4D55A

Focal adhesion kinase catalytic domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
260
Chain Sequence
b'RDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRYLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE
publication title Allosteric Regulation of Focal Adhesion Kinase by Pip2 and ATP.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 82
structure length 260
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d55A01
2WFYA 5HVYA 5C8NA 3QX4A 4MX9A 3D14A 3P7AA 2WGJA 3R7VA 4GJ3A 1SNUA 3GOKA 5FUTA 5CY3A 4C4FA 2UW6A 2RG5A 2G1TA 4C61A 4RIWB 5AP5A 5DA3A 3ZUTA 3CD8A 3LHJA 2OIDA 2IW6A 3V51A 5JFWA 1H0VA 4M69A 4J98A 3MH1A 5L8JA 5EM7A 4CMOA 3BWJA 4KD1A 4ERWA 1A48A 5DRDA 3FHRA 2VTRA 3COMA 3AG9A 3ET7A 5F95A 1OMWA 3FI2A 5E4HA 4Y46A 3AT4A 4ZS0A 4B8MA 1H1WA 3G6HA 4EQMA 1TVOA 5C9CA 5CALA 2O2UA 2ONLA 5HLPA 3UQFA 4KIQA 3VN9A 1UU3A 3QA0A 5I9ZA 3UP7A 2PVYA 3E93A 5AR3A 5EQYA 2VWWA 4CFFA 4FSNA 3ROCA 4ZSJA 3ZXTA 2XKDA 4LRJA 4HPTE 4PL5A 4QTDA 4IZYA 3ORPA 4DAWA 1K9AA 2J0IA 5A9UA 3AXWA 1KV1A 2J0LA 2OI4X 4I5CA 4MF0A 4UBAA 3PXQA 2UW0A 4FTUA 4JQEA 5CEPA 3RPVA 4EHZA 5K4IA 4RRVA 2BR1A 4F9WA 5K5NA 2W0JA 3V01A 4E4MA 2GTNA 3EQCA 4Z9LA 3DTCA 2XK7A 4ZJJA 4PUZA 4HYSA 1YQJA 3R9DA 3CE3A 4U0IA 5TT7A 4AZEA 4G6OA 5D11A 2ITNA 4YJRA 4C0TA 4L68A 4YURA 1QPEA 2IVVA 3K54A 5DWRA 3UO4A 2WU7A 3C4ZA 2A1AB 4BDCA 5J9LA 5CTPA 4ENYA 4F0FA 4NM3A 3GC7A 4RX9A 4G3FA 5JKGA 3LZBA 2QO9A 3TL8A 5CF5A 3U87A 5FD2A 5B7VA 3PJ2A 4DFYA 2NNWB 5G6VA 1PW2A 4BYIA 3NZ0A 2DUVA 4KAOA 5HCXA 1AGWA 1VZOA 3DKOA 3DQXA 5FP5A 4ZS4A 4G2FA 3FXWA 1OITA 4RIXB 3WF8A 4ORKA 3GNIB 3K2LA 4DGOA 4EK6A 3FLZA 4KWPA 5CAQA 1SVEA 4QMWA 4EOPA 4WSYA 1ZWSA 4AX8A 3OT8A 4AT5A 5F4NA 3U9NA 1UVRA 2XK8A 2REIA 4D4RA 5KMIA 3AC2A 4WHZA 5BYYA 1RQQA 4WNPA 4YJOA 2XCKA 5E91A 2HW6A 5H8EA 4F4PA 5KMKA 4RX8A 3P79A 2WEVA 2YIWA 2GHMA 2YABA 4TL0A 4FKGA 5E8SA 4CCBA 5JFVA 2BKKA 4L6QA 4S34A 3PDTA 4IX6A 4FOBA 3R8LA 4OAVB 3ZLXA 2PZYA 4FKSA 3UYTA 5I3RA 4FKWA 3VUDA 2XYNA 3GU6A 1YXTA 2V7OA 2VN9A 4L3PA 4FE2A 5HTIA 3VIDA 5AR7A 2OJFE 3VRYA 3R1YA 2OJIA 1GIJA 3FMLA 1J91A 2W5BA 3KXGA 5DYJA 3QHWA 4ZMEA 4NFMA 2J0MB 3KULA 2WU6A 1H4LA 2ITQA 3WF9A 2CNQA 3TNQB 2PVKA 3ENMA 4BWKA 1VR2A 5HVJA 4GV1A 3ULZA 3QGYA 2B54A 4TY1A 3BBWA 2XJ0A 1OL5A 3IPHA 4M12A 4MXYA 1W8CA 1P4OA 2GNIA 5HLWA 3SQQA 5AV1A 2WTDA 1PJKA 2C0IA 1SVGA 3KREA 3OVVA 4AZVA 4AW2A 5H8BA 3OEZA 3OXIA 4AP7A 2EB2A 3N9XA 5IUGA 1Q3DA 4LYNA 2P33A 4LOOA 2PL0A 4PMPA 4NZWB 4YJPA 3VS0A 4XYFA 2O5KA 3LCKA 3ZDUA 2HYYA 1PXJA 3PA5A 1OUKA 4DYMA 2QG7A 3P08A 4KNBA 4OTPA 4RVMA 3NVKI 2JITA 4FZ6A 3GVUA 2RGPA 3I60A 1JOWB 4ZSLA 5AP4A 2GNHA 2XYUA 5EYCA 3E3BX 4LOQA 4GRBA 3EFKA 2UW4A 4M0YA 4R7HA 1FINA 2Z7QA 5M56A 2CKOA 2FGIA 3LCTA 4JAIA 1LPUA 3ORLA 4I0RA 5FEEA 1LP4A 2X2KA 4AE9A 4EH5A 5CT7A 4D1ZA 2WB8A 4M15A 5CANA 4JG7A 3MFRA 1YXVA 2C3KA 4EJNA 3O50A 4U44A 1SNXA 1LUFA 3LFSA 3QYZA 4MNEA 4NIFA 3FBVA 4W9XA 4KINA 3FL5A 5HNIX 3CC6A 5CSVA 3EQRA 4FL3A 4YZCA 2XNOA 4JI9A 3T8OA 1PMNA 3DNDA 5LVPA 3HP5A 4O2ZA 4MWHA 3MESA 3NPCA 2GHGA 4NCTC 5EM8A 3DTWA 4O1PA 1ZZ2A 4XG3A 3T9IA 4EKKA 3UQCA 3RAWA 1BLXA 5IDNA 3CKWA 4QYYA 3OS3A 1WFCA 4ONAA 3VULA 4D9TA 2C6DA 3BBTB 1YKRA 3D15A 5AUZA 2UZWE 3TG1A 3UVQA 3N4UA 5F1ZA 3G0EA 4TPTA 1OZ1A 4IACA 3R63A 3ZO3A 4X21A 3LFEA 4FEUA 2ITWA 4CT2A 4I6BA 3LOKA 3FQHA 4XS2A 3HAMA 3HV7A 2WTVA 3VF8A 5LMKC 4YLJA 3CKXA 2XVDA 3QZGA 4ZEGA 3L8SA 4JAJA 4CRLA 2HOGA 3QAME 4FI1A 4J1RA 4MXOA 2UZNA 4UYNA 3E8NA 2CCHA 1U54B 3Q52A 4IAYA 3TUBA 4L43A 4XLIA 3BYOA 3SV0A 3LVPA 4ZSGA 2PZIA 3CEKA 2F57A 5EOLA 5DPVA 3BYVA 3QRIA 2OXYA 1GIHA 1V0PA 4LMUA 3VS2A 4NL0A 3RCDA 5HLNA 4R5SA 1BMKA 2BRGA 2Q83A 3GXLA 1PF8A 3NUXA 2IZSA 2Y7JA 1YDRE 3EQHA 3A4PA 3RTPA 4K6ZA 5JQ5A 3DOGA 2SRCA 3PYYA 4I3ZA 4HYUA 4CMUA 4C3PA 4ZTMA 2X2LA 1QMZA 3MY0A 4LV8A 1MRUA 3FMJA 4FKQA 2NP8A 4U45A 3C7QA 1H1RA 2ITXA 5BVFA 1FPUA 4O27B 3NMUF 3BHTA 3IW5A 4QP1A 4QP2A 3RCJA 4FNYA 4IDTA 4IJPA 4QNAA 4LL5A 4R3CA 1U5QA 4FV2A 3POZA 3BQCA 4CG9A 3ZLSA 4CFWA 2CJMA 5M53A 1QCFA 4RIYB 3H9RA 3DV3A 3TZ8A 3H0YA 5M4FA 3O23A 3BV3A 4CZUA 3CSVA 1TQPA 4EOSA 4DGLC 5EW8A 3V5JA 5A6OA 3ROYA 5J1WA 3PLAE 5JEBA 2BZHB 1BUHA 4DA5A 3M42A 4L45A 4W4XA 4IQ6A 3IW7A 4YTFA 3UODA 3TTIA 3DKFA 4BWPA 5K9IA 2GTMA 3PIXA 4G1WA 2W9ZB 3EHAA 2R3RA 3BPRA 5K5XA 5KE0A 2XIYA 4O0TA 4HYHA 3UTOA 5LWNA 4L3JA 5EH0A 2BFXA 1R39A 2R7BA 1I44A 4WG3A 1DI8A 3HV3A 3SC1A 2WTKB 5BVDA 3LQ5A 5LCJA 4LRMA 5FWKK 5L8KA 5CF8A 4OBQA 4J8MA 2AUHA 3LJ0A 4FT5A 4MHAA 3KVWA 2WOTA 2R3OA 4MQ1A 4FSRA 4XV3A 3IOPA 2QVSE 3UP2A 5IEYA 3RHXA 3NUPA 4NEUA 3UC4A 2YN8A 4S2ZA 2ZVAA 3R0TA 3DCVA 3EQBA 5M55A 4ZLOA 2BRHA 2R7IA 1W0XC 4ZIMA 3ORKA 4QYFA 3A8XA 5DVRA 5TR6A 5AUTA 3PP0A 4PMSA 4FGBA 4AGWA 4USFA 3PG1A 4HZRA 3WF7A 3HKOA 3PVGA 1Y8YA 4FTJA 4PL4A 1H08A 3ID6C 4JX3A 3SW7A 2PY3A 4IWOA 2VRXA 5LVNA 4QO9A 1OIUA 4BCFA 2J5EA 3R8VA 3R8ZA 3O7LD 3RALA 4CFUA 3BX5A 2UW8A 4MD9E 4O0XA 4FBXA 3D7TA 3PFQA 4P7EA 1H8FA 3VUKA 1ZYJA 4OTQA 4EHEA 3UMXA 4C4JA 3PA4A 3VW6A 3T9TA 3W8QA 3DKGA 4QMPA 4JQ8A 2WMVA 1JNKA 2YLEA 3PPZA 3WZEA 4D55A 4C8BA 5CI6A 5EDQA 1FOTA 4U8ZA 4ASEA 2WTWA 4TRLA 3NYXA 3R7EA 3D83A 5EDPA 4QP9A 1VYWA 2QR8A 3UJGA 4DH8A 3HVCA 1JWHA 5AIRA 2QODA 4DG0E 2XNBA 2C1AA 4L9IA 1Q24A 3R9HA 4EZ5A 4DCAA 2W96B 4JBVA 4L7FA 5A54A 4EH8A 5CU3A 2BZKB 3BZ3A 4I24A 2XB7A 2ZM4A 3FC2A 3PIYA 3UIMA 5HNBA 2CN8A 5HESA 5ANEA 1QL6A 4M69B 4X0MA 5JRSA 2FSLX 5HE3A 2ZDUA 2A27A 3ATSA 3DB6A 4IX4A 3HUCA 5A6NA 3E63A 4FYOA 3PWDA 4DT9A 4FTTA 4ZP5A 2RSVA 3ORMA 3KN6A 3PY0A 2JKQA 2PZ5A 3PVWA 2BHHA 3TNPC 2ZAZA 2Y8OA 3D5XA 2Z7RA 1YXSA 3AMBA 3Q5IA 1CKPA 1UU7A 3R7OA 4X6QC 2CGUA 3AT3A 3ZZWA 4YJVA 1UNHA 4DLIA 3VBTA 5H8GA 2CLQA 4YLKA 4F1TA 4DH3A 1OL1A 3S4QA 3S3IA 3SVVA 4R1VA 2I0YA 2GNLA 3QKMA 2Y9QA 3CTJA 3DXQA 3CQUA 1UU8A 4PX6A 3HRCA 4YC8A 3VBWA 3TKUA 4C4IA 2FSTX 4IB3A 4QPAA 1YOJA 1OKYA 2PK9A 2DQ7X 3UG2A 5DNRA 2PE2A 1M17A 3ZTXA 4XBUA 2QQ7A 3Q2JA 3NNVA 4RC2A 5EG3A 4S33A 1J7UA 4PTCA 2XM9A 2EVAA 2UW5A 2VWVA 3S95A 2JIVA 4BY9E 4EOJA 3RHKA 5AAFA 2R0IA 3U4UA 3M11A 1DAYA 3PY3A 5ANIA 4A9TA 4F9AA 2JFMA 3D2KA 5HZNA 2R3NA 3OUNB 2W5HA 1OPJA 2V0DA 2BAQA 4MEDA 5IQDA 2ZV7A 2X7OA 4UZHA 4BIDA 3CY3A 2PHKA 4QQJA 3Q9XA 1UKIA 4RJ5A 3UE4A 4ZZNA 3ENHA 2XM8A 3L8XA 4M7IA 2P55A 3GCVA 1GY3A 4U41A 4U7ZA 5DGZA 5C01A 3RAHA 2RL5A 3WZKA 2HK5A 3BHUA 1WZYA 4DC2A 4BDDA 5IMXA 3PZHA 4ZLZA 3F6XA 2FA2A 2JKKA 2YM8A 3OC1A 3PXZA 1PYXA 5KKRB 4GU9A 4AWIA 1F3MC 5ANGA 1KE9A 4CNHA 4BDKA 2C5YA 3QRUA 4FG7A 3TJDA 2XS0A 4FEXA 1H26A 3MYGA 3PZEA 3RKBA 3UPZA 4NYEA 4Z7HA 1H25A 1ZYLA 1Q62A 2WPAA 5DT4A 1H27A 3N51A 5CNOA 3TT0A 4F6WA 4O96A 5B2MA 5HE1A 1NVRA 2OICA 4HZSA 3EL7A 4QTBA 5J9ZA 3D9VA 4DINA 4AFJA 4CTCA 5LMBA 5DOSA 3U55A 4YHJA 4R78A 3RP9A 3LMHA 1PMUA 2P0CA 2C6LA 3F3UA 3KULB 3FXZA 3CPCA 5IQHA 4RJ6A 1M2RA 3BGQA 5DHJA 5CT0A 3GC8A 2QU6A 4GH2A 2C5VA 5C4KA 2VTAA 3QWKA 4NJ3A 4G9CA 4BDIA 5GNKA 1O6LA 3TIZA 4XG4A 4UWYA 3TN8A 1Q5KA 3GCUA 4DTBA 4FSQA 4ZTHA 2BRBA 4YSMA 5CF4A 4TZRA 3KK9A 5HE2A 2V55A 3AC8A 3C4FA 1H07A 3GP0A 4L67A 4APPA 4OTWA 3W18A 4JRNA 3RWQA 2JDTA 3FXXA 3FC1X 2E9PA 3DAEA 3W2PA 5A4EA 4AFEA 2PMIA 3PE2A 3OBGA 4ZTLA 4ACHA 4K11A 2Y4IC 3FMKA 4JIKA 4PQNA 3DB8A 1J1CA 4E4LA 2OH4A 5AP1A 4NM0A 4UMQA 3Q6UA 1O6YA 2YM4A 3MWUA 4ITHA 4FEVA 4FG9A 4F9BA 4IVDA 4GG5A 5AJQA 3ELJA 4HCUA 2ETRA 3FKNA 5GHVA 1T46A 3HDMA 2UZOA 5KMMA 1XKKA 3MY5A 3VVHA 4XRJA 2JDRA 4O0SA 3ZC5A 3RJCA 4EJ7A 1FGIA 2BKZA 1YWRA 5FDPA 5I0BA 5CU0A 4NIFB 2O8YA 1M14A 4BDFA 3A7GA 3I79A 3KXNA 3LIJA 5BVEA 2WAJA 4BCQA 4D2RA 5AADA 1IAHA 5J87A 2XZSA 4PTGA 2ZM1A 4MXXA 1K2PA 3R04A 4AUAA 5GIPE 4O7YA 4FK3A 3C0GA 3VUMA 5KHWA 4UN0C 3NR9A 1RE8A 2WTKC 2YIRA 1YXXA 3GBZA 3JS2A 4U40A 5D10A 3Q3BA 4ZJVA 5CEMA 3AD6A 3CQEA 3ZU7A 2X0GA 2WOUA 4IXPA 5CZIA 4ZY5A 2ITVA 5CLPA 3LFCA 1CMKE 2B7AA 4RVKA 4FR4A 2QI8A 4FA2A 4GU6A 2VV9A 2VWUA 3FQSA 3Q4UA 3G90X 3FZTA 5JQ8A 1JVPP 3N4TA 3FQEA 4I94A 2R5TA 3UMWA 3GC9A 3QQLA 2CKQA 3OTVA 5AV0A 4FEWA 3OCSA 2B9HA 4FIHA 3EFLA 3JVSA 4J97A 4IWQA 4BTMA 1JQHA 3O8UA 4TWCA 2WO6A 1J7IA 2YCSA 4IAKA 2OH0E 4J7BA 4NUSA 4D5HA 2NRYA 3A99A 2YHVA 5AR4A 3TCPA 3R30A 2O64A 4WKQA 4IH8A 3RM7A 1O6KA 1ZARA 3BU5A 5ETFA 4M68A 3UZRA 1OKZA 3M1SA 4X6RA 4M66A 4LRKA 2JFLA 2VTHA 3DK6A 3OY3A 3FI3A 4OTRA 4TNDA 2Q0BA 5HG9A 5BVWA 2YM7A 4KS8A 4RT7A 5HO7A 3QTSA 3VS7A 2C5OA 1IRKA 4IDVA 4AT4A 5C4LA 4FTNA 3NX8A 1OL7A 3G6GA 3REPA 2OWBA 1URWA 1Q99A 2IVSA 2EUFB 3MB7A 4O21A 2Z2WA 4G6LA 1B6CB 1FMOE 2DWBA 1STCE 4CTBA 4D58A 3TDWA 1NT2A 3GOPA 4MXZA 3PLSA 4O91A 4DG3E 3BLQA 4KIKA 3R28A 2G01A 1M7QA 4HVDA 1VYZA 4AN2A 4JJRA 4AXAA 5IZFA 1XWSA 5AM7A 4QP4A 5E7RA 3EYHA 1ATPE 3MFUA 4DEIA 4YJQA 2C5XA 4XLVA 3U8WA 4IVBA 4Q9ZA 3E5AA 3KXMA 3B8RA 3QQJA 4BRXA 5EW3A 1Q8YA 3Q9ZA 3LCOA 4G3GA 5IUIA 5F20A 2J90A 1GIIA 4OUCA 5EFQA 2IPXA 1EH4A 3HLLA 4IZ7A 3CPBA 4FF8A 2W7XA 5E8VA 5FRIA 5AMNA 4E8AA 3QBNA 3TZMA 1QPCA 4MD8E 4F1OA 3QX2A 1YDSE 4BFMA 2O0UA 1YHWA 4YPSA 1Q4LA 4BCJA 3QUEA 4DH5A 5GIOE 2Z8CA 4GIHA 4ALUA 2BILB 4O7TA 3W2QA 4G5PA 3DZQA 4ZLYA 5A4LA 4IB5A 5KZ0A 1GJOA 3KMMA 4DEGA 4GW8A 3MIYA 3QD2B 4Z55A 4S30A 4FTAA 5CVFA 2HZ4A 2VX1A 4L7SA 4ANQA 2CNVA 2YZLA 2QOOA 3DT1A 3P7CA 5BUEA 5AP7A 4YTCA 5EDRA 4Z3VA 3O8TA 3ZRKA 5LMAA 4FSUA 2F7EE 5AIKA 4ANSA 1BX6A 3MVMA 4IFGA 4L3LA 2PPQA 5CYIA 3KC3A 4GYGA 4CFNA 4BCMA 2EWAA 3VUIA 4Y95A 4ANOA 4EYMA 4F65A 4QP3A 2B53A 2ERKA 1AD5A 3QCQA 4S32A 3TZ7A 3DDQA 4OBOA 1MUOA 2J50A 3QQUA 5BUJA 4J52A 4X2FA 4R8QA 1MQBA 1P4FA 2WMBA 4LGDA 4I92A 5DH3A 4O0VA 4D4VA 1RJBA 3C5IA 5DEWA 4IIRA 3ALOA 4WG4A 3WYXA 4IZ5A 1MP8A 3D7TB 3CJGA 4XHKB 3ZSIA 5ETAA 5JZJA 3FZPA 2C47A 3LJ2A 2VWIA 3P7BA 3VBYA 2Z60A 4RFMA 2A4LA 2VTQA 4PDOA 1YOMA 2C6EA 5CU2A 3GC0A 3O17A 4M13A 4WOVA 1OVEA 4YJTA 4YZ9A 2VO6A 3C50A 5CU4A 3LQ8A 2YERA 3VRZA 2CLXA 3BQRA 4QTEA 4FVPA 3R83A 4JG8A 4EK3A 1BKXA 2G2IA 5FLFA 4E26A 5T6KA 4AZFA 4IC7A 2R3FA 3I0OA 4ZTRA 5IQCA 4IANA 1WVXA 4PP9A 2EXMA 4NKAA 5HG5A 5AX9A 2RFDA 5EI6A 2PMNX 2PTKA 5LARA 3EN6A 1IR3A 5J5TA 5M44A 4E4XA 4DITA 1TQIA 4EWQA 4A9YA 2UZLA 4Y83A 3V5QA 3U51A 3KB7A 4PMMA 5BMSA 2X9FA 3L9LA 3KQ7A 3NLBA 4C2VA 2GDOA 2VTLA 3TNWA 4RZVA 4C59A 3RK9A 2B55A 1WBVA 3ZS5A 2VWBA 5HGIA 3QTUA 3ALNA 5HX6A 1MRVA 3A7FA 4QRCA 5FM3A 2VTIA 1A06A 3ZOSA 5I4NA 2Z02A 1JSTA 3GENA 3RM6A 4F7JA 2BAJA 4XP3A 3OEFX 3OD6X 2W1GA 3COIA 2W1FA 2QOKA 4O83A 2HXQA 2WMWA 4DN5A 4Q2AA 4FT0A 2QHNA 3L8VA 3TNHA 3FZ1A 2W17A 2HZ0A 2X4FA 3BGPA 3CGFA 3EN9A 3KF7A 4I5MA 4FT9A 4I4FA 5ANKA 3NCZA 4YZDA 3ZM9A 4WA9A 2C6IA 4JQ7A 5HIDA 1KOBA 2BMCA 2EB3A 2GQGA 1OKWA 1ZMWA 3IDPA 1OL2A 3CY2A 5FXRA 4IAIA 4WUNA 2J6MA 3F2NA 4FTOA 4PV0A 2J5FA 4D0WA 3O7LB 4FNXA 2H8HA 4OTIA 3GI3A 3HECA 4C7TA 3KCKA 2FO0A 4XH6A 4ACMA 4V01A 5AP2A 3QTWA 1PKGA 2IZTA 3ODYX 3LXPA 4DFZE 4ENXA 2XBJA 5GJDA 2HXLA 1XH8A 2CGXA 3GGFA 3FI4A 3O2MA 4I6QA 4GVAA 2XK3A 2BCJA 4QTCA 5D7VA 3HA6A 5EOBA 1OPLA 4ALWA 3A7JA 2VNYA 3G9LX 3F7WA 3A7IA 3C9WA 3GFWA 3NNUA 3PSCA 4HNFA 4FTCA 4QMXA 1H0WA 3F66A 3AMYA 4G3CA 3SRVA 5AUUA 2JDOA 4O7VA 3QRJA 4FV8A 2R3KA 3SOCA 2CNUA 2C0TA 5FGKA 2J51A 3THBA 5AV4A 5AR5A 2BFYA 2NO3A 3FJQE 2XF0A 4HNIA 2C5NA 3F3ZA 5M09A 3OCBA 1OM1A 3GQLA 4AGDA 4OTFA 4ITJA 4X2KA 1SM2A 4Q5EA 3DY7A 4S31A 2XP2A 4ZAUA 4ZTSA 4GYIA 2WMTA 1IEPA 1WBNA 2BPMA 2O65A 3JXWA 3QUPA 5HTBA 5GINE 1I09A 4RX5A 4BZNA 3VS1A 4K77A 5FTGA 5BVNA 3W55A 5FTQA 3A61A 3FE3A 1IG1A 3PJ8A 4I22A 4AW5A 4LFIA 3MFTA 3OFMA 3H4JA 4EWHA 2E9VA 4H3QA 2VTPA 4GK2A 4C62A 4N57A 3PY1A 4H58A 1FVTA 3ORIA 4DEBA 3RPOA 3GU5A 4D2WA 4IZAA 4YC6A 5FQDC 1Y91A 4EUTA 5HICA 3L9PA 5L6PA 3C4CA 5L2SA 3E92A 1W83A 2OXXA 3PVUA 3JPVA 4OLIA 2ZV9A 3G51A 4FG8A 3BYUA 1KOAA 3CXWA 5EHOA 1UA2A 4M14A 3ODZX 4GFGA 3QTRA 2W1EA 4JDHA 4AF3A 4BWXA 4TT7A 3NS9A 5TE0A 1KUTA 5IQAA 3H3CA 2X1NA 1KE7A 5CSPA 1WVWA 4AN9A 4WBBB 4DBNA 4EOLA 4QMNA 1G3NA 3GUBA 3V8TA 4EK5A 3PIZA 5HIBA 4UMTA 2HENA 5CSWA 3QTZA 2XK4A 4I93A 4WNOA 3ZBFA 5FG8A 1CDKA 2GCDA 2UVXA 4BBMA 4CSVA 4O7WA 4RQKA 1MRYA 4KSPA 5CNNA 4O86A 3IDBA 3PG3A 2VTSA 3PPKA 5BNJA 2VTNA 4IBMA 2VZ6A 4NW6A 5DBXA 4PTEA 3WYYA 3R2BA 2UZTA 2EXEA 3OT3A 3VHKA 3QZFA 4O2PA 5FBNC 3HRBA 4CEGA 4FTQA 4ANBA 3LMGA 1ZYDA 4JG6A 3HEGA 3HRFA 2QLQA 4RJ4A 4ANMA 1Q97A 4IM2A 3KA0A 4KBKA 4D4YA 5J9YA 3PXKA 4ZSEA 3IK3A 4EH2A 3OWJA 4RGJA 2OF4A 4HGSA 4DGNA 1WCCA 4C02A 5HIEA 2WTJA 1YWNA 3SGCA 4BB4A 2OZAA 3IONA 4UZDA 4EH4A 3K5VA 5HHWA 4PDYA 3NIZA 1KE6A 3B8QA 3OY1A 1CKJA 3IDCA 4KBCA 3VNTA 4A7CA 1ZY4A 4FIEA 3V8WA 4WSQA 4DH1A 4EH6A 3CBLA 3TM0A 3LPBA 2JIUA 3LCDA 4C58A 4M84A 3DQWA 3L8PA 4HVHA 5TF9A 3P86A 2V5QA 3QZHA 1YHSA 3IS5A 2YEXA 3MA3A 3UIBA 1YI4A 1ZLTA 3HV5A 3PJ1A 4QT1A 3ZEWA 4ASXA 3MH3A 3GQIA 4P2KA 3UDBA 5A46A 5BQ0A 4A4XA 4IWPA 5GZAA 3OW3A 3HGKA 5F9EA 4GEOA 4MCVA 1HCKA 5HBHA 3LM0A 4AAAA 2V22A 2W4OA 4RWJA 4DTAA 2BDWA 3GU7A 4FX3A 4UMUA 4BHZA 4J71A 1XHAA 2C3LA 2LGCA 3DS6A 3NRMA 4EYJA 2OO8X 4BHNA 5BUIA 1U59A 5HBEA 4BCOA 5HBJA 5KO1A 4BBEA 3QUDA 3MPMA 5GJGA 2E9OA 4C33A 5E8TA 1UU9A 4B9DA 4EK8A 4F64A 2PVJA 2XKEA 3AQVA 4QD6A 4GK4A 4RVTA 4FOCA 3BE9A 2YWVA 4WD5A 3MPAA 4K2RA 3TZ9A 5IQGA 3MS9A 4F9CA 3AOXA 1GZKA 3H9FA 4CZTA 4H3PA 4O6EA 4NTTA 3BEGA 4I4EA 4RMZA 3FZOA 4RSSA 3FI8A 2WD1A 2WZJA 3S0OA 4RPVA 1ZYCA 2OSCA 3DAJA 5ETCA 5EYDA 3VUTA 4BTFA 2QD9A 4H39A 2ZJWA 1QPDA 2YLFA 3CP9A 3OUKA 4OTHA 4YJNA 3ZFXA 4NM5A 2W1HA 5F94A 1XO2B 4C3RA 2WMSA 4FNZA 4A9UA 2QKRA 4E6DA 4MYGA 4E7WA 1PY5A 1WVYA 2UVYA 4DE4A 3UGCA 4L8MA 2ZMCA 3OWLA 3PTGA 4Y73A 4KIKB 4OT5A 3TDVA 5LMKA 5EQEA 4QMQA 4U9AA 1F0QA 3MTFA 3CR0A 3DK3A 3EYGA 1XQZA 4MNFA 3ZSHA 4NSTA 4XG8A 5C03A 2HW7A 4PPAA 3BYSA 1BI8A 4CQGA 4QPMA 4CFMA 3II5A 4GVJA 4JR7A 4UWCA 1AQ1A 2A19B 4RIOA 3LXLA 3ORZA 5H9BA 3V04A 4BDJA 4EEVA 1PYEA 2YM3A 1Y6BA 1JKLA 4WIHA 3C1XA 4J99A 5IG1A 2OLCA 2X8IA 3RNIA 3PXFA 5HOAA 5M57A 2H96A 4J95A 4MAOA 3HZTA 3TWJA 4UV0A 3VQHA 2GS6A 5AAEA 4FGRA 4E73A 4MBJA 2ITUA 4JLCA 2A0CX 4CG8A 2X4ZA 2C4GA 2RG6A 2WELA 4IFCA 2XRWA 1YI6A 5TOZA 1KE5A 1OB3A 4TYEA 4NH1A 4PP7A 4UMRA 1ERKA 4O81A 4IAZA 1MQ4A 3FYKX 3DZOA 2FH9A 2ZM3A 4HCTA 2XIKA 5EYMA 3FLSA 2QC6A 5K0KA 3ZZEA 1R0EA 2XBAA 4E4NA 5EHYA 1YWVA 3NCGA 4G34A 3EN5A 4I0SA 3FLYA 3RPRA 4BGQA 2IW8A 4W4VA 4BGHA 4XBRA 4DFUA 3V5LA 2OKRA 3KRXA 2QO7A 5LOHA 1S9IA 3MB6A 5HE0A 3WE8A 2X81A 4B8LA 2WEIA 4DG2E 2YITA 4FV1A 1PMEA 5A4QA 4RJ3A 3QXOA 4K18A 4E6AA 2R3HA 5BMMA 4WNMA 4KS7A 5K4JA 2C6MA 2VWYA 3QQHA 3VBQA 2ITPA 3I7CA 3ORNA 4X3FB 3A4OX 3NYNA 2OXDA 3MVJA 5C1QB 1OGUA 3MVLA 5IEVA 5JGAA 1FVVA 3UOKA 4IVAA 3WIKA 4ERKA 5CAPA 4E1ZA 4AA0A 4EQCA 3G0FA 2R64A 5IEXA 2EXCX 4FEQA 2HELA 4F63A 2QOCA 5KMJA 5LJJA 4FUYA 3MN3A 1KWPA 5IA2A 5M08A 3SG8A 3GCPA 2XK9A 3WZDA 3OOMA 5EI2A 3QRTA 5HO6A 3SXFA 4GSBA 4TTHB 3C0HA 4LG4A 3R01A 1H28A 4BL1A 3TV6A 3BHVA 2XNEA 3QQKA 2Z7LA 5BX0A 1SYKA 3U6JA 3F2AA 3PP1A 4FSMA 3SLSA 3ZO1A 1Z57A 2C3JA 4PPCA 3E8EA 2V62A 4U42A 5AEPA 3UZPA 2R3MA 2YZAA 4M3QA 2XIXA 4RA4A 5CEKA 1URCA 3NDMA 4I20A 4XP2A 4I23A 4O84A 3CGOA 4XV2A 4FT7A 2G2FA 4BN1A 4KKGA 3FSKA 5IQBA 5DIAA 4ASDA 1ZY5A 1OI9A 4TN6A 4O7ZA 4FIJA 3UNJA 3QCXA 4EOKA 4EI4A 5E9EA 3VJOA 2WTIA 3AGMA 4FICA 4UYAA 4M97A 5DR2A 4AZWA 3PRFA 3R73A 3AC5A 3DBDA 3SRVB 4AN3A 3SA0A 1DS5A 2PMOX 3EL8A 1V0BA 4RWLA 4JS8A 4D2PA 2R3JA 3BU6A 3HMIA 2ITYA 3G9NA 4C35A 2B0QA 2ZOQA 4RBLA 4EOIA 3HV4A 3I6WA 3Q4CA 3QZIA 1YW2A 3QCSA 3FDNA 3Q4ZA 3RGFA 3NUUA 1WBOA 3PXYA 5A14A 5JH6A 3E3PA 3P78A 2JEDA 4RLKA 3DNEA 2C1BA 3W2OA 3IECA 4QYHA 4G3DA 2JDVA 2JGZA 4NU1A 4RX7A 5IH6A 5M07A 1HCLA 4KA3A 3R9OA 4AS0A 3MFSA 5HQ0A 4FIFA 2UW9A 2DS1A 2NRUA 3DXNA 3HMOA 4BKZA 1JBPE 1BI7A 3SDJA 1H1PA 5L2IA 2CMWA 3VS6A 5IPJA 2P3GX 2IW9A 4O82A 2F7ZE 1DM2A 4MVFA 3DDPA 3R1SA 1JAMA 5CENA 4D5KA 4WT6A 1XR1A 4FT3A 5E8YA 2B9IA 3UOHA 4UEUA 4UY9A 2RKUA 2W05A 3QD0A 4ACCA 3QCYA 3FMEA 4BCNA 4ZTNA 3V6SA 3RAKA 2ZB1A 2O63A 3SXRA 4D2TA 5JFSA 1JLUE 1M2QA 4RWKA 1OKVA 2WQNA 4ANLA 4C4HA 2BAKA 4AOIA 1PRYA 4G5JA 3E7OA 4UB7A 2VO0A 4TW9A 3R00A 4DFBA 1GZNA 2P2HA 2PVHA 1PXKA 2GNJA 3I7BA 4CZYB 2WXVA 4HPUE 5CEOA 4UX9A 3A62A 3OOGA 3BEAA 3D4QA 2YM5A 4YBKA 2WQEA 4GFMA 2BTSA 3I0QA 3F69A 3F7ZA 3BI6A 3R22A 4J96A 3Q96A 1DI9A 2AYPA 3QL8A 3ZSGA 2J9MA 5CASA 1F5QA 4BICA 2JKOA 2QO2A 2ZB0A 4GL9A 4DFXE 5IUHA 3E87A 3O51A 4Y72A 4DLJA 5CAUA 3ZYAA 4Q5HA 1G8AA 2PMLX 3ORTA 4CKRA 3UNZA 1JSVA 4D9UA 4FZ7A 4K8AA 2BALA 3AD5A 2UZDA 3DJ7A 2Y6MA 3BLRA 3VUHA 4XG2A 2GPHA 2YACA 3RVGA 4CFXA 4F0GA 4D28A 2QOFA 4M0ZA 5CSHA 3MBLA 4XCUA 4NKSA 3DU8A 3FAAA 3QYWA 1ZOEA 4I0TA 1Q3WA 4GS6A 2XIRA 4QMYA 3CD3A 4O7LA 4G17A 4DCEA 3BHYA 4Q9SA 3PVBA 3UO6A 4MKCA 4LMNA 3R7IA 3ZFYA 3ZO4A 1XH7A 2BZIB 2FSMX 4FSYA 5KZIA 4Z7GA 2ITOA 1H00A 3UO5A 3ZRMA 4USEA 4O7RA 3FY2A 2X7FA 5KBRA 4XUFA 3ZUVA 3VQUA 4I21A 5G1XA 3TEIA 4FSTA 5DEYA 4RA5A 2XEZA 3R7GA 3Q04A 4TKSA 3T3UA 4I5PA 4IB0A 1R3CA 3NEWA 4MD7E 2QNJA 4HVIA 3F3WA 3NAYA 4R3RA 1IA9A 4XRLA 5FP6A 4BI0A 3KK8A 2QOBA 4L44A 4QNYA 3RMFA 4C38A 2GSFA 4A07A 2BTRA 4L53A 3ZEPA 4ARKA 2IJMA 2PE0A 2VU3A 5AAGA 4R6VA 3RPYA 4F70A 4BBFA 4IEBA 1WBSA 4KIOA 3RK5A 4CKIA 4LQMA 5CX9A 4AU8A 3PUPA 4EZ7A 4QMTA 4A9SA 3MDYA 3FLQA 4FMQA 1CTPE 4QQCA 1ZYSA 3F5GA 2CHLA 2QHMA 3GEQA 2Q0NA 3NUNA 4OTGA 4PPBA 4YO6A 5I5ZA 4KRCA 3R71A 2PZRA 5HCZA 2OU7A 3FWQA 4FKRA 5T3QA 2GMXA 4EORA 5AUWA 4RZWA 3D7ZA 2UV2A 3RNYA 2XKFA 3QLGA 3DXPA 1OUYA 3EFWA 4K0YA 1ZOGA 1V1KA 5FDXA 4GFOA 4XP0A 2H34A 4B0GA 1ZOHA 4G3EA 4AOJA 4FV7A 3ACJA 3LLAA 3P1AA 1PXOA 2OFUA 3R2YA 4YNEA 3LAUA 3FV8A 4QYEA 3UIXA 4DFLA 5I9WA 5CWZA 3WE4A 2W1IA 5JK3A 2AC5A 3R21A 5E8XA 5IMEA 1E1XA 2OZAB 4LM5A 2PYWA 3I5ZA 3LXKA 3ULIA 4BI2A 2G15A 4AW1A 4LUDA 5AUXA 3FMHA 5IISA 1XJDA 2R0UA 2YIXA 2JDSA 3Q53A 1GAGA 2I0HA 3IGOA 3NIEA 2JBOA 3DBEA 2QCSA 4R5YA 4LGHA 2ZV8A 3LM5A 2F9GA 2P4IA 4GK3A 4Z16A 3C51A 4FZDB 3FMDA 3LJ1A 4JDIA 4KB8A 1FBNA 4BI1A 5EW9A 3ZDIA 3ZC6A 2H6DA 1ZRZA 3P23A 4BTJA 3V6RA 1Y57A 5L2TA 4EKLA 3U9CA 3E64A 3BLHA 4EBWA 4W9WA 4PF4A 4QTAA 3QHRA 4RQVA 3Q6WA 2W9FB 4EC9A 5H2UA 4GKIA 4CD0A 3LFQA 5JMSA 3Q60A 5CEIA 2WIPA 3W8LA 2BVAA 1ZZLA 4ZJIA 5KMNA 2ONLC 4G6NA 1XH5A 2W1DA 3NYOA 2ETMA 3ANRA 4CKJA 3U6IA 2GFCA 4C2WA 4IW0A 4TWNA 3VBVA 3UNKA 2I0EA 3H10A 4WO5A 1Y6AA 2GU8A 4XG9A 4CGAA 5D7AA 1RW8A 3E8CA 3MH2A 4OT6A 4QP7A 2LAVA 5EM6A 2B52A 3PPJA 1YHVA 4QMMA 5IU2A 3ZONA 2BDJA 2J4ZA 4PWNA 3VS3A 4DGMA 4F99A 2BIKB 4O0WA 4K1BA 4LV5A 4C4EA 1Z9XA 4FV5A 4YZNA 2XMYA 1DAWA 4D2SA 3HDNA 2IVTA 3PSDA 3IG7A 2IWIA 4U97A 5TO8A 5HEZA 2BRNA 2XNNA 3H0ZA 3VS4A 5BVOA 4Y85A 3HMPA 4IJ9A 4BZOA 2QKWB 3EZRA 2ETKA 4OW8A 5AFVA 4FKOA 4DEAA 1NXKA 2A2AA 2IG7A 5B2LA 2QOLA 2OF2A 5HVKA 4CMTA 5IA1A 4EK4A 3MGYA 2WMQA 1OBGA 1REKA 3Q4TA 5C8MA 4MK0A 3BCEA 4O38A 4X3FA 4XMOA 1GOLA 2B9FA 2GHLA 4BCGA 4BTKA 4LI5A 4EUUA 4EQUA 4XJ0A 3WBLA 3IO7A 5ACKA 1NVSA 2Z7SA 4YJUA 4EOMA 4AZTA 3TXOA 2UVZA 1PHKA 3ETAA 3OXTA 2YISA 4MH7A 4CCUA 4YU2A 3FEGA 4QMZA 3OG7A 3E8DA 5DRBA 4BDBA 5EK7A 3K5UA 5KKRC 4O0UA 5IA0A 2R9SA 2YAAA 3JY0A 5M4CA 3F5XA 4IM0A 4F7NA 5E1SA 4N0SA 4FZFB 1L8TA 2GS7A 3COHA 1PXPA 2WMXA 3DFCB 5HG7A 4P5ZA 5M4UA 5JZNA 2RF9A 5CXZA 4R1YA 5CF6A 3PSBA 4O0YA 3NWWA 4MXCA 3Q2MA 3EH9A 5J95A 4EOOA 4X7QA 2ZDTA 4IVCA 5C8KA 3NVMB 1P2AA 4F6UA 2B4SB 2P2IA 4XV1A 4ZMFA 2OW3A 2VAGA 3DKCA 4YTHA 5J7HA 1JKSA 3UZTA 4PRJA 2ACXA 3TKIA 3LFAA 4YSJA 3RI1A 5HD4A 4LOPA 2UW7A 3R9NA 1JKKA 1U5RA 2H9VA 3IQ7A 4JL9A 3FYJX 3W2SA 4J53A 3H9OA 3I81A 2YFXA 4UMPA 4KABA 3MA6A 2XIZA 2ZMDA 5K0XA 1CM8A 1G5SA 3OF0A 4RC3A 5DT3A 5FXQA 5IKWA 3WF6A 5A4TA 5KX8A 2Y6OA 2VWZA 3QRKA 4KBAA 4MTAA 3LCSA 4NM7A 4RLLA 4BCHA 4JOAA 4H36A 4HOKA 4KKEA 2OIBA 5HORA 5IA5A 5CVGA 4GCJA 4TXCA 2I6LA 3CTQA 4XX9A 4BDHA 3OWKA 4U79A 5AR2A 4BR3A 3O71A 1IAJA 3FUPA 4FKPA 2X6EA 4QQ5A 1PXNA 3ANQA 4TYJA 4X2JA 5AUVA 1HOWA 3LMIA 4TWPA 5D41A 4YNOA 5AUYA 1TKIA 1XH4A 3EB0A 4JT3A 4E5AX 5IQFA 4JBQA 1H01A 3T3VA 4G16A 3LFNA 5I9XA 1JSUA 4G9RA 5B0XA 5HNGA 4FNWA 5IA4A 3KU2A 5L2WA 3BKBA 2GNFA 1IA8A 4IM3A 4I1ZA 4JBOA 3IW6A 4XOZA 2VO7A 4W4YA 1YDTE 4A06A 5I9UA 3EWHA 4E20A 3KMWA 4JX7A 3WZJA 4E3CA 4YO4A 4YR8A 5IQEA 2W4KA 3ZCLA 4F7SA 3KVXA 3FZSA 3HMNA 3LXNA 4QOXA 3ATTA 4UXQA 2F49A 3ZH8A 2F7XE 5DFPA 2C30A 3GFEA 4YZMA 2XK6A 3NUSA 2BDFA 2XCHA 3QD3A 1Q8TA 4FKVA 4FTIA 3RINA 4EHVA 4HGLA 1FGKA 4RC4A 1CSNA 1WAKA 3OHTA 1UWJA 3ZO2A 3SXSA 3BGZA 2I1MA 4CVAA 1XBCA 4PMTA 4FC0A 2JAVA 2W06A 3UOJA 4O7SA 4GT4A 3SHEA 3EQDA 4QMUA 3WILA 3WIGA 3MTLA 2WMUA 2YWPA 3L9NA 1X8BA 1KSWA 4QP6A 4TWOA 1WBPA 4B7TA 1R78A 2R4BA 4CXAA 5BPYA 1M7NA 4V0GB 3W2RA 4U81A 4F0IA 1H24A 3NSZA 1LEZA 1Q8UA 2E2BA 3BIZA 4IAAA 4R7IA 4CQEA 4ZY4A 4ALVA 2YDJA 1OIRA 4GMYA 4KKHA 5E92A 1UV5A 4C36A 2X39A 3K3JA 4FTRA 4BCKA 4E6CA 5IQIA 5IA3A 2UZUE 1YOLA 2XKCA 5CEQA 3PXRA 3BU3A 2OG8A 5AA8A 5BVKA 2E9NA 1PXLA 1R0PA 2BIYA 2Y0AA 3OROA 3R6XA 4GT5A 5ICPA 4BVUA 3R7UA 5E8ZA 1S9JA 2YCRA 3VW8A 3VS5A 4AOTA 1Q8ZA 3BV2A 3LFBA 2X8DA 2OGVA 4XNEA 5L6WL 2PVMA 2PZPA 5ANDA 3VO3A 3SX9A 3ZBXA 4LGGA 4QP8A 3AT2A 3WZUA 3DLZA 3S00A 2YM6A 3TUCA 5HU3A 2OJ9A 3D2IA 4IHPA 4W8EA 2PSQA 2RFEA 4YLLA 4DTKA 2WQMA 2QOIA 5M4IA 4D0XA 4XG6A 4HGTA 5CU6A 3KXXA 1A9UA 2GS2A 2UZEA 4JVGA 4WBOA 5D1JA 3L9MA 3QALE 3V3VA 3R8UA 4AW0A 1UKHA 4FIIA 4ITIA 3B2TA 3OW4A 4ID7A 4ZOGA 2PUPA 3IKAA 2YAKA 3DLSA 3UVRA 2CKEA 1VJYA 4MQ2A 2J7TA 3HYHA 4ZXTA 4BGGA 4CYJA 4FV0A 4F09A 1W7HA 2QG5A 3KRWA 4XOYA 5A3XA 1LR4A 4D1SA 3I1AA 3TTJA 5HU9A 4P5QA 4ACGA 5ANJA 3BWFA 3VF9A 5J8IA 2OBJA 4FTLA 4ASZA 2W1CA 2CPKE 3GCQA 3NNXA 4QMSA 1G8SA 3KEXA 3Q5ZA 3FPMA 2C0OA 2FB8A 2XNMA 2W1ZA 3QKKA 3MW1A 4I6HA 1U46A 2HAKA 3IGGA 3ORXA 3TJCA 4BIBA 3U54A 3DJ6A 3H30A 4IADA 4AA4A 3JY9A 3R9RA 2GQSA 4FTMA 4BZDA 2RIOA 4JR3A 4TYGA 5CXHA 3OCTA 3MH0A 3E7VA 3DPKA 2UZVA 1P5EA 3EKKA 2JD5A 3HV6A 3CCNA 5FEDA 5IH4A 3BRBA 3ERKA 1J3HA 4WRGA 3O8PA 4EOQA 1CKIA 4FZAB 4FKUA 2OIQA 3GU4A 2HIWA 3KXHA 2OZOA 4F08A 4YC3A 5AM6A 3AC3A 4AE6A 4APCA 2RFSA 4JDJA 4H1MA 4NJDA 5ETIA 1ZMVA 5FM2A 3FLNC 2OJGA 4DEHA 2KTYA 3BHHA 4OAUC 3SW4A 4PNKA 4JBPA 5M06A 2QOQA 4HVSA 1W98A 3HA8A 4TYHB 4YMJA 4LUEA 5KBQA 2VTTA 3AD4A 5B2KA 4PDPA 1M2PA 5ITAA 3C5UA 3F3TA 5AP6A 1O9UA 3BE2A 1V0OA 3UIUA 3KFAA 3NNWA 4EH7A 3RK7A 2PUUA 3KGAA 3QLFA 3FKLA 2VD5A 4BDEA 4E5BA 4QYGA 5FBOA 3F5PA 2HWPA 3ZXZA 5JSMA 3QQGA 3DGKA 4BDAA 5CQWA 3ZMMA 4O0RA 4FKLA 3CIKA 4L42A 4MF1A 3F9NA 5H3QA 5KHXA 2VX0A 1H1QA 2R3GA 2R3IA 2O3PA 4KIPA 3ZLWA 4U3ZA 3UYSA 3SAYA 2ESMA 4BIEA 1E1VA 1FQ1B 2YIYA 3EZVA 3MPTA 4NCTA 4D2VA 1JKTA 5HX8A 3EIDA 3AMAA 5KCVA 4GUBA 3QC9A 5DE2A 5EM5A 5EI8A 4DBXA 2G2HA 1B38A 3FMMA 3DBCA 2B9JA 1UNLA 2GNGA 4F9YA 4YHTA 2WHBA 4NTSA 1J7LA 2QR7A 2Y4IB 3EN4A 2XA4A 4RFYA 5C26A 3FKOA 3KRRA 1E9HA 4FKTA 4PDSA 3WOWA 5LQFA 2HZNA 3IW4A 5AA9A 3P9JA 2WQBA 1BYGA 3FHIA 4N6ZA 1BL7A 4MBLA 3LW0A 4II5A 3S1HA 2CGVA 5AR8A 4FVQA 3OBJA 2EU9A 2OK1A 1OBDA 3OZ6A 3F88A 3RZFA 5HCYA 4BKJA 1TQMA 2JLDA 3EQPA 4L00A 1M52A 4GJ2A 4U43A 3VHEA 1REJA 3A60A 3E88A 3Q9YA 3W16A 1XH9A 3MV5A 3ZRLA 3TKHA 5LWMA 3EN7A 5M51A 4GKHA 4WG5A 3PA3A 3LQ3A 2WMAA 4ANNA 1BL6A 3QTIA 3QGWA 2CKPA 1YVJA 2PWLA 3D94A 3NAXA 2FSOX 3C4WA 2FVDA 3TV7A 3M2WA 3VC4A 3KMUA 2QOHA 3HMMA 3E62A 2WQOA 5J79A 2JBPA 3QA8A 2I7QA 2FYSA 1R1WA 3EFJA 3GB2A 4FUXA 2WNTA 4IX5A 3MSSA 5LCKA 2WTCA 3B2WA 1YRPA 2X6DA 3UOLA 3R1NA 4RIWA 5IDPA 5DG5A 4AT3A 5AX3A 3MY1A 4A4LA 5CAVA 5IF1A 2C68A 5CVHA 2ITTA 5KMOA 5AV2A 3LFFA 4U80A 4X2GA 2I40A 2HY0A 2VUWA 2PVRA 4IX3A 4DEEA 4JNWA 3WI6A 2GQRA 5E8UA 3NUAA 3TUDA 4I5HA 1GZ8A 4BYJA 4GG7A 2X8EA 3KXZA 1JPAA 3Q32A 1WBTA 1ZXEA 4FYNA 4OGRA 1OIYA 3A7HA 3CQWA 4RG0A 4P90A 3I6UA 4O6LA 2PUNA 3HP2A 3GU8A 4KUJA 5EKOA 2J0KA 4G31A 4N70A 4F1MA 1Z5MA 4YJSA 3NGAA 3RZBA 3SD0A 1OL6A 3FZRA 3LLTA 1RDQE 3C4EA 4NT4A 2YCQA 2UUEA 2XJ1A 4GUEA 2WMRA 3VAPA 5CI7A 3G5DA 4FKJA 4QQTA 3WF5A 4EZ3A 4CRSA 4HJOA 4ZZMA 2CGWA 4XG7A 1XH6A 4U3YA 4BC6A 4A9RA 3G2FA 4C37A 4AGCA 2F4JA 2HCKA 3BYMA 4FL2A 3W10A 4ACDA 4OTDA 4Y5HA 3V5PA 3W2CA 2IN6A 4F7LA 3JUHA 3CS9A 4FODA 4M8TA 2WKMA 2PVLA 4DEDA 3C4XA 2R3LA 3POOA 4ZTQA 2PUIA 2YCFA 5DR6A 3DFAA 5ANOA 3CLYA 1WMKA 2J0JA 1Q41A 2W99B 1WBWA 2VGPA 3VBXA 4RIXA 3KL8A 5EHLA 4E5WA 1LEWA 4EBVA 2RFNA 4IMYA 5I9VA 3DK7A 1J1BA 2VNWA 2W4JA 5LXMA 5L6OA 1SZMA 3TIYA 2R2PA 1ZMUA 5EKNA 4EC8A 5AP0A 5JN2A 4AACA 3MI9A 4AQCA 3UC3A 4IB1A 1ZAOA 4QMOA 4FTKA 2XEYA 3FLWA 4U5JA 1PKDA 4B99A 4GT3A 5HTCA 4EH9A 5IH5A 4C3FA 3PJ3A 3TNIA 3DAKA 2BHEA 3PRIA 5FXSA 1PMVA 1UWHA 4M67A 5DR9A 2YIQA 5AP3A 3R8MA 2KULA 3CTHA 3UBDA 4BDGA 3FL4A 4UALA 3VWAA 4B6LA 4DH7A 3EQGA 4ZK5A 5E8WA 4CYIA 3QQFA 4Y8DA 4WRSA 3JVRA 5BYLA 1B39A 5EYKA 4HVGA 4ZSAA 3QFVA 3F5UA 2IO6A 3F3VA 4DGGA 3HX4A 3IOKA 4V0GA 4UWBA 3PE1A 4BKYA 3R02A 2E9UA 3W1FA 2VTMA 3KCFA 3I4BA 2PVFA 4DT8A 2C6OA 2YJRA 3PWYA 2PE1A 4U6RA 3EQIA 2JAMA 3V5TA 5JGDA 2X9EA 1GNGA 3R7YA 5FTOA 3QD4A 5E90A 4IWDA 4H05A 1SVHA 2C6KA 4KRDA 3AGLA 4C57A 5GZ9A 3C0IA 3EOCA 5K3YA 1UNGA 3K3IA 3U4WA 3RBWA 3L1SA 3MJ2A 5GJFA 5HO8A 4N6YA 3R8PA 1XBBA 2VGOA 2YA9A 2NPQA 3KY2A 2R3PA 2CDZA 2ZV2A 3CJFA 3KKVA 2I0VA 5J5SA 2X7GA 3KF4A 4I41A 5L8LA 3QC4A 4QMVA 4BCIA 3PJCA 2PULA 5CZHA 3BELA 5HI2A 3OCGA 4EL9A 4QPSA 4H3BA 2VO3A 4FIGA 4C34A 5KNJA 2VTJA 3D5VA 3F61A 2XUUA 3I5NA 4IAFA 2F2CB 2JC6A 5LVOA 3V5WA 3AC4A 4YHFA 1PXMA 4EH3A 4XV9A 5FEQA 3RWPA 2J2IB 4FK6A 2FUMA 2OFVA 3RPSA 2VTOA 3N4VA 3LE6A 4AGUA 4PL3A 3SOAA 3W32A 3S2PA 3FSFA 2YDIA 3TV4A 4W8DA 1FMKA 4X3JA 2Y4PA 4O1OA 5DI1A 3AC1A 2W5AA 4NK9A 4JXFA 5I3OA 3ZUUA 4USDA 4CLJA 5BYZA 1IASA 3TACA 3OXZA 4JIAA 3NW5A 2XJ2A 4K9YA 3ITZA 4K33A 5DMZA 4FSWA 3U6HA 3JYAA 2IZRA 3QTXA 1PXIA 4MBIA 4TYIA 4X2NA 4J8NA 3G15A 4RJ8A 3R1QA 3P5KA 3FPQA 4FVRA 4YPDA 5TKDA 2XNPA 3D5WA 4RVLA 5JFXA 5CAOA 3QU0A 3P4KA 3GT8A 3QXPA 5AV3A 4P4CA 2QONA 3QKLA 4V04A 5DN3A 4FV3A 4BF2A 1QPJA 4R3PA 2HZIA 3HUBA 3LFDA 4OBPA 4QMLA 1YI3A 4IC8A 5L3AA 5JGBA 4WNKA 4ZZOA 4YP8A 4ZY6A 4MNEB 4TYHA 5HKMA 4EONA 1APME 3HNGA 3D0EA 4AA5A 3OMVA 1U54A 4LL0A 5JT2A 3OTUA 2B1PA 4W4WA 2XH5A 2HY81 3HL7A 4UXLA 4RJ7A 5E1EA 3A2CA 4PNIA 3ZHPC 3O96A 4HW7A 1Q61A 2R3QA 2ERZE 4FV6A 1L3RE 3UQGA 1OECA 3EMGA 3QF9A 5J7BA 1OIQA 4L46A 4XEYA 3TI1A 5KMLA 1KV2A 2OJJA 4YGAA 2AC3A 3KRJA 1OPKA 3NW6A 4CV9A 4E6QA 1KE8A 5KUPA 3NW7A 2ITZA 3RAIA 4C4GA 5JRQA 3COKA 4CT1A 1VEBA 1Y8GA 2WIHA 2QLUA 3MIAA 3SKCA 4NFNA 1NY3A 2VX3A 3UVPA 4CV8A 2BROA 3C13A 2HWOA 4BCPA 2CSNA 4AG8A 4RFZA 3ZM4A 3LKMA 1W84A 4DFNA 2UW3A 3IW8A 5LVMA 3JR1A 2IVUA 4NW5A 4CFVA 4D1XA 2JKMA 3ACKA 4RIYA 3FY0A 3D5UA 5LVLA 3EJ1A 4RWIA 5L2QA 5T68A 4B4LA 1XBAA 2YDKA 2X2MA 4F6SA 5L4QA 1NVQA 3KRLA 4NWMA 3WARA 4FV9A 3SG9A 2CCIA 2YJSA 3NYVA 5D12A 2XRUA 4X3FC 5DT0A 1YXUA 3OP5A 4OR5A 3V8SA 2F2UA 4TNBA 4IE9A 5HD7A 4Y5QA 3UPXA 4CLIA 2BZJA 2IZUA 1T45A 2JIIA 2QU5A 4YUQA 1NW1A 4E93A 3G33A 2PVNA 3GCSA 5C27A 3Q9WA 5CS6A 3DA6A 3KN5A 4GIIA 3NUYA 5I9YA 4JDKA 2C3IB 2BUJA 2XNGA 4HYIA 3HAVA 3ZFMA 4FL1A 1K3AA 4L52A 4D4SA 2DYLA 4MWIA 1NA7A 4H1JA 3F2RA 4HCVA 5J1VA 2UZBA 3FMNA 4EHGA 3DBFA 5CQUA 3DJ5A 4L01A 3MJ1A 4YBJA 2C6TA 3UG1A 2ZYBA 3QTQA 4DHFA 4YZBA 5DLSA 2PU8A 4O7NA 3ZLYA 1U4DA 3DBQA 5ACBC 1FVRA 2G9XA 4V05A 1ND4A 5D9HA 4DF3A 1H1SA 3F82A 1Q8WA 3VJNA 3A8WA 3EKNA 5EQPA 4R77A 4I6FA 1P14A 4A4OA 1SMHA 2VWXA 3O0GA 1GZOA 2V7AA 3P0MA 4FSZA 4WUAA 4AZSA 4HGEA 3VUGA 4R7BA 4KSQA 4FKIA 3MVHA 2BRMA 4O22A 3W33A 2GFSA 4PY1A 5A4CA 2CN5A 3EQFA 4MXAA 5AWMA 4N4SA 4FV4A 2C69A 1W82A 3QWJA 4JRVA 4YTIA 3OWPA 2QURA 5HG8A 5GZ8A 5CSXA
chains in the Genus database with same CATH superfamily
2WFYA 5HVYA 5C8NA 3QX4A 4MX9A 3D14A 3P7AA 2WGJA 3R7VA 4GJ3A 1SNUA 3GOKA 5FUTA 5CY3A 4C4FA 2UW6A 2RG5A 2G1TA 4C61A 4RIWB 5AP5A 5DA3A 3ZUTA 3CD8A 3LHJA 2OIDA 2IW6A 3V51A 5JFWA 1H0VA 4M69A 4J98A 3MH1A 5L8JA 5EM7A 4CMOA 3BWJA 4KD1A 4ERWA 1A48A 5DRDA 3FHRA 2VTRA 3COMA 3AG9A 3ET7A 5F95A 1OMWA 3FI2A 5E4HA 4Y46A 3AT4A 4O4BB 4ZS0A 4B8MA 1H1WA 3G6HA 4EQMA 1TVOA 5C9CA 5CALA 2O2UA 2ONLA 5HLPA 3UQFA 4KIQA 3VN9A 1UU3A 3QA0A 5I9ZA 3UP7A 2PVYA 3E93A 5AR3A 5EQYA 2VWWA 4CFFA 4FSNA 3ROCA 4ZSJA 3ZXTA 2XKDA 4LRJA 4HPTE 4PL5A 4QTDA 4IZYA 3ORPA 4DAWA 1K9AA 2J0IA 5A9UA 3AXWA 1KV1A 2J0LA 2OI4X 4I5CA 4MF0A 4UBAA 3PXQA 2UW0A 4FTUA 4JQEA 5CEPA 3RPVA 4EHZA 5K4IA 4RRVA 2BR1A 4F9WA 5K5NA 2W0JA 3V01A 4E4MA 2GTNA 3EQCA 4Z9LA 3DTCA 2XK7A 4ZJJA 4PUZA 4HYSA 1YQJA 3R9DA 3CE3A 4U0IA 5TT7A 4AZEA 4G6OA 5D11A 2ITNA 4YJRA 4C0TA 4L68A 4YURA 1QPEA 2IVVA 3K54A 5DWRA 3UO4A 2WU7A 3C4ZA 2A1AB 4BDCA 5J9LA 5CTPA 4ENYA 4F0FA 4NM3A 3GC7A 4RX9A 4G3FA 5JKGA 3LZBA 2QO9A 3TL8A 5CF5A 3U87A 5FD2A 5B7VA 3PJ2A 4DFYA 2NNWB 5G6VA 1PW2A 4BYIA 3NZ0A 2DUVA 4KAOA 5HCXA 1AGWA 1VZOA 3DKOA 3DQXA 5FP5A 4ZS4A 4G2FA 3FXWA 1OITA 4RIXB 3WF8A 4ORKA 3GNIB 3K2LA 4DGOA 4EK6A 3FLZA 4KWPA 5CAQA 1SVEA 4QMWA 4EOPA 4WSYA 1ZWSA 4AX8A 3OT8A 4AT5A 5F4NA 3U9NA 1UVRA 2XK8A 2REIA 4D4RA 5KMIA 3AC2A 4WHZA 5BYYA 1RQQA 4WNPA 4YJOA 2XCKA 5E91A 2HW6A 5H8EA 4F4PA 5KMKA 4RX8A 3P79A 2WEVA 2YIWA 2GHMA 2YABA 4TL0A 4FKGA 5E8SA 4CCBA 5JFVA 2BKKA 4L6QA 4S34A 3PDTA 4IX6A 4FOBA 3R8LA 4OAVB 4DDGA 3ZLXA 2PZYA 4FKSA 3UYTA 5I3RA 4FKWA 3VUDA 2XYNA 3GU6A 1YXTA 2V7OA 2VN9A 4L3PA 4FE2A 5HTIA 3UDTA 3VIDA 5AR7A 2OJFE 3VRYA 3W0OA 3R1YA 2OJIA 1GIJA 3FMLA 1J91A 2W5BA 3KXGA 5DYJA 3QHWA 4ZMEA 4NFMA 2J0MB 3KULA 2WU6A 1H4LA 2ITQA 3WF9A 2CNQA 3TNQB 2PVKA 3ENMA 4BWKA 1VR2A 5HVJA 4GV1A 3ULZA 3QGYA 2B54A 4TY1A 3BBWA 2XJ0A 1OL5A 4AXDA 3IPHA 4M12A 4MXYA 1W8CA 1P4OA 2GNIA 5HLWA 3SQQA 5AV1A 2WTDA 1PJKA 2C0IA 1SVGA 3KREA 3OVVA 4AZVA 4AW2A 5H8BA 3OEZA 3OXIA 4AP7A 2EB2A 3N9XA 5IUGA 1Q3DA 4LYNA 2P33A 4LOOA 2PL0A 4PMPA 4NZWB 4YJPA 3VS0A 4XYFA 2O5KA 3LCKA 3ZDUA 2HYYA 1PXJA 3PA5A 1OUKA 4DYMA 2QG7A 3P08A 4KNBA 4OTPA 4RVMA 3NVKI 2JITA 4FZ6A 3GVUA 2RGPA 3I60A 1JOWB 4ZSLA 5AP4A 2GNHA 2XYUA 5EYCA 3E3BX 4LOQA 4GRBA 3EFKA 2UW4A 4M0YA 4R7HA 1FINA 2Z7QA 5M56A 2CKOA 2FGIA 3LCTA 4JAIA 1LPUA 3ORLA 4I0RA 5FEEA 1LP4A 2X2KA 4AE9A 4EH5A 5CT7A 4D1ZA 2WB8A 4M15A 5CANA 4JG7A 3MFRA 1YXVA 2C3KA 4EJNA 3O50A 4U44A 1SNXA 1LUFA 3LFSA 3QYZA 4MNEA 4NIFA 3FBVA 4W9XA 4KINA 3FL5A 5HNIX 3CC6A 5CSVA 3EQRA 4FL3A 4YZCA 2XNOA 4JI9A 3T8OA 1PMNA 3DNDA 5LVPA 3HP5A 4O2ZA 4MWHA 3MESA 3NPCA 2GHGA 4NCTC 5EM8A 3DTWA 4O1PA 1ZZ2A 4XG3A 3T9IA 4EKKA 3UQCA 3RAWA 1BLXA 5IDNA 2IF8A 3CKWA 4QYYA 3OS3A 1WFCA 4ONAA 3VULA 4D9TA 2C6DA 3BBTB 1YKRA 3D15A 5AUZA 3AKLA 2UZWE 3TG1A 3UVQA 3N4UA 5F1ZA 3G0EA 4TPTA 4LV7A 1OZ1A 4IACA 3R63A 3ZO3A 4X21A 3LFEA 4FEUA 2ITWA 4CT2A 4I6BA 3LOKA 3FQHA 4XS2A 3HAMA 3HV7A 2WTVA 3VF8A 5LMKC 4YLJA 3CKXA 2XVDA 3QZGA 4ZEGA 3L8SA 3PFYA 4JAJA 4CRLA 2HOGA 3QAME 4FI1A 4J1RA 4MXOA 2UZNA 4UYNA 3E8NA 2CCHA 1U54B 3Q52A 4IAYA 3TUBA 4L43A 4XLIA 3BYOA 3SV0A 3LVPA 4ZSGA 2PZIA 3CEKA 2F57A 5EOLA 5DPVA 3BYVA 3QRIA 2OXYA 1GIHA 1V0PA 4LMUA 3VS2A 4NL0A 3RCDA 4AQKA 5HLNA 4R5SA 1BMKA 2BRGA 2Q83A 3GXLA 1PF8A 3NUXA 2IZSA 2Y7JA 1YDRE 3EQHA 3A4PA 3RTPA 4K6ZA 5JQ5A 3DOGA 2SRCA 3PYYA 4I3ZA 4HYUA 4CMUA 4C3PA 4ZTMA 2X2LA 1QMZA 3MY0A 4LV8A 1MRUA 3FMJA 4FKQA 2NP8A 4U45A 3C7QA 1H1RA 2ITXA 5BVFA 1FPUA 4O27B 3NMUF 3BHTA 3IW5A 4QP1A 4QP2A 3RCJA 4FNYA 4IDTA 4IJPA 4QNAA 3VONA 4LL5A 4R3CA 1U5QA 4FV2A 3POZA 3BQCA 4CG9A 3ZLSA 4CFWA 2CJMA 5M53A 1QCFA 4RIYB 3H9RA 3DV3A 3TZ8A 3H0YA 5M4FA 3O23A 3BV3A 4CZUA 3CSVA 1TQPA 4EOSA 4DGLC 5EW8A 3V5JA 5A6OA 3ROYA 5J1WA 3PLAE 5JEBA 2BZHB 1BUHA 4DA5A 3M42A 4L45A 4W4XA 4IQ6A 3IW7A 4YTFA 3UODA 3TTIA 3DKFA 4BWPA 5K9IA 2GTMA 3PIXA 4G1WA 2W9ZB 3EHAA 2R3RA 3BPRA 5K5XA 5KE0A 2XIYA 4O0TA 4HYHA 3UTOA 5LWNA 4L3JA 5EH0A 2BFXA 1R39A 2R7BA 1I44A 4WG3A 1DI8A 3HV3A 3SC1A 2WTKB 5BVDA 3LQ5A 5LCJA 4LRMA 5FWKK 5L8KA 5CF8A 4OBQA 4J8MA 2AUHA 3LJ0A 4FT5A 4MHAA 3KVWA 2WOTA 2R3OA 4MQ1A 4FSRA 4XV3A 3IOPA 2QVSE 3UP2A 5IEYA 3RHXA 3NUPA 4NEUA 3UC4A 2YN8A 4S2ZA 2ZVAA 3R0TA 3DCVA 3EQBA 5M55A 4ZLOA 2BRHA 2R7IA 1W0XC 4ZIMA 3ORKA 4QYFA 3A8XA 5DVRA 5TR6A 5AUTA 3PP0A 4PMSA 2X0QA 4FGBA 4AGWA 4USFA 3PG1A 4HZRA 3WF7A 3HKOA 3PVGA 1Y8YA 4FTJA 4PL4A 1H08A 3ID6C 4JX3A 3SW7A 2PY3A 4IWOA 2VRXA 5LVNA 4QO9A 1OIUA 4BCFA 2J5EA 3R8VA 3R8ZA 3O7LD 3RALA 4CFUA 3BX5A 2UW8A 4MD9E 4O0XA 4FBXA 3D7TA 3PFQA 4P7EA 1H8FA 3VUKA 1ZYJA 4OTQA 4EHEA 3UMXA 4C4JA 3PA4A 3VW6A 3T9TA 3W8QA 3DKGA 4QMPA 4JQ8A 2WMVA 1JNKA 2YLEA 3PPZA 3WZEA 4D55A 4C8BA 5CI6A 5EDQA 1FOTA 4U8ZA 4ASEA 2WTWA 4TRLA 3NYXA 3R7EA 3D83A 5EDPA 4QP9A 1VYWA 2QR8A 3UJGA 4DH8A 3HVCA 1JWHA 5AIRA 2QODA 4DG0E 2XNBA 2C1AA 4L9IA 1Q24A 3R9HA 4EZ5A 4DCAA 2W96B 4JBVA 4L7FA 5A54A 4EH8A 5CU3A 2BZKB 3BZ3A 4I24A 2XB7A 2ZM4A 3FC2A 3PIYA 3UIMA 5HNBA 2CN8A 5HESA 5ANEA 1QL6A 4M69B 4X0MA 5JRSA 2FSLX 5HE3A 2ZDUA 2A27A 3ATSA 3DB6A 4IX4A 3HUCA 5A6NA 3E63A 4O4FA 4FYOA 3PWDA 4DT9A 4FTTA 4ZP5A 2RSVA 3ORMA 3KN6A 3PY0A 2JKQA 2PZ5A 3PVWA 2BHHA 3TNPC 2ZAZA 2Y8OA 3D5XA 2Z7RA 1YXSA 3AMBA 3Q5IA 1CKPA 1UU7A 3R7OA 4X6QC 2CGUA 3AT3A 3ZZWA 4YJVA 1UNHA 4DLIA 3VBTA 5H8GA 2CLQA 4YLKA 4F1TA 4DH3A 1OL1A 3S4QA 3S3IA 3SVVA 4R1VA 2I0YA 2GNLA 3QKMA 2Y9QA 3CTJA 3TMOA 3DXQA 3CQUA 1UU8A 4PX6A 3HRCA 4YC8A 3VBWA 3TKUA 4C4IA 2FSTX 4IB3A 4QPAA 1YOJA 1OKYA 2PK9A 2DQ7X 3UG2A 5DNRA 2PE2A 1M17A 3ZTXA 4XBUA 2QQ7A 3Q2JA 3NNVA 4RC2A 5EG3A 4S33A 1J7UA 4PTCA 2XM9A 2EVAA 2UW5A 2VWVA 3S95A 4QDEA 2JIVA 4BY9E 4EOJA 3RHKA 5AAFA 2R0IA 3U4UA 3M11A 1DAYA 3PY3A 5ANIA 4A9TA 4F9AA 2JFMA 3D2KA 5HZNA 2R3NA 3OUNB 2W5HA 1OPJA 2V0DA 2BAQA 4MEDA 5IQDA 2ZV7A 2X7OA 4UZHA 4BIDA 3CY3A 2PHKA 4QQJA 3Q9XA 1UKIA 4RJ5A 3UE4A 4ZZNA 3ENHA 2XM8A 3L8XA 4M7IA 2P55A 3GCVA 1GY3A 4U41A 4U7ZA 5DGZA 5C01A 3RAHA 2RL5A 3WZKA 2HK5A 3BHUA 1WZYA 4DC2A 4BDDA 5IMXA 3PZHA 4ZLZA 3F6XA 2FA2A 2JKKA 2YM8A 3OC1A 3PXZA 1PYXA 5KKRB 4GU9A 4AWIA 1F3MC 5ANGA 1KE9A 4CNHA 4BDKA 2C5YA 3QRUA 4FG7A 3TJDA 2XS0A 4FEXA 1H26A 3MYGA 3PZEA 3RKBA 3UPZA 4NYEA 4Z7HA 1H25A 1ZYLA 1Q62A 2WPAA 5DT4A 1H27A 3N51A 5CNOA 3TT0A 4F6WA 4O96A 5B2MA 5HE1A 1NVRA 2OICA 4HZSA 3EL7A 4QTBA 5J9ZA 3D9VA 4DINA 4AFJA 4CTCA 5LMBA 5DOSA 3U55A 4YHJA 5BV3A 4R78A 3RP9A 3LMHA 1PMUA 3W0RA 2P0CA 2C6LA 3F3UA 3KULB 3FXZA 3CPCA 5IQHA 4RJ6A 1M2RA 3BGQA 5DHJA 5CT0A 3GC8A 2QU6A 4GH2A 2C5VA 5C4KA 2VTAA 4AXCA 2XAOA 3QWKA 4NJ3A 4G9CA 4BDIA 5GNKA 1O6LA 3TIZA 4XG4A 4UWYA 1W2DA 3TN8A 1Q5KA 3GCUA 4DTBA 4FSQA 4ZTHA 2BRBA 4YSMA 5CF4A 4TZRA 3KK9A 5HE2A 2V55A 3AC8A 3C4FA 1H07A 3GP0A 4L67A 4APPA 4OTWA 3W18A 4JRNA 3RWQA 2JDTA 3FXXA 3FC1X 2E9PA 3DAEA 3W2PA 5A4EA 4AFEA 2PMIA 3PE2A 3OBGA 4ZTLA 4ACHA 4K11A 2Y4IC 3FMKA 4JIKA 4PQNA 3DB8A 1J1CA 4E4LA 2OH4A 5AP1A 4NM0A 4UMQA 3Q6UA 1O6YA 2YM4A 3MWUA 4ITHA 4FEVA 4FG9A 4F9BA 4IVDA 4GG5A 5AJQA 3ELJA 4HCUA 2ETRA 3FKNA 5GHVA 1T46A 3HDMA 2UZOA 5KMMA 1XKKA 3MY5A 3VVHA 4XRJA 2JDRA 4O0SA 3ZC5A 3RJCA 4EJ7A 1FGIA 2BKZA 1YWRA 5FDPA 5I0BA 5CU0A 4NIFB 2O8YA 1M14A 4BDFA 3A7GA 3I79A 3KXNA 3LIJA 5BVEA 2WAJA 4BCQA 4D2RA 5AADA 1IAHA 5J87A 2XZSA 4PTGA 2ZM1A 4MXXA 1K2PA 3R04A 4AUAA 5GIPE 4O7YA 4FK3A 3C0GA 3VUMA 5KHWA 4UN0C 3NR9A 1RE8A 2WTKC 2YIRA 1YXXA 3GBZA 3JS2A 4U40A 5D10A 3Q3BA 4ZJVA 5CEMA 3AD6A 3CQEA 3ZU7A 3NFGB 2X0GA 2WOUA 4IXPA 5CZIA 4ZY5A 2ITVA 5CLPA 3LFCA 1CMKE 2B7AA 4RVKA 4FR4A 2QI8A 4FA2A 4GU6A 2VV9A 2VWUA 3W0NA 3FQSA 3Q4UA 3G90X 3FZTA 5JQ8A 1JVPP 3N4TA 4AAYA 4JMQA 3FQEA 4I94A 2R5TA 3UMWA 3GC9A 3QQLA 2CKQA 2XARA 3OTVA 5AV0A 4FEWA 3OCSA 2B9HA 4FIHA 3EFLA 3JVSA 4J97A 4IWQA 4BTMA 1JQHA 4FJVA 3O8UA 4TWCA 2WO6A 1J7IA 2YCSA 4IAKA 2OH0E 4J7BA 4NUSA 4D5HA 2NRYA 3A99A 2YHVA 5AR4A 3TCPA 3R30A 2O64A 4WKQA 4IH8A 3RM7A 1O6KA 1ZARA 3BU5A 5ETFA 4M68A 3UZRA 1OKZA 3M1SA 4X6RA 4M66A 4LRKA 2JFLA 2VTHA 3DK6A 3OY3A 3FI3A 4OTRA 4TNDA 2Q0BA 5HG9A 5BVWA 3AKJA 2YM7A 4KS8A 4RT7A 5HO7A 3QTSA 3VS7A 2C5OA 1IRKA 4IDVA 4AT4A 5C4LA 4FTNA 3NX8A 1OL7A 3G6GA 3REPA 4DHJA 2OWBA 1URWA 1Q99A 2IVSA 2EUFB 3MB7A 4O21A 2Z2WA 4G6LA 1B6CB 1FMOE 2DWBA 1STCE 4CTBA 4D58A 3TDWA 1NT2A 3GOPA 4MXZA 3PLSA 4O91A 4DG3E 3BLQA 4KIKA 3R28A 2G01A 1M7QA 4HVDA 1G8KA 1VYZA 4AN2A 4JJRA 4AXAA 5IZFA 1XWSA 5AM7A 4QP4A 5E7RA 3EYHA 1ATPE 3MFUA 3TYKA 4DEIA 4YJQA 2C5XA 4XLVA 3U8WA 4IVBA 4Q9ZA 3E5AA 3KXMA 3B8RA 3QQJA 4BRXA 5EW3A 1Q8YA 3Q9ZA 3LCOA 4G3GA 5IUIA 5F20A 2J90A 1GIIA 4OUCA 5EFQA 2IPXA 1EH4A 3HLLA 4IZ7A 3CPBA 4FF8A 2W7XA 5E8VA 5FRIA 5AMNA 4E8AA 3QBNA 3TZMA 1QPCA 4MD8E 4F1OA 3QX2A 1YDSE 4BFMA 2O0UA 1YHWA 4YPSA 1Q4LA 4BCJA 3QUEA 4DH5A 5GIOE 2Z8CA 4GIHA 4ALUA 2BILB 4O7TA 3W2QA 4G5PA 3DZQA 4ZLYA 5A4LA 4IB5A 5KZ0A 1GJOA 3KMMA 4DEGA 4MUQA 4GW8A 3MIYA 3QD2B 4Z55A 4S30A 4FTAA 5CVFA 2HZ4A 2VX1A 4L7SA 4ANQA 2CNVA 2YZLA 2QOOA 3DT1A 3P7CA 5BUEA 5AP7A 4YTCA 5EDRA 4Z3VA 3O8TA 3ZRKA 5LMAA 4FSUA 2F7EE 5AIKA 4ANSA 1BX6A 3MVMA 4IFGA 4L3LA 2PPQA 5CYIA 3KC3A 4GYGA 4CFNA 4BCMA 2EWAA 3VUIA 4Y95A 4ANOA 4EYMA 4F65A 4QP3A 2B53A 2ERKA 1AD5A 3QCQA 4S32A 3TZ7A 3DDQA 4OBOA 1MUOA 2J50A 3QQUA 5BUJA 4J52A 4X2FA 4R8QA 1MQBA 1P4FA 2WMBA 4LGDA 4I92A 5DH3A 4O0VA 4D4VA 1RJBA 3C5IA 5DEWA 4IIRA 3ALOA 4WG4A 3WYXA 4IZ5A 1MP8A 3D7TB 3CJGA 4XHKB 3ZSIA 5ETAA 5JZJA 3FZPA 2C47A 3LJ2A 2VWIA 3P7BA 3VBYA 2Z60A 4RFMA 2A4LA 2VTQA 4PDOA 1YOMA 2C6EA 3P5JC 5CU2A 3GC0A 3O17A 4M13A 4WOVA 1OVEA 4YJTA 4YZ9A 2VO6A 3C50A 5CU4A 3LQ8A 2YERA 3VRZA 2CLXA 3BQRA 4QTEA 4FVPA 3R83A 4JG8A 4EK3A 1BKXA 2G2IA 5FLFA 4E26A 5T6KA 4AZFA 4IC7A 2R3FA 3I0OA 4ZTRA 5IQCA 4IANA 1WVXA 4PP9A 2EXMA 4NKAA 5HG5A 5AX9A 2RFDA 5EI6A 2PMNX 2PTKA 5LARA 3EN6A 1IR3A 5J5TA 5M44A 4E4XA 4DITA 1TQIA 4EWQA 4A9YA 2UZLA 4Y83A 3V5QA 3U51A 3KB7A 4PMMA 5BMSA 2X9FA 3L9LA 3KQ7A 3NLBA 4C2VA 2GDOA 2VTLA 3TNWA 4RZVA 4C59A 3RK9A 2B55A 1WBVA 3ZS5A 2VWBA 5HGIA 3QTUA 3ALNA 5HX6A 1MRVA 3A7FA 4QRCA 5FM3A 2VTIA 1A06A 3ZOSA 5I4NA 2Z02A 1JSTA 3GENA 3RM6A 4F7JA 2BAJA 4XP3A 3OEFX 3OD6X 2W1GA 3COIA 2W1FA 2QOKA 4O83A 2HXQA 2WMWA 4DN5A 4Q2AA 4FT0A 2QHNA 3L8VA 3TNHA 1OGYA 3FZ1A 2W17A 2HZ0A 2X4FA 3BGPA 3CGFA 3EN9A 3KF7A 4I5MA 4FT9A 4I4FA 5ANKA 3NCZA 4YZDA 3ZM9A 4WA9A 2C6IA 4JQ7A 5HIDA 1KOBA 2BMCA 2EB3A 2GQGA 1OKWA 1ZMWA 3IDPA 1OL2A 3CY2A 5FXRA 4IAIA 4WUNA 2J6MA 3F2NA 4FTOA 4PV0A 2J5FA 4D0WA 3O7LB 4FNXA 2H8HA 4OTIA 3GI3A 3HECA 4C7TA 3KCKA 2FO0A 4XH6A 4ACMA 4V01A 5AP2A 3QTWA 1PKGA 2IZTA 3ODYX 3LXPA 4DFZE 4ENXA 2XBJA 5GJDA 2HXLA 1XH8A 2CGXA 3GGFA 3FI4A 3O2MA 4I6QA 4GVAA 2XK3A 2BCJA 4QTCA 5D7VA 3HA6A 5EOBA 1OPLA 4ALWA 3A7JA 2VNYA 3G9LX 3F7WA 3A7IA 3C9WA 3GFWA 3NNUA 3PSCA 4HNFA 4FTCA 4QMXA 1H0WA 3F66A 3AMYA 4G3CA 3SRVA 5AUUA 2JDOA 3NFFB 4O7VA 3QRJA 4FV8A 2R3KA 3SOCA 2CNUA 2C0TA 5FGKA 2J51A 3THBA 5AV4A 5AR5A 2BFYA 2NO3A 3FJQE 2XF0A 4HNIA 2C5NA 3F3ZA 3O5AA 5M09A 2XALA 3OCBA 1OM1A 3GQLA 4AGDA 4OTFA 4ITJA 4X2KA 1SM2A 4Q5EA 3DY7A 4S31A 2XP2A 4ZAUA 4ZTSA 4GYIA 2WMTA 1IEPA 1WBNA 2BPMA 2O65A 3JXWA 3QUPA 5HTBA 5GINE 1I09A 4RX5A 4BZNA 3VS1A 4K77A 5FTGA 5BVNA 3W55A 5FTQA 3A61A 3FE3A 1IG1A 3PJ8A 4I22A 4AW5A 4LFIA 3MFTA 3OFMA 3H4JA 4EWHA 2E9VA 4H3QA 2VTPA 4GK2A 4C62A 4N57A 3PY1A 4H58A 1FVTA 3ORIA 4DEBA 3RPOA 3GU5A 4D2WA 4IZAA 4YC6A 5FQDC 1Y91A 4EUTA 5HICA 3L9PA 5L6PA 3C4CA 5L2SA 3E92A 1W83A 2OXXA 3PVUA 3JPVA 4OLIA 2ZV9A 3G51A 4FG8A 3BYUA 1KOAA 3CXWA 5EHOA 1UA2A 4M14A 3ODZX 4GFGA 3QTRA 2W1EA 4JDHA 4AF3A 4BWXA 4TT7A 3NS9A 5TE0A 1KUTA 5IQAA 3H3CA 2X1NA 1KE7A 5CSPA 1WVWA 4AN9A 4WBBB 4DBNA 4EOLA 4QMNA 1G3NA 3GUBA 3V8TA 4EK5A 3PIZA 5HIBA 4UMTA 2HENA 5CSWA 3QTZA 2XK4A 4I93A 4WNOA 3ZBFA 5FG8A 1CDKA 2GCDA 2UVXA 4BBMA 4CSVA 4O7WA 4RQKA 1MRYA 4KSPA 5CNNA 4O86A 3IDBA 3PG3A 2VTSA 3PPKA 5BNJA 2VTNA 4IBMA 2VZ6A 4NW6A 5DBXA 4PTEA 3WYYA 3R2BA 2UZTA 2EXEA 3OT3A 3VHKA 3QZFA 4O2PA 5FBNC 3HRBA 4CEGA 4FTQA 4ANBA 3LMGA 1ZYDA 4JG6A 3HEGA 3HRFA 2QLQA 4RJ4A 4ANMA 1Q97A 4IM2A 3KA0A 4KBKA 4D4YA 5J9YA 3PXKA 4ZSEA 3IK3A 4EH2A 3OWJA 4RGJA 2OF4A 4HGSA 4DGNA 3BL9A 1WCCA 4C02A 5HIEA 2WTJA 1YWNA 3SGCA 4BB4A 2OZAA 3IONA 4UZDA 4EH4A 3K5VA 5HHWA 4PDYA 3NIZA 1KE6A 3B8QA 3OY1A 1CKJA 3IDCA 4KBCA 3VNTA 4A7CA 1ZY4A 4FIEA 3V8WA 4WSQA 4DH1A 4EH6A 3CBLA 3TM0A 3LPBA 2JIUA 3LCDA 4C58A 4M84A 3DQWA 3L8PA 4HVHA 5TF9A 3P86A 2V5QA 3QZHA 1YHSA 3IS5A 2YEXA 3MA3A 3UIBA 1YI4A 1ZLTA 3HV5A 3PJ1A 4QT1A 3ZEWA 4ASXA 3MH3A 3GQIA 4P2KA 3UDBA 5A46A 5BQ0A 4A4XA 4IWPA 5GZAA 3OW3A 2NYAA 3HGKA 5F9EA 4GEOA 4MCVA 1HCKA 5HBHA 3LM0A 4AAAA 2V22A 2W4OA 4RWJA 4DTAA 2BDWA 3GU7A 4FX3A 4UMUA 4BHZA 4J71A 1XHAA 2C3LA 2LGCA 3DS6A 3NRMA 4EYJA 2OO8X 4BHNA 5BUIA 1U59A 5HBEA 4BCOA 5HBJA 5KO1A 4BBEA 3QUDA 3MPMA 5GJGA 2E9OA 4C33A 5E8TA 1UU9A 4B9DA 4EK8A 4F64A 2PVJA 2XKEA 3AQVA 4QD6A 4GK4A 4RVTA 4FOCA 3BE9A 2YWVA 4WD5A 3MPAA 4K2RA 3TZ9A 4I6LA 3MS9A 4F9CA 5IQGA 3AOXA 1GZKA 3H9FA 4CZTA 4H3PA 4O6EA 4NTTA 3BEGA 4I4EA 4RMZA 3FZOA 4RSSA 3FI8A 2WD1A 2WZJA 3S0OA 4RPVA 1ZYCA 2OSCA 3DAJA 5ETCA 5EYDA 3VUTA 4BTFA 2QD9A 4H39A 4FRFA 2ZJWA 1QPDA 2YLFA 3CP9A 3OUKA 4OTHA 4YJNA 3ZFXA 4NM5A 2W1HA 5F94A 1XO2B 4C3RA 2WMSA 4FNZA 4A9UA 2QKRA 4E6DA 4MYGA 4E7WA 1PY5A 1WVYA 2UVYA 4DE4A 3UGCA 4L8MA 2ZMCA 3OWLA 3PTGA 4Y73A 4KIKB 4OT5A 3TDVA 5LMKA 5EQEA 4QMQA 4U9AA 1F0QA 3MTFA 3CR0A 3DK3A 3EYGA 1XQZA 4MNFA 3ZSHA 4NSTA 4XG8A 5C03A 2HW7A 4PPAA 3BYSA 1BI8A 4CQGA 4QPMA 4CFMA 3II5A 4GVJA 4JR7A 4UWCA 1AQ1A 2A19B 4RIOA 3LXLA 3ORZA 5H9BA 3V04A 4BDJA 2XAMA 4EEVA 1PYEA 2YM3A 1Y6BA 1JKLA 4WIHA 3C1XA 4J99A 5IG1A 2OLCA 2X8IA 3RNIA 3PXFA 5HOAA 5M57A 2H96A 4J95A 4MAOA 3HZTA 3TWJA 4UV0A 3VQHA 2GS6A 5AAEA 4FGRA 4E73A 4MBJA 2ITUA 4JLCA 2A0CX 4CG8A 2X4ZA 2C4GA 2RG6A 2WELA 4IFCA 2XRWA 1YI6A 5TOZA 1KE5A 1OB3A 4TYEA 4NH1A 4PP7A 4UMRA 1ERKA 4O81A 4IAZA 1MQ4A 3FYKX 3DZOA 2FH9A 2ZM3A 4HCTA 2XIKA 5EYMA 3FLSA 2QC6A 5K0KA 3ZZEA 1R0EA 2XBAA 4E4NA 5EHYA 1YWVA 3NCGA 4G34A 3EN5A 4I0SA 3FLYA 3RPRA 4BGQA 4DHZA 2IW8A 4W4VA 4BGHA 4XBRA 4DFUA 3V5LA 2OKRA 3KRXA