4D55A

Focal adhesion kinase catalytic domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
260
Chain Sequence
RDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRYLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE
publication title Allosteric Regulation of Focal Adhesion Kinase by Pip2 and ATP.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 82
structure length 260
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d55A01
1DI8A 1Y8GA 2R3HA 4HVIA 2AUHA 4FZDB 4MXCA 2HW6A 2X2MA 4GH2A 4M0ZA 4ZP5A 3NX8A 3RAKA 1J91A 2JLDA 3PYYA 2ZMDA 4DH1A 4NZWB 4I0SA 4U40A 4D5KA 2JIVA 2GQGA 5M4FA 3GCSA 4PNIA 4O27B 2JKOA 1DI9A 4BGQA 3FQHA 4O96A 1H08A 3TACA 5C26A 3VF8A 2C5NA 2YIWA 4O84A 4UY9A 3KK9A 4DGLC 3HEGA 4Y95A 2GFSA 4IVBA 4DEDA 2Q0BA 3F2RA 2IW6A 3R04A 4O7LA 2O3PA 3GC8A 3RK5A 3PA3A 5BUEA 4GG7A 1OUKA 2VTMA 1Y6AA 3QQKA 3FAAA 5C01A 2G01A 4OT6A 2CLXA 5E1SA 2WTKB 3DKCA 4RC4A 3RINA 2XKDA 2YA9A 4IX5A 4JRNA 2VTJA 2QR8A 4O21A 3DAKA 3O8TA 3QD3A 5FXSA 2BRMA 3PLAE 4ZY5A 5I9XA 3UOJA 2VWIA 1CM8A 2C4GA 2QO9A 3F5PA 1DAYA 5C8NA 3F3TA 2QURA 5DE2A 5TT7A 2XNEA 3FUPA 4EKLA 3DLZA 2WHBA 3FPQA 4Z3VA 4HVGA 4HGLA 2YDKA 3NW6A 4C4GA 2OFUA 4A4XA 3PWDA 5KKRB 4PDYA 4D0XA 2CGVA 4FICA 4F9WA 1FVVA 2OH0E 3VUDA 5A54A 2BILB 4KKHA 1R39A 3QKMA 3UIBA 3GVUA 3KF7A 1QPEA 4DEEA 2XBAA 4MBJA 3OCGA 4YJUA 2OFVA 4FT3A 3AMAA 1WBOA 2OIQA 3PZHA 4M97A 5HIDA 4C02A 3E3BX 4H05A 5AWMA 1KE7A 1WBNA 5AR3A 4CVAA 1GZKA 1F5QA 4TYGA 2IJMA 4C37A 3BPRA 1WCCA 4RVKA 2F49A 4TRLA 4JG7A 4II5A 5CF8A 3SGCA 5IPJA 3DTCA 5AP6A 2NRYA 4GUBA 5JFXA 4BDCA 2PUIA 4FV5A 5AM7A 3IGOA 4HJOA 3FZ1A 4FKPA 1JSVA 2R3NA 2J0MB 1P2AA 3MPTA 3COMA 1NA7A 2XMYA 4O2ZA 4DYMA 4IAKA 4GG5A 2R0UA 4FTOA 3D7TB 4FYNA 2QO2A 4ZTMA 2ZV9A 2ZM1A 3I60A 2O65A 3ACJA 4I93A 4PPAA 2F2CB 3PP1A 2GS6A 3UBDA 5E8ZA 4C2WA 2VWZA 4ZIMA 3VUTA 1PXLA 5HG5A 1NVSA 4BWPA 3KEXA 1BX6A 1ATPE 3NAYA 4A06A 3DQXA 3GXLA 4GIHA 4D4VA 1XH8A 4G6OA 5AV1A 2EUFB 5EM8A 3THBA 3ZH8A 2VO6A 2WQMA 2R3JA 1XBAA 4J8MA 3RGFA 1H1PA 4FTJA 3GC9A 5IDNA 2XKFA 4ZAUA 1UV5A 4QQTA 3R7OA 2BMCA 3PP0A 5BVFA 1P4OA 5E8UA 4OTPA 4AX8A 4EWHA 3LMHA 2I0YA 2IZRA 3BHYA 3TZ8A 3TDVA 5HBEA 2XK9A 2RFNA 4F65A 2JDTA 2HXLA 4JJRA 4U79A 3BRBA 3Q9ZA 3NZ0A 3A8WA 2EVAA 4YGAA 3F3UA 4CD0A 1OBGA 5AAFA 3QF9A 5EM7A 4I3ZA 4OTIA 5LVLA 3WOWA 4YR8A 5AA9A 3JY9A 3R22A 2UW9A 2OO8X 2EWAA 1H07A 4RVLA 2JD5A 5CU2A 4CTBA 3D14A 5D9HA 2WTWA 3SAYA 4YJNA 2YLFA 4PDOA 5EHLA 5EHOA 4C0TA 5LVNA 2C5YA 4E6DA 4LL5A 2FA2A 5GZ8A 3KXNA 3FLNC 5CAUA 3CQUA 2PL0A 3FQSA 5H8BA 4YU2A 1FGKA 2R3FA 5D1JA 1IEPA 2VWYA 3AD4A 3H9FA 3UG1A 3DK6A 3ACKA 1PXIA 4EBVA 3OBJA 1XH7A 3LFAA 4CV9A 3NVKI 3W2CA 2H8HA 3GOKA 4O1OA 3BKBA 2VTHA 5FWKK 3RAHA 4L52A 4JRVA 5FEDA 4Q9ZA 3R6XA 5M4UA 3CJGA 3FYJX 3KRJA 4DLJA 3TL8A 1GZ8A 3V8SA 3CGFA 2FSTX 3FXXA 5CU4A 4R5SA 1L8TA 5DRDA 2JDSA 2YIYA 3CSVA 4XMOA 2G15A 5AR2A 3NSZA 4UMPA 2ERKA 4G3CA 4FTKA 3R0TA 4Z9LA 2PK9A 5HVJA 3SRVB 3OTVA 2WTVA 3QYWA 3OHTA 4LGDA 1XH9A 1XR1A 1TVOA 2XIKA 1V1KA 4FNWA 4QYEA 2XIXA 2DYLA 4IWDA 4WBBB 3W2RA 4EHZA 3E88A 5JFSA 3WF8A 5F94A 4ZY6A 3BV3A 3WF9A 2IW9A 3S2PA 5L6PA 3GU6A 5AX9A 5ANIA 1YI3A 3CPCA 5HORA 5JRSA 4D9TA 2OK1A 4DFZE 3D94A 3U4UA 5LMBA 1WBVA 3LCTA 4GK4A 1GIIA 1OIRA 4XG4A 4YC6A 4R1YA 5IH5A 1JSTA 3QKLA 1M2PA 5AP3A 5I3OA 4A9SA 2WQBA 3R1YA 2VNYA 4UYNA 3ZUTA 2QOKA 3NAXA 3JY0A 5J5SA 1ZOEA 2RF9A 5KNJA 4WBOA 3C5UA 3PG3A 2QLUA 3R63A 3BU5A 3QYZA 4KD1A 2PZPA 2F2UA 4DEAA 3D5XA 1VZOA 2G2IA 2W1DA 3GI3A 4R3CA 3ZUVA 3Q6UA 3TJCA 4CXAA 4FKVA 2X8EA 3OT3A 4KSQA 3V01A 4FSNA 4C3RA 4HCTA 5HNGA 4CKRA 2XK3A 2GS2A 3WBLA 2Y4IC 4R78A 1LP4A 3DAEA 4EI4A 2Z8CA 1X8BA 4X0MA 3MS9A 5FEQA 2Z7LA 4FSUA 1YKRA 4JS8A 3DJ7A 3FQEA 1Q8TA 4ONAA 2IG7A 4GIIA 4AN2A 4XOYA 3TKIA 4QMOA 3K54A 3UYTA 4FIGA 3DK3A 4X2GA 4GVJA 4EOJA 4CQEA 2YAKA 5TF9A 1GY3A 2W4OA 3VS3A 1CKIA 4M15A 4C34A 4CCUA 2IPXA 1WAKA 3MIYA 4XG7A 4BDDA 5EOBA 5A6OA 4DGOA 2F57A 2J50A 1YI6A 5AR5A 4RJ6A 3R2BA 3HP5A 3LM0A 2GNHA 4NH1A 5TO8A 2WTIA 3LLTA 4FTMA 4WUAA 4HVSA 4ACDA 2EXCX 4R3RA 1W7HA 3L9MA 4JNWA 4F4PA 4BDHA 5AUVA 4X3FC 5IU2A 4JDIA 3EQGA 1H0VA 3VUGA 5FUTA 1TQPA 2ETMA 2AC3A 5AP1A 2J0JA 4MAOA 4RWJA 3TV6A 3VBXA 4IH8A 4O7RA 1H01A 3MH0A 4O22A 5JK3A 2BHEA 4LMNA 4AGDA 2GQSA 4CZYB 2ZMCA 2YN8A 3FMNA 5D41A 2H6DA 2VTTA 2PYWA 5KMIA 3CQWA 3PVWA 4TWNA 1MRYA 3LKMA 4IM2A 2C6LA 1T46A 3LFQA 3EQCA 1WZYA 4TYEA 4C8BA 4CFMA 3LFNA 4F1OA 2QOLA 1KE9A 3ORMA 4I94A 4WNMA 2NRUA 4RJ4A 5EI8A 1OUYA 2YM8A 3SXRA 3TZ7A 4JVGA 4FV3A 4WD5A 2DS1A 2P55A 3TV7A 3NWWA 4D5HA 4E6QA 5KMKA 5AADA 2Y4IB 4XV9A 2OICA 3SA0A 3VQHA 2XK6A 3TKUA 1K3AA 5FBOA 4BCIA 3ZDUA 4BTJA 3K5VA 4QMTA 3U51A 3R83A 3OCSA 3WI6A 2P3GX 4RIXA 3MY1A 3HX4A 5EKNA 5A9UA 1GOLA 4FSYA 5KMLA 5CVHA 5DMZA 5J8IA 3COIA 4ZEGA 3NLBA 4C62A 4FEVA 1ZMVA 2XK7A 3V8TA 2OJFE 3UMXA 5HE2A 5M53A 3DFAA 5AUXA 4CRSA 4E4MA 1J7LA 3KA0A 2XH5A 3GFEA 2BZIB 2LAVA 2WQOA 1H1WA 5FTQA 3R8LA 3CS9A 2F7ZE 5HI2A 3RPSA 3R1QA 1VJYA 3CC6A 4WRGA 2W1EA 4V0GA 4N57A 3GU5A 3RHXA 2KTYA 1G8SA 4XH6A 4GYIA 3GQIA 3QTUA 2W1HA 5E90A 3GC0A 4FEWA 5IA1A 4CMOA 4YTFA 2ZDUA 3W16A 5I9UA 3BYOA 3ZTXA 4QNAA 4EOMA 4EH6A 4H3PA 2V5QA 4NFNA 4O82A 5AP2A 3O50A 2A4LA 3DKFA 4IC7A 3EQHA 3TTIA 4TL0A 4WA9A 1PXOA 3HL7A 3R01A 3EYHA 2IO6A 3RBWA 2Z02A 1ZZ2A 4CYJA 4L3JA 4EH2A 4L9IA 5AX3A 2DQ7X 4XS2A 2J0IA 1REKA 3PY3A 2HOGA 3E8CA 4FV9A 1P14A 4IVDA 4N70A 4PTCA 4F99A 4KAOA 3KRLA 3QLGA 2XNPA 4ITHA 5H8EA 4FG7A 5AV2A 3VBTA 3R00A 2WEIA 3F3VA 3I0OA 3RI1A 3U9NA 3QLFA 4O1PA 2OJJA 5GIOE 4FMQA 3FKOA 4C4EA 2FSMX 3RWPA 4PMTA 3ZXTA 5J9ZA 2BVAA 4FKIA 4ZJJA 1IG1A 2WNTA 5JGDA 2C3IB 4XEYA 2YCRA 3P78A 5FD2A 3CPBA 3V5PA 5JSMA 5DN3A 4UMQA 3ZSHA 1ZYDA 3A4PA 4EZ3A 4EQUA 5C1QB 5CY3A 4A9RA 2VV9A 5FLFA 5KBQA 3HAVA 3OXIA 2BTRA 3E87A 4DC2A 1JQHA 5J9LA 3PSDA 4WHZA 3HLLA 5HICA 4UXLA 3ROCA 4U44A 4DEIA 4WUNA 4FL3A 3E7OA 4ANQA 4FTIA 3R02A 5J79A 3FEGA 2ONLA 4QQ5A 4YNOA 2EB3A 3KRRA 3HMIA 3IW4A 3UNJA 4C61A 3NUYA 3ATSA 3OVVA 4JAJA 4ACHA 4ALWA 5EQPA 4Z7HA 4ZSEA 4IAZA 1OM1A 2JAVA 3EKNA 4TKSA 4FOBA 4LI5A 1NVQA 4C4IA 4NM5A 2X7GA 4V05A 2WIPA 4YMJA 2PUPA 4I24A 2UV2A 3BLHA 5IA2A 5C8MA 3SG9A 1Q4LA 2C6TA 2QD9A 4KBAA 4FKJA 5CEQA 3ORLA 3CY2A 3WZJA 4IDVA 4U80A 3W2QA 3VN9A 3LJ0A 4EK3A 2BDJA 2UW7A 4DEGA 5JRQA 4QMUA 1FMKA 3FMHA 3DT1A 4HZSA 3P4KA 3OC1A 1OIYA 3AC4A 4V01A 2GMXA 3MTFA 4MF0A 1G3NA 3P7CA 3BHHA 3IPHA 4YHFA 4BDEA 3POZA 2GTMA 2QOOA 3FV8A 4TT7A 2V55A 3QCQA 2VN9A 3UOHA 4ALVA 5I5ZA 4LRMA 3NUPA 4G9CA 1W0XC 3QZFA 4QP1A 1JSUA 2QNJA 5D11A 4EC8A 4G5PA 4FG8A 4LM5A 3T3UA 2YIQA 3KVXA 4O2PA 3D5UA 3QCYA 2C3KA 4NIFB 2OJ9A 4AUAA 3H0YA 2X39A 3M2WA 1I09A 3BQCA 4F7JA 1FOTA 2WMSA 4IFCA 4FG9A 3G9LX 4P7EA 5HG7A 4I6HA 4IACA 4DLIA 4LV5A 2OXDA 4TN6A 5JGBA 2J7TA 4HYUA 2BHHA 5FGKA 3EN6A 2PMNX 4MXAA 4GS6A 3QZHA 2YDIA 2CDZA 3DLSA 4KSPA 4XCUA 3W10A 5LMAA 4UMTA 3VJNA 2XJ0A 4FA2A 1R0PA 4DT9A 2QOQA 5ACKA 3U6HA 5FXQA 5CAOA 5C27A 5DR2A 1XKKA 2XS0A 1VYZA 4L7SA 2RIOA 3HDNA 2UZDA 3FLWA 5EYDA 1O6LA 4LOPA 4XOZA 3HV3A 4PTGA 2VO3A 2C47A 5LWNA 1O9UA 3UQGA 2GQRA 5DEWA 4CV8A 3PJ3A 4IB0A 3V8WA 4AE9A 4FODA 4O0WA 4MVFA 4C33A 2PWLA 3DOGA 2OZOA 4DBXA 1Q8UA 2WB8A 3ALNA 4WT6A 4CFWA 4D1XA 2QODA 5GHVA 4MH7A 4BHZA 4FVRA 2BZKB 2UZTA 3A8XA 3K3JA 2X6EA 4EK4A 5M09A 5HE0A 5JH6A 4HNIA 4BCPA 5CEOA 3MPAA 3ANRA 1DM2A 1W83A 3QTZA 3FI8A 2J0KA 5H3QA 5DLSA 4XBRA 3RPVA 4CFXA 5ACBC 4C36A 4X2JA 4BCHA 2GPHA 3UQCA 5I4NA 4X2FA 3C1XA 4EH8A 3NDMA 2WQEA 4AT5A 3EIDA 1K9AA 2ZV2A 3QXPA 2VX0A 4EOIA 2BFXA 2YM3A 5HESA 4UX9A 4BCOA 3ZSGA 5E8TA 4UN0C 4CTCA 5CU0A 5HBJA 2C6OA 4XRLA 3TI1A 3EFWA 3AXWA 5I9ZA 4U7ZA 3RNIA 4O91A 5EHYA 2BKKA 5B2LA 4R1VA 3CKXA 3QQFA 4DCAA 4GT5A 5DOSA 3EL8A 4L6QA 5E8XA 4KABA 1OL2A 4KIQA 4D2RA 5ITAA 3EZVA 4FIIA 4C35A 4AGUA 2ZAZA 3R2YA 2UW5A 3QXOA 3LQ8A 4RFZA 4YBKA 1QPDA 3F9NA 3BBTB 5ETIA 3W33A 3PUPA 4QOXA 4BZDA 4RLLA 1OZ1A 4AA0A 1XHAA 5BYZA 4BL1A 3DBFA 4PUZA 3W1FA 3GUBA 4XYFA 3UVQA 1JBPE 4D28A 3CTHA 5L2QA 2EB2A 3PRFA 2ZV8A 4JOAA 3UO5A 1PXJA 3KCKA 3SVVA 2ITXA 2XA4A 3QA0A 3W8LA 4AFJA 4FKRA 4LYNA 4RIYB 4YLLA 4FIFA 4IB1A 5J7HA 4NCTA 3PRIA 3R8ZA 1H0WA 4BI1A 2QOFA 3R71A 5AP7A 2C5VA 3TN8A 4KIOA 4EK8A 2ZB1A 1BKXA 2O64A 2C68A 1BLXA 3PXKA 5A4EA 3RZBA 3DCVA 3GEQA 3R8VA 1JKSA 3AT3A 3HVCA 3Q52A 4IZAA 2R0IA 2HCKA 4IAAA 2OU7A 2UZOA 3AC1A 4PL3A 2BDWA 4DE4A 3FSFA 3GP0A 4DFUA 4ORKA 1RE8A 2XYUA 3P7BA 4WG3A 3VNTA 2BTSA 2W1FA 5H8GA 4BCJA 2CCHA 4RVMA 5FTGA 3MYGA 1YRPA 4KWPA 1FMOE 2XIYA 2C5XA 3TZ9A 3NUSA 4JBOA 3FZSA 3OWLA 1QPJA 4LV8A 4BBEA 2AC5A 4IDTA 4O0SA 4L53A 2E9OA 1GZOA 3A7IA 5HEZA 4BFMA 3F5GA 5C8KA 3ATTA 4YP8A 2BAQA 2ITYA 1XH5A 2JAMA 2OIBA 2CKQA 3ENHA 4RMZA 3QQGA 4CLIA 3U8WA 4LUDA 5BYYA 3UVPA 4DEBA 3OROA 4ANOA 4X2KA 3DJ6A 5L8KA 4RX7A 3DTWA 4QMPA 4G34A 4RA5A 1H00A 4HZRA 3C13A 5ANKA 5H9BA 2RL5A 1UVRA 3E3PA 1BI8A 1HCKA 4QRCA 3DBQA 3D15A 3VS4A 4ASDA 3G9NA 3LFSA 3PDTA 4QQCA 5BPYA 4O81A 1R0EA 3KF4A 2JDVA 3OEZA 4EH4A 3BELA 3D7TA 1AD5A 3DFCB 3PA5A 2Z7QA 4LQMA 2VGPA 3A7GA 3BE2A 4JDHA 5FM3A 3VBQA 5ANGA 5BMSA 3A4OX 3FY0A 4BIBA 3DB8A 3UZRA 1V0PA 4RA4A 4O0XA 4PMMA 4NW5A 4USEA 4IEBA 3LAUA 4ZTRA 1UWHA 4H3QA 4DFYA 5LJJA 3U6IA 4ANSA 3E7VA 3DA6A 3ZLSA 1FINA 2C6IA 3UODA 3EQDA 2Z60A 1V0OA 4GUEA 4A9YA 4C59A 5IA3A 3KU2A 3FMKA 3LVPA 3VW8A 3WZKA 4DITA 5C4KA 4F0FA 4MXZA 2VWBA 4QO9A 3R9RA 3DBCA 1MQ4A 3EN5A 4QP6A 4W4VA 5BQ0A 5JQ5A 3A60A 3QX2A 3ZFYA 4JG6A 4E7WA 2BRHA 2XZSA 4FEXA 4JDJA 2QOIA 4KRCA 2C3JA 2V7OA 2W5AA 4KNBA 4IANA 3UDBA 4HGEA 4IE9A 4DFNA 4O7NA 4LFIA 4YPDA 4YJVA 2HZIA 4EH9A 4FF8A 4D2WA 1EH4A 1AGWA 3ERKA 2Y4PA 5L8JA 3W2OA 3T9TA 1IRKA 3NYOA 1NY3A 3ZFXA 4J95A 2FH9A 5CLPA 3OOMA 4KBKA 4FKLA 4J52A 2UUEA 3QRTA 4M8TA 3AD5A 3LFCA 4F0IA 4ZMFA 3G6HA 1ZLTA 4BF2A 1H24A 2JEDA 2H96A 3KQ7A 3Q60A 3U87A 5L8LA 5LQFA 4R7BA 3KULA 3FZTA 3ZZWA 1PMNA 5D7AA 2PVJA 2QLQA 5L2TA 2HWOA 5K9IA 5CEMA 2ETKA 5IQEA 3PZEA 3BLQA 2PU8A 1BL6A 3OMVA 3QQUA 1J1CA 2BALA 2ERZE 3QGYA 5CZIA 3VBVA 3O8PA 4BGGA 1YDSE 2ZVAA 5E7RA 3RAIA 3W32A 2ZB0A 3KCFA 5CNOA 1PY5A 2F7EE 3OWJA 5DHJA 3ZMMA 4AN9A 3ETAA 5IQAA 2OW3A 3C9WA 3DAJA 5CVGA 3FC1X 3G5DA 3MB7A 5F4NA 4EZ7A 4CKIA 3ID6C 3I6UA 1OI9A 1KOBA 3UVRA 2PVRA 3DKGA 3JS2A 4TPTA 2PHKA 5DI1A 4BTKA 5BNJA 4MD9E 3SKCA 4EH7A 1OL5A 2YERA 3TWJA 5CAPA 4I41A 3LCOA 2R5TA 4YJSA 2PE1A 3W2SA 5HBHA 5BVWA 3TUCA 4R3PA 5J87A 3RP9A 3SRVA 1URCA 5I0BA 5IA0A 2QKRA 3AC8A 1ZYLA 3D2KA 1L3RE 5C9CA 3LM5A 3R9DA 3EQIA 2WTCA 2B9FA 4E26A 2NNWB 3ORPA 1P4FA 4NKAA 3ZEWA 3QQJA 4C7TA 4AQCA 2W17A 3GENA 5JZJA 1SYKA 3F61A 3VS5A 4L43A 4EK6A 2X4FA 3R7GA 5CS6A 3VC4A 2FVDA 5EW8A 3ROYA 4IJ9A 4JDKA 3OW4A 3WARA 5ETFA 3E62A 4M14A 5LWMA 2BIKB 4MNEB 3I6WA 1HOWA 4H39A 3RJCA 3ZC6A 4U3YA 4GMYA 5DH3A 4I0RA 4CFFA 4CGAA 1P5EA 3KMMA 3MN3A 5HKMA 1U54B 2HXQA 2PVHA 4TZRA 4AW0A 3MESA 4O7ZA 2IVUA 3FLQA 3IW8A 4Y5QA 3U6JA 3NUXA 3LE6A 2OGVA 5FEEA 1OL7A 5M55A 2YHVA 3ZEPA 4EOPA 3FDNA 5HVKA 2RFEA 4ZTQA 3R21A 3RPYA 4M12A 3COHA 4JT3A 1WFCA 5CYIA 3ZM9A 3Q2MA 4RJ7A 4F1MA 3IW5A 3K3IA 4IQ6A 3KL8A 4RJ5A 3JUHA 4YJQA 5ANOA 5AV3A 4BDGA 4DG2E 1UNGA 2CPKE 4QTEA 5HO7A 4J97A 3MSSA 2HZNA 2XCHA 4EH5A 4IZ5A 4Y85A 3L8PA 3ZU7A 3NRMA 2JDRA 2YCFA 4AGWA 4EZ5A 1YOMA 4M69B 3UP2A 5CEIA 2OBJA 1G5SA 2JFLA 3I79A 3MI9A 3FL4A 4UBAA 4UMRA 3AMYA 3FSKA 5CSPA 2VO0A 3FZOA 4HGTA 4CMUA 2UW0A 5L2SA 1YXSA 4R6VA 4XV3A 4CRLA 2DUVA 5HTBA 4J99A 5BMMA 2XBJA 1PXPA 4NM0A 3NCGA 3P7AA 1Q8WA 3E8DA 2CN8A 1VYWA 3AMBA 4B0GA 4U81A 1NXKA 4NTSA 3F2NA 3WF6A 3MVLA 3QA8A 3BI6A 3PVUA 5HOAA 5IEXA 5JFVA 4DT8A 5K0KA 4RPVA 5TR6A 4CQGA 4JBQA 2EXMA 5L3AA 2V0DA 3PWYA 2X7FA 3C4FA 4FL2A 4JX7A 4O7VA 4LMUA 5CAVA 4AZTA 4U3ZA 3ZYAA 3HGKA 2HZ0A 2VZ6A 5AP5A 4NW6A 3UE4A 3P1AA 5LCJA 4DTKA 3DZOA 3GCQA 2ZDTA 3HV7A 4B8MA 5IA4A 3RK9A 3BGQA 2PVMA 4HPUE 4XBUA 5CT0A 4BWKA 5CSXA 4BB4A 3TT0A 4PP7A 1UA2A 5T68A 2E9UA 1LEWA 2HK5A 5FP5A 2JKKA 3TDWA 5LXMA 4MWHA 2QCSA 2OG8A 2WMTA 3DBEA 4O0YA 4P5ZA 4BICA 5M08A 4Q5HA 4FZ6A 4LUEA 3NUNA 3WZEA 3AT4A 2W4KA 4H1JA 5JGAA 3R73A 4AS0A 3ZRKA 4YTCA 3MY5A 4IM0A 3PXFA 4RBLA 3FY2A 5J1WA 3LFEA 1WBWA 1ZMUA 4L8MA 3MA3A 1UU7A 3KN5A 3MBLA 3GU8A 4FIJA 3ZLWA 2WXVA 4PPBA 3R8UA 4CFVA 5CF6A 4MXOA 5CXHA 1U59A 4HVDA 1Z5MA 4Z55A 3HAMA 2YEXA 3RALA 3BYVA 3ZC5A 4QMZA 4ANMA 4FV2A 4X3FA 4BR3A 5E8SA 3TNPC 1XQZA 3FI3A 2XEYA 1YDTE 3OBGA 1YXTA 2VAGA 4MYGA 2VGOA 1JOWB 2YM4A 3QD4A 3VS7A 4CFNA 3UZTA 3VVHA 3R7IA 4WOVA 5F20A 3OWPA 1Q62A 2YDJA 5B7VA 4ZS4A 2W4JA 3QD0A 4MNFA 5EDPA 5AR4A 2YM6A 2PZ5A 3Q5ZA 2GS7A 2X7OA 4WO5A 2VX1A 3QUEA 3DJ5A 4QP7A 3S0OA 4RWIA 2R64A 3AQVA 3DPKA 3TNWA 4EOOA 4JR7A 3K5UA 2WMBA 2YIRA 4RIWB 4XRJA 4AA4A 2RFDA 4YBJA 4BBFA 5B2MA 1QPCA 3H4JA 1Q61A 4JR3A 4D58A 4QTDA 5CEKA 1M2RA 3C7QA 4ZTNA 4EWQA 3F7ZA 2I1MA 2XKCA 2J90A 2WU7A 4I6FA 3VBYA 1JAMA 4C2VA 3RMFA 3ULIA 4D1ZA 4MBIA 4G16A 3FMDA 3VHEA 1OBDA 1APME 5BVDA 3QQHA 4MD8E 2FSOX 5M57A 4GFGA 4IX4A 3ENMA 5AUUA 1PXMA 4AZWA 3R28A 4FIEA 5DGZA 4M13A 4YSJA 2QHNA 3FHRA 5AV4A 5DR6A 3O7LB 2QOBA 4IX3A 4AACA 1YDRE 5HLNA 2RG5A 2Y7JA 3PPJA 2CKPA 5L2WA 3O71A 2CGXA 2GSFA 2BPMA 4GJ3A 4K6ZA 2VX3A 2XK4A 3KXHA 4FTTA 4BVUA 4YJTA 5CWZA 4FOCA 3LCSA 3LCDA 2BAKA 4PL4A 3RWQA 2I7QA 5CT7A 5HLWA 2IN6A 3KRXA 2OSCA 5EH0A 1O6YA 4BCFA 3PJCA 4AF3A 3D5WA 2WGJA 2B9JA 1G8AA 2HY0A 3VAPA 3PJ2A 4FTUA 5AEPA 1KWPA 1M7QA 1LEZA 3OTUA 2O5KA 4FTCA 3VHKA 5HIEA 5HQ0A 2YJSA 1IAHA 3C4CA 5K5NA 3K2LA 5HG9A 4ZLZA 2W1ZA 4FSTA 3QWKA 5EW3A 2CNVA 4DA5A 1XWSA 2Y0AA 4JI9A 4TWOA 2IVSA 2VTSA 5CNNA 4IFGA 4YZMA 5KMNA 3VULA 4Y83A 5IISA 3G0EA 4HCUA 3QTIA 5BVNA 4R5YA 4FNXA 1OVEA 2VTPA 3P9JA 4K2RA 5CXZA 2A2AA 2YISA 1PXKA 2LGCA 1JNKA 3EB0A 3S3IA 4YJPA 3TUBA 4DTAA 2WTJA 4LRJA 3QCSA 1JPAA 1ZWSA 4ZSGA 3IDBA 5HCZA 3UIUA 4NIFA 2X2LA 2RG6A 4FTAA 4H3BA 4NJ3A 3VW6A 4FC0A 4CCBA 1PW2A 4AXAA 1QL6A 4FT7A 2GDOA 4XG8A 3VIDA 1GJOA 3HMMA 4IXPA 5E1EA 4F6SA 4X21A 3LMIA 3HP2A 4WIHA 5CSVA 3MH1A 3GGFA 4RX9A 5CF4A 1M17A 3GCVA 4JIKA 3EFLA 3RM7A 4ENYA 3QTWA 3PJ1A 4W8DA 1MRVA 4W4YA 3BHTA 4QYYA 3CD8A 3BV2A 3N9XA 2BDFA 3CR0A 5D7VA 1Q8YA 3MVJA 4RIOA 5DR9A 5JFWA 2BRBA 5ETAA 4BDKA 3IG7A 3BLRA 1RQQA 3DY7A 4OTWA 3NIZA 5KHXA 3KXMA 4HNFA 3WF7A 3OY3A 4WNPA 4B6LA 1OPKA 2IVVA 5ANEA 4WG4A 4IX6A 4BDBA 3WF5A 1DS5A 2UZLA 4M68A 4MKCA 3FL5A 3O96A 3OS3A 4N6YA 3ZLYA 4XJ0A 4Z16A 3HA8A 4DH7A 1M2QA 3LPBA 2VTIA 3D2IA 3FMEA 5HLPA 3ZO4A 4QP2A 3L9PA 3V5JA 4FSZA 5EQEA 4F63A 4U8ZA 1XH4A 4I4EA 3HV5A 1A9UA 3BYMA 4Y46A 1R3CA 3LXNA 3VUKA 1XO2B 1YVJA 4N0SA 3JYAA 4YZDA 3C0GA 3UC4A 4APCA 5BVOA 4ASZA 2R9SA 2QOCA 3WE4A 3EMGA 4NL0A 3R8MA 3HRBA 4IAYA 3DV3A 5C4LA 4AAAA 4CZTA 3G51A 1XBBA 3E93A 2YWPA 3F66A 3JPVA 4FKWA 3UPZA 1OIQA 4KS7A 1FQ1B 2BIYA 3C0HA 1U4DA 5AUWA 1Y6BA 3LFDA 1ZYCA 4RT7A 3PIYA 3A2CA 5BVKA 3MPMA 4XNEA 3QTSA 1R78A 3UG2A 1NT2A 3EFJA 4L3LA 5KMMA 4ASEA 1SNXA 3U4WA 5IQBA 5A6NA 4NEUA 3BHUA 2E9VA 4Y73A 5EQYA 3QKKA 3HECA 5D12A 2XP2A 3M1SA 3MVMA 4FYOA 4FTNA 4D55A 3KREA 1JKKA 2Y6OA 2YAAA 3EFKA 4OT5A 4L00A 4RX5A 3IDCA 2Z7RA 4XLVA 4FZ7A 1ZYJA 3SLSA 2GNJA 2QVSE 3Q4ZA 1ZY4A 1TKIA 3HRFA 5AP0A 3UJGA 5EKOA 4QTAA 4D2PA 5DFPA 3LW0A 2WMUA 2BKZA 2BZHB 3R30A 1BMKA 2C1BA 2UVZA 4TWCA 5EYCA 4A7CA 2VNWA 3E8EA 2YZLA 4YZ9A 3PVGA 5E9EA 2WU6A 5K4JA 4HYIA 4EC9A 3NR9A 4QMQA 1J3HA 1UKHA 1B6CB 5FDXA 2C6MA 3ZO3A 3NUUA 1I44A 3O17A 4BHNA 3I1AA 5G1XA 5IZFA 3AGMA 3FMMA 5DWRA 4RIYA 1U5QA 4DG0E 4ERWA 5CTPA 1H25A 4HYSA 4HCVA 4MF1A 4XUFA 3O23A 4S32A 5EK7A 2I0VA 1ZYSA 4QTCA 1MUOA 3NNUA 3IO7A 3CTJA 3F3ZA 4FKTA 3RAWA 4ANLA 2F9GA 2E2BA 5IQHA 1J7IA 4B7TA 3QCXA 4OTQA 2ESMA 3HNGA 4BGHA 4E8AA 2CSNA 4NYEA 3LFFA 3QZGA 2VO7A 3BWJA 4N4SA 4X6RA 3BIZA 1BYGA 2PY3A 5J7BA 3BWFA 1Z9XA 2J0LA 4N6ZA 3BYUA 2FYSA 4RWLA 3D7ZA 3JXWA 3JR1A 4RWKA 4E6CA 4DINA 4K33A 3FXWA 4RQKA 4EQMA 4RZVA 3KB7A 4A9TA 3UTOA 2RGPA 2XK8A 2I40A 4M67A 3C4XA 4QMYA 3RM6A 2XIZA 3FZPA 3ZS5A 4APPA 1KOAA 5JMSA 4U0IA 4JIAA 3WILA 2UZVA 4I5PA 4O0UA 4GW8A 4EBWA 4QYHA 2R3KA 4YO6A 4NFMA 3BBWA 5AIRA 2XVDA 2PVLA 3UYSA 4G6LA 2XJ2A 4IWQA 2HENA 1MP8A 3I0QA 3NS9A 3R7YA 4IWPA 5HG8A 4RVTA 1IAJA 4S33A 4P90A 3F88A 3OF0A 4JLCA 3HA6A 4UB7A 5F1ZA 3R9NA 1IASA 3AG9A 2R7BA 3II5A 4AW5A 1LUFA 5KMOA 3MTLA 3T8OA 3SC1A 4I20A 3WZUA 5LVOA 4QMLA 3P0MA 4QP8A 5A4CA 4WSQA 2QC6A 4CKJA 1GZNA 3B8RA 1H27A 4IB5A 4I22A 4I5CA 5CASA 3VF9A 4NM3A 1ERKA 4F6WA 2A1AB 4O6LA 2XNGA 4PV0A 5A46A 5BUIA 2BFYA 3MDYA 4G17A 4E4XA 4YLJA 3U55A 5HCYA 2VTNA 2RFSA 3H9RA 2ITUA 4IZ7A 4QMMA 4QMWA 1OGUA 1OL6A 3R7VA 3QC9A 3VBWA 5E8WA 3T3VA 1YWNA 2BR1A 4GT3A 3VUHA 4XG2A 2P33A 4MTAA 4L68A 3SHEA 4IHPA 4F70A 1GNGA 5IEVA 2BAJA 1PKDA 1WVXA 5FRIA 5EI6A 4OTGA 2A27A 4FEQA 2J51A 2JGZA 5EDQA 3ZBXA 4Z7GA 3Q53A 3TTJA 4G6NA 1Q5KA 3OD6X 3HUCA 4UZDA 1YW2A 2O63A 2XM8A 3LZBA 5I3RA 3R7UA 4K77A 5HNBA 1XJDA 3ORXA 4YC8A 3EL7A 1K2PA 3CBLA 4EOLA 2IZTA 4FKSA 2CCIA 2ZYBA 4AZFA 4GU9A 4LL0A 2HW7A 1PMUA 2O2UA 4A4LA 4AN3A 5M56A 3ZRMA 3N51A 3VO3A 3HV6A 4IAIA 3L8XA 3MJ1A 4PMPA 1R1WA 2I0EA 4ZY4A 4QNYA 2XNMA 4PQNA 4C57A 3PE1A 1BL7A 3BGZA 1U5RA 3IGGA 1IR3A 3PTGA 4KIPA 4OW8A 3FWQA 4PP9A 4BKJA 3PXYA 1SVHA 2XNOA 3EQBA 3C4WA 2C6DA 4PRJA 3W55A 4F7LA 1QCFA 2QHMA 4O6EA 4YLKA 5TKDA 3C50A 2CNUA 1PRYA 3FLYA 4FSQA 2YJRA 4E6AA 4I23A 5G6VA 3NW5A 1A06A 2HY81 5HNIX 5L4QA 3MY0A 4BDAA 4UALA 4YJRA 2H34A 4GEOA 2WZJA 3FKLA 3UOKA 2GCDA 2R4BA 3PXZA 4G3EA 4FSRA 4R7IA 2PZIA 3FKNA 3MFUA 5JEBA 2C5OA 1H1RA 2C69A 1NW1A 3H10A 4GKIA 3Q96A 1Q99A 4IC8A 1ZOHA 3CIKA 3NGAA 4RJ8A 4RX8A 4TNDA 4EL9A 4FX3A 2I6LA 4FT5A 4PDPA 3NIEA 4K9YA 1YQJA 4AP7A 3PIZA 3OEFX 4GYGA 5LMKC 3D0EA 5K4IA 1JKLA 4FNYA 4E4LA 4D2SA 3BU3A 2JC6A 2YCQA 4BRXA 4M66A 5F95A 3F6XA 4LOQA 3P08A 4IB3A 3R8PA 2B55A 4BIDA 4FTQA 4E5BA 3UOLA 3V5QA 4DTBA 1U54A 5IMEA 3BEAA 4USDA 1UWJA 2PMOX 3TCPA 1PJKA 4B9DA 4RSSA 3WIKA 5IQIA 3FHIA 5J95A 3IECA 3OT8A 2J9MA 3GU4A 3NYXA 3PA4A 3MWUA 4ID7A 3UPXA 4G3FA 2GHLA 4TTHB 4E73A 3NCZA 4AZEA 4XHKB 3Q4UA 3OZ6A 4OTDA 1FPUA 2GNIA 2Z7SA 3DBDA 4ERKA 4W4WA 1Q3DA 3G6GA 4V04A 2OJIA 2WKMA 3VQUA 3F82A 3ORTA 2QU6A 3OOGA 1OECA 1W82A 3L9NA 2CN5A 2ITZA 3ZLXA 3V51A 3QWJA 1SNUA 4M7IA 4ACCA 4X7QA 4E3CA 2UZWE 1YOJA 4MQ1A 5KZ0A 2YM5A 1UU3A 3TEIA 1QMZA 3QU0A 4DG3E 3CQEA 4EJNA 4QPAA 3ZDIA 3EQFA 1BUHA 1ZARA 3PXRA 4MHAA 2W0JA 3OUKA 3PVBA 4FK3A 5KCVA 3QALE 4YNEA 3LHJA 2X2KA 4YZBA 3SDJA 3UIXA 5DRBA 3V6SA 2V7AA 5AMNA 4CMTA 4GFOA 5KO1A 3H9OA 4K1BA 4TY1A 5T3QA 2Q0NA 1UNLA 4JBVA 3IONA 3EN7A 4R77A 4EYJA 4P4CA 4L01A 3QAME 4IM3A 4L7FA 2XKEA 4KB8A 4E1ZA 3UGCA 4HGSA 1RW8A 4WNOA 4DH5A 4RFMA 3V5TA 2X81A 3ZHPC 1VR2A 4BTFA 2IWIA 3FYKX 4GL9A 2B0QA 3E5AA 2W1CA 4F7NA 5IDPA 2WMVA 4Q2AA 2ITTA 3I7BA 3QBNA 4QQJA 4CT2A 3PPKA 3QD2B 3BGPA 3TNHA 2WO6A 2CGUA 2B9HA 3FI4A 2FB8A 3OW3A 4J1RA 4ZZOA 5HHWA 3Q6WA 3Q3BA 4S31A 5IQDA 2PE0A 4K11A 4DEHA 1OKZA 3F5XA 3Q4CA 4MX9A 4TYIA 4XV2A 4NKSA 4BCQA 5JKGA 4FZAB 5CEPA 3MH3A 3N4VA 4EJ7A 3OCTA 4FKOA 4OAVB 1OKYA 3P79A 2GFCA 5LVMA 4WRSA 3H3CA 4GCJA 2O8YA 5A14A 2GNFA 4U6RA 3BCEA 4IIRA 4G31A 3ZUUA 2SRCA 4G1WA 5L6OA 2XUUA 2UZBA 3KXZA 4LRKA 4XP2A 2XNNA 1Q97A 3NEWA 4Y72A 4DF3A 4WNKA 4ITJA 3OG7A 1WBPA 1F3MC 3SW4A 2V62A 1DAWA 3ZO1A 4CNHA 2X8IA 2YM7A 4UMUA 4J8NA 2NP8A 3TKHA 2P2IA 4BN1A 4FGRA 1FVRA 1FVTA 3GCPA 2HELA 3O2MA 5GZAA 4MEDA 2G2HA 2JBPA 5AM6A 2ACXA 1JVPP 4IADA 4HOKA 3IKAA 4RG0A 5IF1A 4U5JA 3MH2A 5DNRA 4EORA 2PZYA 1YHVA 3A99A 4AW2A 4YZNA 4QTBA 4TNBA 2GNGA 5DPVA 1Y57A 3U9CA 4XV1A 2YZAA 2QQ7A 3POOA 2FO0A 1H1SA 3CKWA 4NK9A 3SV0A 4RFYA 2OZAB 4L3PA 1H26A 4NM7A 1KE6A 1E1XA 4FKGA 4C4FA 5KE0A 3PFQA 3ODYX 5J1VA 2ETRA 4JQ8A 4MBLA 1OKWA 4RIWA 4DAWA 4BYJA 4FV0A 4FTRA 5JQ8A 4HVHA 4D4RA 3ALOA 3CCNA 2PSQA 2JIIA 3MV5A 3OFMA 3ZM4A 4D9UA 1F0QA 4EHGA 4O86A 5AIKA 2QONA 3IS5A 1NVRA 5HZNA 4EYMA 4F0GA 5HU9A 4TYHB 2XB7A 3D9VA 5DIAA 2W06A 3P86A 4J96A 4KIKB 4IJPA 3GT8A 3TJDA 1HCLA 3M42A 3IDPA 5LCKA 2IZSA 3DS6A 2C6KA 4QYGA 2AYPA 3E63A 5DEYA 1IA8A 1ND4A 4F9CA 2RKUA 3MFSA 4FGBA 1CTPE 5EI2A 4U43A 5IQCA 3RPOA 4YSMA 3W18A 2EXEA 5HCXA 4C3PA 4DGNA 5M51A 2C30A 4TYJA 1RJBA 2A0CX 3KY2A 5DA3A 3ZBFA 2IZUA 4D1SA 4XP0A 2J6MA 3I5NA 2W1IA 2OIDA 5AV0A 4EONA 4NT4A 3SD0A 3IW6A 4K8AA 1KE5A 3V3VA 5IEYA 4EOQA 5K0XA 5HGIA 4ZK5A 3KULB 4NJDA 1WMKA 1REJA 3UIMA 3QRKA 4IZYA 4JXFA 4O7TA 4X2NA 2DWBA 3A7JA 2P2HA 4BCNA 4JL9A 2QU5A 2R3OA 4KKEA 4QP9A 3LOKA 5FXRA 2B4SB 1GIHA 2ITQA 4KA3A 2H9VA 3F2AA 1E9HA 3FE3A 3KVWA 3F3WA 4J7BA 3Q9XA 3TIZA 4O7WA 4EOKA 3PIXA 3NMUF 2UW4A 2NPQA 4L67A 3QL8A 4QMSA 4AT3A 1ZMWA 1URWA 3BZ3A 4I6BA 4ZJVA 2IVTA 2PVKA 3CD3A 4BKYA 3KXXA 5TE0A 2XRUA 4B4LA 4EEVA 4ENXA 3LJ1A 3LXKA 3HMNA 2WTDA 3UP7A 4F9AA 4PNKA 5HU3A 4O0VA 4AOJA 1VEBA 3KMUA 2V22A 1AQ1A 5HTIA 3B2TA 1S9IA 2UW3A 4FK6A 3VRZA 3PY0A 2YLEA 3IW7A 5LOHA 4RLKA 2E9PA 2QG5A 4F08A 4BDFA 4O0TA 3FXZA 3PSCA 4NSTA 3TZMA 2OF2A 4YUQA 4H58A 1JKTA 2PPQA 3KC3A 4OTFA 4ZSJA 3RHKA 4UEUA 5CSHA 3VWAA 3MVHA 4HW7A 5GZ9A 4ZOGA 4ZZNA 3SW7A 3ORZA 3ZZEA 1CMKE 2E9NA 4FV6A 2OI4X 4ACMA 2WQNA 4AOIA 3B8QA 4AT4A 3QGWA 3QC4A 4ZSAA 4NUSA 2OF4A 1SVEA 3GB2A 3R1NA 3ZRLA 1PHKA 2CGWA 5LARA 1YI4A 4FVQA 5CU6A 2WAJA 3QUPA 4CSVA 3S95A 3S4QA 4DFLA 2WMXA 3NW7A 2R3RA 4BCKA 5K3YA 3VJOA 4AG8A 3DGKA 4F09A 4RJ3A 2FGIA 2ITVA 3CTQA 5ANJA 1OL1A 1SVGA 3Q2JA 4XP3A 4BYIA 4ZTHA 4I92A 4RRVA 3UC3A 2WFYA 3AD6A 3O51A 4KINA 5E8VA 2VWVA 1JLUE 3KRWA 2WMRA 3KN6A 1PYXA 2PMIA 3REPA 3LXLA 2C6EA 4BDIA 5HTCA 4XG6A 5EG3A 5A3XA 3GNIB 2VU3A 2JITA 4UV0A 5FTOA 1ZRZA 5IG1A 4I5HA 3DXQA 2WOUA 3DNDA 3GQLA 2R2PA 3QHWA 2WMQA 4GT4A 5HIBA 4O83A 2R3GA 3LCKA 3MW1A 3SOCA 4YZCA 1Y91A 2P0CA 5L6WL 3FJQE 5CI7A 4EK5A 4KUJA 2R3LA 2OXYA 4S34A 2UZUE 1OB3A 2GHMA 2QO7A 4U45A 5KMJA 5HE1A 5M4CA 4YPSA 1XH6A 4IAFA 2VD5A 2PUUA 2PZRA 4F1TA 3LFBA 4FUYA 3SXSA 1W84A 2QOHA 3KMWA 4AA5A 5HO6A 4E5WA 3GFWA 4BI0A 4AZVA 3C4EA 5DT4A 2OKRA 3OP5A 4ALUA 5IUGA 2A19B 4FTLA 2JFMA 5B0XA 2C0TA 4UWBA 1WBTA 2B54A 3DXPA 5ETCA 2PVYA 2YFXA 3AC3A 5EM5A 3A7FA 3W2PA 4IBMA 4QT1A 5FP6A 5CAQA 5CF5A 4CG9A 3TM0A 4OBOA 4D2TA 3UQFA 4ZSLA 5AFVA 2Q83A 3SG8A 5BYLA 4X6QC 4D0WA 4ZJIA 3NYVA 1WBSA 2OWBA 2X8DA 3IK3A 1WVYA 2PTKA 3COKA 3I81A 3A62A 3W8QA 3QX4A 4PF4A 3QTRA 5CI6A 3E64A 4QP4A 3DQWA 3F69A 2P4IA 2R3MA 4FV8A 3OXTA 3HUBA 4L46A 4AE6A 1W8CA 4L42A 4YC3A 2VTRA 2NO3A 4K18A 5M44A 5BVEA 3ITZA 3KFAA 4ASXA 5BX0A 5FDPA 3EN9A 2UZNA 2W7XA 1H1QA 4FZFB 2B52A 5E4HA 4I5MA 5CQWA 3VS0A 2VWXA 4S30A 3EQPA 4C3FA 1LR4A 3EJ1A 2HYYA 2UZEA 4G5JA 3E92A 3GBZA 3MB6A 5FM2A 3V5WA 2Y9QA 5L2IA 4S2ZA 3DNEA 4BI2A 3VS6A 4EOSA 4QYFA 2HWPA 3A61A 4I0TA 5GNKA 4U97A 4C4HA 5KBRA 4PX6A 3BEGA 5I9VA 4F9BA 3L8SA 3V6RA 4I6QA 1ZZLA 5AR7A 4BBMA 5AP4A 3QZIA 5JZNA 2XJ1A 5A4LA 2R7IA 2WELA 3VUIA 5KHWA 1KV1A 3C0IA 3CXWA 3FZRA 4FV7A 3B2WA 2CKOA 3C5IA 4EUTA 5HE3A 2XRWA 3PJ8A 4X3FB 4WSYA 4LGGA 3LQ5A 3UO4A 3FC2A 5EYMA 4F9YA 2VTAA 4M0YA 3KXGA 1CKJA 4OBQA 3HMPA 5FG8A 3MJ2A 3WYYA 2X4ZA 2XCKA 2VUWA 1Q3WA 3GU7A 3LJ2A 4AU8A 1PF8A 2I0HA 1M14A 3HYHA 4C58A 3GC7A 4L44A 3DK7A 4F6UA 1KUTA 4MXYA 3L9LA 4BC6A 3JVRA 2J5FA 1PYEA 4TXCA 3FMJA 2XM9A 4YTIA 2FUMA 3H0ZA 4QMNA 3R9HA 4QPSA 4MCVA 3ODZX 4DN5A 3L1SA 4YHTA 2J4ZA 5CZHA 2XIRA 2PE2A 3ULZA 4IMYA 3NNXA 5LVPA 1YOLA 4J53A 1MQBA 4JG8A 4CT1A 4B8LA 1PMVA 4M3QA 1BI7A 3FLZA 3ZSIA 1YXUA 2X1NA 3AGLA 4JQ7A 4O0RA 4PMSA 5I9YA 2OLCA 5IH6A 4UXQA 3FBVA 3GOPA 4JBPA 2F7XE 3I4BA 3M11A 1XBCA 4FT0A 4EQCA 2W5BA 5GINE 2C0IA 2YIXA 2CLQA 2C0OA 3O0GA 4FKQA 4ACGA 3UZPA 1UU8A 2B7AA 5E91A 4GSBA 3DB6A 3PE2A 4FR4A 4ZTSA 3TNQB 1W98A 3VRYA 5I9WA 2VWUA 3PLSA 2GNLA 2W1GA 2B1PA 2C1AA 3C4ZA 1J1BA 4ANNA 5IMXA 5ANDA 4ZLOA 1OMWA 3EN4A 2OH4A 4YTHA 3D5VA 3N4UA 4W4XA 2WPAA 4UZHA 3TXOA 1YWRA 4H36A 4J71A 4B99A 1OKVA 3QTXA 4G2FA 3OWKA 4D4SA 2PUNA 5HX8A 4ZZMA 4ANBA 4U42A 2ITNA 4Y8DA 4O7YA 5HD4A 3UNZA 3TV4A 3RPRA 4ZMEA 5EFQA 3D4QA 3OCBA 4XG3A 1GIJA 4M84A 3EHAA 2R3QA 3QFVA 5AUTA 3TNIA 4BWXA 4GV1A 2C3LA 4A4OA 3MFRA 2RSVA 3H30A 2ITOA 3QTQA 5AJQA 3FLSA 3VS2A 4BTMA 1FBNA 3KK8A 4DGMA 4MD7E 2R3PA 1SM2A 4K0YA 4RIXB 4LG4A 3VUMA 2X9FA 5IUHA 5FBNC 3G0FA 1MRUA 4F64A 3HDMA 4ITIA 4Q5EA 4DH8A 2BROA 4FE2A 1JWHA 3UO6A 5CALA 3PSBA 2CKEA 2OJGA 3E8NA 2XNBA 5CU3A 5IKWA 1B38A 4FV1A 5HX6A 1A48A 5IQFA 4WG5A 4XG9A 2ZOQA 4OTHA 3TG1A 2JKQA 1PMEA 4DHFA 2QG7A 2PVFA 2ONLC 4RZWA 3WZDA 3V5LA 3Q9WA 3G15A 1PXNA 2CHLA 3T9IA 5KZIA 4KS8A 3QUDA 4V0GB 4G3DA 1T45A 4GU6A 2G2FA 4GRBA 5FQDC 4RC3A 4OAUC 3AC5A 3EH9A 4KKGA 2VRXA 2BZJA 2YWVA 2REIA 3MA6A 5CVFA 3LXPA 5AAEA 4X3JA 3ET7A 2BRGA 3KGAA 2ITPA 3ZOSA 4AOTA 4D4YA 4QMVA 1PKGA 5AUYA 2XYNA 4DBNA 4IW0A 1Z57A 4Q9SA 3L8VA 4QP3A 2W96B 5HO8A 4EHEA 4UWCA 4CZUA 1OIUA 4JAIA 4I4FA 2XEZA 3O7LD 4BKZA 5ICPA 3IOPA 5IA5A 1J7UA 2UVYA 2BCJA 5HD7A 2ZV7A 1RDQE 3EQRA 1STCE 4MWIA 2W9FB 4KRDA 2BUJA 2GU8A 4RC2A 2Y6MA 3LLAA 4RGJA 4PWNA 3RCJA 5J5TA 1M7NA 3IOKA 4OR5A 3Q5IA 1GAGA 4D2VA 3BYSA 3NYNA 4CG8A 1TQIA 2X0GA 4FUXA 3ORKA 5GJGA 5H2UA 1OITA 3RVGA 3PG1A 5AAGA 3LQ3A 3JVSA 3QRIA 1UKIA 3MGYA 3NNWA 4EH3A 2CNQA 4BY9E 4I21A 3WIGA 2HZ4A 3QQLA 3HV4A 4W9XA 3WYXA 2R3IA 4EUUA 4ZTLA 2UVXA 3TUDA 4E4NA 1UNHA 2JBOA 2Z2WA 3DKOA 4JX3A 4O7SA 5CQUA 3Q9YA 1WVWA 3BQRA 4C4JA 2WIHA 3PY1A 2UW8A 5DT0A 4LOOA 3IQ7A 1E1VA 4G3GA 5DBXA 1KSWA 1IA9A 4PDSA 2YABA 1B39A 2W9ZB 2OXXA 3AT2A 5JN2A 3CGOA 3OY1A 4PL5A 3ELJA 4DCEA 3PPZA 4P5QA 4FI1A 1YXVA 4GK3A 1SMHA 2IW8A 2J2IB 1CKPA 2B9IA 5B2KA 2W99B 4R7HA 3NPCA 3DDQA 3UNKA 2O0UA 3EWHA 4W9WA 5GIPE 3LMGA 3QRUA 2KULA 3BHVA 4U41A 1Q24A 5J9YA 2ZJWA 2YACA 2WOTA 4C38A 4FIHA 4TW9A 2JIUA 4OGRA 2HIWA 1Y8YA 3CEKA 4J98A 4QMXA 2BRNA 3ZCLA 4YO4A 3G33A 4DFXE 4FBXA 3DZQA 1YXXA 4ZXTA 3EOCA 3SQQA 4UYAA 5T6KA 2CMWA 4QPMA 4YHJA 5AR8A 1H4LA 5EW9A 2UW6A 3F5UA 3BE9A 3CE3A 3NNVA 3ORNA 3OXZA 5CSWA 4OBPA 5TOZA 5K5XA 1H28A 2YITA 3GCUA 4DFBA 1OPJA 5JT2A 5LMKA 4GFMA 3CY3A 4ZLYA 4FV4A 3NUAA 1V0BA 3CP9A 1Q41A 4CYIA 4NU1A 2XF0A 3EKKA 3FI2A 4IWOA 1KV2A 3WE8A 4AFEA 5M4IA 5E8YA 1H8FA 3NVMB 1U46A 2X6DA 4FL1A 1O6KA 3N4TA 4MQ2A 3R7EA 4NWMA 4ARKA 3O8UA 4PPCA 2ITWA 3EYGA 3ANQA 5F9EA 3QRJA 3HMOA 3V04A 2PMLX 4DH3A 4EHVA 3C51A 1CDKA 1ZXEA 3Q32A 2W5HA 3D83A 1TQMA 3UMWA 2EU9A 3RK7A 4MK0A 3KKVA 3SX9A 5EM6A 4IVCA 5IH4A 1KE8A 2WMAA 3RTPA 1ZY5A 3Q4TA 4HYHA 4QD6A 5IQGA 5KUPA 4TWPA 3R9OA 4CLJA 4AWIA 4E5AX 4ZS0A 4FEUA 5AA8A 3EZRA 3AOXA 2WD1A 1YWVA 2GHGA 2Y8OA 2VTOA 3DDPA 5E92A 5EYKA 4A07A 4A9UA 4DGGA 4CEGA 3SOAA 4YURA 5CANA 3HRCA 4G9RA 3S1HA 3QHRA 4YJOA 2G1TA 4O38A 3RNYA 4BCMA 2FSLX 5AUZA 3RZFA 5CX9A 4BIEA 1OPLA 1YHSA 2HAKA 1ZOGA 3PXQA 4FSWA 4FSMA 4KBCA 4HPTE 4U9AA 2PVNA 2WEVA 3DU8A 4BZNA 5KX8A 4IVAA 2J5EA 2X9EA 3MFTA 4MNEA 2VTQA 3BU6A 4L45A 3ZXZA 4BCGA 1SZMA 1S9JA 2W05A 4WKQA 2ZM3A 3FMLA 3LIJA 1CSNA 3TIYA 4I1ZA 2QR7A 5EDRA 2VTLA 3MIAA 4GJ2A 4NTTA 3U54A 2QKWB 2CJMA 2JDOA 4FT9A 4NCTC 2G9XA 1M52A 2QI8A 1YHWA 3G2FA 5CENA 3R1SA 2WTKC 2B53A 4OLIA 5BUJA 4OTRA 4FVPA 4CFUA 4OUCA 4GVAA 3G90X 3Q04A 4XX9A 4LGHA 4BDJA 1UU9A 3P23A 4UWYA 5DT3A 4PY1A 2GTNA 2ZM4A 4FNZA 4BZOA 4AGCA 4F7SA 1FGIA 5HVYA 4GKHA 4Y5HA 4H1MA 4E20A 4AZSA 5DVRA 5GJDA 2OZAA 3CLYA 3I7CA 3AC2A 1LPUA 3HKOA 1Q8ZA 3A7HA 5A4QA 5DYJA 5EOLA 2JKMA 4W8EA 5GJFA 5KKRC 5A4TA 3I5ZA 3DXNA 4RQVA 3ZFMA 3VS1A 4E93A 3FPMA 4XLIA 4JQEA 5DG5A 4AW1A 5D10A 4M69A 4PTEA 3SXFA 3ORIA 5M07A 1ZAOA 3BX5A 2YCSA 5M06A 4USFA 4MXXA 3S00A 4EKKA 3P5KA 3ZONA 2F4JA 3CJFA 5IUIA 4GK2A 5C03A 3F7WA 4FKUA 4TYHA 3ZO2A 2PULA 2WMWA 3RKBA 3HZTA 4KIKA 3RCDA 4P2KA 3OUNB 2VWWA 4R8QA
chains in the Genus database with same CATH superfamily
1DI8A 1Y8GA 2R3HA 4HVIA 2AUHA 4FZDB 4MXCA 2HW6A 2X2MA 4GH2A 4M0ZA 4ZP5A 3NX8A 3RAKA 1J91A 2JLDA 3PYYA 2ZMDA 4DH1A 4NZWB 4I0SA 4U40A 4D5KA 2JIVA 2GQGA 5M4FA 3GCSA 4PNIA 4O27B 2JKOA 1DI9A 4BGQA 3FQHA 4O96A 1H08A 3TACA 5C26A 3VF8A 2C5NA 2YIWA 4O84A 4UY9A 3KK9A 1VLRA 4DGLC 3HEGA 4Y95A 2GFSA 4IVBA 4DEDA 2Q0BA 3F2RA 2IW6A 3R04A 4O7LA 2O3PA 3GC8A 3RK5A 3PA3A 5BUEA 4QDVA 4GG7A 1OUKA 2VTMA 1Y6AA 3QQKA 3FAAA 5C01A 2G01A 4OT6A 2CLXA 5E1SA 2WTKB 3DKCA 4RC4A 3RINA 2XKDA 2YA9A 4IX5A 4JRNA 2VTJA 2QR8A 4O21A 3DAKA 3O8TA 3QD3A 5FXSA 2BRMA 3PLAE 4ZY5A 5I9XA 3UOJA 2VWIA 1CM8A 2C4GA 2QO9A 3F5PA 1DAYA 5C8NA 3F3TA 2QURA 5DE2A 5TT7A 2XNEA 3FUPA 4EKLA 3DLZA 2WHBA 3FPQA 4Z3VA 4HVGA 4HGLA 2YDKA 3NW6A 4C4GA 2OFUA 4A4XA 3PWDA 5KKRB 4PDYA 4D0XA 2CGVA 4FICA 4F9WA 1FVVA 2OH0E 3VUDA 5A54A 2BILB 4KKHA 1R39A 3QKMA 3UIBA 3GVUA 3KF7A 1QPEA 4DEEA 2XBAA 4MBJA 3OCGA 4YJUA 2OFVA 4FT3A 3AMAA 1WBOA 2OIQA 3PZHA 4M97A 5HIDA 4C02A 3E3BX 4H05A 5AWMA 1KE7A 1WBNA 5AR3A 4CVAA 1GZKA 1F5QA 4TYGA 2IJMA 4C37A 3BPRA 1WCCA 4RVKA 2F49A 4TRLA 4JG7A 4II5A 5CF8A 3SGCA 5IPJA 3DTCA 5AP6A 2NRYA 4GUBA 5JFXA 4BDCA 2PUIA 4FV5A 5AM7A 3IGOA 4HJOA 3FZ1A 4FKPA 1JSVA 2R3NA 2J0MB 1P2AA 3MPTA 3COMA 1NA7A 2XMYA 4O2ZA 4DYMA 4IAKA 4GG5A 2R0UA 4FTOA 3D7TB 4FYNA 2QO2A 4ZTMA 2ZV9A 2ZM1A 3I60A 2O65A 3ACJA 4I93A 4PPAA 2F2CB 3PP1A 2GS6A 3UBDA 5E8ZA 4C2WA 2VWZA 4ZIMA 3VUTA 1PXLA 5HG5A 1NVSA 4BWPA 3KEXA 4QEBA 1BX6A 1ATPE 3NAYA 4A06A 3DQXA 3GXLA 4GIHA 4D4VA 1XH8A 4G6OA 5AV1A 2EUFB 5EM8A 3THBA 3ZH8A 2VO6A 2WQMA 2R3JA 1XBAA 4J8MA 3RGFA 1H1PA 4FTJA 3GC9A 5IDNA 2XKFA 4ZAUA 2XALA 1UV5A 4QQTA 3R7OA 2BMCA 3PP0A 5BVFA 1P4OA 5E8UA 4OTPA 4AX8A 4EWHA 3LMHA 2I0YA 2IZRA 3BHYA 3TZ8A 3TDVA 5HBEA 2XK9A 2RFNA 4F65A 2JDTA 2HXLA 4JJRA 4U79A 3BRBA 3Q9ZA 3NZ0A 3A8WA 2EVAA 4YGAA 3F3UA 4CD0A 1OBGA 5AAFA 3QF9A 1W2CA 5EM7A 4I3ZA 4OTIA 5LVLA 3WOWA 4YR8A 5AA9A 3JY9A 3R22A 2UW9A 2OO8X 2EWAA 1H07A 4RVLA 2JD5A 5CU2A 4CTBA 3D14A 5D9HA 2WTWA 3SAYA 4YJNA 2YLFA 4PDOA 5EHLA 5EHOA 4C0TA 5LVNA 2C5YA 4E6DA 4LL5A 2FA2A 5GZ8A 3KXNA 3FLNC 5CAUA 3CQUA 2PL0A 3FQSA 5H8BA 4YU2A 1FGKA 2R3FA 5D1JA 1IEPA 2VWYA 3AD4A 3H9FA 3UG1A 3DK6A 3ACKA 1PXIA 4EBVA 3OBJA 1XH7A 3LFAA 4CV9A 3NVKI 3W2CA 2H8HA 3GOKA 4O1OA 3BKBA 2VTHA 5FWKK 3RAHA 4L52A 4JRVA 5FEDA 4Q9ZA 3R6XA 5M4UA 3CJGA 3FYJX 3KRJA 4DLJA 3TL8A 4DHIB 1GZ8A 3V8SA 3CGFA 2FSTX 3FXXA 5CU4A 4R5SA 1L8TA 5DRDA 2JDSA 2YIYA 3CSVA 4XMOA 2G15A 5AR2A 3NSZA 4UMPA 2ERKA 4G3CA 4FTKA 1XMLA 3R0TA 4Z9LA 2PK9A 5HVJA 3SRVB 3OTVA 2WTVA 3QYWA 3OHTA 4LGDA 1XH9A 1XR1A 1TVOA 2XIKA 1V1KA 4FNWA 4QYEA 2XIXA 2DYLA 4IWDA 4WBBB 3W2RA 4EHZA 3E88A 5JFSA 3WF8A 5F94A 4ZY6A 3BV3A 3WF9A 2IW9A 3S2PA 5L6PA 3GU6A 5AX9A 5ANIA 1YI3A 3CPCA 5HORA 5JRSA 4D9TA 2OK1A 4DFZE 3D94A 3U4UA 5LMBA 1WBVA 3LCTA 4GK4A 1GIIA 1OIRA 4XG4A 4YC6A 4R1YA 5IH5A 1JSTA 3QKLA 1M2PA 5AP3A 5I3OA 4A9SA 2WQBA 3R1YA 2VNYA 4UYNA 3ZUTA 2QOKA 3NAXA 3JY0A 5J5SA 1ZOEA 2RF9A 5KNJA 4WBOA 3C5UA 3PG3A 2QLUA 3R63A 3BU5A 3QYZA 4KD1A 2PZPA 2F2UA 4DEAA 3D5XA 1VZOA 2G2IA 2W1DA 3GI3A 4R3CA 3ZUVA 3Q6UA 2XAMA 3TJCA 4CXAA 4FKVA 2X8EA 3OT3A 4KSQA 3V01A 4FSNA 4C3RA 4HCTA 5HNGA 4CKRA 2XK3A 2GS2A 3WBLA 2Y4IC 4R78A 1LP4A 3DAEA 4EI4A 2Z8CA 1X8BA 4X0MA 3MS9A 5FEQA 2Z7LA 4FSUA 1YKRA 4JS8A 3DJ7A 3FQEA 1Q8TA 4ONAA 2IG7A 4GIIA 4AN2A 4XOYA 3TKIA 4QMOA 3K54A 3UYTA 4FIGA 3DK3A 4X2GA 2XANA 4GVJA 4EOJA 4CQEA 2YAKA 5TF9A 1GY3A 2W4OA 3VS3A 1CKIA 4M15A 4C34A 4CCUA 2IPXA 1WAKA 3MIYA 4XG7A 2NYAA 4BDDA 5EOBA 5A6OA 4DGOA 2F57A 2J50A 1YI6A 5AR5A 4RJ6A 3R2BA 3HP5A 3LM0A 2GNHA 4NH1A 5TO8A 2WTIA 3LLTA 3O5AA 4FTMA 4WUAA 4HVSA 4ACDA 2EXCX 4R3RA 1W7HA 3L9MA 4JNWA 2X0OA 4F4PA 4BDHA 5AUVA 4X3FC 5IU2A 4JDIA 3EQGA 1H0VA 3VUGA 5FUTA 1TQPA 2ETMA 2AC3A 5AP1A 2J0JA 4MAOA 4RWJA 3TV6A 3VBXA 4IH8A 4O7RA 1H01A 3MH0A 4O22A 5JK3A 2BHEA 4LMNA 4AGDA 2GQSA 4CZYB 2ZMCA 2YN8A 3FMNA 5D41A 2H6DA 2VTTA 2PYWA 5KMIA 3CQWA 3PVWA 4TWNA 1MRYA 3LKMA 4IM2A 2C6LA 1T46A 2ZFYA 3LFQA 3EQCA 1WZYA 4TYEA 4C8BA 4CFMA 3LFNA 4F1OA 2QOLA 1KE9A 3ORMA 4I94A 4WNMA 2NRUA 4RJ4A 5EI8A 1OUYA 2YM8A 3SXRA 3TZ7A 4JVGA 4FV3A 4WD5A 2DS1A 2P55A 3TV7A 3NWWA 4D5HA 4E6QA 5KMKA 5AADA 2Y4IB 4XV9A 2OICA 3SA0A 3VQHA 2XK6A 3TKUA 1K3AA 5FBOA 4BCIA 3ZDUA 4BTJA 3K5VA 4QMTA 3U51A 3R83A 3OCSA 3WI6A 2P3GX 4RIXA 3MY1A 3HX4A 5EKNA 5A9UA 1GOLA 4FSYA 5KMLA 5CVHA 5DMZA 5J8IA 3COIA 4ZEGA 3NLBA 4C62A 3BLAA 4FEVA 1ZMVA 2XK7A 3V8TA 2OJFE 1W2FA 3UMXA 5HE2A 5M53A 3DFAA 5AUXA 4CRSA 4E4MA 1J7LA 3KA0A 2XH5A 3GFEA 2BZIB 2LAVA 2WQOA 1H1WA 5FTQA 3R8LA 3CS9A 2F7ZE 5HI2A 3RPSA 3R1QA 1VJYA 3CC6A 4WRGA 2W1EA 4V0GA 4N57A 3GU5A 3RHXA 2KTYA 1G8SA 4XH6A 4GYIA 3GQIA 3QTUA 2W1HA 5E90A 3GC0A 4FEWA 5IA1A 4CMOA 4YTFA 2ZDUA 3W16A 5I9UA 3BYOA 3ZTXA 4QNAA 4EOMA 4EH6A 4H3PA 2V5QA 4NFNA 4O82A 5AP2A 3O50A 2A4LA 3DKFA 4IC7A 3EQHA 3TTIA 4TL0A 4WA9A 1PXOA 3HL7A 3R01A 3EYHA 2IO6A 3RBWA 2Z02A 1ZZ2A 4CYJA 4L3JA 4EH2A 3PFYA 4L9IA 5AX3A 2DQ7X 4XS2A 2J0IA 1REKA 3PY3A 2HOGA 3E8CA 4FV9A 1P14A 4IVDA 4N70A 4PTCA 4F99A 4KAOA 3KRLA 3QLGA 2XNPA 4ITHA 5H8EA 4FG7A 5AV2A 3VBTA 3R00A 2WEIA 3F3VA 3I0OA 3RI1A 3U9NA 3QLFA 4O1PA 2OJJA 5GIOE 4FMQA 3FKOA 4C4EA 2FSMX 3RWPA 4PMTA 3ZXTA 5J9ZA 2BVAA 4FKIA 4ZJJA 1IG1A 2WNTA 5JGDA 2C3IB 4XEYA 2YCRA 3P78A 5FD2A 3CPBA 3V5PA 5JSMA 5DN3A 4UMQA 3ZSHA 1ZYDA 3A4PA 4EZ3A 4EQUA 3W0PA 5C1QB 5CY3A 4A9RA 3TYKA 2VV9A 5FLFA 5KBQA 3HAVA 3OXIA 2BTRA 3E87A 4DC2A 1JQHA 5J9LA 3PSDA 4WHZA 3HLLA 5HICA 4UXLA 3ROCA 4U44A 4DEIA 4WUNA 1XMMA 4FL3A 3E7OA 4ANQA 4FTIA 3R02A 5J79A 3FEGA 2ONLA 4QQ5A 4YNOA 2EB3A 3KRRA 3HMIA 3IW4A 3UNJA 4C61A 3NUYA 3ATSA 3OVVA 4O4DA 4JAJA 4ACHA 4ALWA 5EQPA 4Z7HA 4ZSEA 4IAZA 1OM1A 2JAVA 3EKNA 4TKSA 4FOBA 4LI5A 1NVQA 4C4IA 4NM5A 2X7GA 4V05A 2WIPA 4YMJA 2PUPA 4I24A 2UV2A 3BLHA 5IA2A 5C8MA 3SG9A 1Q4LA 2C6TA 2QD9A 4KBAA 4FKJA 5CEQA 3ORLA 3CY2A 3WZJA 4IDVA 4U80A 3W2QA 4DDIA 3VN9A 3LJ0A 4EK3A 2BDJA 2UW7A 4DEGA 5JRQA 4QMUA 1FMKA 3FMHA 3DT1A 4HZSA 3P4KA 3OC1A 1OIYA 3AC4A 1W2DA 4V01A 2GMXA 3MTFA 4MF0A 1G3NA 3P7CA 3BHHA 3IPHA 4YHFA 4BDEA 3POZA 2GTMA 2QOOA 3AKLA 3FV8A 4TT7A 2V55A 3QCQA 2VN9A 3UOHA 4ALVA 5I5ZA 4LRMA 3NUPA 4G9CA 1W0XC 3QZFA 4QP1A 1JSUA 2QNJA 5D11A 4EC8A 3NFFB 4G5PA 4FG8A 4LM5A 3T3UA 2YIQA 3KVXA 4O2PA 3D5UA 3QCYA 2C3KA 4NIFB 2OJ9A 4AUAA 3H0YA 4O4EA 2X39A 3M2WA 1I09A 3BQCA 4F7JA 1FOTA 2WMSA 4IFCA 4FG9A 3G9LX 4P7EA 5HG7A 4I6HA 4IACA 4AXCA 4DLIA 4LV5A 2OXDA 4TN6A 5JGBA 2J7TA 4HYUA 2BHHA 5FGKA 3EN6A 2PMNX 4MXAA 4GS6A 3QZHA 2YDIA 2CDZA 3DLSA 4KSPA 4XCUA 3W10A 5LMAA 4UMTA 3VJNA 2XJ0A 4FA2A 1R0PA 4DT9A 2QOQA 5ACKA 3U6HA 5FXQA 5CAOA 5C27A 5DR2A 1XKKA 2XS0A 1VYZA 1OGYA 4L7SA 2RIOA 3HDNA 2UZDA 3FLWA 5EYDA 1O6LA 4LOPA 4XOZA 3HV3A 4PTGA 2VO3A 2C47A 5LWNA 1O9UA 3UQGA 2GQRA 5DEWA 4CV8A 3PJ3A 4IB0A 3V8WA 4AE9A 4FODA 4O0WA 4MVFA 4C33A 2PWLA 3DOGA 2OZOA 4DBXA 1Q8UA 2WB8A 3ALNA 4WT6A 4CFWA 4D1XA 2QODA 5GHVA 4MH7A 4BHZA 4FVRA 2BZKB 2UZTA 3A8XA 3K3JA 2X6EA 4EK4A 4BJJB 5M09A 5HE0A 5JH6A 4HNIA 4BCPA 5CEOA 3MPAA 3ANRA 1DM2A 1W83A 3QTZA 3FI8A 2J0KA 5H3QA 5DLSA 4XBRA 3RPVA 4CFXA 5ACBC 4C36A 4X2JA 4BCHA 2GPHA 3UQCA 5I4NA 4X2FA 3C1XA 4EH8A 3NDMA 2WQEA 4AT5A 3EIDA 1K9AA 2ZV2A 3QXPA 2VX0A 4EOIA 2BFXA 2YM3A 5HESA 4UX9A 4BCOA 3ZSGA 5E8TA 4UN0C 4CTCA 5CU0A 5HBJA 2C6OA 4XRLA 3TI1A 3EFWA 3AXWA 5I9ZA 4U7ZA 3RNIA 4O91A 5EHYA 2BKKA 5B2LA 4R1VA 3CKXA 3QQFA 4DCAA 4GT5A 5DOSA 3EL8A 4L6QA 5E8XA 4KABA 1OL2A 4KIQA 4D2RA 4AXDA 5ITAA 3EZVA 4FIIA 4C35A 4AGUA 2ZAZA 3R2YA 2UW5A 3QXOA 3LQ8A 4RFZA 4YBKA 1QPDA 3F9NA 3BBTB 5ETIA 3W33A 3PUPA 4QOXA 4BZDA 4RLLA 1OZ1A 4AA0A 1XHAA 5BYZA 4BL1A 3DBFA 4PUZA 3W1FA 3GUBA 4XYFA 3UVQA 1JBPE 4D28A 3UDSA 3CTHA 5L2QA 2EB2A 3PRFA 2ZV8A 4JOAA 3UO5A 1PXJA 3KCKA 3SVVA 2ITXA 2XA4A 3QA0A 3W8LA 4AFJA 4FKRA 4LYNA 4RIYB 4YLLA 4FIFA 4IB1A 5J7HA 4NCTA 3PRIA 3R8ZA 1H0WA 4BI1A 2QOFA 3R71A 5AP7A 2C5VA 3TN8A 4KIOA 4EK8A 2ZB1A 1BKXA 2O64A 2C68A 1BLXA 3PXKA 5A4EA 3RZBA 3DCVA 3GEQA 3R8VA 1JKSA 3AT3A 3HVCA 3Q52A 4IZAA 2R0IA 2HCKA 4IAAA 2OU7A 2UZOA 3AC1A 4PL3A 2BDWA 4DE4A 3FSFA 3GP0A 4DFUA 4ORKA 1RE8A 2XYUA 3P7BA 4WG3A 3VNTA 2BTSA 2W1FA 5H8GA 4BCJA 2CCHA 4F78A 4RVMA 5FTGA 3MYGA 1YRPA 4KWPA 1FMOE 2XIYA 2C5XA 3TZ9A 3NUSA 4JBOA 3FZSA 3OWLA 1QPJA 4LV8A 4BBEA 2AC5A 4IDTA 4O0SA 4L53A 3BL7A 2E9OA 1GZOA 3A7IA 5HEZA 4BFMA 3F5GA 5C8KA 3ATTA 4YP8A 2BAQA 2ITYA 1XH5A 2JAMA 2OIBA 2CKQA 3ENHA 4RMZA 3QQGA 4CLIA 3U8WA 4LUDA 5BYYA 3UVPA 4DEBA 3OROA 4ANOA 2XAOA 4X2KA 3DJ6A 5L8KA 4RX7A 3DTWA 4QMPA 3W0NA 4G34A 4RA5A 1H00A 4HZRA 3C13A 5ANKA 5H9BA 2RL5A 1UVRA 3E3PA 1BI8A 4AAYA 1HCKA 4QRCA 3DBQA 3D15A 3VS4A 3BL9A 3ML1A 4ASDA 3G9NA 3LFSA 3PDTA 4QQCA 5BPYA 4O81A 1R0EA 3KF4A 2JDVA 3OEZA 4EH4A 3BELA 3D7TA 1AD5A 3DFCB 3PA5A 2Z7QA 4LQMA 2VGPA 3A7GA 3BE2A 4JDHA 5FM3A 3VBQA 5ANGA 5BMSA 3A4OX 3FY0A 4BIBA 3DB8A 3UZRA 1V0PA 4RA4A 4O0XA 4PMMA 4NW5A 4USEA 4IEBA 3TMOA 3LAUA 4ZTRA 1UWHA 4H3QA 4DFYA 5LJJA 3U6IA 4ANSA 3E7VA 3DA6A 3ZLSA 1FINA 2C6IA 3UODA 3EQDA 2Z60A 1V0OA 4GUEA 4A9YA 4C59A 5IA3A 3KU2A 3FMKA 3LVPA 3VW8A 3WZKA 4DITA 5C4KA 4F0FA 4MXZA 2VWBA 4QO9A 3R9RA 3DBCA 1MQ4A 3EN5A 4QP6A 4W4VA 5BQ0A 5JQ5A 3A60A 3QX2A 3ZFYA 1ST4A 4JG6A 4E7WA 2X0QA 2BRHA 2XZSA 4FEXA 4JDJA 2QOIA 4KRCA 2C3JA 2V7OA 2W5AA 4KNBA 4IANA 3UDBA 4HGEA 4IE9A 4DFNA 4O7NA 4LFIA 4YPDA 4YJVA 2HZIA 4EH9A 4FF8A 4D2WA 1EH4A 1AGWA 3ERKA 2Y4PA 5L8JA 3W2OA 4I6LA 3T9TA 1IRKA 3NYOA 1NY3A 2X0PA 3ZFXA 4J95A 2FH9A 5CLPA 3OOMA 4KBKA 4FKLA 4J52A 2UUEA 3QRTA 4M8TA 3AD5A 3LFCA 4F0IA 4ZMFA 3G6HA 1ZLTA 4BF2A 1H24A 2JEDA 2H96A 3KQ7A 3Q60A 3U87A 5L8LA 5LQFA 4R7BA 3KULA 3FZTA 3ZZWA 1PMNA 5D7AA 2PVJA 2QLQA 5L2TA 2HWOA 5K9IA 5CEMA 2ETKA 5IQEA 3PZEA 3BLQA 2PU8A 1BL6A 3OMVA 3QQUA 1J1CA 2BALA 2ERZE 3QGYA 5CZIA 3VBVA 3O8PA 4BGGA 1YDSE 2ZVAA 5E7RA 3RAIA 3W32A 2ZB0A 3KCFA 5CNOA 1PY5A 2F7EE 3OWJA 5DHJA 3ZMMA 4AN9A 3ETAA 5IQAA 2OW3A 3C9WA 3DAJA 5CVGA 3FC1X 3G5DA 3MB7A 5F4NA 4EZ7A 4CKIA 3ID6C 3I6UA 1OI9A 1KOBA 3UVRA 2PVRA 3DKGA 3JS2A 4TPTA 2PHKA 5DI1A 4BTKA 5BNJA 4MD9E 3SKCA 4EH7A 1OL5A 2YERA 3TWJA 5CAPA 4I41A 3LCOA 2R5TA 4YJSA 2PE1A 3W2SA 5HBHA 5BVWA 3TUCA 4R3PA 5J87A 3RP9A 3SRVA 1URCA 5I0BA 5IA0A 2QKRA 3AC8A 1ZYLA 3D2KA 1L3RE 5C9CA 3LM5A 3R9DA 3EQIA 4O4CA 2WTCA 2B9FA 4E26A 2NNWB 3ORPA 1P4FA 4NKAA 3ZEWA 3QQJA 4C7TA 4AQCA 2W17A 3GENA 5JZJA 1SYKA 3F61A 3VS5A 4L43A 4EK6A 2X4FA 3R7GA 5CS6A 3VC4A 2FVDA 5EW8A 3ROYA 4IJ9A 4JDKA 3OW4A 3WARA 5ETFA 3E62A 4M14A 5LWMA 2BIKB 4MNEB 3I6WA 1HOWA 4H39A 3RJCA 3ZC6A 4U3YA 4GMYA 5DH3A 4I0RA 4CFFA 4CGAA 1P5EA 3KMMA 3MN3A 5HKMA 1U54B 2HXQA 2PVHA 4TZRA 4AW0A 3MESA 4O7ZA 2IVUA 3FLQA 3IW8A 4Y5QA 3U6JA 3NUXA 3LE6A 2OGVA 5FEEA 1OL7A 5M55A 2YHVA 3ZEPA 4EOPA 3FDNA 5HVKA 2RFEA 4ZTQA 3R21A 3RPYA 4M12A 3COHA 4JT3A 1WFCA 5CYIA 3ZM9A 3Q2MA 4RJ7A 4F1MA 3IW5A 3K3IA 4IQ6A 3KL8A 4RJ5A 3JUHA 4YJQA 5ANOA 5AV3A 4BDGA 4DG2E 1UNGA 2CPKE 4QTEA 5HO7A 4J97A 3MSSA 2HZNA 2XCHA 4EH5A 4IZ5A 4Y85A 3L8PA 3ZU7A 3NRMA 2JDRA 2YCFA 4AGWA 4EZ5A 1YOMA 4M69B 3UP2A 5CEIA 2OBJA 1G5SA 2JFLA 3I79A 3MI9A 3FL4A 4UBAA 4UMRA 3AMYA 3FSKA 5CSPA 2VO0A 3FZOA 4HGTA 4CMUA 2UW0A 5L2SA 1YXSA 4R6VA 4XV3A 4CRLA 2DUVA 5HTBA 4J99A 5BMMA 2XBJA 3P5JC 1PXPA 4NM0A 3NCGA 3P7AA 1Q8WA 3E8DA 2CN8A 1VYWA 3AMBA 4B0GA 4U81A 1NXKA 4NTSA 3F2NA 3WF6A 3MVLA 3QA8A 3BI6A 3PVUA 5HOAA 5IEXA 5JFVA 4DT8A 5K0KA 4RPVA 5TR6A 4CQGA 4JBQA 2EXMA 5L3AA 2V0DA 3PWYA 2X7FA 3C4FA 4FL2A 4JX7A 4O7VA 4LMUA 5CAVA 4AZTA 4U3ZA 3ZYAA 3HGKA 2HZ0A 2VZ6A 5AP5A 4NW6A 3UE4A 3P1AA 5LCJA 4DTKA 3DZOA 3GCQA 2ZDTA 3HV7A 4B8MA 5IA4A 3RK9A 3BGQA 2PVMA 4HPUE 4XBUA 5CT0A 4BWKA 5CSXA 4BB4A 3TT0A 4PP7A 1UA2A 5T68A 2E9UA 1LEWA 2HK5A 5FP5A 2JKKA 3TDWA 5LXMA 4MWHA 2QCSA 2OG8A 2WMTA 3DBEA 4O0YA 4P5ZA 4BICA 5M08A 4Q5HA 4FZ6A 4LUEA 3NUNA 3WZEA 3AT4A 2W4KA 4H1JA 5JGAA 3R73A 4AS0A 2AEGA 3ZRKA 4YTCA 3MY5A 4IM0A 3PXFA 4RBLA 3FY2A 5J1WA 3LFEA 1WBWA 1ZMUA 4L8MA 3MA3A 1UU7A 3KN5A 3MBLA 3GU8A 4FIJA 3ZLWA 2WXVA 4PPBA 3R8UA 4CFVA 5CF6A 4MXOA 5CXHA 1U59A 4HVDA 1Z5MA 4Z55A 3HAMA 2YEXA 3RALA 3BYVA 3ZC5A 4QMZA 4ANMA 4FV2A 4X3FA 4BR3A 5E8SA 3TNPC 1XQZA 3FI3A 2XEYA 1YDTE 3OBGA 1YXTA 2VAGA 4MYGA 2VGOA 1JOWB 2YM4A 3QD4A 3VS7A 4CFNA 3UZTA 3VVHA 3R7IA 4WOVA 5F20A 3OWPA 1Q62A 2YDJA 5B7VA 4ZS4A 2W4JA 3QD0A 4MNFA 5EDPA 5AR4A 2YM6A 2PZ5A 3Q5ZA 2GS7A 2X7OA 4WO5A 2VX1A 3QUEA 3DJ5A 4QP7A 3S0OA 4RWIA 2R64A 3AQVA 3DPKA 3TNWA 4EOOA 4JR7A 3K5UA 2WMBA 2YIRA 4RIWB 4XRJA 4AA4A 2RFDA 4YBJA 4BBFA 5B2MA 1QPCA 3H4JA 1Q61A 4JR3A 4D58A 4QTDA 5CEKA 1M2RA 3C7QA 4ZTNA 4EWQA 3F7ZA 2I1MA 2XKCA 2J90A 2WU7A 4I6FA 3VBYA 1JAMA 4C2VA 3RMFA 3ULIA 4D1ZA 4MBIA 4G16A 3FMDA 3VHEA 1OBDA 1APME 5BVDA 3QQHA 4MD8E 2FSOX 5M57A 4GFGA 4IX4A 3ENMA 5AUUA 1PXMA 4AZWA 3R28A 4FIEA 5DGZA 4M13A 4YSJA 2QHNA 3FHRA 5AV4A 3AKJA 5DR6A 3O7LB 2QOBA 4IX3A 4AACA 1YDRE 5HLNA 2RG5A 2Y7JA 3PPJA 2CKPA 5L2WA 3O71A 2CGXA 2GSFA 2BPMA 4GJ3A 4K6ZA 2VX3A 2XK4A 3KXHA 4FTTA 4BVUA 4YJTA 5CWZA 4FOCA 3LCSA 3LCDA 2BAKA 4PL4A 3RWQA 2I7QA 5CT7A 5HLWA 2IN6A 3KRXA 2OSCA 5EH0A 1O6YA 4BCFA 3PJCA 4AF3A 3D5WA 2WGJA 2B9JA 1G8AA 2HY0A 3VAPA 3PJ2A 4FTUA 5AEPA 1KWPA 1M7QA 1LEZA 3OTUA 2O5KA 4FTCA 3VHKA 5HIEA 5HQ0A 2YJSA 1IAHA 3C4CA 5K5NA 3K2LA 5HG9A 4ZLZA 2W1ZA 4FSTA 3QWKA 5EW3A 2CNVA 4DA5A 1XWSA 2Y0AA 4JI9A 4TWOA 2IVSA 2VTSA 5CNNA 4IFGA 4YZMA 5KMNA 3VULA 4Y83A 5IISA 3G0EA 4HCUA 3QTIA 5BVNA 4R5YA 4FNXA 1OVEA 2VTPA 3P9JA 4K2RA 5CXZA 4LDTA 2A2AA 2YISA 1PXKA 2LGCA 1JNKA 3EB0A 3S3IA 4YJPA 3TUBA 4DTAA 2WTJA 4LRJA 3QCSA 1JPAA 1ZWSA 4ZSGA 3IDBA 5HCZA 3UIUA 4NIFA 2X2LA 2RG6A 4FTAA 4H3BA 4NJ3A 3VW6A 4FC0A 4CCBA 1PW2A 4AXAA 1QL6A 4FT7A 2GDOA 4XG8A 3VIDA 1GJOA 3HMMA 4IXPA 5E1EA 4F6SA 4X21A 3LMIA 3HP2A 4WIHA 5CSVA 3MH1A 3GGFA 4RX9A 5CF4A 1M17A 3GCVA 4JIKA 3EFLA 3RM7A 4ENYA 3QTWA 3PJ1A 4W8DA 1MRVA 4W4YA 3BHTA 4QYYA 3CD8A 3BV2A 3N9XA 2BDFA 3CR0A 5D7VA 1Q8YA 3MVJA 4RIOA 5DR9A 5JFWA 2BRBA 5ETAA 4BDKA 3IG7A 3BLRA 1RQQA 3DY7A 4OTWA 3NIZA 5KHXA 3KXMA 4HNFA 3WF7A 3OY3A 4O4BB 4WNPA 4B6LA 1ST0A 1OPKA 2IVVA 5ANEA 4WG4A 4IX6A