4D55A

Focal adhesion kinase catalytic domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
260
Chain Sequence
RDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRYLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE
publication title Allosteric Regulation of Focal Adhesion Kinase by Pip2 and ATP.
pubmed doi rcsb
source organism Gallus gallus
total genus 82
structure length 260
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d55A01
4FKQA 4IIRA 3CSVA 3A7FA 4JDJA 4G3GA 3PXQA 3CY3A 2XM9A 3O7LD 4XG9A 2F7XE 2OZOA 2QNJA 2X2KA 3FXWA 3NWWA 3CTHA 2VAGA 2I0EA 4NW6A 4FNXA 4IWDA 4AUAA 4F6SA 4BBMA 3IW4A 4QTDA 4F99A 4EJ7A 4DAWA 3HAMA 1H1QA 4FIIA 5BQ0A 5IUGA 3NUAA 3GI3A 3AC1A 4F0GA 3ZBFA 4EOLA 3EFWA 5KUPA 4KS8A 1OVEA 4FSZA 5BVDA 4XRLA 5E91A 3RPYA 3ORMA 4JJRA 5TT7A 3QD2B 3HV4A 3BYVA 3KU2A 3KF4A 4YLJA 5HO7A 3A99A 4IM3A 3W16A 2RL5A 5ANKA 5FTOA 4G2FA 1O6YA 1F5QA 3RPOA 5L6OA 3RWQA 2IVSA 4UB7A 3P4KA 3V51A 4AOJA 2FVDA 3QQLA 2EWAA 1B38A 3E92A 5K0KA 4ZSAA 1E1VA 4DEBA 2DQ7X 1BL7A 1J1CA 2WMBA 3LFSA 4I24A 4IB1A 5DNRA 4M66A 5TO8A 1KE5A 3FI8A 3D94A 4BTFA 2V0DA 3AC2A 5JH6A 2GHGA 2XJ2A 2BFXA 2PVRA 2BAJA 4BYJA 3ROCA 3FBVA 5AUXA 2X0GA 4L53A 5B0XA 4DGLC 3TKUA 3OS3A 1IA8A 4XP0A 2BRGA 4RJ4A 3WZEA 5HNBA 4JDHA 4FKWA 4MD9E 2XK4A 1M2QA 3HDNA 4FG9A 4KKEA 3C5UA 2GNFA 5TE0A 4E4XA 3OY1A 4BICA 4WRGA 3HECA 3A4OX 4E5AX 5ANDA 3DA6A 4LGDA 3FKOA 3IOKA 3MY5A 1CTPE 5EDPA 4FKRA 4UMQA 4O7RA 3MN3A 3BLHA 1PMEA 4ZLOA 4YLLA 3VUMA 2FGIA 1OZ1A 3C4EA 2J5EA 3C0HA 1ZZLA 5F4NA 4D4RA 1XJDA 2R3MA 2XS0A 4FOCA 1ZARA 1W98A 3IW5A 4IVAA 5FBOA 3E93A 1TQPA 4TKSA 4C4FA 4IX4A 3I60A 4CRSA 3R9RA 3QX2A 4L67A 5IA2A 3CXWA 3W1FA 2VWYA 5K0XA 3FHIA 4IX3A 5CANA 4IADA 4HYHA 5AA8A 2UW8A 4V04A 4LL0A 3DT1A 1ZY4A 3VRZA 3IS5A 2W4OA 2Y4IB 3JY9A 1QPCA 3ORZA 2VU3A 3F7ZA 3QYZA 4GUEA 3UZPA 3VIDA 3ZXTA 4C3FA 1JOWB 4R8QA 4BYIA 3KRRA 3R7OA 1QL6A 1WBTA 4X21A 2VV9A 3V8WA 2JAMA 4CQGA 5L3AA 1OIQA 3FSKA 4XG8A 1YDSE 4I4FA 4PWNA 5HD7A 4QMQA 4JQEA 4BHNA 1ZY5A 3GU4A 3FI4A 4F70A 3WZDA 1PXIA 3SA0A 3FZOA 2OJFE 4L9IA 4LUEA 1YXVA 3VF8A 3RJCA 4CKRA 3E3PA 5I0BA 5IQHA 2HZIA 3SW7A 3TNHA 3CLYA 4I0RA 1WZYA 3TTIA 4DLIA 4PRJA 3VRYA 2YACA 4U5JA 2Y4PA 3FL4A 1WBPA 2CN8A 4L00A 4ACHA 3UZRA 4G31A 4PV0A 1H1RA 4JR3A 2C6OA 2OZAB 4X2FA 3OTUA 3TXOA 3FXZA 5H3QA 3GFWA 1FVTA 3T8OA 4RIYB 2BPMA 5E8SA 4LRJA 1PF8A 2BAKA 1R0PA 2BKZA 1JSUA 2CKOA 5CNNA 5BUIA 3F5PA 2G2HA 3L9MA 2XKFA 5CEKA 4MTAA 2GSFA 5E8ZA 2CPKE 4NTSA 4NUSA 5BUEA 4RZWA 2W1ZA 1GY3A 2B4SB 4B0GA 3E8NA 4O86A 3NCZA 3A7IA 2WTKC 2ZB1A 4UX9A 3GC9A 2R3JA 4WIHA 2VWWA 5KMIA 5EH0A 2CSNA 2GMXA 1YHWA 4BDBA 3DKOA 4CFFA 3BGZA 4IHPA 4JXFA 3ZRMA 4QMWA 1OKVA 3FMDA 4YZMA 4EH9A 1H07A 4I0TA 3PZHA 4ZS0A 3OD6X 4O7SA 3EQFA 3DAJA 3I7CA 3LAUA 4AP7A 1LP4A 5J1VA 3QBNA 5AIRA 1KE8A 4DFLA 3QF9A 4OW8A 1BYGA 3COHA 2HXLA 2QURA 4WA9A 2OZAA 4MXCA 1A06A 2XH5A 1P4OA 1XO2B 3Q2MA 5AIKA 1Q24A 1P2AA 3PJ8A 2WEIA 4DG0E 1J91A 4BZNA 5ETIA 3WE4A 3ZLXA 4AWIA 5CU4A 5C4KA 3EH9A 4U44A 4O83A 2Z7RA 3MH2A 4RMZA 3NIZA 4GCJA 2OH0E 5JGAA 2JFMA 3QZIA 1IASA 4C2VA 2ITPA 3O2MA 3O8UA 3QKMA 4MD8E 5BNJA 4O7NA 2VD5A 4AACA 3U9CA 4UMPA 5M51A 2JBPA 4Y83A 5LCKA 3PJ3A 1FGIA 4D2TA 3LFBA 3BHUA 4LOPA 2O5KA 2XB7A 3QYWA 3PA3A 4PMMA 2ITTA 5JRSA 5AA9A 2W4JA 2GFSA 3Q2JA 3KF7A 5EW3A 2XRUA 4BCGA 2B53A 2W5HA 1IA9A 2QLQA 2BZHB 3QRUA 4S31A 4F9CA 2Q0NA 3QTRA 3FZPA 1DAYA 4EOPA 3LKMA 3QZFA 3LCDA 3FI3A 5CVHA 5HO6A 5J9LA 4JNWA 2LGCA 4L3LA 5HVKA 5EYMA 3U54A 2CNQA 1MP8A 2YM3A 4E93A 3TUCA 2HOGA 2YAKA 4TYIA 2PY3A 3VVHA 4YHJA 4PDYA 2CLQA 3HA8A 4DFNA 4ORKA 1M17A 1PXJA 2Y8OA 1OPJA 4FSRA 2XIRA 3G90X 2R4BA 3MVMA 5CLPA 2G1TA 2W05A 2ZB0A 4QNYA 3JVSA 4U3ZA 4DEEA 5E1EA 2R5TA 5L2WA 3ULZA 2C3IB 2C6EA 4AS0A 1H08A 3NPCA 4MBJA 5I5ZA 2VWVA 2B55A 2XIKA 3UIUA 3ZU7A 2GQRA 3MV5A 4C2WA 5CEIA 4FG7A 1UV5A 2UW0A 4QP8A 1SMHA 3HYHA 4D4SA 4U41A 3NNXA 5D11A 1ZMUA 4OUCA 2GQSA 4I1ZA 1S9IA 4MEDA 3L9PA 4X2GA 4YURA 2J9MA 5HCZA 4FR4A 1R78A 4FTIA 4FTQA 3ZMMA 2Y7JA 1WVYA 3EL7A 5HBEA 4ZZMA 4K6ZA 1E9HA 2QHNA 2PUIA 4K33A 4F6UA 4EKKA 3BLQA 5BVEA 4F4PA 3R8MA 3ROYA 1BUHA 1IRKA 4R7IA 3OFMA 4U40A 4EOMA 2W5BA 3GCUA 2O2UA 2X8DA 1JNKA 4FTRA 1FQ1B 4DGMA 4QYYA 4XCUA 3U87A 2Y4IC 1Y91A 3BCEA 5LMAA 4GIIA 3ZCLA 4IWQA 3MJ2A 1Z9XA 2OJGA 3A7HA 3LFNA 3OUNB 4R3CA 2BRNA 4RWJA 5HBHA 2PZ5A 3GU6A 3VS7A 3MS9A 3MDYA 2YM8A 4ZXTA 3R8UA 5HX6A 4FTOA 5H9BA 1ZYSA 4Y73A 3TNIA 5CT7A 2OJ9A 3UOKA 2EXCX 3PXKA 3HV7A 5T3QA 4I0SA 4KBCA 4Z3VA 2JDSA 2QO9A 3Q6WA 2AC5A 3H0ZA 4C3PA 2VX1A 4FV0A 5ANIA 4BDEA 3AT2A 1XH4A 1YQJA 4IWOA 4XP2A 2ZJWA 5I3RA 4HGEA 4I5HA 2I1MA 4AAAA 4B8MA 4EK5A 5AUWA 4EOKA 5IUIA 2A2AA 4X3FA 3HLLA 2IZUA 4F9YA 2YM6A 4FNZA 5LWMA 4BCHA 5FEEA 3E8EA 5IA0A 3ZLSA 5BVKA 4MXYA 2WZJA 3GC7A 2HY0A 4LYNA 4YTCA 3HV5A 1SNXA 3BEAA 5FGKA 1TVOA 2V5QA 4PL3A 3EN5A 4R5YA 3V6SA 5AAEA 3MFRA 3PY0A 4EHVA 3II5A 1WMKA 2X1NA 2QOBA 1F0QA 1H25A 2WTVA 3O96A 4UXLA 2J51A 3HMMA 4CMOA 5HU9A 5IEXA 2BROA 4O7VA 4FC0A 1RDQE 3R04A 5IA5A 4ZMEA 4F7LA 4ZMFA 2ESMA 4WUAA 2XUUA 2CKQA 4ACDA 1NXKA 1TQIA 4NEUA 3FYJX 3DOGA 3DQWA 3TNWA 4V05A 3Q5IA 3LW0A 4PX6A 1H28A 3OVVA 2WU6A 2BTRA 3LFCA 1AQ1A 4M97A 4D28A 3E88A 1YVJA 2BDWA 4P4CA 4I41A 5E9EA 1Q62A 2ETRA 5ETCA 3FLNC 1Y8GA 4FZ7A 4QP4A 5M55A 4JOAA 3RGFA 2PVLA 4I5MA 4ITJA 4G17A 2C68A 3BRBA 3LM5A 3A7GA 3BHYA 3VF9A 4D2RA 1SVGA 4CSVA 1DI8A 3QQFA 3H0YA 4RQKA 4RWLA 4G3DA 3TIYA 4WNKA 5AJQA 4L8MA 5BUJA 3ZZEA 1M7QA 2WQBA 3Q4TA 4ACGA 4HGTA 4L7FA 5L6WL 3FLYA 4GU6A 5EKOA 1JQHA 1PJKA 4FKVA 4QMOA 4O84A 2QODA 2WMAA 3KCFA 1U46A 3P78A 3W33A 2RFDA 5E4HA 3QQUA 4QP1A 2BRBA 4BDGA 4AA0A 5AMNA 4MNEA 4Y72A 5EDQA 4RVTA 3KGAA 4W8DA 4QMXA 2V62A 4NK9A 5EM8A 5LQFA 3MVHA 3E63A 4QP9A 4RC2A 5IQEA 1H4LA 3BU5A 2VX0A 1UA2A 3SLSA 2ACXA 4F0FA 3CPCA 3TUDA 4BDFA 2X2LA 3R2BA 4GKIA 1MUOA 3PE1A 5FTQA 2F49A 3A61A 4WUNA 5M4CA 1XH9A 3PP0A 4X6QC 4D9UA 1OPKA 3QAME 4FK3A 3WZJA 4W4YA 1OBGA 2QOIA 2W7XA 4IB0A 3VJNA 3PP1A 3Q4CA 1PMVA 3JPVA 3LFQA 2YCRA 5CU6A 5AAFA 3RPRA 4CT2A 4I6HA 4NFMA 2Y6MA 4XS2A 4A4LA 4HYIA 3D7TB 1UKHA 4EH6A 3KMMA 5IEVA 4BKZA 5JKGA 4FIGA 4RJ3A 3W2OA 3ORTA 4B4LA 3WF7A 2BKKA 3SC1A 1CMKE 4LRMA 2PVHA 3R83A 4AOIA 3QXOA 5A6NA 1NVQA 4LV5A 2GCDA 2QOCA 2W1GA 5IU2A 4CFWA 2VTNA 4FGRA 3BU3A 4CEGA 1KE6A 1W8CA 4XEYA 5GNKA 4BDAA 3OUKA 4ANLA 4CFVA 2VO3A 1JSTA 1PW2A 2X9EA 2YIRA 3TZMA 4O1OA 4RC4A 3MGYA 3QWKA 4JBVA 3WF9A 3WZKA 3ZTXA 3ORKA 2O64A 3VUTA 4YU2A 2F2CB 3RZFA 1ZYLA 4RJ8A 5CY3A 3QUEA 4M14A 4PTGA 4TWCA 5L6PA 5IKWA 4WG5A 1OKYA 2ERKA 2FA2A 3BYSA 3DBCA 5M57A 4M69A 4EH7A 2CMWA 5CXZA 3EN7A 2XNBA 3ZS5A 4EUTA 4O0WA 4ACCA 2GHLA 1UKIA 3DAKA 4E6QA 5HTBA 4DH7A 1Q8TA 2BRHA 3DTCA 1W82A 3MI9A 4ZY6A 4Z7GA 5C8KA 3HV6A 4U9AA 5EI2A 4Q9ZA 3D7TA 3F61A 5GJDA 4X3FC 3NX8A 5HE0A 3GGFA 1XHAA 5K9IA 1FVVA 4DHFA 3EQCA 4F9WA 3GCSA 2UUEA 1H0VA 4JAJA 4KSQA 4ZJIA 4FF8A 3GENA 1PXOA 3EYGA 4IMYA 5EG3A 3SAYA 3UOHA 4QPSA 4WBBB 2ITNA 4AN2A 4E6AA 3AGMA 4GK3A 3W2PA 5EQPA 3KULB 2QO2A 3NYNA 4FKSA 3HAVA 3G6GA 3OBGA 3TEIA 2ONLA 3CTQA 2XNEA 3BELA 4KKGA 2VX3A 3U4UA 3GCQA 4UEUA 4R7HA 5HE2A 4BCIA 4O7WA 2WTJA 4YJQA 3U51A 5CSXA 1LEZA 3R8PA 4GUBA 3EFKA 3N9XA 2UZTA 3O50A 5JZNA 3P86A 1CKJA 4MNFA 1Y8YA 3PZEA 3PA4A 2ZM1A 1FPUA 4USDA 4FV9A 2OWBA 3DBFA 4V0GA 4CFMA 2OH4A 3QCQA 4KWPA 2WB8A 4EYJA 4G3FA 3EWHA 4RZVA 3VO3A 2PSQA 4A9RA 3LFFA 3C1XA 5HVYA 4H36A 4KAOA 5LOHA 3OXZA 4HPTE 4CQEA 1OUKA 5EI8A 3ETAA 4DGOA 3CD3A 1WAKA 4KRCA 5I9WA 3TACA 1KOBA 2OFVA 4GT4A 4E26A 3JYAA 3P9JA 4RA4A 4AZSA 5J7BA 3OOMA 3QCYA 4O96A 1E1XA 4OGRA 4QMZA 3NYOA 5D7VA 3S95A 4C34A 1UU7A 3KULA 5IH4A 4XHKB 5HG9A 4E5WA 2CHLA 3KRJA 3DCVA 4KA3A 3FUPA 3KXMA 3ALNA 2OSCA 4YJSA 5J5SA 2R0IA 4R5SA 4UWYA 3KXGA 3D7ZA 3SOAA 3RCJA 3COKA 5CAPA 5IG1A 5AV3A 4BDHA 2E9PA 5M53A 3QALE 4JDIA 4NTTA 5ACKA 4RA5A 2R3QA 4PTCA 4FEVA 3F3WA 3KK9A 5AP6A 1YXXA 4IJ9A 3KK8A 3NDMA 4GYGA 3T9TA 5GJFA 5IEYA 4RFYA 3ORPA 4IZ7A 4KIQA 3VQUA 3VN9A 3DXPA 3ZO1A 3GQLA 3MIYA 1TQMA 3QZGA 4CKIA 3BBTB 3OP5A 4RC3A 4WG3A 4ASEA 5HLNA 4NM7A 2P0CA 2VTOA 5J7HA 3KL8A 4C02A 3MA3A 2QKWB 4YHTA 2J6MA 2YM5A 1SM2A 4AT4A 4LQMA 2JKMA 1BL6A 3H9RA 5GHVA 3GBZA 4PPCA 2IO6A 4BY9E 1OMWA 2JGZA 4DTBA 4FYNA 4A9YA 3UJGA 1KV1A 2Z02A 4C4HA 2YA9A 1V0OA 3CP9A 5J9YA 2WIHA 4MKCA 4D1XA 4DFYA 4JG6A 3R21A 5J5TA 1KE9A 3R9OA 2JKOA 3R1YA 2ZDTA 2ERZE 4YJUA 4AW5A 4CKJA 2BALA 1OUYA 2QR7A 3CQWA 3AT4A 5CU3A 3NUUA 1J7IA 2IN6A 4D5HA 2FSLX 2WKMA 3E64A 4FODA 3DV3A 3F9NA 4PDSA 4EONA 2UZUE 5K4JA 3QD3A 4E5BA 2FUMA 3U6JA 3SGCA 5AR4A 3DDQA 3GFEA 4OT5A 1QPDA 2W0JA 3OWPA 4TWPA 2C0TA 4IC7A 3OXTA 3DJ6A 1PY5A 4O81A 3R7GA 2CJMA 3PVUA 3PRIA 4I23A 4HVGA 2I0VA 3ODZX 3Q4ZA 4F6WA 2YJSA 3GT8A 3THBA 4A9UA 4CYJA 2YCSA 4QQ5A 2SRCA 5BYZA 2QU5A 1GZNA 2R3FA 2F9GA 3KVWA 4HNIA 3FPMA 3PXYA 4KKHA 3CBLA 2Y0AA 2XKEA 2C0IA 2ITVA 3SDJA 5KMLA 2ONLC 1XR1A 3IGGA 4RVKA 2OLCA 4IAAA 4UY9A 3UNKA 4G1WA 4D55A 3PVBA 3NVMB 2RFSA 3SOCA 3CCNA 3NR9A 3ZC6A 1DAWA 4M13A 4ZY4A 1LPUA 3CY2A 3KXZA 4O0UA 3NLBA 3RHXA 3RZBA 4EQCA 2XNOA 3D9VA 4ZSLA 2JDOA 3FKNA 4LV8A 3UIBA 4CMTA 4YGAA 4QTBA 3LLTA 5HG8A 3KCKA 4FT9A 4WBOA 4MBLA 4QTEA 5KBQA 3UBDA 4BGHA 2XYUA 5LVPA 3U9NA 1YDRE 5LJJA 2NO3A 5IA4A 3ZOSA 3HVCA 4BGGA 5DIAA 2A0CX 3PG3A 2IZSA 5GJGA 3VS1A 3KY2A 2WIPA 4NT4A 4ANBA 4XV9A 4O0VA 3MH1A 4FKUA 4ZSJA 2CKEA 4ANOA 2R3LA 3QC9A 4MXAA 4J53A 4R3PA 3R9HA 3VS5A 5LXMA 1UWHA 5EHOA 2VWZA 4IX5A 2WTDA 3AC3A 1V1KA 4FSMA 4E4LA 2HWOA 4CLIA 2YM7A 4EC8A 3VS2A 3G6HA 4AG8A 1ND4A 4CMUA 4A7CA 3F2NA 5HVJA 2W1DA 2W4KA 4HVSA 4HW7A 1NY3A 5CSWA 4Y5HA 2OO8X 4EEVA 2IW8A 1YXSA 3UO6A 4AGCA 1MRVA 3RM6A 3U6HA 3SX9A 4M15A 3NGAA 4FV8A 4V01A 1VYZA 3TT0A 4YTHA 4E8AA 3ZM9A 4DTKA 3JS2A 3V01A 5CU2A 3KRXA 5J1WA 4DBXA 4TYHA 4DA5A 2J4ZA 1WBVA 2J5FA 5AP7A 2UV2A 2GNLA 2XNMA 4C8BA 4GG5A 4F64A 4XG4A 1XBCA 3AD5A 3IPHA 3DB8A 4FIJA 5HLPA 2O8YA 2G15A 2IVVA 4DN5A 3CJGA 3DTWA 5EM5A 3O0GA 3Q3BA 3EN4A 3OCGA 2YISA 4NM5A 4W9XA 3W2RA 3S2PA 1PKDA 3R1NA 3UC3A 3UQFA 2V7OA 4EH3A 3DLSA 4AE9A 4AN9A 2FSMX 5CASA 4DCAA 5C27A 1P5EA 3MPMA 3RINA 4BCFA 4FE2A 3QLGA 3BQCA 1Y6BA 3E62A 4J7BA 3FPQA 4CFNA 3R7IA 5DHJA 5EW8A 1PXKA 1OM1A 3DNEA 4L7SA 4ENXA 4RRVA 3SHEA 3WBLA 4MWIA 4X7QA 4TWOA 5KO1A 4XMOA 3NUNA 1GZ8A 1XH6A 5IMEA 4O6EA 4D1SA 1PYXA 3FQHA 1JKKA 4DEAA 3PSCA 4FGBA 4RFMA 4DEDA 2UW9A 3FMJA 1Z5MA 4NW5A 4QP7A 5H8EA 3G0FA 3FY0A 5AUTA 5D10A 4FEQA 5JN2A 2E9NA 4ALVA 3RBWA 2J0MB 4GU9A 4WNOA 4FNWA 3FEGA 1RJBA 3EB0A 1JVPP 2QO7A 2A27A 5CQWA 2FB8A 2QOLA 3NYXA 2NRYA 4TPTA 3GB2A 4KSPA 4O38A 3SXSA 4LMUA 4O2PA 3T9IA 3ENHA 3Q32A 4ZSEA 4BCNA 4C37A 5HEZA 4HOKA 2J50A 4AT3A 3DAEA 5F1ZA 4F7SA 5JZJA 4PPAA 4X3JA 3DBDA 4UN0C 2UZBA 2C30A 4PQNA 4W8EA 2R0UA 3E8DA 1WBNA 4JBQA 2XJ0A 3MY1A 4UBAA 3QWJA 1LR4A 2UZOA 3FMKA 3MTFA 2WXVA 2QG7A 1YHSA 2CNUA 1RQQA 2JD5A 4J98A 3I0OA 3RPSA 4AGWA 1G5SA 2PUPA 2WQEA 3R8LA 5IH6A 5EYKA 2ETKA 3NUYA 3HEGA 4LM5A 3UODA 4E7WA 5D1JA 5AEPA 5KCVA 4BRXA 2EB3A 4Q9SA 4IBMA 2RFEA 4QMMA 4QYGA 3QC4A 4L68A 2WO6A 2EVAA 2XEZA 5JFVA 2VUWA 4YNOA 1PXNA 5AP3A 3OCSA 5C1QB 3UVQA 4ZS4A 3QA8A 3RPVA 2X7FA 3F7WA 4EOJA 4D4VA 4S30A 3QTWA 5BMMA 4AW2A 5CYIA 1GIJA 5AP5A 2WQOA 4RJ6A 1SZMA 5B2KA 4RLKA 5DN3A 3SQQA 3V8SA 4EL9A 5CS6A 4R1VA 4ZSGA 3ANQA 3IOPA 2UVZA 4R3RA 2YERA 3L8SA 5L8KA 2C6MA 2UZDA 3EQGA 4I93A 4BDIA 4OR5A 2YDIA 4EC9A 3O8PA 2NP8A 3IECA 3MH3A 2WMSA 4L45A 1S9JA 3F2AA 2V7AA 3I6UA 4UV0A 3I6WA 3MYGA 4HYSA 4YZ9A 1WBWA 5DI1A 4JQ7A 2RGPA 3OT3A 4YSJA 1GJOA 4O0SA 4GSBA 2QHMA 1H27A 3OEZA 4L46A 5AADA 5M56A 3M1SA 3ZHPC 5CQUA 4O7TA 4G34A 4ZTNA 3DFAA 4GFGA 3ZDIA 4TWNA 3RVGA 5IMXA 2EB2A 1Q61A 2OIQA 3COMA 2JDTA 2QD9A 4BC6A 3KC3A 1Q8WA 2W99B 3QQHA 4Z16A 2X81A 1M52A 2C6LA 3A2CA 3PVWA 4RGJA 4B7TA 4BHZA 5GZ8A 3BYMA 3KXHA 4N70A 1X8BA 5HIBA 1PHKA 5HICA 2WAJA 3TUBA 3UPZA 4IWPA 5KZ0A 4OAUC 1UWJA 5E8YA 3O8TA 4G6LA 5I3OA 3D2KA 4UZHA 3V3VA 5G1XA 4USEA 3LCSA 3F3UA 4JRNA 4TNDA 4WO5A 3BLRA 5CEPA 2RG6A 4YJTA 2R3IA 2B9FA 2PVKA 4RIYA 4OT6A 3RNYA 4FTMA 3HMPA 1OL7A 2Z7QA 2ZYBA 3EQDA 3RM7A 4YLKA 2WQMA 3I0QA 4KBKA 3UMXA 3HRFA 3V5LA 2X7GA 3ZFYA 5KZIA 1KUTA 1F3MC 5FM3A 4QTAA 5IZFA 3ID6C 3TDVA 3OOGA 2B9JA 3HMIA 5DT3A 3NNWA 5EYDA 4YR8A 1IAJA 2BFYA 5EQYA 4MXZA 5DBXA 5LMBA 5AP2A 1VEBA 4BCKA 3G9NA 1M7NA 4TW9A 3UMWA 4IFCA 4TYGA 4BKYA 4BWKA 4JIKA 3R00A 1GAGA 5HE3A 1BI7A 3CR0A 4QYFA 4H39A 1VR2A 4Y95A 2ZM3A 4W9WA 1IG1A 5LVLA 4EOQA 3WI6A 4FV6A 2UZWE 1H1WA 4BCPA 3RAWA 1UU3A 1KSWA 5A4TA 3O23A 4MYGA 2VTRA 5AX9A 3TZ7A 3UG1A 3MWUA 4FYOA 4CG9A 4FTAA 4TTHB 3FAAA 3PJ2A 3W2SA 3WIGA 2C3LA 3E7OA 3KEXA 5IQDA 3GCVA 3LJ2A 4EWHA 1Y57A 2XBJA 2KTYA 2ZV8A 3BWJA 2P3GX 3PE2A 4FSUA 4EOSA 2YCQA 3FLZA 1W83A 4DH1A 5LMKA 5E8VA 4C4IA 2BZKB 2F7EE 4M68A 3HP5A 3MPTA 5ANJA 1JLUE 4AZEA 2I0HA 3H9FA 3NUXA 4D2PA 2VO0A 1XKKA 1T46A 5KBRA 3G2FA 3UP7A 3IKAA 2PHKA 3FLWA 3LFAA 5J95A 3BQRA 1JWHA 5HU3A 3TZ8A 5F9EA 1KV2A 3UZTA 3Q60A 2LAVA 3ZM4A 5A54A 2X39A 3S1HA 3R22A 3WE8A 4ERWA 5KMKA 3TTJA 3VULA 4BTKA 5ANEA 4OAVB 2XA4A 4IE9A 2UZNA 3ENMA 3B8QA 4ITHA 4YO6A 5ANGA 4QOXA 4YJVA 3R7VA 4EJNA 1Q3DA 3N4VA 3O71A 3CE3A 4GFMA 3CEKA 3HDMA 4MQ1A 3KN5A 3FC1X 3PPZA 2B9HA 2WD1A 3ZYAA 3FSFA 1U5RA 2OICA 2YWVA 2QLUA 3DK6A 3R7EA 1ZYJA 2C5VA 5EOLA 4QYHA 3WARA 2EU9A 1UVRA 4BB4A 4DH3A 1Z57A 3FQEA 5FRIA 3Q6UA 2YLFA 3NNUA 4O0XA 1WVWA 3D2IA 3JUHA 3FLQA 2YCFA 4IAKA 5EHYA 5F95A 4USFA 4JR7A 3QTSA 4O91A 4E1ZA 4EK6A 4ZTMA 5HORA 1KWPA 3H3CA 3PG1A 4PPBA 4EORA 3LQ3A 5F20A 1FVRA 2XMYA 5FXSA 4FVPA 5IQBA 2E2BA 2W1HA 5CF5A 1O6LA 4QQTA 5CZHA 5IDNA 2F57A 3DJ7A 4GIHA 5HKMA 2O3PA 3A7JA 3SG9A 5DEYA 3BZ3A 2I6LA 1CM8A 2C6IA 5HLWA 5FQDC 4B8LA 3PDTA 3GNIB 4PL5A 4FOBA 3N4TA 4GRBA 2UZLA 3RP9A 3FC2A 5KX8A 2XEYA 2VRXA 1IR3A 2PU8A 3BGPA 3VUGA 4XOYA 3PFQA 2QC6A 3IGOA 4GFOA 2HENA 4ZLYA 5GZ9A 3VW8A 5FP6A 1WBOA 2DYLA 5AUUA 4QMUA 2XK9A 4P5QA 3GC0A 3AD6A 4WSQA 3BHTA 3LQ8A 4I3ZA 2C5NA 4LOOA 1VJYA 4O0YA 3I1AA 4M7IA 3ULIA 4NJ3A 3MESA 3EQIA 2RKUA 3C0GA 3BEGA 4U7ZA 3L8PA 4JG7A 1OL1A 4DT9A 1WBSA 2NRUA 5EW9A 2RG5A 4YZBA 3WF8A 4C59A 5BX0A 3D15A 5DA3A 4BCMA 2W96B 4QP6A 4RQVA 2YEXA 4TRLA 2QR8A 4F09A 3PLAE 4FL1A 3VQHA 2C6DA 4MCVA 4MVFA 5M4IA 4FV5A 4LMNA 4FKOA 2GDOA 1DS5A 3VUIA 3NSZA 4DINA 4TT7A 3EMGA 4XX9A 4OTWA 3ORIA 4C58A 2ITOA 4FV3A 3VBQA 1B6CB 1CSNA 3ELJA 4U0IA 3HA6A 4FEUA 4RIWB 4D9TA 2C1BA 3OMVA 4OTPA 4RWIA 4NIFB 4OTQA 3FY2A 4MWHA 5F94A 5CENA 2WHBA 1AD5A 4C36A 2GNGA 5D12A 3CTJA 4DBNA 2WOUA 5ANOA 4A06A 4APPA 5IF1A 4RX7A 4YSMA 4LUDA 5CF8A 5LMKC 3R9DA 3RAKA 5M07A 4JG8A 3KXXA 3LCKA 4DTAA 5CT0A 4CCUA 3TN8A 4R1YA 5A9UA 4BVUA 3FHRA 3QCXA 4Y85A 4FEWA 2GTMA 3SXFA 1PXMA 3OTVA 2DS1A 4P7EA 4UYNA 2R3RA 2VTIA 3OWJA 4S32A 5L2TA 2YIYA 3DDPA 4D2SA 4PMTA 3KXNA 3C0IA 3QRKA 3ERKA 4QP3A 5TKDA 3UVPA 4AXAA 4BN1A 4WSYA 4BZDA 3QTXA 2C3KA 4O27B 5EQEA 3AD4A 2UVXA 4JX3A 5AR3A 4O1PA 3TI1A 2NPQA 4RIWA 4N6ZA 4XBRA 2OXYA 3ACJA 2VTJA 2UZEA 1OL2A 4KS7A 4KB8A 3OHTA 4JL9A 3AMAA 3LJ0A 4U79A 4Z7HA 5A14A 1L8TA 1OITA 4JAIA 2ZDUA 4DH5A 5CSPA 4QPAA 2X2MA 4CXAA 4H1JA 4DG2E 3F2RA 2PPQA 5CAUA 5JK3A 1OBDA 4Z55A 4RWKA 1I44A 1V0PA 3LXPA 4FT7A 4GEOA 3AG9A 4ZTLA 3ZEWA 4I6FA 2V22A 1DI9A 4EUUA 3VBTA 4PTEA 3FMEA 4CGAA 3PY1A 1UU9A 1APME 2A4LA 2IW9A 2HAKA 4LFIA 4QRCA 3W32A 4XV3A 3OT8A 5BVWA 3LM0A 3DXNA 3EIDA 2IVTA 3G15A 4BKJA 1J7LA 5K5XA 4NSTA 3GOPA 5EI6A 5L2QA 4ZLZA 3T3VA 4BIDA 1HOWA 4UWBA 4L6QA 4BBEA 4DGGA 4QMTA 3EQRA 2PVJA 5C9CA 4CFXA 1ZYCA 3HUBA 4NCTA 2C6KA 1OL5A 4S33A 4EWQA 3NZ0A 4Y8DA 4FI1A 4TNBA 2XVDA 4XV1A 4DE4A 4JDKA 1Y6AA 4JBPA 2WNTA 2YZLA 2F7ZE 5FDPA 4FUYA 4R78A 4FG8A 4MD7E 3SW4A 2H34A 4TZRA 5A3XA 1YI3A 1ZMVA 2OF2A 2W17A 3HUCA 2XCHA 3QZHA 5DRBA 2FH9A 4IJPA 2BR1A 4RX5A 3B8RA 1Q97A 4NFNA 4XP3A 1VYWA 5E8WA 3TWJA 4EQMA 3QCSA 4YJRA 2Z2WA 5DT0A 2VTTA 3W18A 4HCVA 4DLJA 5J79A 4J95A 4GG7A 2H9VA 3NNVA 4MQ2A 4BDDA 1LEWA 2RSVA 4H1MA 4TN6A 4R7BA 3R30A 2X8EA 1CDKA 3F3ZA 4YC3A 2PZRA 1M2PA 2PVMA 2CGXA 2RFNA 3NMUF 3EFJA 4XRJA 4AX8A 2XKCA 1MQ4A 3VUHA 4P2KA 3CPBA 5EHLA 4CYIA 2VGOA 4IM2A 4EH2A 2WQNA 4OTRA 5I4NA 3LMIA 1H0WA 2PWLA 3BE9A 5HCXA 3L9NA 4B9DA 4AQCA 5JGBA 3UQCA 3M2WA 3SG8A 5E90A 3G5DA 3ITZA 3PPKA 3U8WA 5HX8A 1NT2A 4GW8A 4FEXA 4Q2AA 4ZK5A 2JKQA 4X2KA 2EXEA 1P4FA 3IONA 3ALOA 3RK5A 2W1EA 3ZDUA 1L3RE 3AOXA 2GPHA 2CCIA 3TV4A 2QQ7A 4FTKA 2OGVA 1I09A 4WD5A 3DU8A 2VTHA 5FG8A 4CZYB 1K2PA 1YXTA 1Q8YA 4ZTQA 4ANSA 3BYOA 3R9NA 3ZBXA 2VTPA 3NYVA 5IQIA 3QHWA 5DYJA 5GIPE 4Q5EA 5AR2A 5FD2A 3OF0A 2W1IA 2R7IA 4L01A 2F4JA 5T6KA 5ACBC 3LXKA 4EK3A 3U6IA 3E5AA 4MXXA 3PSDA 2R3HA 3VC4A 3QU0A 3C4XA 5FEQA 2IVUA 3CKWA 4C7TA 4CV9A 3DK7A 3B2TA 3LLAA 4C38A 5K4IA 3PWYA 4JQ8A 4OTGA 1OL6A 4FTLA 3OWLA 3FWQA 1HCLA 3FMHA 3OROA 2F2UA 3QRIA 4GVJA 3UGCA 4PY1A 2ZM4A 3MSSA 2CDZA 4UALA 5CAQA 5JEBA 4FL2A 4H05A 5E8XA 3C4CA 4GS6A 5ITAA 1V0BA 2RIOA 5M08A 4PNIA 4PUZA 4ZEGA 1ZOGA 2BDJA 5J8IA 2PVFA 4YTFA 1GIHA 4RT7A 4A9SA 3NVKI 4A4XA 4U97A 2R3PA 5E92A 4X6RA 4OLIA 3I5ZA 3WYYA 2J7TA 3BI6A 3FYKX 5BVNA 3EN9A 4BWPA 3REPA 1XBBA 4OTDA 3FZTA 4FSWA 1GZKA 3R71A 5CSHA 3Q04A 3R28A 2BDFA 3ZRLA 4CCBA 2YN8A 5H8GA 5IH5A 3FQSA 1RE8A 2XK3A 3R73A 3U4WA 3OEFX 5BVFA 1QCFA 3C50A 5EFQA 4JLCA 4FSNA 5CI7A 3C4WA 3RAIA 3VS3A 4E3CA 4ZZOA 4DEHA 1U4DA 5HG7A 3UIMA 5B2MA 5FTGA 4B99A 3AC4A 3HL7A 2B52A 1JKTA 3LZBA 5KMNA 3F3VA 4ALWA 1XBAA 3NW6A 3TNQB 5CALA 3C5IA 1QMZA 5JFXA 3FZRA 4HYUA 3R63A 4O22A 3U55A 4FX3A 3ZONA 3FMNA 3UP2A 4NCTC 1UNGA 4FNYA 4R77A 3ZSGA 4C61A 2XF0A 4RVLA 2HELA 5AM6A 3ZUTA 5CVFA 4J8MA 4FA2A 2E9VA 4GT5A 2ZV9A 3DS6A 3G9LX 1U5QA 4MH7A 1FOTA 2WELA 2VO6A 3DZOA 4UWCA 3VHEA 5CEOA 4HPUE 2XZSA 4D1ZA 5D7AA 4WHZA 2Q83A 3NCGA 3A60A 3C9WA 5IQGA 4PL4A 3B2WA 3V5WA 2GHMA 2HYYA 3QTQA 4DG3E 1SVHA 1RW8A 1GOLA 3GOKA 4DEGA 5HD4A 3BKBA 4O7ZA 3RALA 5LARA 5K5NA 2JDRA 3BIZA 1PMUA 3UO4A 3LOKA 3TG1A 2CGVA 3DY7A 4I94A 4I6BA 5AV4A 1XWSA 4NZWB 2C4GA 4TYJA 1NW1A 3FKLA 2PMNX 2C69A 4M12A 4AFEA 3V5QA 4RVMA 5KMOA 5I9ZA 4C3RA 3UYSA 4HCUA 2PL0A 2VNYA 2WPAA 3RK9A 4C4JA 4O0RA 3QGWA 1AGWA 4FSYA 3I5NA 4DF3A 4XNEA 3OCTA 3DKFA 1PYEA 3F88A 5HNGA 3KQ7A 4AF3A 5LVOA 2VWUA 1ATPE 4TL0A 4K8AA 3EJ1A 4ALUA 4K11A 3QUPA 2XIXA 5EKNA 5I9YA 5JRQA 2QU6A 3UNJA 5FXRA 5FEDA 2YIWA 3CQUA 3OBJA 3AQVA 2GS6A 4GV1A 2UZVA 2GS2A 2XK6A 2YAAA 4J71A 4UMUA 4TXCA 3BX5A 2WTKB 3AGLA 3LHJA 5I9UA 4D0WA 4GL9A 2CNVA 4FTTA 3ACKA 4KUJA 1KOAA 2BZIB 3DK3A 4KD1A 3I79A 2WTCA 2IPXA 3UYTA 3PIYA 2WMRA 2X4FA 2J0JA 2JKKA 5DLSA 1FMOE 3PRFA 4XV2A 4BZOA 3PSBA 5CI6A 1URCA 5EK7A 3FI2A 2PVNA 2IZRA 3NEWA 2JIVA 3QLFA 4RJ7A 4BCJA 4DFXE 4IQ6A 3K54A 2GFCA 4FTJA 3UDBA 5GZAA 5DFPA 3KREA 2H8HA 5FP5A 4AT5A 2O63A 3QRJA 1NVRA 4JIAA 3SV0A 4WNPA 4IXPA 2GNJA 3LFEA 2QOOA 4F7JA 3K5VA 2JIUA 2OFUA 3BU6A 4EKLA 4ACMA 4YC8A 1G3NA 2QOFA 4L42A 5C01A 4BBFA 4EBVA 3S00A 4MF0A 3G33A 4YBJA 2HW6A 4HCTA 3UNZA 3Q9ZA 4IANA 4FUXA 1YOMA 4QQJA 5CVGA 3ZLYA 3IDCA 3IK3A 4BCOA 4A9TA 4F7NA 4CT1A 4O7YA 1WCCA 4K2RA 4MHAA 3NAXA 5AFVA 4JX7A 4FKTA 2XRWA 2YZAA 3D5VA 3PVGA 4ZZNA 5IUHA 4XBUA 5L2IA 3W2QA 4FV1A 2ITWA 4A4OA 5JQ5A 5AUYA 3T3UA 5IA3A 5L4QA 4YO4A 5HZNA 4BIBA 4G5PA 5M4FA 1W0XC 2HWPA 4YZDA 4CRLA 5AR7A 1PMNA 2JC6A 3CS9A 3V5PA 1J1BA 1ZMWA 3E8CA 4BDCA 1LUFA 3UE4A 4AZTA 3OXIA 4QT1A 3M42A 3D5WA 4NYEA 3QXPA 4E6CA 1OKZA 4BFMA 2VNWA 2ZMCA 1MRUA 2CLXA 4U43A 4NKSA 3CQEA 3O7LB 4ITIA 3PTGA 4EI4A 4XLIA 2OKRA 5DVRA 2BUJA 1GNGA 2ZOQA 3L8VA 2UW3A 4NKAA 4ASZA 3F3TA 4D4YA 5DR2A 3AMYA 3FMLA 3QA0A 3VHKA 1O9UA 5JMSA 3CD8A 5E8UA 4IFGA 4J1RA 4L3PA 4XYFA 3ZRKA 2Z60A 4QD6A 4CFUA 4F1TA 4B6LA 4FICA 2R3OA 1GIIA 5HI2A 5HGIA 3RCDA 3TZ9A 2QCSA 5HHWA 4G6NA 4L52A 4D58A 1EH4A 2YDKA 4WG4A 3LE6A 4RFZA 4D0XA 4NU1A 1UNLA 4MAOA 4KINA 3CGFA 3EYHA 2ZMDA 4EHZA 4JRVA 2BZJA 3LIJA 2ZAZA 2GU8A 3EZVA 4I22A 2X6DA 2OXXA 2YIQA 4FIFA 4GJ3A 3A8WA 4RSSA 5DE2A 3BWFA 3VAPA 4E4NA 4O6LA 3F5XA 4EQUA 5LVNA 1G8SA 4H3BA 1PXPA 3EQPA 2PUUA 3CJFA 2XNNA 3ZUUA 1Q8ZA 2C5OA 2B54A 2IZTA 4IAYA 3V04A 4ZJVA 2Z7SA 4GT3A 1Q8UA 5LWNA 2XP2A 5KHXA 3WILA 4WT6A 2VTAA 1REJA 4D2WA 3DB6A 5E8TA 4ZAUA 3D83A 3Q9WA 4FV7A 4ZTRA 3TIZA 2QOHA 2OW3A 4S34A 2C5XA 1SNUA 3RMFA 2VTMA 2VWIA 3GP0A 4FZAB 4BGQA 3R0TA 3SRVB 3QQKA 5M4UA 4F1MA 4EOIA 1R1WA 3EFLA 5KKRB 3E7VA 2ETMA 4KIOA 2A19B 4EK4A 4QQCA 4LRKA 3VJOA 4DITA 1J7UA 4LG4A 3P7AA 3EQBA 1J3HA 4I5CA 3QUDA 1UU8A 1T45A 3D14A 5FWKK 2HXQA 3DBEA 2DUVA 3F5GA 3KN6A 1TKIA 4O0TA 5C8MA 3W10A 5JT2A 4BI2A 2PMLX 3ZFMA 4PP7A 4IACA 3A4PA 3O17A 2WMXA 3UOJA 1YOLA 4BWXA 3F69A 3AC8A 3ET7A 3AC5A 4G9RA 4EH4A 1HCKA 4WNMA 3ORLA 2JLDA 4MK0A 2RF9A 4EOOA 3Q96A 3ZH8A 4CZUA 3PWDA 2PK9A 4M67A 2P2HA 4R6VA 1R39A 4X0MA 3UOLA 5CAVA 2QG5A 5CSVA 4C62A 3PXRA 3HNGA 4G6OA 4KNBA 4D5KA 3ANRA 2YWPA 2R9SA 4O2ZA 2G9XA 3SRVA 2OF4A 3VUKA 2PUNA 3R7UA 3HP2A 4K9YA 4D2VA 3NW7A 3M11A 1JKLA 5CZIA 3RK7A 4IC8A 3MW1A 4ZIMA 3Q53A 4FKJA 4I21A 3F82A 2W06A 2P55A 3C4ZA 3OC1A 4FIEA 4ZTSA 5HCYA 3ZO2A 3QX4A 3PLSA 4BI1A 3ATSA 2H96A 5CTPA 2XYNA 2R7BA 3GC8A 4OTFA 4I6QA 5KHWA 4EHEA 3QKLA 3BPRA 3E3BX 3NRMA 5AWMA 5J9ZA 1YOJA 5DG5A 4DT8A 4XG2A 2PZPA 5EM6A 4QMYA 3MIAA 4LL5A 1DM2A 1ZXEA 1ZZ2A 1URWA 2PZYA 3IQ7A 4FZ6A 4N4SA 3BE2A 3R1QA 3KVXA 4XJ0A 1SYKA 1MRYA 5EYCA 3TV6A 1IEPA 1K3AA 2GQGA 4YBKA 2BCJA 4QNAA 3QKKA 3OW4A 4X2NA 3UVRA 4DC2A 3FZSA 5FXQA 4GMYA 2GTNA 5AM7A 4OBOA 4RPVA 3MY0A 4ERKA 3FJQE 3KKVA 1MQBA 3OCBA 3OW3A 5FM2A 3ZO3A 1A9UA 2OG8A 4F65A 2X6EA 5BVOA 3ZO4A 5HE1A 4DH8A 1KE7A 1PXLA 1YHVA 4DFUA 2BILB 4DEIA 3TKHA 5IPJA 2OI4X 4XG6A 3I4BA 5HIDA 3W8LA 3IW8A 3R7YA 4QMNA 4FIHA 3HKOA 4XLVA 5DWRA 4ZTHA 2WMUA 4JI9A 4JBOA 3GCPA 4QO9A 1JSVA 2J0KA 5HTIA 3MTLA 1PKGA 4YJPA 3FE3A 3WOWA 2B9IA 4U80A 2PMOX 5G6VA 3PY3A 2J0LA 2R3KA 2UW5A 3ORNA 4FSQA 4RX8A 5AUVA 4ANQA 3L1SA 2X7OA 3FMMA 4FKLA 4IVDA 5C03A 4PDPA 3W8QA 4EK8A 2IG7A 4YC6A 5D41A 3I7BA 3MB7A 2REIA 2VWBA 3HRBA 3OZ6A 4JT3A 1OI9A 5C26A 4O7LA 3BHVA 3KRWA 4ARKA 5CU0A 5CF4A 4U81A 3UC4A 2I40A 4YPSA 1W84A 4OBQA 3G51A 4F1OA 1ZYDA 4QMSA 5CEMA 4GKHA 3ZUVA 3D0EA 4RLLA 3R01A 4DFBA 3DGKA 3SVVA 2ZV7A 3PA5A 4MXOA 2C47A 3PUPA 4NM3A 4FV2A 4IVCA 2IW6A 4G5JA 4IZ5A 4UYAA 4WKQA 3VS4A 1NA7A 2J90A 2JEDA 1YI6A 3JY0A 3EZRA 4CV8A 4YZCA 3EQHA 1B39A 3HMOA 4E6DA 2YFXA 4C33A 2XK7A 2Q0BA 3EL8A 4F08A 3VS6A 2YIXA 3TKIA 5E7RA 2I0YA 3IDBA 3C13A 5L8LA 4HZSA 4LOQA 5DR6A 2PE0A 3HX4A 4X3FB 1BLXA 4XG3A 3NUPA 5K3YA 5A4EA 3R1SA 5IDPA 2HZ0A 4CG8A 1SVEA 4YUQA 4G16A 4W4VA 4H58A 3POOA 1PRYA 4LGGA 3PIXA 4N6YA 4Y46A 4HVIA 5A4CA 5JFWA 3P23A 3NW5A 3FLSA 4CVAA 5E1SA 3QTIA 2P2IA 4TY1A 3V5JA 4YMJA 5EM7A 4IVBA 5B7VA 4O21A 5BPYA 3EOCA 4BTMA 4CNHA 4IAFA 2CN5A 3LMGA 4ZY5A 5FBNC 4FV4A 2EUFB 3K2LA 2KULA 2PE2A 3R2YA 4Y5QA 2VGPA 4YHFA 3TCPA 3ZEPA 3O51A 4PMPA 3MH0A 2WGJA 3DFCB 5KE0A 4CLJA 5DR9A 2XIYA 2ITQA 3TV7A 4ANMA 1H1SA 2Y6OA 3KFAA 4FL3A 3VBYA 3D5UA 5KKRC 4C35A 2J2IB 4NH1A 5TF9A 1G8AA 5A4QA 5A46A 2VTLA 2BMCA 5ETAA 2X9FA 3DQXA 3PXFA 1H01A 4QP2A 2OU7A 2BIYA 4KABA 3MB6A 3CKXA 3ZZWA 4HVHA 4BF2A 3NAYA 5CWZA 4AFJA 2O65A 5BMSA 4BCQA 3P7BA 3RTPA 1ZRZA 5IQAA 4C57A 4CTCA 3HZTA 3C7QA 4W4XA 2YJRA 3BHHA 3POZA 4EH5A 1IAHA 5HBJA 4FK6A 2PYWA 3MFSA 2WEVA 4H3PA 2YLEA 5AR8A 3N4UA 4E73A 5HTCA 1OIYA 2YHVA 3DLZA 2C6TA 5DGZA 5KMMA 2YDJA 4ID7A 4OBPA 2ITUA 4BI0A 2QONA 3QHRA 4C4GA 4J52A 3OWKA 1H00A 1H26A 2G2FA 4I20A 4IW0A 4MNEB 4AZWA 4F9AA 5AV0A 3ODYX 4FT5A 3AT3A 2J0IA 4J99A 2WOTA 5AR5A 1FINA 2OBJA 3UPXA 4XG7A 4C0TA 3QL8A 4L43A 3JXWA 5KMJA 4I92A 3L8XA 2PE1A 2ITXA 2DWBA 2WMWA 3QQGA 4L44A 4U8ZA 4UMRA 3VWAA 1Q4LA 2G2IA 2JITA 2UW6A 2FSTX 2ZVAA 3GVUA 3CIKA 2WMVA 5DH3A 4M0ZA 3DBQA 3R6XA 4YPDA 4XH6A 2YM4A 3KRLA 4QMPA 4AOTA 4O82A 3PJ1A 4K18A 3MBLA 1OB3A 3W2CA 2CGWA 4M3QA 2JFLA 4GJ2A 2W5AA 3ZSIA 1JAMA 1OPLA 2ZV2A 3TNPC 4U6RA 2NNWB 1VZOA 2OXDA 5DEWA 3GUBA 4JVGA 3MFUA 4UXQA 1W7HA 4WRSA 3DJ5A 4W4WA 4FKGA 2X4ZA 4NIFA 4AZFA 1YW2A 1ERKA 1XH5A 3LFDA 3C51A 3MJ1A 5M09A 4L3JA 4J96A 2IJMA 2XNPA 3V5TA 2FSOX 4GK2A 4RBLA 3QD0A 4IDTA 3QQJA 3VBXA 4AU8A 2BAQA 3EKKA 4OTHA 3SXRA 1QPEA 5ICPA 2W9ZB 1U59A 2PZIA 2W1CA 5HESA 4DFZE 1YWNA 3WIKA 4M69B 2OIDA 3QTUA 4QMVA 1U54B 1ZWSA 4IAIA 3MA6A 5AV2A 3DKGA 2G01A 5A6OA 2FO0A 4AE6A 3PJCA 5M44A 4MX9A 5CEQA 1BMKA 1XH8A 3S3IA 4HJOA 5JGDA 4BR3A 3VBVA 5CAOA 4FT0A 3GU5A 3RI1A 4ANNA 4PF4A 2QKRA 2V55A 4FTNA 1OKWA 4FZDB 4U3YA 3RAHA 3GQIA 3UG2A 5FUTA 3G0EA 3R8ZA 2OJJA 4EBWA 3ZFXA 1QPJA 2BTSA 4IH8A 5AP0A 3LMHA 4N57A 3BV2A 3QFVA 5JSMA 3SD0A 4NWMA 3IG7A 4QMLA 3BGQA 5DRDA 4OTIA 5HG5A 5DPVA 2JAVA 3PXZA 1Q99A 2W9FB 3NUSA 2XM8A 3WZUA 4FBXA 2WU7A 4A07A 5CNOA 4FZFB 4FVRA 1ZOEA 4AGDA 3JR1A 2R64A 3HGKA 3OG7A 1YXUA 1FGKA 2R3GA 4DGNA 4FT3A 1Q41A 4HGSA 4K0YA 3GEQA 1U54A 2OJIA 3UQGA 1JPAA 4F0IA 3KMWA 4WOVA 5ETFA 2BIKB 3K5UA 3FZ1A 3C4FA 4V0GB 4FMQA 4FTCA 5CX9A 5DOSA 1JKSA 2XIZA 5DT4A 4HVDA 2ITYA 3OY3A 1ZLTA 1Q5KA 3NIEA 1UNHA 2GNIA 4GH2A 4KIPA 5JQ8A 1YKRA 3QGYA 3PIZA 5L8JA 3Q5ZA 2WFYA 4AW1A 2VZ6A 3BV3A 3FDNA 2UVYA 2UW4A 3DNDA 4KIKB 4UMTA 3IW7A 2E9UA 3ZC5A 4BTJA 2VN9A 3VW6A 4EH8A 4S2ZA 3TJDA 4X2JA 3LJ1A 4IZAA 1ZOHA 2QVSE 3EN6A 3H10A 4F9BA 4AN3A 1OECA 3HV3A 4JS8A 4PP9A 4U45A 4ZJJA 3TM0A 2C0OA 2O0UA 2AUHA 1H24A 2VO7A 3H4JA 4K1BA 3IO7A 2AYPA 4I4EA 5LVMA 5I9VA 1YWRA 3K3IA 2YITA 2OK1A 5AP4A 3DKCA 2HZ4A 2IWIA 3FXXA 4H3QA 5EDRA 2BHHA 4HNFA 5TOZA 4J97A 1YDTE 2Y9QA 4UZDA 2C1AA 2XBAA 4FVQA 2HW7A 3I81A 3GU7A 3F6XA 2P4IA 3P1AA 4AA4A 2HCKA 2HK5A 3A62A 2WMQA 4RIXB 2C3JA 3E87A 3DZQA 4KIKA 2XNGA 3LVPA 4PDOA 3P08A 4LI5A 3TL8A 5FLFA 4EYMA 1CKPA 5H2UA 2A1AB 3CC6A 3RWPA 3EKNA 1OGUA 4M84A 4YP8A 4IM0A 2QI8A 3H30A 4DCEA 4NJDA 1BX6A 2B7AA 5AX3A 4G3EA 3IW6A 2Z7LA 2R3NA 2VWXA 3IDPA 4XUFA 5T68A 3QRTA 4ASXA 3WF6A 3P0MA 3PPJA 4YTIA 4II5A 3S0OA 2JDVA 2R2PA 3H9OA 3KA0A 4AZVA 4APCA 3ATTA 1R0EA 4IX6A 3EHAA 2XK8A 4FSTA 4RG0A 5AP1A 3LCOA 5IISA 4RX9A 3V8TA 5CF6A 3ZSHA 5IQCA 3VS0A 2WMTA 3MVJA 4NM0A 4QYEA 3P79A 3ZLWA 4ONAA 3DPKA 4AGUA 3P7CA 5LCJA 3LCTA 3N51A 2X8IA 1WFCA 4RIXA 2JBOA 4YNEA 5HOAA 3VNTA 3RHKA 1H1PA 1REKA 3PYYA 1O6KA 2GS7A 5A4LA 2CKPA 1A48A 1R3CA 4XOZA 2PTKA 4FTUA 4BIEA 3MVLA 4IZYA 1M2RA 5AUZA 3MPAA 2GNHA 3A8XA 4BL1A 3LPBA 4E4MA 2H6DA 1OIUA 3TJCA 1FBNA 4E20A 2E9OA 3RKBA 5M06A 3Q9XA 2QOQA 4HZRA 5I9XA 2HZNA 4G3CA 4G9CA 4Z9LA 3WF5A 5GINE 3FL5A 3V6RA 5J87A 3Q52A 1M14A 2BVAA 2BHEA 5HO8A 5AAGA 3D4QA 4IB5A 5EOBA 4ASDA 4CD0A 2HY81 3F66A 3LXNA 1XH7A 4QTCA 1P14A 1BKXA 3AXWA 3P5KA 1K9AA 2WTIA 4CTBA 5FDXA 4FKIA 4DYMA 3ORXA 4IDVA 2FYSA 3NS9A 2YABA 3W55A 2C5YA 4F63A 4M8TA 3HRCA 4U42A 4GK4A 3L9LA 4P5ZA 1ZAOA 4YJOA 4PNKA 1Q3WA 4Q5HA 3UIXA 2WTWA 4GYIA 4TYEA 5B2LA 2ITZA 5C8NA 4LGHA 4ZP5A 2UW7A 2PMIA 5L2SA 2QOKA 3MFTA 2I7QA 4ZOGA 3AMBA 3KMUA 2HIWA 1JBPE 4KRDA 1GZOA 4AW0A 4EHGA 3VUDA 4EZ7A 2CGUA 4J8NA 1H8FA 2XJ1A 2B1PA 2BRMA 3FV8A 3HMNA 3LQ5A 2Z8CA 3QTZA 4HGLA 3BBWA 3R8VA 1FMKA 2XCKA 4AA5A 5BYYA 3BYUA 4BDKA 4MF1A 4KBAA 3CGOA 3JVRA 4MBIA 4EZ3A 3ZXZA 4P90A 4ENYA 5HQ0A 3GU8A 4BDJA 1YWVA 2EXMA 4M0YA 4RJ5A 5AV1A 3RNIA 4I5PA 3KB7A 2W1FA 2XKDA 4YZNA 5D9HA 4TYHB 2PVYA 5HIEA 3TDWA 3SKCA 1YRPA 2OIBA 5DMZA 1XQZA 1CKIA 4GVAA 4IEBA 5H8BA 2PULA 5TR6A 2CCHA 3LXLA 4YJNA 4IAZA 1NVSA 3COIA 5IA1A 5CXHA 3WYXA 2VTQA 2P33A 5JFSA 4FKPA 5HNIX 4NL0A 1YI4A 4EZ5A 5KNJA 4C4EA 4QPMA 3UO5A 4RIOA 5IQFA 2B0QA 3F5UA 3Q4UA 3R02A 4PMSA 2JIIA 3QD4A 5GIOE 2AC3A 4CZTA 3S4QA 5BYLA 3Q9YA 4IB3A 3DXQA 1BI8A 3D5XA 3VBWA 1OIRA 2VTSA 3GXLA 4K77A 3K3JA 5C4LA 1WVXA 1STCE 3UTOA 4N0SA
chains in the Genus database with same CATH superfamily
4FKQA 4IIRA 2AEGA 3CSVA 3A7FA 4JDJA 4G3GA 3PXQA 3CY3A 2XM9A 3O7LD 4XG9A 2F7XE 2OZOA 2QNJA 2X2KA 3FXWA 3NWWA 3CTHA 2VAGA 2I0EA 4NW6A 4FNXA 4IWDA 4AUAA 4F6SA 4BBMA 3IW4A 4QTDA 4F99A 3W0NA 4EJ7A 4DAWA 1XMLA 3HAMA 1H1QA 4FIIA 5BQ0A 5IUGA 3NUAA 3GI3A 3AC1A 1G8KA 4F0GA 3ZBFA 4EOLA 3EFWA 5KUPA 4KS8A 1OVEA 4FSZA 5BVDA 4XRLA 5E91A 3RPYA 3ORMA 4JJRA 5TT7A 3QD2B 3HV4A 3BYVA 3KU2A 3KF4A 4YLJA 5HO7A 3A99A 4IM3A 3W16A 2RL5A 5ANKA 5FTOA 4G2FA 1O6YA 1F5QA 3RPOA 5L6OA 3RWQA 2IVSA 4UB7A 3P4KA 3V51A 4AOJA 2FVDA 3QQLA 2EWAA 1B38A 3E92A 5K0KA 4ZSAA 1E1VA 4DEBA 2DQ7X 1BL7A 1J1CA 2WMBA 3LFSA 4I24A 4IB1A 5DNRA 4M66A 5TO8A 1KE5A 3FI8A 3D94A 4BTFA 2V0DA 3AC2A 5JH6A 2GHGA 2XJ2A 2BFXA 2PVRA 2BAJA 4BYJA 3ROCA 3FBVA 5AUXA 2X0GA 4L53A 5B0XA 4DGLC 3TKUA 3OS3A 1IA8A 4XP0A 2BRGA 4RJ4A 3WZEA 5HNBA 4JDHA 4FKWA 4MD9E 2XK4A 1M2QA 3HDNA 4FG9A 4KKEA 3C5UA 2GNFA 5TE0A 4E4XA 3OY1A 4BICA 4WRGA 3HECA 3A4OX 4E5AX 5ANDA 3DA6A 4LGDA 3FKOA 3IOKA 3MY5A 1CTPE 5EDPA 4FKRA 4UMQA 4O7RA 3MN3A 3BLHA 1PMEA 4ZLOA 4YLLA 3VUMA 2FGIA 1OZ1A 3C4EA 2J5EA 3C0HA 1ZZLA 5F4NA 4D4RA 1XJDA 2R3MA 2XS0A 4FOCA 1ZARA 1W98A 3IW5A 4IVAA 5FBOA 3E93A 1TQPA 4TKSA 4C4FA 4IX4A 3I60A 4CRSA 3R9RA 3QX2A 4L67A 5IA2A 3CXWA 3W1FA 2VWYA 5K0XA 3FHIA 4IX3A 5CANA 4IADA 4HYHA 5AA8A 2UW8A 4V04A 4LL0A 3DT1A 1ZY4A 3VRZA 3IS5A 2W4OA 2Y4IB 3JY9A 1QPCA 3ORZA 2VU3A 3F7ZA 3QYZA 4GUEA 3UZPA 3VIDA 3ZXTA 4C3FA 1JOWB 4R8QA 3VONA 4BYIA 3KRRA 3R7OA 1QL6A 1WBTA 4X21A 2VV9A 3V8WA 2JAMA 4CQGA 5L3AA 3AKLA 1OIQA 3FSKA 4XG8A 1YDSE 4I4FA 4PWNA 5HD7A 4QMQA 4JQEA 4BHNA 1ZY5A 3GU4A 3FI4A 4F70A 3WZDA 5BV3A 1PXIA 3SA0A 3FZOA 2OJFE 4L9IA 4LUEA 1YXVA 3VF8A 3RJCA 4CKRA 3E3PA 5I0BA 5IQHA 2HZIA 3SW7A 3TNHA 3CLYA 4I0RA 1WZYA 3TTIA 4DLIA 4PRJA 3VRYA 2YACA 4U5JA 2Y4PA 3FL4A 1WBPA 2CN8A 4L00A 4ACHA 3UZRA 4G31A 4PV0A 1H1RA 1W2DA 4JR3A 2C6OA 2OZAB 4X2FA 3OTUA 3TXOA 3FXZA 5H3QA 3GFWA 1FVTA 3T8OA 3W0SA 4RIYB 2BPMA 5E8SA 4LRJA 1PF8A 2BAKA 1R0PA 2BKZA 2AQXA 1JSUA 2CKOA 5CNNA 5BUIA 3F5PA 2G2HA 3L9MA 2XKFA 5CEKA 4MTAA 2GSFA 5E8ZA 2CPKE 4NTSA 4NUSA 5BUEA 4RZWA 2W1ZA 1GY3A 2B4SB 4B0GA 3E8NA 4O86A 3NCZA 3A7IA 2WTKC 2ZB1A 4UX9A 3GC9A 2R3JA 4WIHA 2VWWA 5KMIA 5EH0A 2CSNA 2GMXA 1YHWA 4BDBA 3DKOA 4CFFA 3BGZA 4IHPA 4JXFA 3ZRMA 4QMWA 1OKVA 3FMDA 4YZMA 4EH9A 1H07A 4I0TA 3PZHA 4ZS0A 3OD6X 4O7SA 3EQFA 3DAJA 3I7CA 3LAUA 4AP7A 1LP4A 5J1VA 3QBNA 5AIRA 1KE8A 4DFLA 3QF9A 4OW8A 1BYGA 3COHA 2HXLA 2QURA 4WA9A 2OZAA 4MXCA 1A06A 2XH5A 1P4OA 1XO2B 3Q2MA 5AIKA 1Q24A 1P2AA 3PJ8A 2WEIA 4DG0E 1J91A 4BZNA 5ETIA 3WE4A 3ZLXA 4AWIA 5CU4A 5C4KA 3EH9A 4U44A 4O83A 2Z7RA 3MH2A 4RMZA 3NIZA 4GCJA 2OH0E 5JGAA 2JFMA 3QZIA 1IASA 4C2VA 2ITPA 3O2MA 3O8UA 3QKMA 4MD8E 5BNJA 4O7NA 2VD5A 2IEWA 3U9CA 4AACA 4UMPA 5M51A 2JBPA 4Y83A 5LCKA 3PJ3A 1FGIA 4D2TA 3LFBA 3BHUA 4LOPA 2O5KA 2XB7A 3QYWA 3PA3A 4PMMA 2ITTA 5JRSA 5AA9A 2W4JA 2GFSA 3Q2JA 3KF7A 5EW3A 2XRUA 4BCGA 2B53A 2W5HA 1IA9A 2QLQA 2BZHB 3QRUA 4S31A 4F9CA 2Q0NA 3QTRA 3FZPA 1DAYA 4EOPA 3LKMA 3QZFA 3LCDA 3FI3A 5CVHA 5HO6A 5J9LA 4JNWA 2LGCA 4L3LA 5HVKA 5EYMA 3U54A 2CNQA 1MP8A 2YM3A 4E93A 3TUCA 2HOGA 2YAKA 4TYIA 2PY3A 3VVHA 4YHJA 4PDYA 2CLQA 3HA8A 4DFNA 4ORKA 1M17A 1PXJA 2Y8OA 1OPJA 4FSRA 2XIRA 3G90X 2R4BA 3MVMA 5CLPA 2G1TA 2W05A 2ZB0A 4QNYA 3JVSA 4U3ZA 4DEEA 5E1EA 2R5TA 5L2WA 3ULZA 2C3IB 2C6EA 4AS0A 1H08A 3NPCA 4MBJA 5I5ZA 2VWVA 2B55A 2XIKA 3UIUA 3ZU7A 2GQRA 3MV5A 4C2WA 5CEIA 4FG7A 1UV5A 2UW0A 4QP8A 1SMHA 3HYHA 4D4SA 4U41A 3NNXA 5D11A 1ZMUA 4OUCA 2GQSA 4I1ZA 1S9IA 4MEDA 3L9PA 4X2GA 4YURA 2J9MA 5HCZA 4FR4A 1R78A 4FTIA 4FTQA 3ZMMA 2Y7JA 1WVYA 3EL7A 5HBEA 4ZZMA 4K6ZA 1E9HA 2QHNA 2PUIA 4K33A 2X0QA 4F6UA 4EKKA 3BLQA 5BVEA 4F4PA 3R8MA 3ROYA 1BUHA 1IRKA 4R7IA 3OFMA 4U40A 2A98A 4EOMA 2W5BA 3GCUA 2O2UA 2X8DA 1JNKA 4FTRA 1FQ1B 4DGMA 4QYYA 4XCUA 3U87A 2Y4IC 1Y91A 3BCEA 5LMAA 4GIIA 3ZCLA 4IWQA 3MJ2A 1Z9XA 2OJGA 3A7HA 3LFNA 3OUNB 4R3CA 2BRNA 4RWJA 5HBHA 2PZ5A 3GU6A 3VS7A 3MS9A 3MDYA 2YM8A 4ZXTA 3R8UA 5HX6A 4FTOA 5H9BA 1ZYSA 4Y73A 3TNIA 5CT7A 2OJ9A 3UOKA 2EXCX 3PXKA 3HV7A 5T3QA 4I0SA 4KBCA 4Z3VA 2JDSA 2QO9A 3Q6WA 2AC5A 3H0ZA 4C3PA 2VX1A 4FV0A 5ANIA 4BDEA 3AT2A 1XH4A 1YQJA 4IWOA 4XP2A 2ZJWA 5I3RA 4HGEA 4I5HA 2I1MA 4AAAA 4B8MA 4EK5A 5AUWA 4EOKA 5IUIA 2A2AA 4X3FA 3HLLA 2IZUA 4F9YA 2YM6A 4FNZA 5LWMA 4BCHA 5FEEA 3E8EA 5IA0A 3ZLSA 1XMMA 2XAOA 5BVKA 4MXYA 2WZJA 3GC7A 2HY0A 4LYNA 4YTCA 3HV5A 1SNXA 3BEAA 5FGKA 1TVOA 2V5QA 4PL3A 3EN5A 4R5YA 3V6SA 5AAEA 3MFRA 3PY0A 4EHVA 3II5A 1WMKA 2X1NA 2QOBA 1F0QA 1H25A 2WTVA 3O96A 4UXLA 2J51A 3HMMA 4CMOA 5HU9A 5IEXA 2BROA 4O7VA 4FC0A 1RDQE 3R04A 5IA5A 4ZMEA 4F7LA 4ZMFA 2ESMA 4WUAA 2XUUA 2CKQA 4ACDA 1NXKA 1TQIA 4NEUA 3FYJX 3DOGA 3DQWA 3TNWA 4V05A 3Q5IA 3LW0A 4PX6A 1H28A 3OVVA 2WU6A 2BTRA 3LFCA 1AQ1A 4M97A 4D28A 3E88A 1YVJA 2BDWA 4P4CA 4I41A 5E9EA 1Q62A 2ETRA 5ETCA 3FLNC 1Y8GA 4FZ7A 4QP4A 3UDSA 5M55A 4JOAA 3RGFA 2PVLA 4I5MA 4ITJA 4G17A 2C68A 4BJJB 3BRBA 3LM5A 3A7GA 3BHYA 3VF9A 4D2RA 1SVGA 4CSVA 1DI8A 3QQFA 3H0YA 4RQKA 4RWLA 4G3DA 3TIYA 4WNKA 5AJQA 4L8MA 5BUJA 3ZZEA 1M7QA 2WQBA 3Q4TA 4ACGA 4HGTA 4L7FA 2NYAA 5L6WL 3FLYA 4GU6A 5EKOA 1JQHA 1PJKA 4FKVA 4QMOA 4O84A 2QODA 2WMAA 3KCFA 1U46A 3P78A 3W33A 2RFDA 5E4HA 3QQUA 4QP1A 2BRBA 4BDGA 4AA0A 5AMNA 4MNEA 4Y72A 5EDQA 4RVTA 3KGAA 4W8DA 4QMXA 2V62A 4NK9A 5EM8A 5LQFA 3MVHA 3E63A 4QP9A 4RC2A 5IQEA 1H4LA 3BU5A 2VX0A 1UA2A 3SLSA 2ACXA 4F0FA 3CPCA 3TUDA 3W0RA 4BDFA 2X2LA 3R2BA 4GKIA 1MUOA 3PE1A 5FTQA 2F49A 3A61A 4WUNA 5M4CA 1XH9A 3PP0A 4X6QC 4D9UA 1OPKA 3QAME 4FK3A 3WZJA 4W4YA 1OBGA 2QOIA 2W7XA 4IB0A 3VJNA 3PP1A 3Q4CA 1PMVA 3JPVA 3LFQA 4BJJA 2YCRA 5CU6A 5AAFA 3RPRA 4CT2A 4I6HA 4NFMA 2Y6MA 4XS2A 4A4LA 4HYIA 3W0OA 3D7TB 1UKHA 4EH6A 3KMMA 5IEVA 4BKZA 5JKGA 4FIGA 4RJ3A 3W2OA 3ORTA 4B4LA 3WF7A 2BKKA 3SC1A 1CMKE 4LRMA 2PVHA 3R83A 4AOIA 3QXOA 5A6NA 1NVQA 4LV5A 2GCDA 2QOCA 2W1GA 5IU2A 4CFWA 2VTNA 4FGRA 3BU3A 4CEGA 1KE6A 1W8CA 4XEYA 5GNKA 4BDAA 3OUKA 4ANLA 4CFVA 2VO3A 1JSTA 1PW2A 2X9EA 2YIRA 3TZMA 4O1OA 4RC4A 3MGYA 3QWKA 4JBVA 3WF9A 4AXCA 3WZKA 3ZTXA 3ORKA 2O64A 3VUTA 4YU2A 2F2CB 3RZFA 1ZYLA 4RJ8A 5CY3A 3QUEA 4M14A 4PTGA 4TWCA 5L6PA 5IKWA 4WG5A 1OKYA 2ERKA 2FA2A 3BYSA 3DBCA 5M57A 4M69A 4EH7A 2CMWA 5CXZA 3EN7A 2XNBA 3ZS5A 4EUTA 4O0WA 4ACCA 2GHLA 1UKIA 3DAKA 4E6QA 5HTBA 3KIOC 4DH7A 1Q8TA 2BRHA 3DTCA 1W82A 3MI9A 4ZY6A 4Z7GA 5C8KA 3HV6A 4U9AA 5EI2A 4Q9ZA 4AQKA 3D7TA 3F61A 5GJDA 4X3FC 3NX8A 5HE0A 3GGFA 1XHAA 5K9IA 1FVVA 4DHFA 3EQCA 4F9WA 3GCSA 2UUEA 1H0VA 4JAJA 4KSQA 4ZJIA 4FF8A 3GENA 1PXOA 3EYGA 4IMYA 5EG3A 3SAYA 4QEBA 3UOHA 4QPSA 4WBBB 2ITNA 4AN2A 4E6AA 3AGMA 4GK3A 3W2PA 5EQPA 3KULB 2QO2A 3NYNA 4FKSA 3HAVA 3G6GA 3OBGA 3TEIA 2ONLA 2XNEA 3BELA 3CTQA 4KKGA 2VX3A 3U4UA 3GCQA 4UEUA 4R7HA 5HE2A 4BCIA 4O7WA 2WTJA 4YJQA 3U51A 5CSXA 1LEZA 3R8PA 4GUBA 3EFKA 3N9XA 2UZTA 3O50A 5JZNA 3P86A 1CKJA 4MNFA 1Y8YA 3PZEA 3PA4A 2ZM1A 1FPUA 4USDA 4FV9A 2OWBA 3DBFA 4V0GA 4CFMA 2OH4A 3QCQA 4KWPA 2WB8A 4EYJA 4G3FA 3EWHA 4RZVA 3VO3A 2PSQA 4A9RA 3LFFA 3C1XA 5HVYA 4H36A 4KAOA 5LOHA 3OXZA 4HPTE 4CQEA 1OUKA 5EI8A 3ETAA 4DGOA 3CD3A 1WAKA 4KRCA 5I9WA 3TACA 1KOBA 2OFVA 4GT4A 4E26A 3JYAA 3P9JA 4RA4A 4AZSA 5J7BA 3OOMA 3QCYA 4O96A 1E1XA 4OGRA 4QMZA 3NYOA 5D7VA 3S95A 4C34A 1UU7A 3KULA 5IH4A 4XHKB 5HG9A 4E5WA 2CHLA 3KRJA 3DCVA 4KA3A 3FUPA 3KXMA 3ALNA 2OSCA 4YJSA 5J5SA 2R0IA 4R5SA 4UWYA 3KXGA 3D7ZA 2XAMA 3SOAA 3RCJA 3COKA 5CAPA 5IG1A 5AV3A 4BDHA 2E9PA 5M53A 3QALE 4JDIA 4NTTA 5ACKA 4RA5A 2R3QA 4PTCA 4FEVA 3F3WA 3KK9A 5AP6A 1YXXA 4IJ9A 3KK8A 3NDMA 4GYGA 3T9TA 5GJFA 5IEYA 4RFYA 3ORPA 4IZ7A 4KIQA 3VQUA 3VN9A 3DXPA 3ZO1A 3GQLA 3MIYA 1TQMA 3QZGA 4CKIA 3BBTB 3OP5A 4RC3A 4WG3A 4ASEA 5HLNA 4NM7A 2P0CA 2VTOA 5J7HA 3KL8A 4C02A 3MA3A 2QKWB 4YHTA 2J6MA 2YM5A 1SM2A 4AT4A 4LQMA 2JKMA 1BL6A 3H9RA 5GHVA 3GBZA 4PPCA 2IO6A 4BY9E 1OMWA 2JGZA 4DTBA 4FYNA 4A9YA 3UJGA 1KV1A 2Z02A 4C4HA 2YA9A 1V0OA 3CP9A 5J9YA 2WIHA 4MKCA 4D1XA 4DFYA 4JG6A 3R21A 5J5TA 1KE9A 3R9OA 2JKOA 3R1YA 2ZDTA 2ERZE 4YJUA 3PUFC 3BL7A 4AW5A 4CKJA 2BALA 1OUYA 2QR7A 3CQWA 3AT4A 5CU3A 3NUUA 1J7IA 2IN6A 4D5HA 4JMQA 2FSLX 2WKMA 3E64A 4FODA 3DV3A 3F9NA 4PDSA 4EONA 2UZUE 5K4JA 3QD3A 4E5BA 2FUMA 3U6JA 3SGCA 5AR4A 3DDQA 3GFEA 4OT5A 1QPDA 2W0JA 3OWPA 4TWPA 2C0TA 4IC7A 3OXTA 3DJ6A 1PY5A 4O81A 3R7GA 2CJMA 3PVUA 3PRIA 4I23A 4HVGA 2I0VA 3ODZX 3Q4ZA 4F6WA 2YJSA 3GT8A 3THBA 4A9UA 4CYJA 2YCSA 4QQ5A 2SRCA 5BYZA 2QU5A 1GZNA 2R3FA 2F9GA 3KVWA 4HNIA 3FPMA 3PXYA 4KKHA 3CBLA 2Y0AA 2XKEA 2C0IA 2ITVA 3SDJA 5KMLA 2ONLC 1XR1A 3IGGA 4RVKA 2OLCA 4IAAA 4UY9A 3UNKA 4G1WA 4D55A 3PVBA 3NVMB 2RFSA 3SOCA 3CCNA 3NR9A 3ZC6A 1DAWA 4M13A 4ZY4A 1LPUA 3CY2A 3KXZA 4O0UA 3NLBA 3RHXA 3RZBA 4EQCA 2XNOA 3D9VA 4ZSLA 2JDOA 3FKNA 4LV8A 3UIBA 4CMTA 4YGAA 4QTBA 3LLTA 5HG8A 3KCKA 4FT9A 4WBOA 4MBLA 4QTEA 5KBQA 3UBDA 4BGHA 2XYUA 5LVPA 3U9NA 1YDRE 5LJJA 2NO3A 5IA4A 3ZOSA 3HVCA 4BGGA 5DIAA 2A0CX 3PG3A 2IZSA 5GJGA 3VS1A 3KY2A 2WIPA 4NT4A 4ANBA 4XV9A 4O0VA 3MH1A 4FKUA 4ZSJA 2CKEA 4ANOA 2R3LA 3QC9A 4MXAA 4J53A 4R3PA 3R9HA 3VS5A 5LXMA 1UWHA 5EHOA 2VWZA 4IX5A 2WTDA 3AC3A 1V1KA 4FSMA 4E4LA 2HWOA 4CLIA 2YM7A 4EC8A 3VS2A 3G6HA 4AG8A 1ND4A 4CMUA 4A7CA 3F2NA 5HVJA 2W1DA 2W4KA 4HVSA 4HW7A 1NY3A 5CSWA 4Y5HA 2OO8X 4EEVA 2IW8A 1YXSA 3UO6A 4AGCA 1MRVA 3RM6A 3U6HA 3SX9A 4M15A 3NGAA 4FV8A 4V01A 1VYZA 3TT0A 4YTHA 4E8AA 3ZM9A 4DTKA 3JS2A 3V01A 5CU2A 3KRXA 5J1WA 4DBXA 4DDGA 4TYHA 4DA5A 2J4ZA 1WBVA 2J5FA 5AP7A 2UV2A 2GNLA 2XNMA 4C8BA 4GG5A 4F64A 4XG4A 1XBCA 3AD5A 3IPHA 3DB8A 4FIJA 5HLPA 2O8YA 2G15A 2IVVA 4DN5A 3CJGA 3DTWA 5EM5A 3O0GA 3Q3BA 3EN4A 3OCGA 2YISA 4NM5A 4W9XA 3W2RA 3S2PA 1PKDA 3R1NA 3UC3A 3UQFA 2V7OA 4EH3A 3DLSA 4AE9A 4AN9A 2FSMX 5CASA 4DCAA 5C27A 1P5EA 3MPMA 3RINA 4BCFA 4FE2A 3QLGA 3BQCA 1Y6BA 3E62A 4J7BA 3FPQA 4CFNA 3R7IA 5DHJA 5EW8A 1PXKA 1OM1A 3DNEA 4L7SA 4ENXA 4RRVA 3SHEA 3WBLA 4MWIA 4X7QA 4TWOA 5KO1A 4XMOA 3NUNA 1GZ8A 1XH6A 5IMEA 4O6EA 4D1SA 1PYXA 3FQHA 1JKKA 4DEAA 3PSCA 4FGBA 4RFMA 4DEDA 2UW9A 3FMJA 1Z5MA 4NW5A 4QP7A 5H8EA 3G0FA 3FY0A 5AUTA 5D10A 4FEQA 5JN2A 2E9NA 4ALVA 3W0PA 3RBWA 2J0MB 4GU9A 4WNOA 4FNWA 3FEGA 1RJBA 3EB0A 1JVPP 2QO7A 2A27A 5CQWA 2FB8A 2QOLA 3NYXA 2NRYA 4TPTA 3GB2A 4KSPA 4O38A 3SXSA 4LMUA 4O2PA 3T9IA 3ENHA 3Q32A 4ZSEA 4BCNA 4C37A 5HEZA 4HOKA 2J50A 4AT3A 3DAEA 5F1ZA 4F7SA 5JZJA 4PPAA 4X3JA 3DBDA 4UN0C 2UZBA 2C30A 4PQNA 4W8EA 2R0UA 3E8DA 1WBNA 4JBQA 2XJ0A 3MY1A 4UBAA 3QWJA 1LR4A 2UZOA 3FMKA 3MTFA 2WXVA 2QG7A 1YHSA 2CNUA 1RQQA 2JD5A 4J98A 3I0OA 3RPSA 4AGWA 1G5SA 2PUPA 2WQEA 3R8LA 5IH6A 5EYKA 2ETKA 3NUYA 3HEGA 4LM5A 3UODA 4E7WA 5D1JA 5AEPA 5KCVA 4BRXA 2EB3A 4Q9SA 4IBMA 2RFEA 4QMMA 4QYGA 3QC4A 4L68A 2WO6A 2EVAA 2XEZA 5JFVA 2VUWA 4YNOA 1PXNA 5AP3A 3OCSA 5C1QB 3UVQA 4ZS4A 3QA8A 3RPVA 2X7FA 3F7WA 4EOJA 4D4VA 4S30A 3QTWA 5BMMA 4AW2A 5CYIA 1GIJA 5AP5A 2WQOA 4RJ6A 1SZMA 5B2KA 4RLKA 5DN3A 3SQQA 3V8SA 4EL9A 5CS6A 4R1VA 4ZSGA 3ANQA 3IOPA 2UVZA 4R3RA 2YERA 3L8SA 5L8KA 2C6MA 2UZDA 3EQGA 4I93A 4BDIA 4OR5A 2YDIA 4EC9A 3O8PA 2NP8A 3IECA 3MH3A 2WMSA 4L45A 1S9JA 3F2AA 2V7AA 3I6UA 4UV0A 3I6WA 3MYGA 4HYSA 4YZ9A 1WBWA 5DI1A 4JQ7A 2RGPA 2IF8A 3OT3A 4YSJA 1GJOA 4O0SA 4GSBA 2QHMA 1H27A 3OEZA 4L46A 5AADA 5M56A 3M1SA 3ZHPC 5CQUA 4O7TA 4G34A 4ZTNA 3DFAA 4GFGA 3ZDIA 4TWNA 3RVGA 5IMXA 2EB2A 1Q61A 2OIQA 3COMA 2JDTA 2QD9A 4BC6A 3KC3A 1Q8WA 2W99B 3QQHA 4Z16A 2X81A 1M52A 2C6LA 3A2CA 3PVWA 4RGJA 4B7TA 4BHZA 5GZ8A 3BYMA 3KXHA 4N70A 1X8BA 5HIBA 1PHKA 5HICA 2WAJA 3TUBA 3UPZA 4IWPA 5KZ0A 4OAUC 1UWJA 5E8YA 3O8TA 4G6LA 5I3OA 3D2KA 4UZHA 3V3VA 5G1XA 4USEA 3LCSA 3F3UA 4JRNA 4TNDA 4WO5A 3BLRA 5CEPA 2RG6A 4YJTA 2R3IA 2B9FA 2PVKA 4RIYA 4OT6A 3PFYA 3RNYA 4FTMA 1ST4A 3HMPA 1OL7A 2Z7QA 2ZYBA 3EQDA 3RM7A 4YLKA 2WQMA 3I0QA 4KBKA 3UMXA 3HRFA 3V5LA 2X7GA 3ZFYA 5KZIA 1KUTA 1F3MC 5FM3A 4QTAA 5IZFA 3ID6C 3TDVA 3OOGA 2B9JA 3HMIA 5DT3A 3NNWA 5EYDA 4YR8A 1IAJA 2BFYA 5EQYA 4MXZA 5DBXA 5LMBA 5AP2A 1VEBA 4BCKA 3G9NA 1M7NA 4TW9A 3UMWA 4IFCA 4TYGA 4BKYA 4BWKA 4JIKA 3R00A 1GAGA 5HE3A 1BI7A 3CR0A 4QYFA 4H39A 1VR2A 4Y95A 2ZM3A 4W9WA 1IG1A 5LVLA 4EOQA 3WI6A 4FV6A 2UZWE 1H1WA 4BCPA 3RAWA 1UU3A 1KSWA 4FJVA 5A4TA 3O23A 4MYGA 2VTRA 5AX9A 3TZ7A 3UG1A 3MWUA 4FYOA 4CG9A 4FTAA 4TTHB 3FAAA 3PJ2A 3W2SA 3WIGA 2C3LA 3E7OA 3KEXA 5IQDA 3GCVA 3LJ2A 4EWHA 1Y57A 2XBJA 2KTYA 2ZV8A 3BWJA 2P3GX 3PE2A 4FSUA 4EOSA 2YCQA 3FLZA 1W83A 4DH1A 5LMKA 5E8VA 4C4IA 2BZKB 2F7EE 4M68A 3HP5A 3MPTA 5ANJA 1JLUE 4AZEA 2I0HA 3H9FA 3NUXA 4D2PA 2VO0A 1XKKA 1T46A 5KBRA 3G2FA 3UP7A 3IKAA 2PHKA 3FLWA 3LFAA 5J95A 3BQRA 1JWHA 5HU3A 3TZ8A 5F9EA 1KV2A 3UZTA 3Q60A 2LAVA 3ZM4A 5A54A 2X39A 3S1HA 3R22A 3WE8A 4ERWA 5KMKA 3TTJA 3VULA 4BTKA 5ANEA 4OAVB 2XA4A 4IE9A 2UZNA 3ENMA 3B8QA 4ITHA 4YO6A 5ANGA 4QOXA 4YJVA 3R7VA 4EJNA 1Q3DA 3N4VA 3O71A 3CE3A 4GFMA 3CEKA 3HDMA 4MQ1A 3KN5A 3FC1X 3PPZA 2B9HA 2WD1A 3ZYAA 3FSFA 1U5RA 2OICA 2YWVA 2QLUA 3DK6A 3R7EA 1ZYJA 2C5VA 5EOLA 4QYHA 3WARA 2EU9A 1UVRA 4BB4A 4DH3A 1Z57A 3FQEA 5FRIA 3Q6UA 2YLFA 3NNUA 4O0XA 1WVWA 3D2IA 3JUHA 3FLQA 2YCFA 4IAKA 5EHYA 5F95A 4USFA 1TZDA 2X0OA 4JR7A 3QTSA 4O91A 4E1ZA 4EK6A 4ZTMA 5HORA 1KWPA 3H3CA 3PG1A 4PPBA 4EORA 3LQ3A 3UDZA 5F20A 4DHZA 1FVRA 2XMYA 5FXSA 4FVPA 5IQBA 2E2BA 2W1HA 5CF5A 1O6LA 4QQTA 5CZHA 5IDNA 2F57A 3DJ7A 4GIHA 5HKMA 2O3PA 3A7JA 3SG9A 5DEYA 3BZ3A 2I6LA 1CM8A 2C6IA 5HLWA 5FQDC 4B8LA 3PDTA 3GNIB 4PL5A 4FOBA 3N4TA 4GRBA 2UZLA 3RP9A 3FC2A 5KX8A 2XEYA 2VRXA 1IR3A 2PU8A 3BGPA 3VUGA 4XOYA 3PFQA 2QC6A 3IGOA 4GFOA 4MUQA 2HENA 4ZLYA 5GZ9A 3VW8A 5FP6A 1WBOA 2DYLA 5AUUA 4QMUA 2XK9A 4P5QA 3GC0A 3AD6A 4WSQA 3BHTA 3LQ8A 4I3ZA 2C5NA 4LOOA 1VJYA 4O0YA 3I1AA 4M7IA 3ULIA 4NJ3A 3MESA 3EQIA 2RKUA 3C0GA 3BEGA 4U7ZA 3L8PA 4JG7A 1OL1A 4DT9A 1WBSA 2NRUA 5EW9A 2RG5A 4YZBA 3WF8A 4C59A 5BX0A 3D15A 5DA3A 4BCMA 2W96B 4QP6A 4RQVA 2YEXA 4TRLA 2QR8A 4F09A 3PLAE 4FL1A 3VQHA 2C6DA 4MCVA 4MVFA 5M4IA 4FV5A 4LMNA 4FKOA 2GDOA 1DS5A 3VUIA 3NSZA 4DINA 4TT7A 3EMGA 4XX9A 4OTWA 3ORIA 4C58A 2ITOA 4FV3A 1W2FA 1B6C