4D55A

Focal adhesion kinase catalytic domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
260
Chain Sequence
RDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRYLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE
publication title Allosteric Regulation of Focal Adhesion Kinase by Pip2 and ATP.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 82
structure length 260
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d55A01
3KA0A 3V5JA 4BCNA 2R0IA 1PXMA 4JDIA 1BUHA 2HAKA 4UMTA 4D5HA 4DGLC 1Q8TA 4PDYA 4OTQA 4FIIA 4O22A 1UU9A 5E9EA 4ZTHA 3V5TA 1LPUA 3EQGA 3ZHPC 4O0TA 5D10A 5CEMA 1E1XA 2RSVA 5CVHA 2QO9A 4YGAA 2YM8A 5DA3A 5CF6A 4RFYA 5C4KA 4FKSA 3R30A 3FLWA 1CSNA 3NUSA 3WARA 1FMKA 4QPAA 3QKMA 4FKVA 4JDJA 2J0IA 4IZ7A 3EL7A 4ITHA 4XYFA 3R21A 3PY1A 4Y5HA 5EDPA 5TE0A 5AUZA 3UMXA 2WMXA 4UN0C 4FSMA 5J7BA 3PUPA 2PSQA 2NPQA 3KRRA 3K2LA 4BHZA 5JFVA 3KXZA 5EG3A 1X8BA 2GMXA 3E62A 4Z3VA 4I6FA 3R7GA 4DH1A 3NW7A 3VBTA 4X3FC 4RVKA 3G0FA 2QLQA 3RK7A 2WIPA 1MQBA 2WEVA 3GC8A 3MA3A 3AD6A 2IO6A 4YHFA 3G51A 1XH4A 5HI2A 4QMYA 1Q8YA 3EFKA 4XS2A 3F66A 2YFXA 2IVSA 3HV6A 5HG5A 5CSVA 3CGFA 3IQ7A 4O21A 5AP1A 4B6LA 4EOKA 4D4SA 4ASXA 4AA0A 3VRZA 4CNHA 4C4IA 1UU3A 4GIIA 4IJ9A 2UW9A 1CDKA 3CD8A 1NA7A 3UTOA 4NIFB 4BICA 2XEZA 3QCSA 4IX5A 3MBLA 2XYUA 2UZDA 2WD1A 3NSZA 4MWIA 4BBEA 2X0GA 4BIBA 3OXZA 3JS2A 4D4RA 4EC9A 4EQMA 5A4TA 5I9XA 3CP9A 4O1OA 3BWJA 1M2PA 2W96B 1UU7A 5F95A 4KIQA 4NH1A 3FY2A 2VV9A 2LGCA 2DWBA 3OY1A 4FKIA 2VD5A 3KXMA 3DXNA 4MXCA 4WNOA 3S2PA 3W2QA 5CALA 4PQNA 2JKOA 4I23A 3BZ3A 2R0UA 4RLLA 3LFAA 4TT7A 5DYJA 5AV1A 4YR8A 1YWNA 4AX8A 1H08A 2YIXA 3WILA 2E9VA 4MEDA 5EM5A 4ANMA 4F1MA 2IVUA 4FZ7A 3TNPC 4Z55A 4V04A 5C8MA 3I0QA 3PJ2A 4BTKA 4CFXA 3DK6A 5IMXA 2YISA 4PMMA 2QR7A 3VBVA 4M84A 1M52A 3GNIB 4DG2E 3QA8A 3R7YA 4UYNA 5HZNA 4MNEB 3EL8A 3UIMA 3ZH8A 4X6RA 4A06A 4D9UA 1OI9A 5CVGA 4W4VA 4HYHA 4CG9A 3TJDA 2KTYA 4B8MA 4KINA 4KUJA 4XG6A 1YHVA 4F7NA 4MNFA 3TZ9A 1WMKA 3QZFA 3TT0A 3NNVA 3DTCA 3MFSA 1MRUA 5EM7A 1DI8A 3OCSA 3I6WA 5E8SA 5M57A 3AOXA 5LWNA 2F4JA 5DEWA 4QTAA 4A9YA 5HKMA 1QPCA 4JAJA 3NUNA 4EWHA 3MPMA 5AUWA 5ACKA 1JAMA 4P7EA 4G5JA 1H1PA 4AGUA 4FIHA 4ANOA 4YTIA 4XV1A 3NDMA 3DBEA 5EDQA 4ZXTA 4BCFA 4F1TA 3UQFA 1REKA 3RPVA 2GQSA 4BDGA 5BYZA 4DAWA 3C13A 4O0WA 4C02A 1W84A 1OL1A 4IFCA 1ZOHA 4J99A 4C7TA 4D2RA 3RAKA 2R4BA 4LM5A 3KB7A 5M44A 2ERKA 2XRUA 4GVJA 3MFUA 2BIKB 3CE3A 4UMQA 1U4DA 1VR2A 4TPTA 2VRXA 4U42A 4LV8A 4BTMA 2XK3A 2V62A 5EYCA 2B55A 2IWIA 4ZSEA 2GNGA 2NRUA 4PF4A 4X2FA 4M67A 5D41A 3PE1A 2PYWA 4JRVA 2NRYA 4WOVA 1JQHA 4G5PA 2OZAB 4DCAA 5GNKA 3BV2A 3MY5A 3HVCA 2H8HA 2VWZA 5LVMA 2OLCA 2WQEA 3NAYA 3HMPA 3W2OA 5L6PA 2J0KA 2J51A 5BVFA 4JJRA 2G01A 3D2KA 2X81A 5DR6A 3TXOA 1PXJA 1URWA 4CKRA 4ZTSA 3I1AA 5CTPA 4FA2A 2BAKA 4YNEA 3QAME 3PSBA 2B7AA 4NEUA 4ZJVA 2R9SA 4YUQA 2PY3A 2BZIB 3BBTB 3E92A 2IW9A 3EQRA 2PMLX 1IG1A 3BU6A 2Z7LA 3NYXA 1S9JA 4F1OA 3QTQA 2XK7A 5CY3A 3ZSIA 1K3AA 2UZLA 3Q32A 5DRBA 3MV5A 2JDSA 4J71A 4QP1A 4I5CA 4GL9A 1ZYDA 5K0XA 3WZKA 3Q9WA 1J1CA 2UVXA 5AUTA 4PDSA 4JX3A 3AC1A 3KMUA 2OXXA 4IX4A 2YZLA 2VZ6A 4IIRA 4PTCA 2HCKA 2UW4A 5D11A 2PMNX 3BHUA 4AZEA 2ETRA 5CZHA 4O91A 3R2BA 2WKMA 3HP5A 5AX3A 5BMSA 4CFFA 4Q5HA 2BUJA 4A4OA 5CLPA 2YERA 3GOKA 5LCKA 3FHIA 3V5QA 3MY0A 1Q61A 1B39A 2OH4A 3R1QA 3MB7A 4TN6A 4NYEA 5CAQA 5M4IA 2P55A 1VEBA 3FSFA 3GEQA 3O7LD 3UQGA 5H9BA 4B99A 3PZEA 1RW8A 1NVRA 1YXUA 4L8MA 1A06A 2FYSA 3QXOA 2AYPA 1XH5A 5ANOA 3RCDA 2WQBA 5EFQA 2VWUA 1V0BA 2OIQA 2W4JA 3GGFA 5EI6A 4GUBA 3E7OA 5TO8A 3ENMA 4X6QC 4DEEA 2XNMA 2YIRA 3FQHA 3CCNA 1PXPA 3QC4A 1PXNA 4UY9A 5LOHA 4PTEA 5HORA 3LCSA 4L43A 2Z7SA 4IQ6A 4OGRA 4GT4A 4OBOA 3FZPA 3O51A 3F82A 3QBNA 2OO8X 4K18A 1NT2A 4HGLA 1OKWA 4M69A 5AX9A 4O7TA 3R8VA 4OTGA 1K2PA 5FEEA 4F7SA 5J9YA 2ZV9A 3ORXA 4CYIA 5AR5A 2WMBA 1OIYA 2GS2A 3IDCA 3HP2A 1PYXA 3BIZA 1IRKA 3PSCA 3IG7A 4EKKA 5BVKA 4LL0A 3PG1A 4QMOA 1FBNA 3OCBA 2O63A 4TL0A 4IANA 4EOSA 3P4KA 3PSDA 1HCKA 5G1XA 3FQEA 5FBOA 3F5XA 3QTRA 4FNWA 2J50A 2QURA 3IPHA 3BLQA 3PA5A 4YZNA 5DT4A 1OBGA 1XH8A 2PUUA 3DK7A 4IW0A 3UODA 5KMIA 4R77A 5IQBA 3GU4A 5IH4A 3ID6C 3G9LX 4EQCA 2Y8OA 2JDRA 2R3JA 4KRDA 1Y8YA 4RZVA 3MGYA 2W1ZA 4APPA 4D2VA 5D7VA 5J87A 2IPXA 4O2ZA 5FTGA 5DEYA 5EOBA 5B0XA 1O9UA 5AV2A 2GFCA 2GNIA 2RG6A 4CQEA 5T6KA 4AA5A 2YA9A 3DXPA 3SA0A 4ARKA 3AT3A 3BE2A 4MWHA 2JFLA 2FSLX 3V5LA 1Y8GA 2XNEA 4PPAA 2P33A 2FSTX 3C5UA 4ZLYA 5A9UA 5LJJA 4JL9A 2WU7A 3OCGA 3C4XA 1PMVA 3HLLA 3RPOA 5HLNA 3POZA 5FLFA 4C4FA 3NRMA 4CCUA 1ZMWA 1VZOA 3UZRA 1H1WA 2QKWB 4GKIA 1XWSA 4YJVA 3SLSA 4WD5A 4FT9A 2YM4A 1F0QA 3RALA 3SXRA 1BL7A 3GT8A 3QHRA 3E7VA 5IA1A 4G6LA 4LUDA 2CHLA 3RKBA 5L8KA 4K1BA 1QCFA 5AR2A 3IGOA 4QMUA 4CMOA 5DLSA 5JZNA 4QMTA 4FG7A 2ZMCA 2QOBA 3R02A 2JDOA 4BGHA 2UVYA 2V22A 3MDYA 4ANQA 3SXSA 2XNNA 3MVHA 3BCEA 3K3IA 3QYZA 4FTKA 4XEYA 5JFSA 3ORMA 3Q4UA 2CDZA 1H0VA 1VJYA 2R3NA 4EEVA 5A4EA 5IU2A 2WQNA 1YKRA 4AW2A 2OFVA 4I22A 1R78A 3D5WA 3DBDA 4L44A 3R8UA 2E2BA 3E63A 3M2WA 3KULA 4JIAA 4YLKA 4KWPA 4Y5QA 3ALOA 3LMIA 3GQLA 4I4FA 4QMLA 5HHWA 3HAMA 2QOHA 1KSWA 1YI3A 2BILB 3ZZWA 3HZTA 3F69A 3H3CA 3R63A 5DFPA 2QO2A 4C57A 4EUTA 4I0TA 3DY7A 1VYWA 4RIWB 3ZO3A 4NJ3A 4YLLA 4EHVA 5JN2A 5AFVA 4DT9A 3L9NA 3MH2A 2WB8A 3TNIA 4BYIA 1OGUA 5JK3A 3ZC6A 4G31A 3EKNA 4I41A 3CTJA 4FVRA 4FEWA 4CMUA 5CYIA 1XQZA 5E92A 3A4OX 4FL3A 4X3FA 3TI1A 3OC1A 5IA2A 4QMSA 4Z7HA 2JC6A 3IW7A 1J91A 1H24A 4NWMA 3W2PA 3W33A 5JRSA 3CTHA 3KN5A 4L52A 5HNIX 4AN9A 3ZC5A 2R3RA 4R1YA 3V8TA 2XKFA 3EQIA 1A9UA 2VO6A 4FV7A 4H58A 4R7IA 4XCUA 4O82A 3FPMA 1J1BA 3DJ6A 2GTMA 4GK4A 2OIBA 2ACXA 2YDJA 3NNWA 4HZSA 4ITJA 2IZTA 4GSBA 4WBBB 3OS3A 4FV0A 4J97A 4NM0A 4Z9LA 4XP0A 4A4XA 1P4OA 5FXSA 4XLIA 4LQMA 1QPDA 2XJ1A 3ELJA 3AQVA 5IISA 2C6KA 1H0WA 2WHBA 4RWKA 3FLZA 4JR3A 4WG5A 5CS6A 5LVNA 3D5XA 3JR1A 3F3VA 3OWKA 3DAJA 3LFQA 3PRIA 5BUIA 2WFYA 1F3MC 4W4YA 4JAIA 5M06A 3RPRA 4KKHA 4FMQA 4FX3A 2YM5A 4C33A 1P4FA 4MF0A 4FSRA 2OI4X 2HZ0A 3WYYA 3P0MA 4F7JA 5L2SA 1WBVA 4IACA 3U9NA 2I40A 4K33A 3ZBXA 4IZAA 2I0EA 4LI5A 2HY81 4OTPA 5J8IA 3A99A 2FA2A 3SOAA 4YMJA 1MRVA 4O27B 4R5SA 1GNGA 2ERZE 2EXEA 2OW3A 3D5UA 3M1SA 4EONA 3GCPA 3UZPA 3FPQA 3B8RA 5HVYA 3Q53A 3FC1X 3MVMA 5H2UA 3SV0A 2X6EA 4EK6A 5CNOA 4ZJJA 3R6XA 3N51A 2UZBA 4E5AX 2QG7A 4IDVA 2B0QA 3NIZA 4FC0A 5AUXA 3DDQA 1UU8A 3R73A 4AACA 3EQFA 4YJQA 4E1ZA 2VTQA 2VTLA 3GU8A 4D1SA 4B4LA 1APME 3GP0A 4YZMA 3DA6A 4KS8A 4C37A 1OUYA 3MTLA 3GXLA 4M0YA 4M69B 2XK4A 5DT3A 3UP2A 3V04A 3QZHA 4BFMA 4LGGA 3LFBA 3BV3A 4R1VA 2F49A 1SMHA 2WEIA 3LE6A 3Q6UA 2XNBA 4K6ZA 5FD2A 4OTWA 3BHVA 2VX3A 3IOKA 4S34A 3PLSA 3BHHA 4D4YA 5HE1A 4ANNA 4QRCA 3OWPA 3WZJA 1H25A 4FKLA 4G3GA 4BWXA 2C0OA 2BPMA 3KF4A 3O7LB 5C9CA 2W99B 5E1EA 4BBMA 2YCFA 2YAKA 4MH7A 1RQQA 5TOZA 4OAUC 2PE1A 3LJ1A 4GUEA 2F7EE 5DNRA 4AGCA 3C7QA 4I4EA 2C69A 1G5SA 2FSMX 4BWPA 3AD5A 4BGQA 5IQCA 1HOWA 2VU3A 3ZZEA 2YACA 3NR9A 4E5WA 4ZTLA 5M4CA 3FMKA 5F4NA 3V8SA 1KUTA 1ATPE 2E9OA 2A2AA 4U5JA 2BHHA 4YC8A 4DGOA 3QQLA 4FV4A 1XKKA 2Y6OA 4LL5A 3AC8A 2JBPA 1O6KA 4RSSA 4X2KA 3UIXA 1EH4A 2ZVAA 4QQJA 3WE4A 3GC0A 5FP5A 2OJGA 5AWMA 5HQ0A 4M12A 4Y83A 5KMOA 4L9IA 3F9NA 1JNKA 5TT7A 3JPVA 2HK5A 4WRSA 3SKCA 1H00A 3WE8A 4DGGA 1XBCA 5DHJA 4FOBA 4OLIA 5DBXA 3PIZA 3QA0A 4IB5A 4RJ3A 5AP2A 1GJOA 5FM2A 3BBWA 3C50A 4G34A 4U81A 4DTKA 2Z60A 5M51A 5L8LA 4IX6A 3SG9A 2PZIA 1KE9A 3FZOA 1J7IA 2JGZA 4J52A 2B4SB 4DITA 4O7SA 3HA8A 3PP0A 3RK9A 4YPDA 5C01A 4PP7A 4DBXA 4IM2A 3Q5IA 4N0SA 3NYNA 3DAEA 2C6EA 4RVMA 3RZBA 4BTJA 2WTVA 4FIGA 5KKRB 4XP3A 3DXQA 3LAUA 4U79A 5BUJA 2YWVA 3QCYA 3PPJA 4C4GA 3CSVA 4UX9A 4KIKB 1QL6A 4FYNA 3KKVA 4CVAA 4FICA 4FT5A 3KL8A 3IECA 4C3RA 4E26A 3FAAA 4PL4A 5AR4A 1DI9A 3R9DA 2HZ4A 5I3RA 5BYLA 4C36A 4O1PA 2C6IA 1XH6A 4JBVA 3FYJX 2PZRA 3DKOA 4FTIA 1IAHA 2PHKA 2UW6A 2WQOA 4FV8A 3TV7A 4R7BA 4BCGA 5BVNA 3EKKA 4FIEA 4LMNA 1GOLA 1NW1A 3TKIA 5F94A 4GU6A 4G3EA 2X2KA 3LCKA 2VWVA 4DEDA 3DS6A 3P7AA 1YI6A 3QKKA 5CSHA 3QLGA 4J8NA 4BCOA 5HCYA 3RAIA 3PVWA 1K9AA 2Z2WA 3FMLA 1SNUA 4FV5A 2WGJA 2ZDTA 2OXYA 3O23A 4FSTA 4HYIA 4KD1A 2BRNA 4ACHA 4YP8A 3FL5A 2UVZA 4JBOA 4USDA 2JIUA 4JI9A 3MVJA 4Q5EA 4EORA 5HNGA 2XP2A 2B9IA 2XIYA 2W5HA 4ERWA 3KMMA 3WIKA 1U46A 5C26A 2JAMA 3NAXA 2HWPA 2XH5A 4KKEA 3W2RA 5IQDA 4XG3A 4U3ZA 4B8LA 1IASA 4CV8A 3MPAA 4PRJA 1JKKA 3SRVB 3U8WA 4AAAA 4Y85A 4EL9A 1QPEA 4GJ3A 4XG8A 3ZCLA 2CKPA 4MBLA 1YOJA 2BVAA 3LJ2A 2XK8A 2R7IA 2X8IA 2HYYA 3S1HA 4Y46A 2HENA 3SX9A 2BDWA 4DYMA 4O7VA 5AP6A 4MQ2A 4TXCA 4LRJA 4XJ0A 2JKKA 4GV1A 5HVJA 2X8EA 2XKEA 3MN3A 5GZAA 4DG3E 3AC5A 2DUVA 3LHJA 5CSWA 5GHVA 4R7HA 4A4LA 1FQ1B 1OL7A 4QYGA 4BVUA 3ZSHA 4L3JA 2BAJA 4FK3A 2ETKA 4GT5A 3QD2B 1E9HA 3HV4A 3F3ZA 1LEZA 3PJ1A 3PY3A 4MBJA 3I5ZA 3LLAA 2QD9A 4RA4A 1YI4A 4P2KA 5EQEA 3A8XA 4F09A 1IAJA 2PE2A 3SGCA 3TWJA 5BVWA 4QTBA 2C6OA 4EZ7A 3SHEA 3PIYA 1UNHA 4TY1A 4RX5A 3HUBA 2BRBA 2VTHA 4AFEA 2CN8A 2QOQA 3A8WA 5EDRA 3VBQA 3VAPA 3H30A 5IKWA 3V51A 3WF6A 4DFXE 2C30A 2WMVA 3COHA 4KIPA 4XG2A 3V5WA 2YITA 1SNXA 2Y6MA 3DOGA 4QP2A 4TYHA 2X1NA 5CQWA 3IO7A 3CLYA 4HOKA 5HOAA 2OGVA 4GS6A 4PY1A 5EOLA 3OUNB 4Y72A 2R3IA 3KRLA 4L7FA 3TIYA 4PTGA 3H9FA 3BYSA 3CKXA 5IQHA 4O7LA 2P0CA 2R3QA 4FKOA 3R83A 4KS7A 4MXXA 2OJFE 4O0RA 3D83A 4ALVA 3UGCA 1ZARA 2W1EA 4EHEA 3TKHA 3UO5A 3A62A 3KC3A 5J7HA 4DF3A 2XBAA 3LXNA 5ANDA 2XKCA 5HX6A 4U44A 3EHAA 3VN9A 3FI2A 4G9RA 4BZOA 3BGQA 4FUYA 4NJDA 5JSMA 4E6CA 3FUPA 1OMWA 3VVHA 3ZTXA 4J7BA 4C4JA 2C6LA 2VTTA 4FKQA 4FKWA 4UALA 2JD5A 4IMYA 4QNYA 1STCE 2UW7A 4OTHA 1YHSA 1XBBA 3F7WA 5H8EA 2WTDA 3LQ3A 2QI8A 3F3UA 4J96A 3U6IA 2P2HA 3BGPA 4IWOA 4WSQA 4YZ9A 2HY0A 1H1RA 2OXDA 4B0GA 4ZTNA 3SQQA 3BRBA 4EJNA 3QTWA 1Z5MA 2F57A 3TNWA 1OM1A 3AG9A 3OEFX 4EK4A 4BI2A 3A7HA 3NUPA 4EH9A 4ZLZA 4BDDA 3TACA 5AM7A 1M17A 3D14A 3PA4A 4TYJA 5AEPA 5BVDA 5AM6A 4XRJA 3TTIA 4F64A 5CF4A 2UZTA 1IA9A 1KE5A 1ZY4A 3F5GA 3FXXA 3Q2JA 1VYZA 3QUPA 4ZSGA 1YWVA 4EH5A 5KMMA 4BCQA 3IW6A 3DU8A 3TIZA 4N70A 2XRWA 1Z57A 4B7TA 4DCEA 4CMTA 5K9IA 4JRNA 4L42A 2ETMA 3NNXA 4KAOA 5A6OA 4IAAA 4YTHA 1FVVA 4AZVA 4E8AA 3MIAA 3TV4A 5I5ZA 3R9NA 3VJOA 4YHTA 3ANQA 5FTQA 4C3PA 5DR9A 3E3BX 3PRFA 3R8LA 4CRLA 2ITVA 4FSQA 1W98A 3UOLA 3TUCA 2C3IB 4AF3A 3QQJA 3TM0A 3FYKX 3GCUA 2XIXA 1WVYA 3MYGA 4IH8A 4XV2A 3UP7A 3UYSA 3VUTA 1URCA 2PVLA 3W2SA 4WRGA 4AOJA 4FTOA 4NSTA 3QCXA 5EW9A 4YJRA 5M08A 2PVKA 5TR6A 3NEWA 5EYMA 4ACCA 5KMJA 2GNFA 2CKEA 5B2MA 5AA9A 3FY0A 2XIRA 2R64A 4S33A 4ZOGA 3VUHA 4FSYA 4BDJA 3E88A 4EH2A 4HNIA 5JKGA 4D28A 4D1ZA 3VBXA 4CD0A 1Q8UA 4FSZA 4NW5A 3NPCA 2B9JA 4JIKA 2W1IA 3O8UA 2QNJA 2XM9A 4KNBA 2C5NA 2PTKA 4QOXA 1E1VA 4DINA 4PNKA 3ZLWA 5LVOA 4DLIA 2JEDA 2GS7A 2AUHA 2HXLA 2ZM4A 5HGIA 5L3AA 3R0TA 3S00A 4DGNA 3RWQA 4RX7A 4H05A 5CWZA 1OIUA 2C6DA 2OF4A 4IWDA 5K4IA 4HYSA 3Q4CA 3RAWA 3VUIA 3MJ1A 3MFTA 2G2IA 1WVXA 5EM8A 3COMA 4K0YA 1YDRE 5CX9A 4KBAA 3S3IA 3U4UA 4QP4A 3EN9A 3IGGA 3QUDA 4YJTA 4AG8A 3GBZA 4BCPA 1JKLA 3DFAA 4GK3A 1ZZLA 3C4EA 3R01A 5HG9A 3ZUTA 3DJ7A 5E7RA 5HO6A 2IVTA 4FEUA 4XHKB 1NVSA 4DH8A 5GINE 4I0RA 3G2FA 2YABA 3C4CA 3PXYA 4HGEA 2AC3A 3RK5A 4ZIMA 2C3KA 3WBLA 3OZ6A 4I5MA 4ALUA 4X2NA 5DE2A 3W8LA 1YWRA 4RIXA 3FE3A 1PKDA 3PTGA 3QZGA 1CMKE 2ZJWA 3F7ZA 3MW1A 4AOIA 2X6DA 4RT7A 2WTCA 3QRIA 3R7OA 2V7AA 1UWJA 4CZUA 3HUCA 1W83A 4L3PA 3COKA 2VO0A 4W9XA 4E73A 4FEXA 3UNKA 4R78A 3QRUA 4RZWA 4AU8A 5CXZA 5J5TA 5FWKK 2B54A 4LOOA 2F7ZE 4MKCA 4AT4A 5F20A 4BDIA 5EQPA 3KVXA 4IADA 4NTTA 4RC2A 5KHXA 3DNEA 3HRFA 4A07A 3ZBFA 3LMHA 4BB4A 4RVTA 4EQUA 3KN6A 4FT7A 4EOQA 4WSYA 4HW7A 3ORLA 4B9DA 3RPSA 2QHMA 1WFCA 2XNGA 4WG3A 4BKZA 5IF1A 2OSCA 1UWHA 1IR3A 3QRTA 4R5YA 2VTMA 4ZEGA 4D0XA 2YAAA 3DFCB 5DG5A 3I7CA 4EBWA 3UPZA 2PPQA 1FPUA 3VW8A 2XMYA 4AUAA 2R2PA 2EVAA 1LP4A 4AT3A 5J1VA 3LIJA 3TTJA 1WBOA 4FUXA 5KZ0A 4C2VA 3PPKA 4FV6A 4NW6A 3L8SA 3K5UA 4Q9SA 2OKRA 4QP9A 2PMIA 2R3MA 4AZSA 3BYOA 3C1XA 5HE2A 3IW5A 4IC7A 1PMEA 4YLJA 3TG1A 4I6BA 2PMOX 3HA6A 5AADA 4LMUA 3ATSA 3WF8A 4O83A 4MYGA 1MRYA 3P7CA 3OBJA 1YQJA 4YZCA 3KCFA 4BZNA 4S32A 4EH6A 3R7UA 3E8EA 5JQ8A 5LVPA 4I3ZA 2Z8CA 2LAVA 1P5EA 5H3QA 3FWQA 1REJA 1KV1A 4CGAA 4D0WA 3JXWA 3SG8A 4HZRA 5I3OA 1ZRZA 4F9BA 3NCZA 2ZOQA 1Y57A 1ZY5A 3VUGA 2J5FA 3ZS5A 4O81A 2Y4IB 4FG9A 2UV2A 4HJOA 4AZFA 1DAWA 3DNDA 3QTIA 3IS5A 3ORNA 3FV8A 4L46A 2PWLA 1W8CA 4IC8A 5KBQA 4EOLA 3KRXA 2IZSA 4RJ8A 3QCQA 3TNHA 3DBFA 4OTDA 2C4GA 2PVNA 3C51A 2X39A 3QRKA 3A61A 4RJ4A 1JWHA 3IKAA 5FDPA 4OTIA 3GU5A 3D7TA 2R5TA 2BRHA 2W1GA 3CPCA 4BDHA 5BUEA 5I9VA 2Q0BA 3PY0A 4O2PA 3TL8A 2IVVA 3NUAA 5CEKA 3ORZA 4FKPA 3OG7A 4X3JA 2BRGA 5IEYA 4UWYA 3H4JA 1M14A 2VNWA 4MXZA 5AMNA 3VO3A 4BHNA 3NUXA 4RIYA 5FXQA 4YJOA 5CF8A 1ND4A 4H3QA 4RJ6A 4K2RA 5AP4A 1AQ1A 3QTSA 2IN6A 4IE9A 3W1FA 4GMYA 5EM6A 5KCVA 5M53A 1YXSA 4KB8A 1YDSE 4O38A 5KUPA 5FBNC 3F2AA 2ITWA 3VS1A 3KK9A 3ACKA 2OJJA 3UO6A 4F08A 2J5EA 2UUEA 1ZYLA 3QQKA 3LMGA 2P4IA 1FGIA 3AC2A 3ZSGA 4OT5A 3G15A 5F1ZA 2XKDA 3TCPA 2X2LA 3ZRKA 4IWPA 5IUGA 5AAEA 3L8VA 4K8AA 2OH0E 4XNEA 4PDPA 2KULA 5BVEA 3WI6A 4AP7A 5J79A 1U54A 3QQHA 1QMZA 5K0KA 4QMWA 3R7VA 2V7OA 4JVGA 3DB6A 5GJFA 1Q24A 3ZU7A 4AA4A 3LXKA 4Q2AA 5T3QA 4DHFA 5HESA 2X9FA 5E8TA 4MXOA 4KKGA 4XBUA 4F63A 1NXKA 3KQ7A 1H26A 3NNUA 2YM6A 5BMMA 1CM8A 4KRCA 4RQVA 4M68A 5E90A 3PWDA 5LMAA 2RFSA 4JR7A 4FV1A 4O0UA 5J95A 3UIUA 3RI1A 3N4TA 4DT8A 2C0TA 2JBOA 4JS8A 3CD3A 5CU0A 5ANEA 3LFNA 5AUUA 2GTNA 2RG5A 1R39A 2ZDUA 4D2PA 5GJGA 5HCXA 5A4QA 4WNMA 2X4ZA 1GZ8A 1H8FA 1UNGA 2GQRA 4EOMA 2WZJA 4BDAA 3UPXA 2I0VA 2GFSA 3EQCA 2UW8A 3IW8A 2CKOA 3U54A 2GQGA 3HDMA 1OKYA 5IG1A 3NGAA 4ZY4A 3OROA 4BC6A 2QODA 1ERKA 3BEGA 2H6DA 2ITUA 4HGTA 4P5QA 2W9ZB 4ZS0A 1U59A 5CZIA 1Q8WA 4WT6A 2J0MB 2O65A 1T45A 4G1WA 2HW6A 2RKUA 3QQGA 2EUFB 2IJMA 4DFLA 4X7QA 2RFEA 2W1CA 4G6OA 3RP9A 4FKUA 4AE9A 4F0FA 4MBIA 2QU6A 4GKHA 3DAKA 4WHZA 2XIKA 3CR0A 1ZAOA 2E9NA 3ETAA 4PDOA 4CEGA 3UO4A 2G2HA 3ODZX 2O3PA 4RG0A 3ZXZA 4O7ZA 4FTRA 1OL5A 4DH7A 5JQ5A 2EXMA 3MJ2A 1NVQA 2YDKA 4XX9A 5HO7A 3HMMA 4TYGA 3VHEA 3VRYA 4KBCA 5AV4A 4MK0A 5KHWA 2SRCA 2QOOA 4G3DA 3FZTA 3CBLA 1OL6A 4UWCA 4AT5A 4M3QA 3MI9A 4CCBA 2QQ7A 4QQCA 3ZO1A 2PUNA 2BAQA 4YBKA 1OKVA 4L45A 4X21A 4GT3A 5CEIA 3TN8A 5EQYA 1ZMUA 2HW7A 5L2WA 4KABA 4IZYA 5A46A 4BL1A 2XJ0A 4PPCA 3OBGA 5CT7A 4ZP5A 4EH7A 3AGLA 3C4ZA 3EIDA 4YJUA 1FINA 4RX8A 3KFAA 5AP7A 4BTFA 2R3HA 3QRJA 3VF8A 3R9RA 4PMTA 3PDTA 1ZOGA 3EQHA 3BYUA 3GOPA 2GHMA 2VNYA 3RINA 4J1RA 4NK9A 4YJPA 1O6LA 4ORKA 2BR1A 1W0XC 4MF1A 5IQAA 4EOPA 3CEKA 2WTIA 2XCHA 3DLSA 3QHWA 3QLFA 4UMUA 4E7WA 4O84A 4DTAA 5GIPE 2EU9A 4MD9E 1V1KA 3ZUVA 4GIHA 2P3GX 4QYHA 3EWHA 3HL7A 3JY9A 3VS5A 4C4HA 3R9HA 1RE8A 4IEBA 5HU9A 4ZSLA 4HVGA 3KEXA 4YPSA 5J9LA 4WO5A 3E5AA 3VJNA 5FM3A 4FKJA 1Q3WA 3F3WA 3Q9XA 3MPTA 3Q52A 1JLUE 3TEIA 1P14A 2XYNA 4KSPA 5L4QA 3QALE 2QVSE 4FTNA 4YJSA 3QX2A 4GFGA 4I6QA 4CSVA 4F0IA 3DKCA 4EH3A 5JGBA 2A4LA 4H3BA 5CEOA 2CMWA 3E3PA 4P5ZA 3FLYA 4BIEA 2VTAA 3QQFA 4V05A 4DLJA 4RBLA 3OXTA 4ZS4A 3V6SA 3DGKA 4WNPA 4ZZNA 2GPHA 4I6HA 3GC9A 5CT0A 3VC4A 1G3NA 3QWJA 2I6LA 2PVHA 4AXAA 3FMEA 3FKNA 3EH9A 4FTJA 1MQ4A 2BTSA 3HV5A 3KVWA 3AMBA 3I60A 4FNYA 4O0SA 3DLZA 3PE2A 5A3XA 3LOKA 3QTUA 4J95A 4WG4A 5FRIA 1JSUA 2BRMA 4O0YA 2PVFA 2BIYA 2JKMA 2W17A 5A4CA 5E8YA 5KMNA 4EOOA 4QMNA 1PXOA 5LCJA 5GZ9A 3UE4A 5EHOA 4EK3A 2WMSA 2Y9QA 2E9PA 3QF9A 3HAVA 2V5QA 4AZWA 5AR3A 4QTCA 3P7BA 5DVRA 3FMHA 3M42A 3Q4ZA 2IW8A 2C5YA 2WNTA 3R71A 4OTFA 3NVKI 2XS0A 3P78A 4LG4A 5LVLA 3AMYA 3K3JA 5LMKC 2XJ2A 4IBMA 4NM3A 4ASDA 4OBPA 1DAYA 5JFWA 3QZIA 5CVFA 2JKQA 5CENA 5IQGA 3LM5A 2WTKB 4AW0A 3Q04A 4D2SA 3W10A 2ONLC 4QMMA 2RIOA 2ZM3A 3FKOA 4NFNA 4EI4A 2QCSA 5ANIA 1MUOA 4NT4A 3JY0A 2QOCA 2BALA 2GNLA 2R3OA 2VWWA 3C4FA 3E87A 4FIJA 2B52A 4RQKA 4QTDA 3T9TA 1F5QA 3LXPA 3FBVA 4YO4A 5M07A 2YWPA 3O71A 3Q2MA 4MXAA 4O0VA 3ANRA 2XBJA 3CJGA 3OOGA 4KA3A 4RFZA 4E4XA 4F6SA 4DA5A 4FR4A 2OICA 4EC8A 4ZAUA 2IZUA 3TUBA 1Q97A 2ITTA 2XVDA 3V3VA 3MS9A 4CFVA 2CGWA 4I5HA 5EW3A 5KE0A 4ZMEA 1KE6A 4O7NA 4RJ5A 3CPBA 1AD5A 1GZNA 3F88A 4LGHA 2PVJA 3ZEWA 4AE6A 4AW1A 5BX0A 3SW7A 4C34A 3ZFMA 4NZWB 5IA4A 1Y6BA 4FGRA 2F2CB 3PPZA 4XG4A 4CFNA 5EH0A 4UMRA 5E91A 4QMZA 3P23A 3KXXA 3ULIA 5AA8A 3T3UA 4YBJA 3SAYA 5HU3A 2C5OA 4X2GA 4IB0A 4FKTA 3OOMA 3GFWA 4IB3A 5IPJA 2ITYA 4FV2A 4D55A 4EZ5A 3ZDUA 2UW0A 1BKXA 5HD7A 4TWNA 2X7FA 3WZDA 4HVIA 4K77A 4F9WA 2VO7A 3ITZA 5ITAA 3QU0A 2YHVA 4QP7A 4XOYA 4C8BA 3NW5A 3BWFA 2F2UA 1OKZA 5AP3A 4HPTE 4IWQA 4FTMA 3DCVA 4GH2A 3VULA 1R3CA 4IJPA 4LUEA 3ZOSA 5L2IA 4IM0A 4MVFA 4NCTA 4BYJA 1B6CB 4E5BA 4ENYA 4V01A 2P2IA 3CS9A 2WPAA 3ZM9A 3MVLA 5L2TA 1GIJA 2ZB0A 2ITQA 3KULB 2BCJA 3RVGA 3TZ8A 2C1AA 3H0ZA 3Q60A 1KE8A 4TYIA 4RLKA 2ITPA 2BHEA 1BL6A 3TDVA 3GFEA 3II5A 2WMQA 3Q6WA 4YURA 2NP8A 2WMWA 3NMUF 4ACMA 4UMPA 4OW8A 4F99A 5FGKA 2E9UA 3C0GA 3U87A 4J53A 4M14A 3MIYA 5DT0A 3UQCA 3FZSA 3ZEPA 5HVKA 3UG2A 3WZEA 4L68A 1J3HA 2PK9A 4U40A 4ZTRA 4BCMA 4TWOA 3D2IA 4X3FB 3RJCA 4U8ZA 2BKZA 4O6LA 4QYFA 1KE7A 3BYMA 3AGMA 5CSXA 3N4VA 4NIFA 2PZPA 4XH6A 3WYXA 2ZV8A 3NCGA 3NYOA 3O8TA 3WF7A 4ZK5A 1XHAA 3L9MA 5EKOA 3CQWA 3D15A 3I7BA 5EI8A 5I4NA 4U97A 3OTVA 4S2ZA 3UYTA 2VTIA 1AGWA 3FLNC 2BMCA 3D94A 1XJDA 2V55A 4CTBA 3PFQA 1BX6A 1OZ1A 4DG0E 4G3CA 5E8WA 3ZMMA 4C3FA 2Y0AA 1H01A 3QFVA 1BMKA 3UC4A 4QD6A 2RFNA 5C8KA 2OJIA 4MD7E 3OP5A 3W2CA 3TZ7A 4PPBA 2O8YA 3OF0A 3LCDA 4FK6A 5EYDA 4O0XA 2HZNA 2REIA 4N4SA 3ATTA 5D9HA 4YC6A 2GU8A 4BZDA 1DS5A 2UW5A 4MNEA 2OU7A 3WF9A 5IEXA 1SVHA 1Q62A 5A4LA 3VQHA 4CLJA 1Q99A 3FXWA 1W7HA 4OBQA 3L8XA 2FVDA 3RTPA 2OG8A 3G90X 5CXHA 3E8DA 4ANLA 3IOPA 4JDKA 4DC2A 1J7UA 1FOTA 3OD6X 4TKSA 2FH9A 4JX7A 4QP6A 4D1XA 3QXPA 3AC3A 3CQEA 4DTBA 5JRQA 3A7IA 5E4HA 5EKNA 2VTOA 5HX8A 2OF2A 4ZY6A 4M66A 3VUDA 4CFUA 1YDTE 1WCCA 4JNWA 4DE4A 1UVRA 3O0GA 3BI6A 3MH0A 3LJ0A 4PV0A 4EHZA 5AIKA 3F2RA 3R1SA 3HMNA 4FKGA 4RC4A 2VGPA 2XF0A 2BFYA 2JFMA 2YLEA 3VQUA 3KREA 5HIDA 4FTLA 2YIQA 2YIWA 3V01A 5CAOA 3QD4A 3ZO4A 4MCVA 5K3YA 4LRMA 4MHAA 4AZTA 3RMFA 3HMOA 3CJFA 1XO2B 5IDPA 2W1DA 3RPYA 2X2MA 1WBWA 4CFMA 4EJ7A 1HCLA 3EN6A 4C0TA 4O86A 2CPKE 3LVPA 3VWAA 2OZAA 3V8WA 5B2LA 5CSPA 2C5VA 4RWIA 4AWIA 2H34A 3A7JA 4CKJA 3EFJA 1OBDA 3SDJA 4AOTA 1TQPA 3P79A 3VUMA 3ZLSA 3R00A 3R2YA 2YCRA 2GCDA 4IAZA 4JOAA 1I09A 4FTCA 3ULZA 4IZ5A 4BCJA 5IZFA 3MESA 5CU2A 3RZFA 3ZRLA 4Y8DA 4A9TA 3G5DA 3RM6A 4NM7A 3FXZA 5CEPA 4FVPA 5ANKA 1MP8A 2R3GA 1CKJA 4IX3A 4ONAA 5I9YA 4QPSA 5K5XA 1PYEA 3L1SA 3RGFA 4A9SA 3GCSA 4YO6A 2X7GA 3B2TA 3UVRA 2C5XA 3GCVA 5C03A 3COIA 2GNHA 4ERKA 1WBNA 1ZYCA 2ITZA 2XIZA 3FMJA 3QKLA 1JSVA 3FZRA 3VNTA 3UDBA 5KKRC 4BRXA 3GENA 4O96A 4I0SA 4E3CA 2W4OA 5LQFA 3KY2A 4EH4A 2H96A 2C6MA 3EN4A 2XCKA 1L8TA 3FI8A 1XH9A 2R3PA 4YJNA 5LWMA 5C27A 4WIHA 1R1WA 1JBPE 3UVPA 3IDBA 4BN1A 3WF5A 3OTUA 3SD0A 3FI3A 4L6QA 4UYAA 2OZOA 5D1JA 3KXHA 5JMSA 4EOJA 1SM2A 3FLSA 2ZMDA 4FIFA 3DV3A 3OMVA 2B1PA 3AT2A 4GVAA 3BEAA 5J5SA 4M8TA 5AP5A 2QR8A 1TQMA 3G0EA 5L6OA 3BE9A 5CAPA 4HCUA 3QC9A 1OPKA 4U45A 2YZAA 2QOLA 4QT1A 2PZ5A 4WUAA 2Y4PA 5A54A 2XNOA 5FEDA 3ZFYA 3HRBA 2CCIA 4QPMA 2EWAA 5E1SA 1YXTA 4NKSA 3RM7A 3G6HA 4EZ3A 1RJBA 5I9ZA 3BHTA 4BKJA 4V0GA 3HMIA 3O17A 5CNNA 5HLPA 3DQWA 2HIWA 4IB1A 4FBXA 4XBRA 1KV2A 4I1ZA 4USFA 2C68A 4W4WA 4QMVA 2X8DA 2C6TA 3PXFA 2X4FA 3FSKA 4I5PA 1YVJA 2QKRA 4HVHA 2WAJA 5LMKA 4GG5A 4IAYA 4ZSAA 2VX1A 3PLAE 5JFXA 2CLQA 4OUCA 3AT4A 1YHWA 3HECA 4G3FA 4HPUE 4F6UA 2VO3A 2FGIA 2ONLA 4LV5A 4MX9A 3ROCA 4U9AA 2CNVA 4AN2A 3O96A 4F4PA 4HCVA 3DPKA 3NS9A 3EZRA 4DN5A 3VF9A 3V6RA 5IA5A 4ZZOA 4U80A 4NU1A 5K5NA 1YRPA 1SYKA 5DPVA 1ZLTA 2XK6A 4BCHA 1T46A 2R3KA 3PJCA 3SXFA 1GIIA 4QYYA 5CEQA 2W05A 4F9YA 5C1QB 4EWQA 4ZY5A 5KO1A 5FUTA 5AAFA 2WIHA 5FTOA 5EI2A 5DWRA 4D58A 3P08A 3U6JA 4QP8A 3UG1A 5D7AA 3TV6A 3PVBA 2HXQA 1YXXA 3PJ8A 4ZSJA 2O0UA 3ORIA 4LRKA 2A0CX 5CU6A 5CAUA 5FXRA 4PMPA 2ZM1A 4DEGA 1O6YA 1WBTA 4I20A 4GEOA 4TW9A 2WOTA 2R3FA 2XUUA 1RDQE 3QTZA 3D4QA 4ID7A 1ZWSA 3DKGA 3THBA 2WU6A 5HE3A 2VWYA 4QMQA 3PXRA 2FSOX 5IEVA 4PP9A 5EHYA 4TYHB 5GIOE 2PE0A 5BVOA 2PL0A 3DBQA 3UMWA 1OIRA 4A7CA 5E8VA 2OIDA 4JBPA 3GVUA 3LW0A 3I4BA 3M11A 4M15A 3NWWA 3PXZA 4TWPA 5J1WA 2HZIA 2VWXA 2W7XA 3R1YA 4RFMA 5FP6A 4BDCA 3KMWA 5HCZA 4ITIA 5A14A 2FUMA 2QOIA 4CQGA 2VTJA 2YN8A 5L6WL 2VWIA 3I6UA 3MH1A 2BROA 3UOKA 4DEBA 1GY3A 2ZV2A 3R9OA 2RFDA 3DT1A 3LKMA 4F65A 1GZKA 2PZYA 4H1MA 3ODYX 5DN3A 5M09A 2XEYA 2JLDA 5BYYA 4RIWA 4CV9A 2VX0A 3CKWA 2YM3A 2PUPA 3MA6A 2I0HA 4FSUA 3WOWA 2A27A 3KU2A 1ZYSA 5DOSA 3BLRA 4D2WA 4BI1A 2B9HA 4CT2A 1S9IA 3W32A 4DEIA 1WVWA 3ROYA 5ICPA 1UKHA 2ZYBA 3DB8A 2XNPA 4GFOA 3ERKA 3CIKA 3FKLA 3G6GA 3L8PA 2YCQA 2BZKB 5C8NA 4XP2A 2UW3A 3HNGA 5HE0A 3Q9YA 4I94A 4XLVA 3F3TA 3LCTA 3AMAA 3QD0A 2W1HA 1H1SA 3EQDA 4NCTC 4RGJA 5I9UA 3FMMA 2G1TA 4IVCA 3GB2A 3Q3BA 1OUKA 3L9PA 1PRYA 5HG7A 4DBNA 3EB0A 4QQ5A 3U4WA 1JPAA 4PWNA 3BELA 2WXVA 2YDIA 3HV7A 5EK7A 2YJSA 4K11A 4KBKA 3ZONA 5CI6A 5E8UA 1GZOA 3HX4A 4UXQA 5DH3A 3LFFA 2ZB1A 2WO6A 1Q5KA 1WAKA 3PWYA 2WELA 3W55A 4WUNA 4NFMA 4BKYA 3AC4A 4UZHA 4C61A 4HNFA 5CU3A 2W4KA 3QGWA 4FNZA 3MB6A 3ZFXA 4RJ7A 1ZMVA 1M7QA 2I0YA 1JKTA 4MQ1A 2RL5A 4JG7A 4FEQA 5HD4A 4MD8E 4QTEA 3NW6A 1PJKA 1OPLA 3D5VA 3OHTA 3FHRA 1KWPA 3W18A 3C9WA 5JGDA 4W4XA 3CTQA 4R6VA 2PULA 5AV0A 4FI1A 3NX8A 1IA8A 3LZBA 3VS0A 3HKOA 4I24A 2WOUA 3U9CA 1UNLA 2RGPA 3E64A 3PP1A 1JSTA 3QUEA 4AN3A 4YC3A 1SVEA 2QLUA 1Y6AA 5CQUA 2BFXA 3FMDA 2W1FA 5ETCA 4O7RA 4PUZA 2QU5A 5CF5A 4QMXA 3ACJA 4C35A 4FZAB 4IHPA 4O7YA 3E8NA 2RF9A 3EQPA 2J90A 1YOLA 4FGBA 5HICA 2GNJA 3DZOA 2ESMA 4YHJA 2FB8A 3FI4A 4AS0A 1M7NA 4CT1A 2DQ7X 4RIOA 4UEUA 4FYOA 4USEA 3RNIA 4M7IA 1ZXEA 4Z7GA 2YJRA 3AXWA 5AV3A 2GHLA 2WMTA 4V0GB 3ZYAA 4F7LA 5LARA 3MTFA 4TYEA 2JIVA 4MTAA 3SC1A 3OVVA 3GUBA 3VS6A 5GZ8A 2UZNA 4AQCA 3UC3A 3JYAA 1OPJA 1YOMA 1CTPE 4J98A 3NLBA 4C2WA 4EK5A 4XV3A 5AAGA 5IQEA 2PVYA 2VWBA 3K54A 3DK3A 3POOA 2W9FB 3CC6A 3E93A 4NKAA 2HELA 3LQ5A 2QHNA 4BY9E 4M13A 5L8JA 4BGGA 2O5KA 3VBWA 1CKPA 3TJCA 4IDTA 2QO7A 3CQUA 1BYGA 3VS7A 3QX4A 4UZDA 3A7FA 5FDXA 4YU2A 4GU9A 2NO3A 2JAVA 1H27A 4M97A 3R7IA 4FL2A 3A2CA 4YZBA 3TKUA 3KXGA 3R22A 4RIXB 4CLIA 3LLTA 2CKQA 1WBPA 4AGDA 3O2MA 3NUUA 5JT2A 4FTAA 1SVGA 3QTXA 3R28A 3W16A 4CZYB 4YZDA 3ZUUA 2Z02A 4BDFA 4PMSA 4N6ZA 1ZYJA 3D7ZA 1Y91A 4JQ8A 4ZTMA 3BLHA 3I81A 4FSNA 2W0JA 5H8BA 2YM7A 3T8OA 2EB3A 4XG7A 5CANA 3ORPA 3RCJA 4XUFA 2UZEA 4IAIA 4UV0A 1DM2A 2J0LA 4FG8A 4JLCA 4G16A 5M4FA 2I1MA 1PMUA 3H9OA 2UZOA 1PKGA 4C4EA 4ZLOA 5C4LA 2UZVA 5G6VA 3B2WA 4L3LA 2PVRA 1FMOE 3LPBA 5JEBA 2VTRA 2UZWE 1H4LA 3F61A 3PJ3A 4KIKA 4BDBA 5EHLA 4OTRA 4P4CA 2VN9A 2BZHB 1UKIA 2XA4A 3BKBA 3ZDIA 3QQUA 4D4VA 3BHYA 3F2NA 5ETFA 3SW4A 1FVTA 5ANGA 3VS2A 2H9VA 2DYLA 2G9XA 3ORTA 3VS4A 2YIYA 3E8CA 3N9XA 3OT3A 4QP3A 5FEQA 5IUIA 1P2AA 2J6MA 3A7GA 3GC7A 5AR7A 5I0BA 5LXMA 4BCKA 1WZYA 4FZDB 3BU5A 1OECA 4E6QA 5HBEA 4RA5A 5E8XA 3PA3A 4RX9A 4A9RA 3KCKA 2CJMA 4FEVA 4H1JA 2NNWB 2BDJA 5DI1A 5J9ZA 3IW4A 3T3VA 3CGOA 1UA2A 2C47A 2CLXA 4GCJA 4UXLA 3LCOA 5HNBA 3H0YA 2CGUA 2QOFA 3PXKA 4FKRA 4LFIA 4OAVB 2EXCX 3HYHA 1YW2A 4DFZE 1OIQA 3CXWA 3OWJA 3OW4A 2Y4IC 3UIBA 1Q4LA 2W5BA 4RVLA 2ZV7A 2J2IB 1KOAA 3DDPA 1Q41A 3LM0A 5JZJA 1R0PA 3SRVA 4YTCA 4R3RA 2VAGA 4JBQA 4CRSA 2QG5A 4W9WA 3ET7A 3L9LA 4IFGA 4NTSA 5HO8A 4DFYA 3EZVA 3GQIA 4ZMFA 3ALNA 3P9JA 4JQEA 4TNBA 4W8EA 4GYGA 4EBVA 3MWUA 4U7ZA 2C0IA 3Q4TA 4NM5A 5DIAA 1OB3A 4BDEA 4H3PA 3UVQA 2IW6A 2JITA 3F5PA 4I92A 4XRLA 2OBJA 4J8MA 4LGDA 2JDVA 3KRWA 4I21A 4GJ2A 1M2QA 4IVBA 4E4LA 3PYYA 3LFCA 1G8SA 4O7WA 3EN5A 4BDKA 1JKSA 5A6NA 1V0OA 3D7TB 3IDPA 3RNYA 5AIRA 4EYMA 4YNOA 2G2FA 3QD3A 5AP0A 4ASEA 5BQ0A 3BQRA 3QL8A 1PY5A 4XV9A 2G15A 1XBAA 4EK8A 2QC6A 3IONA 3U55A 5M56A 3W8QA 2BZJA 4LOQA 3TUDA 4RPVA 5IDNA 4PNIA 4XMOA 4DFUA 3OFMA 4RIYB 2Y7JA 3R1NA 1BLXA 3EFWA 5HBHA 3UOHA 5IA0A 4GK2A 2YLFA 4BCIA 3DTWA 3S0OA 4BI0A 3QGYA 1WBSA 3NIEA 4FT3A 3T9IA 1GIHA 1XH7A 2BDFA 2CN5A 2W06A 2GS6A 3KXNA 4L01A 3WZUA 2EB2A 2OWBA 2XK9A 4BF2A 4DFNA 1Q8ZA 2VTSA 3VBYA 3LFEA 3U51A 4UB7A 4EUUA 1R0EA 3FL4A 4JG8A 5HEZA 4ENXA 2WTJA 3BPRA 3DZQA 3EYGA 4U41A 4QYEA 5EYKA 3UNJA 5KMKA 4JXFA 3KF7A 5IH5A 3LQ8A 2O2UA 2CNUA 3CY2A 3ZXTA 5KZIA 3NVMB 3R8ZA 2VTNA 3EFLA 1PHKA 1TKIA 2C3JA 4GG7A 4AGWA 5CASA 5IH6A 5JGAA 1U54B 2HWOA 5HBJA 5HTCA 2HOGA 3OUKA 1U5RA 3BGZA 3DBCA 1B38A 3G33A 2PU8A 3R8MA 1H28A 2Z7QA 3S95A 4CZTA 4HVDA 3UOJA 2XM8A 4R3CA 5T68A 5LMBA 1OL2A 4FE2A 1PXLA 3UJGA 4M0ZA 1TVOA 2YCSA 1L3RE 4ACDA 2OJ9A 5KMLA 4FZFB 4IVDA 5TKDA 5HTBA 4E6AA 4JQ7A 3G9NA 1PMNA 4FODA 4U43A 3P1AA 3ZRMA 4HCTA 4ZZMA 4FSWA 5ACBC 2OK1A 3OXIA 3V5PA 3GCQA 4KIOA 2J0JA 3MFRA 4XOZA 4N6YA 3HEGA 3I5NA 1U5QA 3ZO2A 2W5AA 3C4WA 4WBOA 3HDNA 3HRCA 4CTCA 4DH5A 3UBDA 3UZTA 3ENHA 3PXQA 4R8QA 1KOBA 3SVVA 1FGKA 5IMEA 3F5UA 5DMZA 3NUYA 2IZRA 4DH3A 5I9WA 2CGVA 1LUFA 2R3LA 3GU6A 1ZZ2A 3I79A 4IM3A 4W8DA 4E20A 3R8PA 4U3YA 4P90A 4AFJA 3K5VA 4PL3A 3U6HA 3FC2A 4BR3A 4OR5A 2WQMA 5DR2A 3EN7A 4IAKA 3EJ1A 2J7TA 1M2RA 3SOCA 3WIGA 3EMGA 2JDTA 3N4UA 4FTQA 4RMZA 4ALWA 1NY3A 4U0IA 4E4MA 4QQTA 3RHKA 3KK8A 4MXYA 3VW6A 4FF8A 2AC5A 4FV9A 5TF9A 3H9RA 1JOWB 4JDHA 3MSSA 3BQCA 4HVSA 4EKLA 4CKIA 2XB7A 2I7QA 5BPYA 2UZUE 2BKKA 3H10A 4H39A 3P86A 4C58A 1H07A 4ANSA 4HGSA 4MAOA 4II5A 4Y95A 5B2KA 3C0HA 2C1BA 4PL5A 4EH8A 2QOKA 4ZTQA 3RAHA 3RHXA 2ITNA 4X2JA 1PF8A 3GI3A 2FO0A 5M55A 3ZLXA 5KX8A 3BX5A 3O50A 4IXPA 1V0PA 4XG9A 3RBWA 2VTPA 1UV5A 5HIEA 2GHGA 4APCA 2C3LA 4G9CA 4LYNA 4C62A 4Z16A 3A4PA 3FZ1A 4G6NA 2Q0NA 4GW8A 5L2QA 5CI7A 3R04A 4FNXA 2QONA 3REPA 4RWLA 3FMNA 4QO9A 5ANJA 3FEGA 5IQFA 3OEZA 1JVPP 5M4UA 3OWLA 4DEHA 2VUWA 4X0MA 4DEAA 2WMAA 5ETAA 4IAFA 2XZSA 3TNQB 4U6RA 3Q5ZA 1PW2A 2GDOA 4G2FA 4F0GA 5HTIA 2Q83A 4K9YA 3LFSA 2ITXA 5AUYA 4FTTA 1TQIA 2CCHA 4TZRA 1OVEA 4BIDA 4OT6A 4YSMA 2YEXA 5EW8A 4EHGA 2J4ZA 2WTWA 3D0EA 4A9UA 4CXAA 2B9FA 4Q9ZA 5B7VA 4TTHB 2O64A 3ZLYA 1A48A 3VIDA 3PVUA 2IG7A 3MH3A 2VGOA 4QNAA 4FZ6A 2CNQA 2PUIA 2A19B 3P5KA 5IQIA 4C38A 1FVRA 4ASZA 4FL1A 3ZM4A 1YXVA 1Z9XA 2R7BA 3ORKA 1XR1A 3PIXA 3PVGA 4GFMA 5FG8A 4D2TA 4H36A 4EOIA 4F6WA 4F70A 3BYVA 3IK3A 3FQSA 4WKQA 3NYVA 3TDWA 3RWPA 4FTUA 1Q3DA 4RWJA 5H8GA 4NUSA 3NZ0A 3AD4A 4TWCA 2WMUA 3KRJA 3JVSA 3FJQE 4I93A 5HIBA 3OW3A 4GRBA 4ZJIA 3KGAA 5ETIA 1BI8A 4D5KA 2F9GA 4CYJA 2B53A 3VUKA 1W82A 3B8QA 4KSQA 4PX6A 5GJDA 4GYIA 3UNZA 5IA3A 5KBRA 4LOPA 4FT0A 3Q9ZA 4L00A 4F9AA 3QYWA 3PG3A 4L53A 3JVRA 4JT3A 3HV3A 5DRDA 2A1AB 1I44A 2X7OA 4TRLA 5AJQA 4ACGA 4N57A 5JH6A 3LXLA 3OT8A 5AR8A 3R7EA 4D9TA 4UBAA 1ZOEA 4R3PA 3VHKA 3DJ5A 5HG8A 2WTKC 1PXKA 4L67A 5DGZA 4E4NA 1SZMA 2DS1A 1GAGA 2F7XE 3O8PA 4WA9A 2GSFA 4WNKA 3A60A 3Q96A 2ITOA 3FLQA 1QPJA 4S30A 5E8ZA 4ANBA 5CAVA 3MY1A 3HGKA 4RRVA 4F9CA 5AUVA 1LEWA 2WMRA 4G17A 5BNJA 4CFWA 3VS3A 4DGMA 2JIIA 1BI7A 2ZAZA 2X9EA 1CKIA 4JG6A 4NL0A 4QMPA 4HYUA 3OCTA 1LR4A 3F6XA 2J9MA 4IVAA 3FDNA 5K4JA 2CGXA 5KNJA 2BTRA 4L7SA 5FQDC 3S4QA 4YSJA 3C5IA 2Z7RA 2PVMA 4BWKA 4YTFA 4FV3A 4O6EA 4UWBA 4FOCA 5F9EA 3TZMA 3EOCA 3OY3A 5CU4A 4TNDA 4E6DA 4CG8A 3BU3A 4S31A 5IUHA 5D12A 4EYJA 2V0DA 3LFDA 3EYHA 4Y73A 3C0IA 3D9VA 3DQXA 4E93A 4BBFA 1IEPA 5HLWA 4FVQA 3CY3A 1J7LA 3I0OA 3PZHA 4C59A 4DFBA 4RC3A 3DKFA 3QWKA 1PXIA 3GU7A 3JUHA 1H1QA 3EQBA 4AW5A 1G8AA 2CSNA 2OFUA 1OITA
chains in the Genus database with same CATH superfamily
3KA0A 3V5JA 4BCNA 2R0IA 1PXMA 4JDIA 1BUHA 2HAKA 4O4DA 4UMTA 4D5HA 1Q8TA 4DGLC 4OTQA 4PDYA 4FIIA 4O22A 1UU9A 5E9EA 4ZTHA 3V5TA 1LPUA 3EQGA 3ZHPC 4O0TA 5D10A 5CEMA 1E1XA 2RSVA 5CVHA 2QO9A 4YGAA 2YM8A 5DA3A 5CF6A 4RFYA 5C4KA 4FKSA 3R30A 3FLWA 1CSNA 3NUSA 3WARA 1FMKA 4QPAA 4AXEA 3QKMA 4FKVA 4JDJA 2J0IA 4IZ7A 3EL7A 4ITHA 4XYFA 3R21A 3PY1A 4Y5HA 5EDPA 5TE0A 5AUZA 3UMXA 2WMXA 4UN0C 4FSMA 5J7BA 3PUPA 2PSQA 2NPQA 3KRRA 3K2LA 4BHZA 5JFVA 3KXZA 5EG3A 1X8BA 2GMXA 3E62A 4Z3VA 3NFFB 4I6FA 3R7GA 4DH1A 3NW7A 3VBTA 4X3FC 4RVKA 3G0FA 2QLQA 3RK7A 2WIPA 1MQBA 2WEVA 3GC8A 3MA3A 3AD6A 2IO6A 4YHFA 3G51A 1XH4A 5HI2A 4QMYA 1Q8YA 3EFKA 4XS2A 3F66A 2YFXA 2IVSA 3HV6A 5HG5A 5CSVA 3CGFA 3IQ7A 4O21A 5AP1A 4B6LA 4EOKA 4D4SA 4ASXA 4AA0A 3VRZA 4CNHA 4AQKA 4C4IA 1UU3A 4GIIA 4IJ9A 2UW9A 1CDKA 3CD8A 1NA7A 3UTOA 4NIFB 4BICA 2XEZA 3QCSA 4IX5A 3MBLA 2XYUA 2UZDA 2WD1A 3NSZA 4MWIA 4BBEA 2X0GA 4BIBA 3OXZA 3JS2A 4D4RA 4EC9A 4EQMA 5A4TA 5I9XA 3CP9A 4O1OA 3BWJA 1M2PA 2W96B 1UU7A 5F95A 4KIQA 4NH1A 3FY2A 2VV9A 2LGCA 2DWBA 3OY1A 4FKIA 2VD5A 3KXMA 3DXNA 4MXCA 4WNOA 3S2PA 3W2QA 5CALA 4PQNA 2JKOA 4I23A 3BZ3A 2R0UA 4RLLA 3LFAA 4TT7A 5DYJA 5AV1A 4YR8A 1YWNA 4AX8A 1H08A 2YIXA 3WILA 2E9VA 4MEDA 5EM5A 4ANMA 4F1MA 2IVUA 4FZ7A 3TNPC 4Z55A 4V04A 5C8MA 3I0QA 3PJ2A 4BTKA 4CFXA 3DK6A 5IMXA 2YISA 4PMMA 2QR7A 3VBVA 4M84A 1M52A 3GNIB 4DG2E 3QA8A 3R7YA 4UYNA 5HZNA 4MNEB 3EL8A 3UIMA 3ZH8A 4X6RA 4A06A 4D9UA 1OI9A 5CVGA 4W4VA 4HYHA 4CG9A 2X0QA 2KTYA 3TJDA 4B8MA 4KINA 3O5AA 2NYAA 4XG6A 1YHVA 4F7NA 4KUJA 4MUQA 4MNFA 3TZ9A 1WMKA 3QZFA 3TT0A 3NNVA 3DTCA 3MFSA 1MRUA 5EM7A 1DI8A 3OCSA 4FJVA 3I6WA 5E8SA 5M57A 3AOXA 5LWNA 2F4JA 5DEWA 4QTAA 4A9YA 5HKMA 1QPCA 4JAJA 3NUNA 4EWHA 3MPMA 5AUWA 5ACKA 1JAMA 4P7EA 4G5JA 1H1PA 4AGUA 4FIHA 4ANOA 4YTIA 4XV1A 3NDMA 3DBEA 5EDQA 4ZXTA 4BCFA 4F1TA 3UQFA 1REKA 3RPVA 2GQSA 4BDGA 5BYZA 4DAWA 3C13A 4O0WA 4C02A 1W84A 1OL1A 4IFCA 1ZOHA 4J99A 4C7TA 4D2RA 3RAKA 2R4BA 4LM5A 3KB7A 5M44A 2ERKA 2XRUA 4GVJA 3MFUA 2BIKB 3CE3A 4UMQA 1U4DA 1VR2A 4TPTA 2VRXA 4U42A 4LV8A 4BTMA 2XK3A 2V62A 5EYCA 2B55A 2IWIA 4ZSEA 2GNGA 2NRUA 4PF4A 4X2FA 4M67A 5D41A 3PE1A 2PYWA 4JRVA 2NRYA 4WOVA 1JQHA 4G5PA 2OZAB 4DCAA 5GNKA 3BV2A 1W2CA 3MY5A 3HVCA 2H8HA 2VWZA 5LVMA 2OLCA 2WQEA 3NAYA 3HMPA 3W2OA 5L6PA 2J0KA 2J51A 5BVFA 4JJRA 2G01A 3D2KA 2X81A 5DR6A 3TXOA 1PXJA 1URWA 4CKRA 4ZTSA 3I1AA 5CTPA 4FA2A 2BAKA 4YNEA 3QAME 3PSBA 2B7AA 4NEUA 4ZJVA 2R9SA 4YUQA 2PY3A 2BZIB 3BBTB 3E92A 2IW9A 3W0OA 3EQRA 2PMLX 1IG1A 3BU6A 2Z7LA 3NYXA 1S9JA 4F1OA 3QTQA 2XK7A 5CY3A 3ZSIA 1K3AA 2UZLA 3Q32A 5DRBA 3MV5A 2JDSA 4J71A 4QP1A 4I5CA 4GL9A 1ZYDA 5K0XA 3WZKA 3Q9WA 1J1CA 2UVXA 5AUTA 4PDSA 4JX3A 3AC1A 3KMUA 4QDEA 2OXXA 4IX4A 2YZLA 2VZ6A 4IIRA 4PTCA 2HCKA 2UW4A 5D11A 2PMNX 3BHUA 4AZEA 2ETRA 5CZHA 4O91A 3R2BA 2WKMA 3HP5A 5AX3A 5BMSA 4CFFA 4Q5HA 2BUJA 4A4OA 5CLPA 2YERA 3GOKA 5LCKA 3FHIA 3V5QA 3MY0A 1Q61A 1B39A 2OH4A 3R1QA 3MB7A 4TN6A 4NYEA 5CAQA 1XMMA 5M4IA 2P55A 1VEBA 3FSFA 3GEQA 3O7LD 3UQGA 5H9BA 4B99A 3PZEA 1RW8A 1NVRA 1YXUA 4L8MA 1A06A 2FYSA 3QXOA 2AYPA 1XH5A 5ANOA 3RCDA 2WQBA 5EFQA 3W0NA 2VWUA 1V0BA 2OIQA 2W4JA 3GGFA 5EI6A 4GUBA 3E7OA 5TO8A 3ENMA 3NFGB 4X6QC 4DEEA 2XNMA 2YIRA 3FQHA 3CCNA 1PXPA 3QC4A 1PXNA 4UY9A 5LOHA 4PTEA 5HORA 3LCSA 4L43A 2Z7SA 4IQ6A 4OGRA 4GT4A 4OBOA 3FZPA 3O51A 3F82A 3QBNA 2OO8X 4K18A 1NT2A 4HGLA 1OKWA 4M69A 5AX9A 4O7TA 3R8VA 4OTGA 1K2PA 5FEEA 4I6LA 4F7SA 5J9YA 2ZV9A 3ORXA 4CYIA 5AR5A 2WMBA 1OIYA 2GS2A 3IDCA 3HP2A 1PYXA 3BIZA 1IRKA 3PSCA 3IG7A 4EKKA 5BVKA 4LL0A 3PG1A 4QMOA 1FBNA 3OCBA 2O63A 4TL0A 4IANA 4EOSA 3P4KA 3PSDA 1HCKA 5G1XA 3FQEA 5FBOA 3F5XA 3QTRA 4FNWA 2J50A 2QURA 3IPHA 3BLQA 3PA5A 4YZNA 5DT4A 1OBGA 1XH8A 2PUUA 3DK7A 4IW0A 3UODA 5KMIA 4R77A 5IQBA 3GU4A 5IH4A 3ID6C 3G9LX 4EQCA 2Y8OA 2JDRA 2R3JA 4KRDA 1Y8YA 4RZVA 3MGYA 2W1ZA 4APPA 4D2VA 5D7VA 5J87A 2IPXA 4O2ZA 5FTGA 5DEYA 5EOBA 5B0XA 1O9UA 5AV2A 2GFCA 2GNIA 2RG6A 4CQEA 5T6KA 4AA5A 2YA9A 3DXPA 3SA0A 4ARKA 3AT3A 3BE2A 4MWHA 2JFLA 2FSLX 3V5LA 1Y8GA 2XNEA 4PPAA 2P33A 2FSTX 3C5UA 4ZLYA 5A9UA 5LJJA 4JL9A 2WU7A 3OCGA 3C4XA 1PMVA 3HLLA 3RPOA 5HLNA 3POZA 5FLFA 4C4FA 3NRMA 4CCUA 1ZMWA 1VZOA 3UZRA 1H1WA 2QKWB 4GKIA 1XWSA 4YJVA 3SLSA 4WD5A 4FT9A 2YM4A 1F0QA 3RALA 3SXRA 1BL7A 3GT8A 3QHRA 3E7VA 5IA1A 4G6LA 4LUDA 2CHLA 3RKBA 5L8KA 4K1BA 1QCFA 5AR2A 3IGOA 4QMUA 4CMOA 5DLSA 5JZNA 4QMTA 4FG7A 2ZMCA 2QOBA 3R02A 2JDOA 4BGHA 2UVYA 2V22A 3MDYA 4ANQA 3SXSA 2XNNA 3MVHA 3BCEA 3K3IA 3QYZA 4FTKA 4XEYA 5JFSA 3ORMA 3Q4UA 2CDZA 1H0VA 1VJYA 2R3NA 4EEVA 5A4EA 5IU2A 2WQNA 1YKRA 4AW2A 2OFVA 4I22A 1R78A 3D5WA 3DBDA 4L44A 3R8UA 2E2BA 3E63A 3M2WA 3KULA 4JIAA 4YLKA 4KWPA 4Y5QA 3ALOA 3LMIA 3GQLA 4I4FA 4QMLA 5HHWA 3HAMA 2QOHA 1KSWA 1YI3A 2BILB 3ZZWA 3HZTA 3F69A 3H3CA 3R63A 5DFPA 2QO2A 4C57A 4EUTA 4I0TA 3DY7A 1VYWA 4RIWB 3ZO3A 4NJ3A 4YLLA 4EHVA 5JN2A 5AFVA 4DT9A 3L9NA 3MH2A 2WB8A 3TNIA 4BYIA 1OGUA 5JK3A 3ZC6A 4G31A 3EKNA 4I41A 3CTJA 4FVRA 4FEWA 4CMUA 5CYIA 1XQZA 5E92A 3A4OX 4FL3A 4X3FA 3TI1A 3OC1A 5IA2A 4QMSA 4Z7HA 2JC6A 3IW7A 1J91A 1H24A 4NWMA 3W2PA 3W33A 2X0OA 5JRSA 3CTHA 3KN5A 4L52A 5HNIX 4AN9A 3ZC5A 2R3RA 4R1YA 3V8TA 2XKFA 3EQIA 1A9UA 2VO6A 4FV7A 4H58A 4R7IA 4XCUA 4O82A 3FPMA 1J1BA 3DJ6A 2GTMA 4GK4A 2OIBA 2ACXA 3PUFC 2YDJA 3NNWA 4HZSA 4ITJA 2IZTA 4GSBA 4WBBB 3OS3A 4FV0A 4J97A 4NM0A 4Z9LA 4XP0A 4A4XA 1P4OA 5FXSA 4XLIA 4LQMA 1QPDA 2XJ1A 3ELJA 3AQVA 5IISA 2C6KA 1H0WA 2WHBA 4RWKA 3FLZA 4JR3A 4WG5A 5CS6A 5LVNA 3D5XA 3JR1A 3P5JC 4DHJA 3F3VA 3OWKA 3DAJA 3LFQA 3PRIA 5BUIA 2WFYA 1F3MC 4W4YA 4JAIA 5M06A 3RPRA 4KKHA 4FMQA 4FX3A 2YM5A 4C33A 1P4FA 4MF0A 4FSRA 2OI4X 2HZ0A 3WYYA 3P0MA 4F7JA 5L2SA 1WBVA 4IACA 3U9NA 2I40A 4K33A 3ZBXA 4IZAA 2I0EA 3AKKA 4LI5A 2HY81 4OTPA 5J8IA 3A99A 2FA2A 3SOAA 4YMJA 1MRVA 4O27B 4R5SA 1GNGA 2ERZE 2EXEA 2OW3A 3D5UA 3M1SA 4EONA 3GCPA 3UZPA 3FPQA 3B8RA 5HVYA 3Q53A 3FC1X 3MVMA 5H2UA 3SV0A 2X6EA 4EK6A 5CNOA 4ZJJA 3R6XA 3N51A 2UZBA 4E5AX 2QG7A 4IDVA 2B0QA 3NIZA 4FC0A 5AUXA 4QEBA 3DDQA 1UU8A 3R73A 4AACA 3EQFA 4YJQA 4E1ZA 2VTQA 2VTLA 3GU8A 4D1SA 3W0RA 4B4LA 1APME 3GP0A 4YZMA 3DA6A 4KS8A 4C37A 1OUYA 3MTLA 3GXLA 4M0YA 4M69B 2XK4A 5DT3A 3UP2A 3V04A 3QZHA 4BFMA 4LGGA 3LFBA 3BV3A 4R1VA 2F49A 1SMHA 2WEIA 3LE6A 3Q6UA 2XNBA 4K6ZA 5FD2A 4OTWA 3BHVA 2VX3A 3IOKA 4S34A 3PLSA 3BHHA 4D4YA 5HE1A 4ANNA 4QRCA 3OWPA 3WZJA 1H25A 4FKLA 4G3GA 4BWXA 2C0OA 2BPMA 3KF4A 3O7LB 5C9CA 2W99B 5E1EA 4BBMA 2YCFA 2YAKA 4MH7A 1RQQA 5TOZA 4OAUC 2PE1A 3LJ1A 4GUEA 2F7EE 5DNRA 4AGCA 3C7QA 4I4EA 2C69A 1G5SA 2FSMX 4BWPA 3AD5A 4BGQA 5IQCA 1HOWA 2VU3A 3ZZEA 2YACA 3NR9A 4E5WA 4ZTLA 5M4CA 3FMKA 5F4NA 3V8SA 1KUTA 1ATPE 2E9OA 2A2AA 4U5JA 2BHHA 4YC8A 4DGOA 3QQLA 4FV4A 1XKKA 2Y6OA 4LL5A 3AC8A 2JBPA 1O6KA 4RSSA 4X2KA 3UIXA 1EH4A 2ZVAA 4AXCA 4QQJA 3WE4A 3GC0A 5FP5A 2OJGA 5AWMA 5HQ0A 4M12A 4Y83A 5KMOA 4L9IA 3F9NA 1JNKA 5TT7A 3JPVA 2HK5A 4WRSA 3SKCA 1H00A 3WE8A 4DGGA 1XBCA 5DHJA 4FOBA 4OLIA 5DBXA 3PIZA 3QA0A 4IB5A 4RJ3A 5AP2A 1GJOA 5FM2A 3BBWA 3C50A 4G34A 4U81A 4DTKA 2Z60A 5M51A 5L8LA 4IX6A 3SG9A 2PZIA 1KE9A 3FZOA 1J7IA 2JGZA 4AXDA 4J52A 2B4SB 4DITA 4O7SA 3HA8A 3PP0A 3RK9A 4YPDA 5C01A 4PP7A 4DBXA 4IM2A 3Q5IA 4N0SA 1ST4A 3NYNA 3DAEA 2C6EA 4RVMA 3RZBA 4BTJA 2WTVA 4FIGA 5KKRB 4XP3A 3DXQA 3LAUA 4U79A 5BUJA 2YWVA 3QCYA 3PPJA 4C4GA 3CSVA 4UX9A 4KIKB 1QL6A 4FYNA 3KKVA 4CVAA 4FICA 4FT5A 3KL8A 3IECA 4C3RA 4E26A 3FAAA 4PL4A 5AR4A 1DI9A 3R9DA 2HZ4A 5I3RA 5BYLA 4C36A 4O1PA 2C6IA 1XH6A 4JBVA 3FYJX 2PZRA 3DKOA 4FTIA 1IAHA 2PHKA 2UW6A 2WQOA 4FV8A 3TV7A 4JMQA 4BCGA 5BVNA 3EKKA 4FIEA 4LMNA 4BJJA 1GOLA 1NW1A 3TKIA 5F94A 4GU6A 4G3EA 2X2KA 3LCKA 2VWVA 4DEDA 3DS6A 3P7AA 1YI6A 3QKKA 5CSHA 3QLGA 4J8NA 4BCOA 5HCYA 3RAIA 3PVWA 3BL9A 1K9AA 2Z2WA 3FMLA 1SNUA 4FV5A 2WGJA 2ZDTA 2OXYA 3O23A 4FSTA 4HYIA 4KD1A 2BRNA 4ACHA 4YP8A 3FL5A 2UVZA 4JBOA 4USDA 2JIUA 4JI9A 3MVJA 4Q5EA 4EORA 5HNGA 2XP2A 2B9IA 2XIYA 2W5HA 4ERWA 3KMMA 3WIKA 1U46A 5C26A 2JAMA 3NAXA 2HWPA 2XH5A 4KKEA 3W2RA 5IQDA 4XG3A 4U3ZA 4B8LA 1IASA 4CV8A 3MPAA 4PRJA 1JKKA 3SRVB 3U8WA 4AAAA 4Y85A 4EL9A 1QPEA 4GJ3A 4XG8A 3ZCLA 2CKPA 4MBLA 1YOJA 2BVAA 3LJ2A 2XK8A 2R7IA 2X8IA 2HYYA 3S1HA 4Y46A 4DHZA 2HENA 3SX9A 2BDWA 4DYMA 4O7VA 5AP6A 4MQ2A 4TXCA 4LRJA 4XJ0A 2JKKA 4GV1A 5HVJA 2X8EA 2XKEA 3MN3A 5GZAA 4DG3E 3AC5A 2DUVA 3LHJA 5CSWA 4O4FA 4R7HA 5GHVA 1XMLA 4A4LA 1FQ1B 1OL7A 4QYGA 4BVUA 3ZSHA 4L3JA 1TZDA 2BAJA 4FK3A 2ETKA 4GT5A 3QD2B 1E9HA 3HV4A 3F3ZA 1LEZA 3PJ1A 3PY3A 4MBJA 3I5ZA 3LLAA 2QD9A 4RA4A 1YI4A 4P2KA 5EQEA 3A8XA 4F09A 1IAJA 2PE2A 3SGCA 3TWJA 2IF8A 5BVWA 4QTBA 2C6OA 4EZ7A 3SHEA 3PIYA 1UNHA 4TY1A 4RX5A 3HUBA 2BRBA 2VTHA 4AFEA 2CN8A 2QOQA 3A8WA 5EDRA 3VBQA 3VAPA 3H30A 5IKWA 3V51A 3WF6A 4DFXE 2C30A 2WMVA 3COHA 4KIPA 4XG2A 3V5WA 2YITA 1SNXA 2Y6MA 3DOGA 4QP2A 4TYHA 2X1NA 5CQWA 3IO7A 3CLYA 4HOKA 5HOAA 2OGVA 4GS6A 4PY1A 5EOLA 3OUNB 4Y72A 2R3IA 3KRLA 4L7FA 3TIYA 4PTGA 3H9FA 3BYSA 3CKXA 5IQHA 4O7LA 2P0CA 2R3QA 4FKOA 3R83A 4KS7A 4MXXA 2OJFE 4O0RA 3D83A 4ALVA 3UGCA 1ZARA 2W1EA 4EHEA 3TKHA 3UO5A 3A62A 3KC3A 5J7HA 4DF3A 2XBAA 3LXNA 5ANDA 2XKCA 5HX6A 4U44A 3EHAA 3VN9A 3FI2A 4G9RA 4BZOA 3BGQA 4FUYA 4NJDA 5JSMA 4E6CA 3FUPA 1OMWA 3VVHA 3ZTXA 4J7BA 4C4JA 2C6LA 2VTTA 4FKQA 4FKWA 4UALA 2JD5A 4IMYA 4QNYA 1STCE 2UW7A 4OTHA 1YHSA 1XBBA 3F7WA 5H8EA 2WTDA 3LQ3A 2QI8A 3F3UA 4J96A 3U6IA 2P2HA 3BGPA 4IWOA 4WSQA 4YZ9A 2HY0A 1H1RA 2OXDA 4B0GA 4ZTNA 3SQQA 3BRBA 4EJNA 3QTWA 1Z5MA 2F57A 3TNWA 1OM1A 3AG9A 3OEFX 4EK4A 4BI2A 3A7HA 3NUPA 4EH9A 4ZLZA 4BDDA 3TACA 5AM7A 1M17A 3D14A 3PA4A 4TYJA 5AEPA 5BVDA 5AM6A 4XRJA 3TTIA 4F64A 5CF4A 2UZTA 1IA9A 1KE5A 1ZY4A 3F5GA 3FXXA 3Q2JA 1VYZA 3QUPA 4ZSGA 1YWVA 4EH5A 5KMMA 4BCQA 3IW6A 3DU8A 3TIZA 4N70A 2XRWA 1Z57A 4B7TA 4DCEA 4CMTA 5K9IA 4JRNA 4L42A 2ETMA 3NNXA 4KAOA 5A6OA 4IAAA 4YTHA 1FVVA 4AZVA 4E8AA 3MIAA 3TV4A 5I5ZA 3R9NA 3VJOA 4YHTA 3ANQA 5FTQA 4C3PA 5DR9A 3E3BX 3PRFA 3R8LA 4CRLA 2ITVA 4FSQA 1W98A 3UOLA 3TUCA 2C3IB 4AF3A 3QQJA 3TM0A 3FYKX 3GCUA 2XIXA 1WVYA 3MYGA 4IH8A 4XV2A 3UP7A 3UYSA 3VUTA 1URCA 2PVLA 3W2SA 4WRGA 4AOJA 4FTOA 4NSTA 3QCXA 5EW9A 4YJRA 5M08A 2PVKA 5TR6A 3NEWA 5EYMA 4ACCA 5KMJA 2GNFA 2CKEA 5B2MA 5AA9A 3FY0A 2XIRA 2R64A 4S33A 4ZOGA 3VUHA 4FSYA 4BDJA 3E88A 4EH2A 4HNIA 5JKGA 4D28A 4D1ZA 3VBXA 4CD0A 1Q8UA 4FSZA 4NW5A 3NPCA 2B9JA 4JIKA 2W1IA 3O8UA 2QNJA 2XM9A 4KNBA 2C5NA 2PTKA 4QOXA 1E1VA 4DINA 4PNKA 3ZLWA 5LVOA 4DLIA 2JEDA 2GS7A 2AUHA 2HXLA 2ZM4A 5HGIA 5L3AA 3R0TA 3S00A 4DGNA 3RWQA 4RX7A 4H05A 5CWZA 1OIUA 2C6DA 2OF4A 4IWDA 5K4IA 4LDTA 4HYSA 3Q4CA 3RAWA 3VUIA 3MJ1A 3MFTA 2G2IA 1WVXA 5EM8A 3COMA 4K0YA 1YDRE 5CX9A 4KBAA 3S3IA 3U4UA 4QP4A 3EN9A 3IGGA 3QUDA 4YJTA 4AG8A 3GBZA 4BCPA 1JKLA 3DFAA 4GK3A 1ZZLA 3C4EA 3R01A 5HG9A 3ZUTA 3DJ7A 5E7RA 5HO6A 2IVTA 4FEUA 4XHKB 1NVSA 4DH8A 5GINE 4I0RA 3G2FA 2YABA 3C4CA 3PXYA 4HGEA 3W0PA 2IEWA 2AC3A 3RK5A 4ZIMA 2C3KA 3WBLA 3OZ6A 4I5MA 4ALUA 4X2NA 5DE2A 3W8LA 1YWRA 4RIXA 3FE3A 1PKDA 3PTGA 3QZGA 1CMKE 2ZJWA 3F7ZA 3MW1A 4AOIA 2X6DA 4RT7A 2WTCA 3QRIA 3R7OA 2V7AA 1UWJA 4CZUA 3HUCA 1W83A 4L3PA 3COKA 2VO0A 4W9XA 4E73A 3W0SA 4FEXA 3UNKA 4R78A 3QRUA 4RZWA 4AU8A 5CXZA 5J5TA 5FWKK 2B54A 4LOOA 2F7ZE 4MKCA 4AT4A 5F20A 4BDIA 5EQPA 3KVXA 4IADA 4NTTA 4RC2A 5KHXA 3DNEA 3HRFA 4A07A 3ZBFA 3LMHA 4BB4A 4RVTA 4EQUA 3KN6A 4FT7A 4EOQA 4WSYA 4HW7A 3ORLA 4B9DA 3RPSA 2QHMA 1WFCA 2XNGA 4WG3A 4BKZA 5IF1A 2OSCA 1UWHA 1IR3A 3QRTA 4R5YA 2VTMA 4ZEGA 4D0XA 2YAAA 3DFCB 5DG5A 3I7CA 4EBWA 3UPZA 2PPQA 1FPUA 3VW8A 2XMYA 4AUAA 2R2PA 2EVAA 1LP4A 4AT3A 5J1VA 3LIJA 3TTJA 1WBOA 4FUXA 5KZ0A 4C2VA 3PPKA 4FV6A 4NW6A 3L8SA 3K5UA 4Q9SA 2OKRA 4QP9A 2PMIA 2R3MA 4AZSA 3BYOA 3C1XA 5HE2A 3IW5A 4IC7A 1PMEA 4YLJA 3TG1A 4I6BA 2PMOX 3HA6A 5AADA 4LMUA 3ATSA 3WF8A 4O83A 4MYGA 1MRYA 3P7CA 3OBJA 1YQJA 4YZCA 3KCFA 4BZNA 4S32A 4EH6A 3R7UA 3E8EA 5JQ8A 5LVPA 4I3ZA 2Z8CA 2LAVA 1P5EA 5H3QA 3FWQA 1REJA 1KV1A 4CGAA 4D0WA 3JXWA 3SG8A 4HZRA 5I3OA 1ZRZA 4F9BA 3NCZA 2ZOQA 1Y57A 1ZY5A 3VUGA 2J5FA 3ZS5A 4O81A 2Y4IB 4FG9A 2UV2A 4HJOA 4AZFA 1DAWA 3DNDA 3QTIA 3IS5A 3ORNA 3FV8A 4L46A 2PWLA 1W8CA 4IC8A 5KBQA 4EOLA 3KRXA 2IZSA 4RJ8A 3QCQA 3TNHA 3DBFA 4OTDA 2C4GA 2PVNA 3C51A 2X39A 3QRKA 3A61A 4RJ4A 1JWHA 3IKAA 5FDPA 4OTIA 3GU5A 3D7TA 2R5TA 2BRHA 2W1GA 3CPCA 4BDHA 5BUEA 5I9VA 2Q0BA 3PY0A 4O2PA 3TL8A 2IVVA 3NUAA 5CEKA 3ORZA 4FKPA 3OG7A 4X3JA 2BRGA 5IEYA 4UWYA 3H4JA 1M14A 2VNWA 4MXZA 5AMNA 3VO3A 4BHNA 3NUXA 4RIYA 5FXQA 4YJOA 5CF8A 1ND4A 4H3QA 4RJ6A 4K2RA 5AP4A 1AQ1A 3QTSA 2IN6A 4IE9A 3W1FA 4GMYA 5EM6A 5KCVA 5M53A 1YXSA 4KB8A 1YDSE 4O38A 5KUPA 5FBNC 3F2AA 2ITWA 3VS1A 3KK9A 3ACKA 2OJJA 3UO6A 4F08A 2J5EA 2UUEA 1ZYLA 3QQKA 3LMGA 2P4IA 1FGIA 3AC2A 3ZSGA 4OT5A 3G15A 5F1ZA 2XKDA 3TCPA 2X2LA 3ZRKA 4IWPA 5IUGA 5AAEA 4O4BB 3L8VA 4K8AA 2OH0E 4XNEA 4PDPA 2KULA 5BVEA 3WI6A 4AP7A 5J79A 1U54A 3QQHA 1QMZA 5K0KA 4QMWA 3R7VA 2V7OA 4JVGA 3DB6A 5GJFA 1Q24A 3ZU7A 4AA4A 3LXKA 4Q2AA 5T3QA 4DHFA 5HESA 2X9FA 5E8TA 4MXOA 4KKGA 4XBUA 4F63A 1NXKA 3KQ7A 1H26A 3NNUA 2YM6A 5BMMA 1CM8A 4KRCA 4RQVA 4M68A 5E90A 3PWDA 5LMAA 2RFSA 4JR7A 4FV1A 4O0UA 5J95A 3UIUA 4AAYA 3RI1A 3N4TA 4DT8A 2C0TA 2JBOA 4JS8A 3CD3A 5CU0A 5ANEA 3LFNA 5AUUA 2GTNA 2RG5A 1R39A 2ZDUA 4D2PA 5GJGA 5HCXA 5A4QA 4WNMA 2X4ZA 1GZ8A 1H8FA 1UNGA 2GQRA 4EOMA 2WZJA 3PFYA 4BDAA 3UPXA 2I0VA 2GFSA 3EQCA 2UW8A 3IW8A 4O4EA 2CKOA 3U54A 2GQGA 3HDMA 1OKYA 5IG1A 3NGAA 4ZY4A 3OROA 4BC6A 2QODA 1ERKA 3BEGA 2H6DA 2ITUA 4HGTA 4P5QA 2W9ZB 4ZS0A 1U59A 5CZIA 4DDGA 1Q8WA 4WT6A 2J0MB 2O65A 1T45A 4G1WA 2HW6A 2RKUA 3QQGA 2EUFB 2IJMA 4DFLA 4X7QA 2RFEA 2W1CA 4G6OA 3RP9A 4FKUA 4AE9A 4F0FA 4MBIA 2QU6A 4GKHA 3DAKA 4WHZA 2XIKA 3CR0A 1ZAOA 2E9NA 3ETAA 4PDOA 4CEGA 3UO4A 2G2HA 3ODZX 2O3PA 4RG0A 3ZXZA 4O7ZA 4FTRA 1OL5A 4DH7A 5JQ5A 2EXMA 3MJ2A 1NVQA 2YDKA 4XX9A 5HO7A 3HMMA 4TYGA 3VHEA 3VRYA 4KBCA 5AV4A 4MK0A 5KHWA 2SRCA 2QOOA 4G3DA 3FZTA 3CBLA 1OL6A 4UWCA 4AT5A 4M3QA 3MI9A 4CCBA 2QQ7A 4QQCA 3ZO1A 2PUNA 2BAQA 4YBKA 1OKVA 4L45A