4WA9A 4K11A 2Z02A 4ZK5A 3F5PA 4O7YA 4ITHA 5D41A 3ZSHA 4IX5A 2VO6A 3I79A 3PA5A 1UWHA 1MQBA 5CT0A 3OWPA 3ZDUA 1WAKA 3AXWA 1PMEA 3FLSA 4Z9LA 3ZSGA 4FSNA 5CF6A 2WB8A 4EQMA 1J1CA 3KL8A 4YJQA 1XR1A 1ZWSA 2J90A 4J53A 3GB2A 1L3RE 3RPRA 4D58A 2DUVA 5HTBA 3DGKA 5CXHA 4IB0A 2F7XE 4QOXA 5JRSA 4G17A 1O6LA 3WIGA 4W9XA 2OLCA 3BHYA 3R8PA 1VZOA 2HOGA 3PUPA 4F65A 1ZY5A 4GIIA 4RX5A 2UZUE 1ZOHA 1Z5MA 3WZKA 2WMWA 4GYIA 3R1NA
chains in the Genus database with same CATH superfamily
4O0UA 5EG3A 4GEOA 3VJOA 3FSFA 4R1YA 4IVDA 5CEPA 3FMMA 1QPJA 2JAMA 1R1WA 2J50A 3LM5A 5DBXA 2XZSA 2P55A 1Q99A 3JXWA 4HPUE 1OVEA 4L9IA 1XO2B 3PY1A 3FMEA 4GG5A 5JMSA 2GNJA 4L45A 4EK6A 3B8RA 3OTUA 2X1NA 5AUWA 4O84A 3W10A 3RAIA 2YWPA 3PRIA 4P5QA 1FVTA 3GCSA 4YJVA 4AT5A 5GIPE 2XNMA 1Y6AA 3LKMA 1FOTA 3RI1A 3PPJA 3ZO3A 5DMZA 2IO6A 4D28A 2HZIA 2JIUA 4D2VA 3R02A 5HVYA 2B4SB 3MH3A 2A0CX 1OPJA 1YWRA 5IA1A 2GNHA 5EI2A 3NVKI 5HE0A 5BQ0A 2FA2A 3C13A 4EHVA 4CYJA 5JK3A 2X0OA 3WE4A 4Y85A 1G8SA 1F0QA 2XRWA 2NP8A 1U5QA 3BPRA 4U81A 4C3RA 4FODA 4HGLA 3SXFA 1BKXA 4M0ZA 5HO6A 4O7LA 3PJ3A 4JS8A 2XS0A 3Q60A 2GTNA 3ROYA 1Q8TA 3EMGA 3SAYA 1BL7A 4KAOA 2QOIA 2VWXA 2XM8A 4FV2A 3SC1A 3JY0A 3OOMA 4DG3E 4MBIA 4BCPA 5HTIA 3DXNA 3A7JA 3NSZA 5F1ZA 3DTCA 4EK3A 4N70A 1PMVA 4FTNA 3F9NA 5FEDA 2YIWA 4FSZA 3FQHA 5GINE 3C4CA 3GT8A 4ANNA 3OWJA 3K2LA 5EQPA 3OFMA 4J95A 2VTOA 3BL9A 3VW8A 3BHUA 2WEVA 4UWYA 3L9PA 3SX9A 1TFFA 3FLNC 3PG1A 4KNBA 3CXWA 4JR3A 2YM4A 4JG7A 4OTRA 3SD0A 3QKKA 4GK2A 4DBNA 4O4EA 3DTWA 4GKHA 1SM2A 2I1MA 3CCNA 2QR8A 1SMHA 3KXNA 3SG8A 1YXTA 2X0GA 3VBWA 4CMUA 4RJ6A 1URCA 2JKOA 4QTDA 3RWQA 5KE0A 5AM6A 4FL1A 3R63A 5DI1A 4WRSA 3N51A 3P79A 1WBOA 3TZ9A 5CTPA 2CMWA 4JBQA 2ONLA 3QWJA 3UODA 1GZOA 3TDWA 4DINA 4E6CA 1UKHA 4RMZA 4FUXA 5F4NA 1JSVA 4ID7A 5HD4A 1UU3A 4KS8A 4O0VA 4HGSA 5AUTA 2IVUA 2O2UA 2VWBA 5AV3A 4LOPA 4B4LA 3VBVA 3EKKA 3VAPA 2WZJA 2X4ZA 3V5LA 4CTCA 1OUKA 1JSUA 3HMOA 3T3VA 1H1QA 1ZYCA 5ANIA 3UZTA 4C7TA 1LUFA 2Q0BA 4M69A 2ITQA 5A6NA 3C4FA 4FIFA 5K5NA 3NPCA 2ESMA 1G8KA 3LJ2A 3BEGA 4AE6A 2BRNA 3EYGA 2HZ4A 2XIRA 3QZHA 1YXVA 4RVMA 3FXWA 5H2UA 4R7IA 1M17A 4RFZA 3RPSA 3DNEA 4N57A 3UOJA 5HVJA 3ZUVA 5CAVA 4JJRA 3UYTA 2X8IA 4DCAA 5D12A 2ZM4A 1PMUA 4BL1A 1J7IA 4RIXA 3V01A 1KOAA 3TG1A 4A7CA 2WTVA 4LM5A 4YHTA 5M53A 2X39A 2ITOA 2YIRA 2E9UA 5EYKA 1WFCA 2C3LA 4FSWA 4MVFA 4E6QA 4BKZA 3L9MA 2Y4IB 4YNOA 2F7EE 4FIJA 5EHLA 3ZEPA 4O4FA 4XG3A 2R3OA 1AD5A 5CNOA 2AYPA 2XNBA 4RLKA 5K3YA 3FE3A 2PUNA 4AXFA 5AWMA 3UQGA 5K0XA 4L68A 2JKKA 3E8EA 3NX8A 5J9LA 3AD5A 4LG4A 4AE9A 3GC0A 4RQVA 4RX8A 4CMOA 1CTPE 4IDVA 2WTIA 4QMZA 3N9XA 4A07A 1J7LA 2PL0A 2V7OA 3OHTA 4P90A 4X0MA 2R3NA 3FMJA 3RM7A 4O96A 1SNXA 3F82A 4W8EA 3Q52A 5EK7A 4EKLA 1KV1A 3ET7A 3IS5A 5F95A 1XBCA 2H6DA 4AW0A 1FMKA 4NL0A 4PDYA 3LJ1A 4W4XA 4YJSA 4O1PA 4O86A 2RG5A 3MI9A 4TT7A 4GU9A 4KIOA 2B9HA 3FLZA 4D4SA 2H9VA 4RFMA 1ZOEA 3W8LA 4BIEA 4BF2A 3CGFA 2RL5A 3RINA 4BFMA 4YU2A 5BUJA 4CMTA 5JKGA 4USDA 1BMKA 4GT5A 3DB6A 1UA2A 4BHZA 2PVMA 1WBTA 4KIKA 4TKSA 5HO7A 3IONA 4HZSA 4DYMA 4MEDA 2BILB 2UW9A 4FX3A 4FTIA 4JX7A 5HQ0A 5KMOA 2PY3A 4NTTA 1IAHA 3PJ1A 4KRCA 2YIXA 1OUYA 4F78A 4RRVA 4WNPA 3DJ5A 3VUDA 1IR3A 4C3PA 5K9IA 5IEXA 1CKIA 3ZYAA 2XNPA 4XOZA 1K2PA 3TJDA 1REJA 2XANA 2W1IA 4F09A 4U44A 4C8BA 4TXCA 2ZDTA 3JYAA 4CFNA 4N4SA 2IZTA 4EWHA 4IAKA 4AWIA 4YSMA 2XJ0A 2WQBA 3VBXA 4DH3A 1OBGA 3W0QA 3I60A 3BKBA 4DEDA 2YN8A 4YZMA 5IQBA 1KSWA 4TNBA 3EN6A 2UZWE 3MJ2A 5KMNA 5DGZA 4AAYA 3QLFA 1XMLA 4TZRA 5BVFA 3O23A 5CVFA 3IECA 5HOAA 2IW8A 4QDVA 5LWMA 1OKZA 4M15A 1M2PA 3EN7A 5AMNA 2GHMA 2CLQA 2OJFE 5J79A 2VTTA 4EOKA 4Z16A 2HY81 3GI3A 1WBVA 4RWKA 4PL3A 1JPAA 1JBPE 4QD6A 2CPKE 3IW7A 2QONA 2VO3A 3GCQA 1O9UA 3RK9A 1H8FA 3N4UA 5FM3A 3VUKA 1U5RA 4QMVA 4CT1A 3PY3A 3CY2A 4YGAA 5J87A 3EL8A 4DTKA 2JKMA 5C8MA 3UMXA 1PKDA 3ZUUA 1M2RA 4AZVA 4KA3A 4X2KA 5CASA 5IQAA 2WNTA 1ZYDA 3C7QA 3R7YA 4XBUA 3VW6A 5LQFA 2ITVA 4AXCA 5BX0A 1CDKA 4UBAA 1FGIA 2V7AA 3BLRA 3UIBA 4O7TA 4EONA 5HVKA 3ZRLA 4E1ZA 4JDHA 5JH6A 4OBOA 2Y0AA 1WVXA 3FDNA 2BRBA 4IAZA 4BTJA 1PKGA 3CKWA 2OO8X 4JDKA 2V0DA 4FG8A 5GJDA 4MH7A 3BU6A 1YI3A 3OT8A 3C5IA 3SDJA 3DNDA 3BBTB 5EW3A 5AR3A 5A3XA 3RCJA 4C37A 2GTMA 4NM7A 4QP3A 4IAYA 4QP8A 4XJ0A 4YP8A 4IVBA 4DEHA 4HNIA 3Q2JA 4DHZA 3S95A 4F9CA 2B9FA 2PVRA 3VJNA 3KMMA 4AOTA 5BUEA 4LDTA 4IBMA 4EYJA 4O7RA 3ORMA 3Q9ZA 3TI1A 5CZIA 3OBJA 2C6DA 2UVYA 4QTAA 4DLJA 4XG2A 3KGAA 3ENHA 3AC2A 4FMQA 4BBEA 3MVMA 4DF3A 4IZ7A 4PPCA 4A4XA 3D7TB 1BI8A 3PIZA 5I9VA 3L8PA 4KS7A 3RMFA 1H1RA 2GS7A 5JFXA 3ZBFA 5AR2A 2A2AA 2Z7RA 1GAGA 1FMOE 3FUPA 2C5OA 3RNYA 4LV7A 3PA3A 3HV4A 5B2MA 3V8TA 3E88A 2OJ9A 4L42A 2BUJA 2R3KA 4ZZOA 5CAUA 2EUFB 4QQJA 4QTBA 4AP7A 4OAUC 3UVQA 4AN3A 3D0EA 3HP2A 4X6QC 2PYWA 3R0TA 4MTAA 5ANOA 3H30A 3UVPA 5EFQA 4BC6A 2XBJA 2XNGA 2XJ1A 2VTMA 2HXLA 3EH9A 4DEEA 4DFZE 4FZAB 1IAJA 4BIDA 4QP6A 4D5HA 4ZAUA 2WFYA 5CF8A 3OUNB 4H1MA 5CNNA 2PUPA 3FI8A 4I24A 3CY3A 3V5WA 1MP8A 1JKTA 4NT4A 1XH5A 2JBOA 3C1XA 4UWBA 4LMNA 2OIBA 2YLEA 3COKA 2W9ZB 4AFEA 3ORXA 2QOBA 4TRLA 3DBCA 4U7ZA 2VUWA 5CU6A 5I9ZA 1H28A 4R7HA 4U79A 3CGOA 5LWNA 4BDKA 2WTJA 4EZ3A 4BWPA 4TY1A 3EQGA 4O4CA 5FDXA 3OEFX 5KHXA 5IDNA 1PMNA 3PXKA 2YCSA 3GCUA 3DLSA 5T6KA 3F88A 2I0YA 2E9OA 2PVJA 4L44A 2XP2A 4LFIA 2C6IA 2PVFA 1JOWB 2X9FA 4GVJA 4CLJA 3ZO2A 3NAXA 4J98A 5EQEA 4F7JA 4CFFA 1H1PA 3A8XA 5E8XA 3LCKA 3DLZA 3DZQA 4FSRA 5B2KA 3BLHA 4D4YA 3DQWA 3IW6A 5KNJA 4GT4A 2UW6A 2IVTA 3BYSA 1OBDA 3TYKA 3KA0A 5TE0A 3HRBA 2HWOA 5J1WA 3NDMA 2UVXA 1XMMA 2Y9QA 4O81A 3COHA 4ZLYA 4Y95A 3EB0A 2W17A 4YJRA 4C3FA 3VRZA 1ZMWA 5CAPA 2C1BA 5L2SA 2GFCA 3DK6A 5E8VA 4D1XA 4H1JA 3TKIA 3TV6A 4C4EA 1R3CA 1K9AA 4UMPA 1PXLA 4V0GB 3QCQA 1NVSA 4G16A 4U43A 4HW7A 5IA2A 3U54A 2WD1A 4FIHA 3OXIA 4CCBA 3HAMA 1W7HA 3WZJA 3DKOA 2R5TA 4AOJA 1OMWA 4IH8A 3D15A 2BIYA 3O2MA 4RZVA 4BKYA 1NT2A 4JG6A 4WT6A 3U51A 2CHLA 5IISA 3V04A 4H3BA 4I6FA 5DEYA 5F94A 2C3KA 3QZFA 3EFWA 4HVHA 2ZB1A 3ZCLA 2R0UA 4JBVA 2EXCX 3HKOA 1PXNA 5IA4A 2XK3A 3ELJA 5CY3A 3VUIA 4J96A 4YO4A 4ZY5A 5M06A 3BLQA 1JNKA 4GUBA 2YDJA 3IDBA 2PE0A 3G0FA 3Q04A 3UBDA 3H3CA 3ZRKA 5D7AA 5DWRA 1ZMVA 1KOBA 4YC6A 2C47A 4F08A 2A19B 3HRCA 4ZSGA 2PHKA 4CQGA 4E6DA 1YXXA 2FGIA 2WXVA 4FSYA 4TW9A 4Y83A 2X2MA 5FM2A 3MBLA 4O83A 4DFBA 4KWPA 1YXUA 4JX3A 4FEQA 4D9UA 4U80A 4BDFA 3R7IA 3EZVA 4WKQA 4RPVA 5DA3A 5AR7A 5GIOE 3P4KA 4C4FA 2XYNA 3QYWA 1G5SA 5HBHA 5LARA 2PUUA 4YLLA 3PFYA 3TNHA 2F9GA 4JXFA 3E92A 4MXZA 5GZAA 1BLXA 1T45A 4U5JA 3QCXA 3R9HA 3H0ZA 2IW6A 4DA5A 3JUHA 4AGDA 1HCKA 1TQIA 3ZLWA 5BMMA 3AC5A 3BBWA 2RG6A 3TZ8A 2BKZA 2HXQA 4QMWA 3PXYA 4ZSAA 4TYHA 4RIWA 4ZZNA 4F70A 3AMYA 4KBKA 2NPQA 4O0RA 3OP5A 4F9AA 5HNBA 3K3JA 4FTQA 2BMCA 3E5AA 2QI8A 2C0TA 3COMA 2JIVA 4PL5A 3QTIA 3AMAA 3H10A 2C4GA 1ZARA 4KBCA 4C61A 4I4EA 4Y5HA 3LLAA 4U6RA 5HBJA 2R0IA 3LW0A 4NK9A 1XH7A 4EH3A 2OF4A 5BYZA 5A9UA 2CNQA 4M14A 4O7SA 5A4EA 5AEPA 5GZ9A 2ZV9A 3MGYA 4U0IA 4RX7A 3SRVB 3UPXA 4HVSA 3G9NA 3IDCA 2PVHA 4C4GA 4K6ZA 5IG1A 4O82A 3VS6A 4MNEA 5I3RA 5HHWA 3C9WA 1ZLTA 3D5WA 5I4NA 3PRFA 4GFGA 3R9NA 3AC3A 2CLXA 4FV9A 4R3PA 3FI3A 4DG0E 4F4PA 4DDGA 2IZRA 3ANQA 3WZEA 4LQMA 3I1AA 4CNHA 5L3AA 1ZMUA 4IMYA 4NSTA 4P4CA 2HW6A 4HJOA 4PNKA 4QMOA 3G90X 4RJ7A 5L6PA 1VEBA 3Q4CA 4FOCA 5IKWA 5AV4A 4YURA 4DGGA 3PDTA 4E6AA 1MUOA 3SA0A 1XH8A 3OTVA 5AP1A 3UDTA 3Q4ZA 3MVLA 3HNGA 4FKOA 4AN9A 4AS0A 5CVGA 5IQDA 4EL9A 4F7SA 3HA6A 4L67A 3ZZWA 5CF4A 2OIDA 3HV6A 4IANA 5J1VA 2YDKA 4YJTA 4FL3A 2OG8A 1Q5KA 3O0GA 5CALA 3FEGA 2HAKA 3FLWA 3QZIA 4YZ9A 5DFPA 1L8TA 5FUTA 1GIJA 2I0VA 3GFEA 3NS9A 2GNIA 5CENA 5JT2A 4NIFA 2R3GA 1V0PA 4G3GA 4BCHA 3O8PA 3OXTA 3EQIA 2AC5A 3P08A 3OC1A 4JT3A 3FMNA 3P7CA 4QNYA 4QQTA 4EC9A 3POZA 4IE9A 3VS5A 4ZSEA 2HW7A 5L8KA 3ZM9A 2Q0NA 5HTCA 5FBOA 4UALA 2JC6A 3NVMB 4RWJA 5HBEA 3G6GA 3AGMA 4TWNA 3IOKA 3ZBXA 1UVRA 2BIKB 2YM7A 3ORIA 3QX2A 3UQCA 4GT3A 4MD9E 4MX9A 4BCFA 4GSBA 3C4XA 5TT7A 1J91A 5HU3A 5CEIA 3ZUTA 4GFOA 3R22A 4EOIA 4MF0A 5DYJA 4EK5A 3DKGA 3RBWA 2PK9A 2XNEA 4R3CA 3VO3A 4FV1A 4PPBA 1AQ1A 3LQ5A 1G8JA 4NYEA 2E9VA 2XNNA 4HVDA 3P5JC 3NWWA 3ZMMA 5C1QB 1JQHA 1W2CA 4MXAA 3GBZA 4A06A 5DN3A 1R0PA 3R21A 4DTBA 4LOOA 2QURA 4MKCA 3E64A 1DS5A 3DAEA 3SKCA 5I9XA 4QNAA 1K3AA 3LXKA 3AT4A 3SV0A 1OIUA 5E1SA 4F9BA 5KKRB 4ZS4A 3GGFA 4DG2E 3DQXA 3W0PA 3KVWA 5GNKA 2NRUA 3UOLA 2OZAB 4D2SA 4C33A 3GU7A 1YW2A 2BDWA 3VS3A 4FT3A 3UDBA 4NWMA 3Q3BA 2PZ5A 2CN8A 2HZ0A 4AZSA 4RJ5A 5CSXA 3QTRA 4FSUA 5CSWA 5IH5A 4GK4A 5EI6A 3PVBA 3SHEA 5HX8A 5DEWA 3E7OA 4BY9E 3W2CA 3U4WA 3EHAA 4JQEA 4ZIMA 3HMPA 3T3UA 5IA5A 3TNPC 5EQYA 1TQMA 1B6CB 2IZUA 2W5BA 3EFKA 4WG5A 5HG5A 3KEXA 5JQ5A 2YZLA 4FNXA 3UIMA 1YOJA 3KMWA 1Y6BA 1SZMA 3HP5A 4YBKA 2X81A 5KBQA 3N4VA 2PVKA 3PP0A 3EFJA 4UMUA 2C6KA 2GHGA 3OZ6A 4FTOA 3BYUA 2VTIA 2VO0A 4XBRA 3IOPA 2CCHA 1YQJA 1NXKA 4FSTA 3UG1A 3W2RA 4Y73A 5BVNA 2C5VA 4USEA 3MYGA 1ZOGA 1OL6A 4LOQA 5EDRA 5J5TA 4I22A 4BDDA 4FYOA 2EXMA 4AU8A 3NW5A 4BCIA 3GOPA 2FSLX 5A14A 3LQ3A 3HUCA 3MPAA 4NCTC 4BDBA 4ZJVA 5CSHA 3UJGA 4HVGA 1O6YA 3OUKA 2G9XA 2VNWA 4PP9A 4XV9A 4MBJA 4GKIA 3JR1A 4O4DA 3PE2A 2QHMA 3AGLA 4PMSA 3LAUA 5C8NA 1TZDA 3WOWA 5AR8A 4BYIA 4FEUA 1W83A 3DKCA 3ORZA 3ZFXA 4XG4A 3TIZA 5BNJA 5M4CA 4FZ7A 3F3UA 4G3CA 5K5XA 1M7NA 3EOCA 3ODZX 3CKXA 4FKVA 1H0VA 2VN9A 3FPMA 4FTAA 4UYNA 1SVEA 2W05A 3LCDA 1Q8UA 4S33A 2VWVA 3D83A 4U9AA 3H9OA 4CKJA 1YWVA 5BMSA 3R7GA 2CN5A 2VZ6A 5L2WA 2GCDA 1OGUA 4KSPA 4E7WA 5ITAA 3RVGA 3WF8A 5LXMA 4HCTA 3HGKA 2NYAA 4MUQA 2OH4A 4AG8A 4FKLA 2YHVA 4E4NA 4ZTNA 3BL7A 2CNUA 5FP6A 4O0XA 5CZHA 4IC8A 4FVRA 3R00A 2BZHB 3G6HA 2NRYA 2DWBA 2PVLA 1ZY4A 2R3QA 3HV7A 3KRWA 3DU8A 1Q8WA 3DKFA 1UWJA 5BVDA 2HYYA 3HDMA 3LXNA 4LUEA 1DI8A 4FTCA 2JDRA 2ZMDA 2XYUA 3TKUA 3MJ1A 3QYZA 1OECA 2OJIA 3ENMA 3WYXA 2R3LA 5A4CA 1SVHA 3UPZA 5C4KA 2PZPA 3EQBA 4ZJIA 4A4LA 2QO2A 3TWJA 3R30A 2YLFA 3JY9A 1BL6A 4EQCA 3TUDA 3E3BX 3GUBA 4C57A 4CKRA 3H4JA 3PSCA 2YJSA 3AD4A 3RAWA 4V01A 4EYMA 4AOIA 4FKRA 4FGRA 3KULB 1KE8A 2C6MA 3MFRA 5BVWA 4YJUA 3CPCA 3F5UA 4JRVA 4ZS0A 1GZNA 4I0RA 2PU8A 4I5PA 4QYGA 3UZPA 4ZLZA 1PXIA 2JDSA 5KCVA 3M11A 5FRIA 4IZ5A 2W4JA 4AA4A 3MW1A 4JL9A 3MA6A 2AQXA 3G33A 3MWUA 2XAMA 3UE4A 2ITZA 2UUEA 4BJJB 2Y7JA 4O7WA 4WSQA 2P0CA 4ASXA 1YOMA 4XEYA 3TTJA 4DITA 3TUCA 3ERKA 3HX4A 3CJGA 3GENA 4R8QA 2QO9A 4ENXA 3QC9A 3OCGA 4F1TA 3CE3A 2P33A 4BCOA 3FSKA 3D5XA 4DTAA 4JMQA 1XH4A 4EHEA 3DPKA 3QQFA 4UB7A 3C4WA 2I7QA 1Y57A 1RE8A 3AC8A 4G6OA 3S0OA 4WG4A 2Z7LA 3RK7A 4FZFB 1MRUA 3I5ZA 4S31A 3ZHPC 3R1QA 4UN0C 4BZNA 1PW2A 2R3RA 2YITA 5ANEA 5AR5A 4FV0A 4BKJA 1IEPA 2BFYA 5DRBA 2R3MA 2UZEA 4EH9A 5ACKA 3FHIA 4AGCA 4EC8A 5I5ZA 3V6SA 5AV2A 5I3OA 4FNYA 5FWKK 3DFCB 3I7CA 4QMPA 3M2WA 1PF8A 4ONAA 1UU8A 2QLQA 3NUYA 3F3TA 5CU4A 2QOQA 3NIZA 5AV1A 5AX3A 3U55A 2C5XA 1OIRA 3I6WA 2XK9A 2ZJWA 4K9YA 3BI6A 3DOGA 4QT1A 4AQCA 5KX8A 2QR7A 1YRPA 5ACBC 3S00A 4IACA 4J52A 4BRXA 3D94A 4MHAA 4AA0A 4DLIA 4R77A 2RKUA 4K18A 5L2QA 5L8LA 5LMKC 2VWYA 4EI4A 4YJNA 4EQUA 3PXQA 4EH8A 1KE7A 3UIUA 3R1YA 3NYOA 5EDQA 2X6DA 3CD8A 1SNUA 5FXQA 4BI2A 5HIBA 4CFUA 1ZRZA 4O38A 4LRKA 3OXZA 2RIOA 3FZRA 4PTEA 4RX9A 1KV2A 5DVRA 3BGQA 4IDTA 4IWPA 5AP2A 3UO4A 1W84A 5CEOA 3R9RA 5IZFA 3JPVA 3EN9A 4O0SA 3F2NA 4IQ6A 5HX6A 3UNKA 2QOKA 5ANGA 1WZYA 4I0TA 3OD6X 5LVOA 4U3YA 4FIGA 4WRGA 1OIQA 2QHNA 4L53A 4YZBA 3DBQA 5FDPA 5T68A 2B9IA 4AUAA 2GS6A 3CQEA 5BVEA 3ORLA 5DLSA 1JAMA 3R83A 1NA7A 4G9RA 4W4VA 3ZLXA 2WIHA 3W2SA 3KXHA 1PXJA 3C0GA 4WNKA 5HO8A 3FQSA 3BV3A 3MFSA 3L9NA 5L6WL 3PWDA 5DT4A 5E92A 4BB4A 3GVUA 2OXYA 4NU1A 2EB3A 3OCTA 5KMKA 2JD5A 2WQEA 2YISA 4M3QA 2G2IA 3CPBA 3BIZA 1J1BA 3V5JA 4CYIA 4BYJA 3RAKA 5CU0A 1OGYA 3QFVA 1YXSA 1CSNA 2XK7A 2OWBA 4TL0A 5A4LA 4GJ3A 4Q9SA 3SLSA 2XK4A 3U9NA 4ACHA 2VD5A 2ERZE 4FTJA 3FBVA 4FR4A 3LFNA 2Z2WA 3D7ZA 3RNIA 4XNEA 4WBOA 4ALVA 3DK7A 4I4FA 3Q4UA 4HCUA 2ZB0A 3SVVA 3I5NA 3NFFB 3O5AA 3PE1A 3LE6A 4DGLC 3LMHA 5IQCA 3REPA 2OXDA 2QD9A 3IGGA 5E91A 2RFDA 3F61A 3G2FA 1WVYA 2E2BA 3GFWA 3FV8A 5LOHA 3RPVA 3PPZA 4TYGA 1BUHA 4CZYB 3QZGA 1LPUA 1XKKA 4UXLA 5TR6A 4MF1A 5A4TA 3LFSA 3V8SA 2HZNA 3W0SA 3PPKA 2Y8OA 2UZVA 2XUUA 3PA4A 2PVYA 4BZDA 4BCKA 1A9UA 2CGWA 3UDSA 2IN6A 2VTPA 4QMNA 4FF8A 4TYIA 5FD2A 5JSMA 3QRKA 5L4QA 4JIAA 3D2KA 4CGAA 5KKRC 3BZ3A 2JFMA 4FIEA 2UZOA 3F7WA 1A06A 3E3PA 2IPXA 5LMAA 2XF0A 4F7LA 1RQQA 2CKOA 4GIHA 4FKGA 2XVDA 4Y8DA 4IZAA 3FXZA 4LRMA 2HWPA 4HGEA 5BYLA 4RIXB 1RW8A 2J9MA 1H1WA 4XG6A 2IVSA 4AZTA 1I09A 4U40A 4H58A 2BRMA 4E26A 3RHKA 3DDQA 3CJFA 2WMVA 5B7VA 4C38A 2J4ZA 2BDFA 1H4LA 2O5KA 4X3FA 4RJ8A 1OKVA 2GMXA 3MH2A 4NKAA 5D9HA 5AAEA 4F0IA 4KSQA 1H0WA 2GNGA 2QKRA 3ZDIA 4Y46A 3ZLSA 2XA4A 4GG7A 4XS2A 3SOAA 4DGMA 3A2CA 5HEZA 4A4OA 2X8DA 4FEXA 2XARA 3NMUF 1FPUA 3WI6A 2ITXA 2WOTA 3GP0A 5DE2A 1H24A 1IA8A 4YTHA 1F3MC 2OXXA 4UMRA 2CKQA 1Q4LA 4OTFA 4FV4A 3LFQA 3D7TA 5HGIA 1XH9A 2XEZA 3LIJA 5HICA 4N0SA 3IW4A 4HYIA 2PSQA 4PDPA 4S30A 5CWZA 5EM8A 2BZIB 1PYEA 3RTPA 4BI0A 2J5EA 4K33A 3LVPA 3LFCA 4D2TA 4FT7A 4O7VA 2YM3A 4EUUA 4MXXA 4GU6A 2P4IA 4ZP5A 1STCE 1KWPA 4QP2A 5KMIA 3VS2A 4LI5A 4XLIA 2B55A 5H8EA 2R2PA 3PWYA 4RGJA 3FYJX 2V62A 4O0WA 3THBA 3OCSA 5E8ZA 5LVLA 2C5NA 4M7IA 2XCKA 4ZTLA 4D55A 3SGCA 3QHRA 3UQFA 3MH1A 4KIQA 1NVQA 2XKEA 5EM6A 2UV2A 3HV5A 3ITZA 3OY3A 4TWOA 5C27A 2UW4A 1H1SA 2BTSA 4FL2A 2IW9A 1YHSA 4FZ6A 3RM6A 1RDQE 4E4MA 3FAAA 2XKCA 3GU5A 3KN5A 3C51A 1OL5A 5CANA 4A9TA 2IVVA 3Q9XA 5AP6A 3KKVA 5ETCA 4R5SA 5M08A 4QMLA 2ZYBA 4PNIA 1BI7A 2OI4X 3QGWA 2YCQA 2XBAA 3NCGA 4RA5A 3OT3A 5IH4A 3BEAA 3DK3A 2WU7A 4Q2AA 1Y8YA 3FPQA 4C4HA 5FP5A 3S3IA 3PTGA 3W2PA 4OAVB 4FVQA 1XQZA 1DAYA 4EK8A 5IMEA 2YACA 2C6TA 3K5VA 4KKEA 3OBGA 1W98A 3O8UA 2LAVA 4XG9A 2HCKA 3DB8A 4YTIA 1PHKA 1DAWA 4AGWA 3LMIA 3NUXA 4X2NA 3TACA 3R8VA 4YO6A 2ETKA 4KINA 5AV0A 2OIQA 4BGQA 4J8NA 3TM0A 4PQNA 3RALA 1QPDA 2WMXA 3GU6A 3Q5ZA 5HLNA 3KK9A 2W1ZA 2OU7A 4FT9A 3R6XA 1ND4A 5HCXA 1Q3DA 3E7VA 4UZDA 3C0HA 2X7OA 3EQDA 4AF3A 2YM8A 4V0GA 2ZM3A 2OGVA 4JLCA 2BPMA 2XK6A 2OBJA 4MK0A 4F9WA 4YBJA 3UZRA 2VTJA 3VQUA 3W55A 3RPOA 2W5HA 4FJVA 3R7EA 4G2FA 3KIOC 1VR2A 1SVGA 1ZZLA 3NUPA 3I0OA 5M4FA 4Z3VA 4E73A 1P4OA 2GHLA 2YA9A 4BCNA 3PJ2A 5AAFA 1P14A 4FV3A 1G3NA 2XB7A 5HG8A 4YUQA 1JKKA 4FNWA 3QHWA 4F99A 2QOOA 5CF5A 4DE4A 4AXAA 1UU7A 4DEGA 4GMYA 3FC1X 3QTXA 3PXFA 4BDIA 4XV3A 2JFLA 5CLPA 1H01A 1GZ8A 2R3PA 3IKAA 4FKIA 3WIKA 1YDTE 1Q41A 4AZWA