4GK2A

Human epha3 kinase domain in complex with ligand 66
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
265
Chain Sequence
VHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRLKIITNLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Optimization of Inhibitors of the Tyrosine Kinase EphB4. 2. Cellular Potency Improvement and Binding Mode Validation by X-ray Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords EPH receptor A3
total genus 87
structure length 265
sequence length 295
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gk2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gk2A01
4IM2A 5B2KA 2RF9A 3ZZWA 4FTMA 4MAOA 3KCFA 1HOWA 5JFSA 2VRXA 3BLHA 2C0TA 5CSVA 4D2WA 2BDFA 4PPBA 4QQ5A 3OP5A 4U9AA 3PTGA 4GU9A 2W4OA 3NCGA 5BYZA 3QHRA 4IB0A 4R3PA 3FEGA 1QPJA 3RK5A 3CKWA 3FQEA 5CT0A 1YXTA 4FSTA 1YW2A 4RIWA 4WNKA 2VNWA 5EOLA 2DUVA 4E5AX 3A4OX 4GG7A 4G3CA 2YCRA 2XK9A 3CQUA 2WMUA 4X0MA 3S2PA 3W2SA 4DFXE 1PXOA 2Z7RA 4M13A 2QOQA 5CQWA 5CU4A 4EOKA 5IPJA 3N4UA 5GJGA 3BWFA 4QMZA 4O83A 1YXUA 3PXZA 4ZTLA 1RDQE 3H9RA 4PMTA 3UVPA 4ZMFA 2FB8A 2G9XA 4QTCA 1WBNA 4E5WA 4EQMA 3FI4A 5A54A 4XLVA 3CD3A 3TN8A 4AE9A 4XG2A 3DBFA 4BGQA 1J7IA 4EL9A 4O0YA 1XH8A 4ANNA 4D4RA 3QRKA 2QKRA 1WZYA 2VTJA 3LFQA 4MTAA 1URCA 1JWHA 2PZYA 4KKGA 2QURA 4M68A 4RA4A 5A3XA 2JKOA 4OTFA 2XIYA 4B7TA 2NO3A 5CVFA 4ZOGA 4EH6A 4BTFA 5IQCA 3G6GA 3PVBA 5AV4A 3ET7A 3QCSA 3UG1A 4UV0A 3A8XA 2Y6OA 4PMMA 5AAFA 2VWBA 4QMTA 4MWIA 5J95A 4EOQA 1F3MC 2C5VA 5GZAA 1RW8A 4YTHA 4QMSA 4UBAA 4EOSA 2J0LA 2UZUE 3VS0A 2FSTX 2XUUA 2C1AA 1V0OA 2B9HA 3NUUA 3VBYA 3R9NA 3FKLA 3FLSA 3ROCA 4J52A 3QLGA 4MHAA 2X39A 3D5VA 3IW5A 2Y4PA 3DV3A 3NRMA 4S32A 3WE4A 3WOWA 3EMGA 3ZUUA 3Q32A 2EU9A 2J5FA 4RT7A 3GC7A 5LCJA 2NNWB 3QTXA 2X4ZA 2XH5A 3IDPA 5DWRA 4FTUA 1BUHA 4WG4A 4E5BA 5CSPA 3RGFA 3PZEA 2G2FA 5IQHA 4O0WA 4RX7A 4D4YA 4RQKA 4X21A 3ANQA 3FZTA 3MA3A 3MFTA 3SRVA 5JK3A 2OXYA 1FQ1B 2I6LA 2GHLA 4EH7A 4ACGA 5AA8A 4A9RA 1A06A 3LOKA 2UZWE 2XRWA 2OH4A 4MXXA 5GNKA 3WF8A 2GTNA 1NW1A 3W18A 2F4JA 4JDHA 3FC1X 3R9RA 2FO0A 3HNGA 2OI4X 3NIEA 5FGKA 3RNIA 2PU8A 3O51A 1P2AA 3CJFA 4L52A 3KY2A 1PXPA 2W96B 4FSWA 4JRNA 5CALA 2PE1A 3HMNA 5KHWA 2HK5A 1GJOA 2FSLX 2VTPA 4YHJA 4PP9A 5AUVA 1PKDA 5CEMA 3BKBA 2CPKE 2FGIA 3WZEA 5HCXA 3U51A 2BVAA 3OUNB 5D9HA 3NW5A 2IZUA 2C30A 4QP4A 4DFBA 3WIKA 4CTCA 4E4LA 4ZTNA 4IAAA 4BRXA 3KK9A 3PVUA 4IC7A 3VBTA 3CSVA 2XIZA 3LCSA 3R7IA 3OS3A 5J1VA 1W0XC 3FXXA 3BLRA 4FIIA 4NZWB 4ENYA 2OLCA 5C4LA 1FMKA 1QMZA 4QNYA 3WYYA 3QBNA 4EK3A 2UW0A 4ZMEA 4NCTA 4UY9A 1P4FA 4AN9A 3EZVA 2PMOX 3P86A 3I60A 3HRCA 3FZOA 4PDOA 5A4EA 5M06A 5CEQA 3ITZA 1NA7A 3R63A 1Y91A 5HO7A 2BHHA 2KTYA 3KRRA 3RJCA 3BV3A 4BKYA 4XYFA 5HD4A 3QRJA 1OIUA 2OH0E 3HEGA 4QMLA 3HAMA 3E8NA 2PZRA 5CEOA 2Z2WA 5BYYA 4WKQA 2HY0A 4X3JA 5F94A 4C36A 2XKFA 1BMKA 5AWMA 2OJFE 4EOPA 3KB7A 1H28A 2OU7A 3QFVA 3DXPA 5C26A 2W5AA 4WNMA 5DH3A 5EG3A 5AUWA 3TJDA 2I0VA 5KCVA 2B9JA 3D9VA 3V8WA 2BKKA 3HV6A 3VULA 5CAOA 1CMKE 4F7NA 3DJ7A 3TKHA 1YOJA 4Q5HA 2QI8A 2NRYA 3F66A 3I1AA 4DINA 3RI1A 2GFSA 4DFZE 4CYIA 2IZSA 4G9CA 1ZYJA 1YI3A 4KIOA 4O0TA 5LXMA 5CI7A 2OZOA 3AMBA 3QWJA 2J0JA 2XKEA 3A60A 4D1SA 4NU1A 2XNGA 3BHYA 3ZUTA 3HV5A 1A48A 4GIHA 3DTWA 3NYXA 5AP2A 3R04A 2JFMA 4XG8A 2R3QA 4ZSJA 2BZIB 4G1WA 5A4CA 2C6LA 3M11A 4AX8A 3TZ7A 3JYAA 4L6QA 3M2WA 4D2SA 1XH4A 2R0UA 4HJOA 2WIPA 4RIYA 4YC6A 3RCDA 4G31A 4MXCA 2IJMA 2RIOA 3ORKA 1MQ4A 5F95A 4W8DA 1KUTA 3ZO3A 3V5TA 5LVNA 2C68A 1YWVA 4Z7GA 3L9LA 2YM3A 4FSRA 4RFYA 2WXVA 1JSTA 5CAVA 2PE0A 4EYMA 2DWBA 3PG3A 3TZMA 3UOHA 5FTQA 4ZLOA 5IQGA 5F1ZA 4IBMA 2ZMCA 3S0OA 5BMSA 3QTSA 2C6OA 2HY81 4N6ZA 2VX1A 5D12A 5CENA 3REPA 2W1CA 1UNHA 5IQAA 3E8CA 5LVPA 5LQFA 1UV5A 4L53A 4FKPA 5I4NA 3ENMA 4U6RA 2BAJA 3R1YA 4FGBA 4QPMA 4RFZA 5AP1A 4O7YA 4P90A 1XBAA 3P5KA 2XCKA 4UXQA 4AXAA 4E7WA 1V0PA 2OSCA 2PMLX 4IFCA 4EOOA 3OXIA 4F1TA 3C0IA 3UTOA 2WOTA 4IC8A 3MS9A 4XCUA 4FKQA 3HL7A 2HW6A 3W8LA 4DCEA 2OIBA 4E4XA 4PMSA 4YBKA 2VD5A 4QMMA 4CKIA 3ZCLA 3MPMA 1CDKA 3MB7A 3DK6A 3IQ7A 3PLAE 3KVWA 3PA5A 4K77A 4YO4A 2BRBA 3KULB 3VQHA 4FEXA 4E93A 2X8DA 5GZ9A 4YJQA 5E8SA 1XHAA 4PX6A 3MH1A 3Q2JA 1JKTA 1J1BA 2VTOA 4NJ3A 3GQIA 2QO9A 2ITOA 2R3FA 4PWNA 5ETIA 3OEFX 5BPYA 5GIPE 5E9EA 1XJDA 3MB6A 2E9UA 3GBZA 2CMWA 3HUCA 4WG5A 2VTMA 4U41A 4E4MA 4FT0A 5GZ8A 2IVUA 5M4UA 3DZQA 4AOJA 3N4VA 4MEDA 3LFDA 3MY5A 1OIYA 3SHEA 3QUDA 3IOKA 4R5SA 3CE3A 4DEDA 4G3FA 2JDVA 4XH6A 2WQBA 3HP5A 4PRJA 4EH5A 4AW2A 3DXNA 3U4UA 4ANLA 4DLJA 3E87A 2I40A 1YDSE 4AT4A 1XH7A 4WO5A 1CSNA 2HZ4A 3MY1A 3R00A 2G1TA 4U44A 5L8JA 3T9IA 5CZIA 2UVXA 3HV3A 3Q04A 4XG7A 1PJKA 5AUYA 3ZLYA 4DYMA 4F9AA 1KE7A 4FSUA 2XNBA 1FINA 4F1MA 4DT8A 1ZRZA 2JAMA 2RKUA 4CYJA 2W06A 4LM5A 3UC3A 4C8BA 2VN9A 1A9UA 4ERWA 4U7ZA 5DOSA 3PJCA 3DOGA 4LMUA 4M0YA 3CD8A 4TWCA 3VUIA 3ODZX 1W83A 5H9BA 3F69A 1QCFA 3CP9A 3O50A 3VF9A 4DN5A 3FSFA 3SW7A 4NWMA 3KC3A 3VNTA 2QO2A 3OW3A 3N9XA 4RIYB 4ZP5A 4RC2A 3BIZA 5HE2A 4MF1A 4Y5QA 3UDBA 2H34A 2R0IA 5L2WA 4GKHA 2XYUA 4FV3A 1Q62A 4Q9ZA 3Q4ZA 3R02A 4D0WA 4USFA 4YPSA 2Q83A 3NIZA 3NGAA 5CF4A 2IZRA 4AUAA 3IONA 4GL9A 4XS2A 4DLIA 3BYVA 2CN8A 2J2IB 3GXLA 3R7OA 4UMPA 1WBOA 2AYPA 4C3FA 1NVQA 3H10A 3B8RA 4BZDA 3MIYA 4G3GA 4F0FA 5KKRB 4HGLA 4CFXA 3H3CA 3AT4A 5HLPA 3R8MA 4IADA 4K9YA 3OOGA 3MJ2A 5AP0A 3ZXTA 3PWDA 3Q52A 3R9HA 4BDKA 2R3NA 4NT4A 3QCYA 3GU7A 3OF0A 2BRMA 4TY1A 4FV7A 3NNWA 3ZLWA 5AR4A 3LE6A 3EFLA 3CTHA 1HCKA 4PQNA 3QTZA 2WQEA 3QQHA 3PWYA 2R3RA 3EN5A 5IMXA 3G15A 1SNXA 4D9UA 2E9PA 5CI6A 2C0OA 4JRVA 3EQIA 3OCSA 2C5XA 4K11A 4FV0A 4IX4A 4TRLA 3ATSA 1DAYA 4O0UA 1FVTA 1T45A 3KULA 3MVLA 4RSSA 4ZSLA 4ZZMA 2BCJA 2ERKA 2JDSA 1SVGA 3RPSA 2GHGA 4OTWA 5BX0A 4HZRA 4F65A 2BALA 4AE6A 4EOIA 1PY5A 1URWA 2F9GA 5L6WL 5JT2A 2Y8OA 2UZBA 2BZJA 4ZLYA 4G3DA 5J9YA 1R3CA 4NFNA 3WZDA 2R3JA 3BEAA 3DKFA 3R71A 2RL5A 5D1JA 5IQFA 4QD6A 4I0TA 3QD0A 5JSMA 2QLQA 2CLXA 1M14A 4JBQA 4TYHB 4JG6A 3F61A 1IR3A 5IDNA 2R5TA 4EK6A 3BQRA 1ZOHA 3GCSA 5A6OA 2A1AB 4F63A 4N57A 4MBLA 3DQXA 3IW7A 1YI6A 2GNGA 2ZB1A 3CGOA 4RWIA 3BU6A 3P7AA 4L45A 2PPQA 3Q9WA 1YDRE 3QC9A 4BHZA 3F3UA 1Q8YA 3PYYA 1Q8WA 3WF6A 5EQPA 5C9CA 5K5XA 4Q5EA 4AZWA 3BHTA 1EH4A 3EQDA 4OUCA 4HVIA 2JFLA 3C5IA 4FV1A 5DT0A 1U54B 3EN6A 2VWXA 5AP7A 4QP8A 4QQCA 3QGYA 2JBPA 3MH0A 2ITUA 2R3GA 3AC1A 2GHMA 4LGHA 5TO8A 4QYEA 4RJ3A 5HTBA 3POZA 2I0EA 4IZAA 3ZRKA 4BTMA 5E8YA 1WVXA 3ORZA 2PVRA 5FEDA 3SX9A 5AX3A 4U5JA 3A8WA 2OF4A 4WBBB 3MIAA 4AACA 4PL3A 4OT6A 2WEVA 1ZMWA 5HE0A 3FLYA 2VTQA 2ERZE 5JGDA 4QTBA 4UXLA 4F4PA 4HGSA 4MXYA 2YZAA 5HOAA 3SGCA 2IWIA 4QRCA 1W98A 5DMZA 4BDDA 3VS3A 5BUEA 4PPAA 2Z7LA 5EI6A 5E92A 4ZIMA 3R8LA 2UW7A 4ANQA 1QPDA 4GEOA 4BL1A 5IH4A 5HICA 4FEVA 3LXKA 1LEZA 2R3LA 4QMVA 3NUXA 4NYEA 4QTAA 2YCQA 4A06A 4RGJA 4ALVA 1TKIA 2RG5A 4KSPA 4L44A 5DLSA 5KX8A 1W84A 2I7QA 3FHRA 4BCFA 5AADA 2CGUA 4H1JA 2R2PA 5CU0A 3DK3A 4RPVA 2P3GX 3TNPC 4IWDA 4ALWA 3KRLA 2C47A 5GJDA 4X6RA 2X2KA 3WF5A 4FIJA 3SXRA 3HECA 4JR7A 3VHKA 4H3QA 1GZ8A 2HZ0A 3C51A 4O1PA 4R7HA 5FD2A 1PW2A 3QX4A 2J0IA 3F5UA 3LZBA 3D14A 1YWRA 2RFSA 4YBJA 5EHOA 4EH9A 5HX6A 1OL6A 1H0WA 3VRYA 4EC8A 5HVJA 3C4EA 1UNLA 2EXEA 5I9VA 4FE2A 3QKMA 2WMTA 3ORLA 4ACMA 3SQQA 3FMHA 2WMAA 2O5KA 4YC8A 2Z02A 1ZLTA 1SVEA 5FTGA 3OCGA 3EKKA 5IZFA 3GT8A 1I44A 2WMRA 2E2BA 2XK4A 2F2UA 2BTSA 3LXNA 2CNQA 2YM6A 4AFEA 3Q9YA 2XEZA 5CF5A 5CXZA 5AAEA 4PNKA 3FKNA 3ATTA 1IASA 3QQKA 4FNZA 4I3ZA 1FGIA 2G01A 2W05A 2YM7A 3RKBA 5IMEA 3NYNA 5L2TA 5LOHA 4LYNA 4EHZA 4CV8A 3U9CA 4ZZOA 2R64A 3MPTA 4AZVA 3NZ0A 4JS8A 4KIKB 2BZKB 4I94A 4IM3A 4IDTA 1XO2B 4L68A 3DFCB 1OUYA 2JC6A 1SZMA 1REJA 3BI6A 1IEPA 4O2PA 4ZJVA 1OGUA 2VGPA 1K2PA 3KF7A 4GSBA 3C4XA 4DFNA 2W9FB 1H0VA 4FL2A 5TR6A 3FV8A 2J5EA 2XJ1A 4O38A 3V6RA 5CSWA 3ZM9A 1PXIA 5DEWA 1JBPE 3TTIA 5B0XA 5KE0A 2WHBA 3Q6UA 4UB7A 3NW6A 4ACCA 2QOLA 4BGHA 3VS2A 3MESA 1MRVA 4R6VA 4BN1A 4LFIA 4D4SA 3PSCA 4FSNA 4JQEA 2ITVA 4BBMA 1WBSA 3QL8A 2WAJA 1QPCA 2W5BA 5BVOA 2IZTA 3GUBA 2HYYA 4KB8A 3RM6A 5HVKA 2ZV9A 4X7QA 2C3IB 2UVZA 5CXHA 3OTUA 4XBRA 2UZNA 5J1WA 3KRWA 4B0GA 4ANBA 3FZPA 3POOA 2ETRA 4KAOA 3SDJA 3NNXA 2VNYA 4GFOA 1YRPA 3HA6A 4I5PA 4O0RA 3TL8A 3ZSHA 4ENXA 4GG5A 3LM0A 5IQEA 2X4FA 3LJ2A 3C0HA 3UIMA 3A7FA 2RSVA 4FEWA 1FBNA 5L2IA 4FC0A 4ASEA 3AC8A 4AGUA 4FODA 2BROA 4O27B 2C3KA 4BWXA 1FMOE 3WF7A 5B2LA 3P4KA 3E62A 3T8OA 5EKOA 3RBWA 3MN3A 4O21A 3D5XA 4HCUA 1YXVA 4X6QC 4NCTC 3CQWA 1OIRA 2ZM1A 2WTKB 3TV4A 4EWQA 5BUJA 1H1QA 4W9WA 4RVTA 3IPHA 2C6TA 2R7IA 1VR2A 2A4LA 4M3QA 4DG0E 4TKSA 4FT9A 4KKEA 3VF8A 4FYOA 2QOKA 3R7GA 3R9OA 4QYHA 4Y72A 3WF9A 1ZMVA 3GEQA 4HVSA 4AP7A 3LQ3A 5IEYA 1PYEA 3H4JA 5DHJA 2OO8X 4QOXA 3SOAA 3ZM4A 4IEBA 4B9DA 3FI3A 1BL7A 4KSQA 4WRSA 4CFMA 5IQDA 3F7ZA 4L7FA 3R2YA 3QA0A 3UNJA 4ITHA 4L01A 3A2CA 4YC3A 4L67A 4C4IA 2O2UA 3BHUA 3E88A 5AUZA 3R22A 4TL0A 3O7LB 2OG8A 3DAEA 3GB2A 4JIAA 5FDXA 4EZ7A 5CAQA 3LFFA 5L6OA 4U3YA 4NKAA 3LFBA 3ORTA 4ONAA 3P23A 4XHKB 4CXAA 5LMKA 2V0DA 2XA4A 4Q2AA 4BCPA 3JY9A 2VZ6A 3FDNA 4FIEA 3ZH8A 4JDIA 4BYIA 5IKWA 5K4IA 5M08A 2PVLA 1E1VA 3UVQA 3ORNA 5DVRA 3VO3A 4DGNA 4PMPA 2ETKA 2UZVA 3AD5A 3ZEWA 2BAKA 2YDIA 1R1WA 4F6UA 2FH9A 3GOKA 3TJCA 1H1SA 2CGWA 5DNRA 1MRUA 3EQFA 4XOYA 5IA0A 3G51A 3GC9A 4BIDA 1YQJA 5DYJA 5EM5A 5IUHA 4I6FA 3TZ8A 3FY0A 4DFLA 1XBCA 3QAME 4AZSA 2Y9QA 1G3NA 5IQBA 3C4ZA 4O7VA 3FBVA 4LUDA 4MQ1A 2BZHB 2IN6A 4PUZA 4RWJA 5JQ8A 1LP4A 4LL0A 3UC4A 2B53A 4BBFA 4U42A 4ZSEA 4OW8A 4WNPA 4BKZA 4CD0A 4FSZA 4PP7A 1OKVA 2YM4A 2W9ZB 3HA8A 5KMJA 4AA0A 3MJ1A 2W7XA 4BIEA 4EC9A 1H1PA 4IVCA 4C2VA 3BX5A 4PL5A 4BTJA 3EHAA 4J98A 1AGWA 1H07A 1LPUA 5HE3A 4IE9A 4YJRA 3DU8A 5I9WA 4B8MA 1IAJA 4B6LA 5TKDA 2NP8A 2X9FA 5CVHA 4OT5A 3ZYAA 2YJRA 2XIXA 2PL0A 5E8ZA 2VUWA 2X2MA 4FNXA 2PVHA 2QODA 2XRUA 5JFVA 2REIA 4UYNA 3D5WA 1PXJA 4MYGA 4RJ7A 1WCCA 3HAVA 4BDAA 4BDFA 2AUHA 5TE0A 2GNLA 3FZSA 3HX4A 3PXQA 4LOQA 4PDPA 2I0YA 4TNDA 3ZZEA 2V7OA 5HNGA 4GUBA 4GRBA 2PMNX 4IDVA 4K2RA 1LUFA 1U4DA 3RALA 4CLIA 4F09A 3U54A 1IRKA 2W1EA 3LIJA 4FF8A 3C13A 4MXZA 4QP7A 2CLQA 3ACKA 2YERA 4FZAB 2J51A 4BYJA 2HXLA 4FKUA 4D55A 4GKIA 4MK0A 5A9UA 4V0GA 4ASXA 3SG9A 3QF9A 4RRVA 3JPVA 1PKGA 3JXWA 4UYAA 5DN3A 3TNIA 3DK7A 4D5KA 4QQTA 4ZTHA 3UO6A 4QYYA 4O7RA 2H6DA 2VTRA 2A2AA 3OTVA 5JGBA 4BFMA 4BTKA 3RHXA 4BDJA 3ZC5A 4D2VA 5FRIA 4ID7A 1H26A 3B2WA 3PIYA 4ZY5A 5LVMA 4BGGA 3IKAA 2YLEA 3KN6A 3PUPA 4U40A 3VS4A 3ACJA 4GW8A 2KULA 3QTQA 3FMJA 3TIYA 3ZO2A 4OBPA 4XX9A 2E9NA 4OTIA 4DH8A 3QQLA 4KD1A 5C27A 1CKIA 3R7UA 3MTFA 4O7ZA 3RNYA 3R6XA 4CZYB 3D2KA 4RG0A 4J95A 2VTTA 1S9JA 4MD7E 4M15A 1PRYA 5IU2A 2QC6A 5HLNA 2BRHA 5M57A 1OPJA 2C6IA 3TNQB 4ANOA 1RE8A 5C4KA 4MD8E 5T3QA 5CLPA 4CKRA 3A7JA 4DBXA 2PVJA 3EWHA 4AAAA 2P2HA 4R3RA 5HGIA 2E9OA 4IX3A 4S33A 4E26A 4IZ7A 5HNBA 1OBDA 4EONA 5M4FA 1BI7A 2XKDA 5BVFA 4O7SA 3MH3A 4RX5A 3OCBA 4O7TA 3EOCA 3V5QA 3R28A 5AP6A 3LMHA 3QUPA 4CT2A 3CJGA 3E5AA 3HUBA 1BI8A 4P5QA 3ZSGA 1UU3A 1VJYA 2WU7A 3LKMA 3E63A 3P9JA 2X7GA 3IW4A 3V51A 2X0GA 3BEGA 5J79A 4IAFA 3KMWA 4FSYA 4D4VA 4RZVA 4ASDA 2WTCA 2O0UA 5HBHA 5KMOA 3KKVA 5LVLA 4WSQA 3NEWA 3RAWA 2QR8A 3V01A 1KWPA 5HESA 5HQ0A 5E4HA 3TTJA 3UO4A 4DTKA 3V5WA 3WYXA 5CANA 2WTKC 2ZJWA 3MI9A 2WO6A 1NVRA 3EFJA 5I0BA 2C5OA 4FTNA 2CDZA 3L1SA 2BRNA 1Y8GA 1M7QA 2RFEA 2XCHA 1E9HA 3C9WA 3NSZA 2EXCX 3R8VA 4BICA 2C4GA 4FK6A 4G6OA 3CC6A 3RAIA 3CTQA 3COMA 5HLWA 2QOBA 2P4IA 4C38A 5EDPA 4RIOA 4J71A 5ITAA 2HENA 2LAVA 3QQGA 4UX9A 4XG6A 1YVJA 5EHLA 2PVYA 2XIRA 5H3QA 1YDTE 2CCIA 4Y5HA 5L3AA 2H8HA 4PPCA 1YXXA 1XH5A 3AC5A 3COHA 3W2QA 4CFWA 3F5XA 4UMRA 3VBQA 3QTWA 3QUEA 3P1AA 2C69A 4I6HA 4JX3A 2W0JA 4EQCA 4IWPA 4GYIA 5EM7A 3DKOA 2R3KA 5CASA 3V5PA 5JRSA 2XMYA 3TUDA 4L3PA 5AV3A 3H30A 3QHWA 4FNYA 4RIXA 4ZEGA 4PTCA 1YI4A 2HIWA 5GJFA 5CS6A 5EI2A 3QKKA 2UW4A 2Y0AA 1V1KA 3MVJA 1KE6A 2HW7A 3KXMA 3SRVB 4AZFA 3PSBA 4BB4A 5HBJA 2IG7A 5AJQA 4KUJA 2VO6A 3OWKA 3G9NA 3R7YA 3QGWA 4XJ0A 3NUAA 4YZMA 3GGFA 3P78A 4KABA 5IUGA 3W10A 2JIUA 5CEKA 4XV2A 3F3TA 2BTRA 5KO1A 3TKUA 3Q9ZA 2WQNA 4X2NA 4TWNA 2X8EA 4HYIA 2J50A 4E6DA 3R0TA 4WSYA 3SKCA 4F1OA 3K54A 3UQGA 3EYGA 4KNBA 4NIFA 4TN6A 5AM7A 5M51A 3JVRA 4PL4A 4M0ZA 3EN4A 5IA1A 3R73A 5CWZA 4BDEA 2DYLA 2XP2A 3HMOA 5AR2A 3KQ7A 4FG9A 1VEBA 2W1IA 5HE1A 4K1BA 4CQGA 4YR8A 2JGZA 3MPAA 4LMNA 3QYWA 1H08A 4YJVA 2WFYA 3NWWA 4UWYA 3PXFA 2C6MA 3DXQA 4TYEA 3RVGA 3MBLA 3FMKA 1KE8A 5EM8A 4BWPA 5LVOA 3GFEA 4NKSA 3PZHA 3VUHA 4S31A 4LG4A 4UWBA 4ACHA 4N0SA 2XVDA 4D2RA 4C61A 2QOHA 4DAWA 2C3JA 5K3YA 4MD9E 4JXFA 1OL7A 5AM6A 2YIRA 1IA8A 3ZO1A 4HGEA 1PHKA 5ANKA 2YLFA 3OXTA 1YOMA 2WPAA 3NAXA 4MBIA 1OKWA 2YAAA 4I41A 4LRMA 2XNNA 4PDYA 1H4LA 4AW1A 2OFVA 1XR1A 4XUFA 2PK9A 5AR7A 1OUKA 2PVFA 3BZ3A 4F9WA 1OPKA 5H2UA 4KRCA 4CMOA 3FYKX 3FMDA 4MXAA 4YTCA 4LQMA 3GOPA 3K3JA 5KNJA 1UWHA 3QU0A 1RJBA 3THBA 3BV2A 2DQ7X 3UIBA 4DCAA 4RZWA 3LXLA 3NCZA 2OICA 3PP0A 4FTRA 4HGTA 4IZYA 4JAIA 4XV1A 3ZFYA 4C4JA 3U6HA 3CPCA 4BDIA 2CNUA 3TCPA 1F0QA 5DG5A 2WEIA 3W55A 3ZTXA 2XF0A 4UN0C 1PMVA 4Z9LA 3UQFA 1ZZ2A 2W17A 1B38A 3IS5A 1DI9A 4BCIA 5HORA 3DTCA 4II5A 2J9MA 4DFUA 2HWOA 1ZY5A 5KMNA 1SVHA 3HDNA 3NUPA 4FUXA 4I5MA 4JBVA 4Z16A 3I7CA 3OROA 5EOBA 3OG7A 4RX8A 4AG8A 3PP1A 3DNDA 2VO3A 4FTKA 4JDKA 3SXSA 4USEA 4RIWB 3GU4A 3EN9A 3ODYX 1JLUE 5BQ0A 2CNVA 2OGVA 3F2RA 3KU2A 4J1RA 4D1ZA 4NK9A 3G33A 4N6YA 2WMXA 4CRLA 5DA3A 5HG9A 3F6XA 4MCVA 5M56A 1P5EA 4KIKA 3F9NA 3S95A 4WUNA 3S4QA 4KIPA 4I0SA 4V05A 2VX3A 4G16A 3LLAA 4G6LA 3F5PA 3MWUA 2JIIA 3NR9A 5C8KA 3E93A 4GK4A 4A4LA 2XBJA 4J8MA 5M44A 5KMIA 1Y57A 3AD4A 4CMUA 3CIKA 3C5UA 1WBTA 1PXKA 2CKEA 4RBLA 2WKMA 5JEBA 3E64A 2OXXA 4A9SA 3KEXA 1REKA 4QP9A 5LARA 2FUMA 3ULIA 4G9RA 1WFCA 2C6EA 3PE1A 3MVHA 4S34A 4ZS0A 5TF9A 4YJTA 2HCKA 3MY0A 3F2NA 2YIWA 4YNOA 1BYGA 4DGLC 1TQIA 3G9LX 4EZ5A 3ZDUA 3FHIA 5I9XA 4XP2A 3RP9A 3UMWA 4W9XA 2YIQA 3ALNA 2SRCA 3EQBA 3G90X 3Q53A 4RWKA 5JZJA 1WBPA 4BDCA 4CT1A 2V22A 3H0YA 4QMNA 2W1FA 4G3EA 3ZONA 4C62A 4PTEA 3VIDA 4K8AA 2PMIA 3UPZA 3Q4UA 2BFYA 1JSUA 1OB3A 2GS6A 3VQUA 2GCDA 4HZSA 4A07A 2BDJA 3C50A 1Q4LA 4O91A 4W4WA 3VWAA 3OWJA 3DAJA 4O84A 3E92A 5FTOA 4FKVA 4MNFA 4LI5A 4E6QA 3F5GA 3H9OA 3OHTA 3VBXA 1VYWA 2UW8A 2VWYA 2BIKB 3FYJX 3VVHA 1GNGA 5M55A 3EB0A 3DJ6A 1JAMA 5D10A 1UU8A 4X2JA 3CTJA 3UVRA 1NT2A 1UA2A 2JKQA 3T3UA 3FL4A 4FTAA 4ZK5A 2X81A 4L7SA 4DEAA 4JQ7A 3TACA 2WOUA 4GCJA 4W4VA 2NRUA 4NL0A 3TNHA 4K6ZA 2Y7JA 1L8TA 3UZPA 2ITWA 2JAVA 4HYHA 2X2LA 3QZHA 3W33A 5ICPA 2ZAZA 3FL5A 2UZEA 3W2OA 1FVVA 5A4LA 5BVWA 4HYUA 1XWSA 2ITNA 3UIXA 2NPQA 4NM5A 5HZNA 3QQFA 4ZTSA 4EI4A 3OWPA 3N4TA 4J7BA 2AC3A 1AQ1A 4FEUA 2OIQA 2ONLA 4U8ZA 1QPEA 3AQVA 2YIYA 3DLSA 3ZMMA 4BI1A 2WMWA 5JN2A 5FG8A 5AAGA 3B2TA 5CQUA 4FVQA 3I5NA 2IW9A 1OM1A 5CSHA 5A4TA 3D83A 4YJSA 4IQ6A 4O81A 4JOAA 4S30A 4X2FA 4BR3A 1H25A 4U0IA 4YU2A 1OVEA 3BQCA 4FKWA 3PJ1A 3KF4A 4QMOA 3PRIA 2J6MA 3MFUA 3G6HA 2UZDA 3CLYA 4ANSA 2V55A 4DFYA 4OR5A 4F64A 4DTAA 1O6KA 3CEKA 5JFXA 3R21A 4DH7A 3AT3A 4NH1A 5CSXA 5EI8A 5JGAA 2UW6A 2IPXA 3QD2B 3A7IA 3OC1A 4QP6A 4ZJJA 2XK6A 5L4QA 3EYHA 4P4CA 2IVVA 2VTAA 2YFXA 4AFJA 2G15A 5BNJA 5CEPA 4O82A 1Q8UA 2Z7QA 4FIGA 5FP5A 5J5TA 4CG9A 4OTQA 2WGJA 4GU6A 2PYWA 1CM8A 4QPSA 4TTHB 2WB8A 4P2KA 2W1DA 2YJSA 1G8SA 2WQOA 3LAUA 4EH2A 2PHKA 3PSDA 4FICA 4U79A 5AP5A 3TWJA 1U5RA 2QOOA 2UV2A 5B2MA 3UO5A 4DEIA 4D1XA 2J4ZA 4BI0A 1GZOA 4H58A 1J7LA 3CGFA 2XK7A 5IEVA 3DBQA 3NUNA 4AOTA 1DI8A 5LMKC 3JVSA 3NYOA 1G5SA 2BMCA 3EKNA 4FVPA 4NM0A 3MFRA 5IH5A 1UKIA 2QHNA 4K18A 3ZOSA 1Q99A 4U43A 4HVHA 4F7LA 4QT1A 4G5PA 3O8PA 4XP3A 2AC5A 2PSQA 3BRBA 3N51A 4FOBA 5CNOA 3V6SA 3TDWA 4RMZA 4HNFA 2R3PA 4EEVA 3HZTA 1VYZA 3L9NA 3ID6C 4EORA 1GIIA 4JBOA 3RZFA 3VBVA 5E1SA 5HCZA 3D7ZA 5I3RA 2Y4IC 2B4SB 2XM8A 3ANRA 4HPTE 3RPVA 4EK5A 4IIRA 3OOMA 5FP6A 4AN2A 2HAKA 2B54A 1NXKA 2PZ5A 1AD5A 2B52A 3QTIA 4ITJA 3MVMA 3U9NA 4IX5A 5J5SA 5KMLA 5CEIA 3OY1A 4U45A 3LHJA 2WD1A 4XEYA 3DQWA 3A62A 3AMYA 3UE4A 4RIXB 3I5ZA 3FXWA 4O0XA 4Y85A 4CQEA 2HZNA 3T9TA 1OECA 1Q61A 2WU6A 5HTIA 5F4NA 4JAJA 1DM2A 1O9UA 4FV5A 5I9YA 3GENA 4RVKA 2ZB0A 3WI6A 4KINA 4B4LA 3GCUA 3DPKA 4E20A 4AW5A 3FQSA 2BUJA 2QU6A 2JD5A 2WTVA 3DY7A 3FKOA 4R5YA 2PVNA 2C6KA 4HW7A 2WZJA 4H3PA 2WTDA 3ORPA 3GU8A 3RINA 1U46A 5E8WA 4M69A 2XS0A 3RTPA 2GDOA 4U80A 2VWZA 4AA5A 5M4IA 4FZ7A 1YOLA 2VAGA 2UZLA 4FL1A 4I4EA 4DH3A 3HP2A 4R78A 4PNIA 1KOBA 3A61A 5TT7A 5EW9A 4FG8A 4C58A 2I1MA 5F9EA 2XYNA 2JKMA 1OL2A 2UW9A 2LGCA 4JVGA 2GFCA 2FSOX 2YZLA 4Y95A 1BLXA 4WD5A 1XQZA 2GS2A 5AR8A 5ANGA 1PMUA 2EB2A 3E8DA 3KXZA 1PYXA 4FKLA 3VUDA 3QRUA 2R3IA 2DS1A 4IACA 4NJDA 1OPLA 2VGOA 3SC1A 2CKOA 3S00A 2XBAA 3MDYA 4D5HA 3LQ8A 3CQEA 2OK1A 4W4XA 3MH2A 1O6LA 1SM2A 3CBLA 4YJUA 4CTBA 3DBDA 5ACKA 3LQ5A 5ETAA 3T3VA 3VC4A 3RWQA 5ETFA 3PVGA 5IEXA 3GCQA 2WMVA 3E3PA 5DT4A 5IDPA 2HWPA 5DGZA 5EQYA 4ZZNA 2GTMA 4YSMA 1M2PA 4M97A 4BCOA 4GH2A 3G0FA 1Q3DA 3TI1A 3PPJA 4DE4A 5CTPA 3VUTA 3ETAA 2VTLA 5CU3A 3W1FA 4YTIA 3AC3A 1J3HA 3A7GA 3R30A 3DKCA 3PE2A 3TIZA 4RVLA 4G17A 4C02A 3SA0A 5FWKK 3CR0A 3VHEA 3KN5A 3PLSA 5D11A 4JIKA 3MTLA 2ITTA 3NX8A 2R3OA 3DBCA 2QKWB 4CCBA 4XV3A 1R39A 4GT5A 4AGDA 4EH8A 3HMMA 4EOMA 4DH1A 2F2CB 4EBVA 2X7OA 4YZDA 5HO6A 3FUPA 5AIRA 1WMKA 4FTCA 4AWIA 4WRGA 3VBWA 4D28A 4IH8A 5CT7A 4QMPA 3V8TA 5A46A 3S1HA 4BCJA 4EZ3A 2YCFA 2WMSA 3ORIA 4O22A 3Q5ZA 1H27A 2GU8A 1ATPE 4BWKA 4UWCA 5HG7A 2Z60A 5HKMA 2YDKA 4HNIA 4HVDA 4JLCA 4TT7A 3BYMA 3KXHA 3KXXA 4EK8A 2O65A 3QX2A 3Q9XA 4BDGA 3EH9A 3F88A 3VJNA 4ASZA 3LLTA 4FT3A 4ZTQA 1YWNA 2O63A 2OF2A 3IOPA 4A9UA 3UNKA 5HU3A 4IAIA 2EWAA 2R3MA 2VO7A 3FSKA 4NTTA 2CGXA 2VV9A 4YZ9A 4MX9A 4O86A 3BHVA 3C0GA 3F3VA 4XRLA 3LCTA 2V7AA 1K9AA 4F6SA 4IXPA 3B8QA 3NS9A 3W32A 4BCKA 4AN3A 4DBNA 4BHNA 1KOAA 4BF2A 4BZNA 4FBXA 3BYUA 1P4OA 3ORXA 4FKTA 3OBGA 5JZNA 3V04A 4C33A 4C59A 4DGGA 4TZRA 4V01A 4C3PA 5ANJA 3QZIA 5AUUA 4IM0A 4OAUC 2VX0A 3LCDA 1J1CA 5AFVA 3PJ2A 4LL5A 3K3IA 4ZAUA 3NAYA 3OCTA 2GS7A 1Z9XA 2F49A 4O6EA 2QOIA 3SLSA 4CG8A 4I22A 4CFVA 2ZVAA 3DJ5A 2YACA 1GZNA 3M42A 4IANA 3RWPA 4QMQA 2VTNA 3QTRA 3PY1A 1KSWA 2V5QA 3E7VA 4NFMA 4EOJA 3UQCA 1ND4A 4E73A 3KREA 1M2RA 4U3ZA 3AG9A 2B55A 4WBOA 3HGKA 3HLLA 3LXPA 3U6JA 4QTDA 2VU3A 5K0XA 4F0GA 3F82A 2P0CA 4A9TA 2R9SA 1GIHA 1ZOEA 2UZTA 4QQJA 4XMOA 2HZIA 2Y4IB 3QQUA 2YDJA 4JR3A 2W1HA 4L8MA 4MQ2A 3QYZA 4P5ZA 2QG5A 2YM5A 3KFAA 4AT3A 2PWLA 3OBJA 1XH9A 2ZDUA 1LR4A 2XK8A 3FE3A 1SNUA 4I23A 4M12A 4GV1A 5DT3A 4E6AA 4RC4A 2EB3A 2JKKA 2CN5A 2C5YA 4JG8A 5FEQA 4BY9E 3K5VA 1ZZLA 3BYOA 3GC0A 3HV4A 4AU8A 4XP0A 3ZXZA 4BC6A 1U59A 4JBPA 3V3VA 3ZLSA 4D2TA 5I3OA 1YXSA 4X2KA 4C4GA 1MP8A 1B39A 3KGAA 2PE2A 3O7LD 4UMQA 5TOZA 4CGAA 3HRFA 1Z5MA 2CHLA 1E1XA 3QTUA 4YSJA 1G8AA 4BVUA 4WG3A 3AGMA 1V0BA 3OFMA 4I93A 3ZFXA 4CZTA 4KBCA 1MUOA 3SVVA 3NPCA 3PIXA 2YA9A 3KVXA 4C7TA 1OMWA 5FUTA 4RJ4A 2VWUA 3MA6A 4GUEA 3D0EA 2W1ZA 4M67A 4NW5A 3S3IA 4WOVA 4I92A 3SXFA 3W8QA 2B9IA 3WZUA 3Q96A 4CVAA 1MRYA 2PVKA 4FKRA 3QZGA 1O6YA 1Y6BA 4R1VA 2GQGA 3PG1A 3EFKA 4J53A 4JNWA 1R0EA 3P7CA 5E8VA 4EH3A 2G2HA 4HOKA 5JH6A 4QP1A 5LWMA 4IB3A 5FQDC 3DS6A 5HIBA 4Y8DA 5G6VA 5M09A 2Q0BA 4J8NA 4USDA 3R2BA 2PUPA 3CY3A 4LOPA 4O7LA 1SYKA 5JFWA 5A6NA 4YGAA 3CPBA 3EIDA 4HCVA 3TNWA 2UUEA 3UPXA 3GU6A 4H1MA 3FMMA 4CRSA 4RJ6A 2F7ZE 3AOXA 4ZSAA 3R1NA 5AV0A 1CKPA 4P7EA 2QLUA 3U4WA 5HVYA 2PY3A 3RPYA 4RFMA 3PVWA 3U87A 4YMJA 5FM2A 3BELA 1ZAOA 4I21A 4XG3A 4QP2A 3TV7A 4FL3A 3KCKA 3KRJA 2OBJA 3AC4A 3R9DA 3GCVA 4LGDA 2O8YA 4NTSA 5B7VA 2CKPA 4YJNA 3ERKA 5CAPA 2XNPA 5FXSA 5IH6A 4IWOA 2JDRA 3WE8A 4DF3A 4FGRA 3U8WA 5GIOE 4I5CA 3W2PA 1JOWB 4G6NA 1W8CA 4W8EA 5IA3A 4WA9A 4M8TA 2PULA 1KV1A 3EN7A 3DFAA 1Q3WA 4JQ8A 3WILA 1OIQA 1QL6A 4X3FB 4C4EA 2OKRA 2C3LA 4C3RA 3FMLA 3R01A 3FLQA 5E91A 3EL8A 5ACBC 3WIGA 3ZO4A 1OKZA 4N4SA 5GHVA 4AZEA 3UIUA 3E8EA 5ANOA 4R1YA 2R7BA 4KWPA 4TXCA 3DB8A 3ZU7A 3E7OA 3VRZA 3R8ZA 4YLKA 2QR7A 1PXMA 5DR9A 3G2FA 2ITQA 4YHFA 3R1QA 5E7RA 4CFUA 1ZYSA 1JKKA 3FI8A 1DS5A 3NNUA 4GS6A 4R7IA 4MXOA 4JDJA 4JG7A 3KMMA 5KMMA 1Q97A 2EVAA 1PMNA 2ITZA 3FQHA 4TW9A 5EYKA 3ORMA 3SV0A 4DG2E 4FUYA 5HCYA 4OTHA 5IG1A 4KS7A 2YWVA 4C4FA 4OTPA 3EFWA 4K33A 3FXZA 2CKQA 1STCE 4AS0A 3QCXA 3TZ9A 4EQUA 1BX6A 4CEGA 1JKSA 3EZRA 4GVAA 3TV6A 4MBJA 1U5QA 1I09A 4J99A 3C1XA 4D0XA 4L00A 5CAUA 4GFGA 3UZTA 4FA2A 2ONLC 2JLDA 4FEQA 5IUIA 1TQPA 2QO7A 4LV5A 4UZHA 4XRJA 4YUQA 5EM6A 1WVWA 4YZCA 4E8AA 3FMEA 2J0KA 3LJ1A 1KE5A 2ZV7A 1OITA 3KXNA 4E1ZA 2XZSA 1R0PA 3BLQA 4U81A 4M14A 4XNEA 5KBRA 4JL9A 3O8TA 3ZSIA 2BILB 4O6LA 4V04A 2C1BA 4UMTA 1W82A 1ZYDA 4NUSA 2GNFA 4HPUE 3NDMA 5AR3A 5FXRA 3OT8A 2I0HA 3IGGA 4LRJA 4FV2A 2BFXA 4AOIA 2YISA 3LMIA 4F7JA 1U54A 4A7CA 1OL5A 4Y83A 2OWBA 4EWHA 3NYVA 4L42A 1YKRA 4I4FA 3WZKA 2OJ9A 3O8UA 3ROYA 3W16A 5IA4A 4ZTRA 3UBDA 2CJMA 3Q2MA 4KBAA 2PUUA 5KKRC 3FLWA 2VTHA 5FDPA 5H8BA 3KMUA 2XIKA 2J0MB 4ITIA 3FPMA 3CKXA 4J97A 3QC4A 5BVEA 3BU5A 4AQCA 4DITA 3DT1A 3NMUF 2QONA 3NLBA 4TYIA 4ACDA 4Z3VA 2QU5A 2ZDTA 2A19B 4XOZA 3SOCA 4YZNA 2JITA 4FT5A 3HKOA 4GJ3A 5FBOA 1YHWA 2W4KA 3R1SA 3R8PA 2B7AA 3FY2A 4Z55A 2PUNA 5EDQA 3VS7A 4C4HA 2H96A 3F7WA 3LFCA 1ERKA 3LW0A 4ZY6A 3OMVA 3OZ6A 3ZBXA 4O96A 3F3WA 3LM5A 4FNWA 2WELA 4GJ2A 2BAQA 4LUEA 1MQBA 4CFFA 4EHVA 4MVFA 4U97A 4NEUA 4QMUA 4FT7A 4FIHA 3SW4A 4TWOA 3ZUVA 3WARA 3IK3A 3L8PA 3R7VA 5LWNA 4ORKA 4KBKA 4PY1A 5AUXA 5DRBA 3TEIA 2A0CX 4XLIA 4EUTA 4WHZA 1JVPP 3UOJA 3QD3A 4OTRA 2J7TA 3O23A 4OAVB 3KXGA 5LMAA 4F9CA 3LMGA 4X3FC 3QA8A 2XEYA 3QZFA 3H0ZA 4Y73A 3RHKA 4D2PA 3PFQA 3I0QA 1ZY4A 3MV5A 2WTIA 3L9PA 1XBBA 5ANDA 5IA2A 3Q6WA 5JKGA 5JMSA 3IDCA 2C5NA 3GCPA 4AT5A 4AZTA 5IQIA 3PDTA 3FLNC 2GNHA 3BE9A 4QPAA 1UKHA 4LOOA 3OUKA 2F7XE 1APME 5C8NA 4YNEA 5J8IA 3ENHA 1TVOA 2RG6A 3DKGA 1IAHA 3HRBA 3I7BA 3W2CA 4FKJA 4R3CA 4OTGA 4BCNA 3BBWA 3ZC6A 4L46A 5D41A 4WT6A 5DRDA 3ULZA 3HV7A 2HXQA 2JEDA 4BDBA 2B1PA 4IAKA 4BIBA 4H05A 3AXWA 1UU9A 2YHVA 1ZYLA 4RA5A 2W4JA 4PF4A 4EJNA 1L3RE 3GFWA 3A99A 2HELA 3UNZA 3D7TA 1GAGA 4YO6A 5E90A 4QYFA 2VO0A 4C0TA 3OXZA 5BYLA 2W99B 4FV9A 2HOGA 3PY0A 5CY3A 3VW8A 1Q8TA 4KA3A 4MH7A 4X3FA 4BCGA 4AW0A 2RGPA 2UW5A 3UOLA 2XNMA 4QNAA 5DFPA 4I1ZA 4FV6A 3RAHA 4CSVA 5FM3A 3SD0A 4IAYA 3PRFA 3JY0A 2GNIA 2IVTA 5LJJA 2BDWA 5J87A 4DC2A 2WTJA 2ZYBA 4E3CA 4I6BA 4LRKA 4KIQA 4L9IA 3DAKA 1JPAA 1ZYCA 3LCOA 2YN8A 3GP0A 4FZFB 2E9VA 1Q24A 3WBLA 4RLLA 4TWPA 4J96A 4YPDA 4APCA 2P33A 2Y6MA 3UYTA 5AV1A 4A4XA 3AGLA 4O7NA 4EK4A 2QOCA 4HVGA 4TYJA 2OXDA 3C4FA 4FZ6A 3CY2A 4F99A 3UP2A 4OGRA 4K0YA 3JS2A 3TT0A 1HCLA 2GMXA 2IVSA 2JDOA 4WUAA 4IB5A 4KRDA 4IW0A 5L8LA 3MFSA 4QMXA 2FSMX 2OJGA 2QNJA 4FKSA 4JJRA 3I4BA 4IAZA 2EUFB 2XJ2A 4F9BA 1WBWA 4DH5A 4YURA 4IX6A 3I6WA 4NSTA 1OBGA 2XM9A 4WNOA 1JQHA 3ALOA 4FX3A 1OL1A 3LFAA 3RCJA 2X6EA 5ANIA 3BCEA 3R8UA 3E3BX 2OJIA 2X7FA 3QQJA 4DA5A 5J7HA 5D7AA 4NM3A 3ZFMA 3VS6A 1BKXA 4RVMA 4EH4A 2ZM4A 4CV9A 5IISA 5HIDA 5EKNA 4GK3A 3NVMB 1DAWA 1YHSA 4EHEA 5ANEA 3FZ1A 4KKHA 1JSVA 4FMQA 3ZEPA 2QHMA 4EBWA 3II5A 4IHPA 1S9IA 5EW8A 2ACXA 4W4YA 5FBNC 3L8SA 5DI1A 3O2MA 3OD6X 4FKOA 5EYMA 5A14A 1H00A 1VZOA 4FOCA 5A4QA 4JX7A 3F3ZA 2B0QA 5AEPA 2FYSA 3RK9A 4GIIA 4BDHA 3AT2A 2ITXA 4G5JA 1FPUA 4I5HA 3HYHA 4GT4A 4OTDA 5EW3A 1M17A 1XKKA 2ITYA 5HU9A 3OY3A 2QOFA 2A27A 3MSSA 3IGOA 3L8VA 4A9YA 5HNIX 4AA4A 2ZOQA 3CS9A 4ZJIA 1CTPE 5DPVA 2P2IA 3IW6A 3TUBA 4Y46A 3OWLA 3UP7A 3ZBFA 2WMQA 2OFUA 2PZPA 3D94A 4IWQA 4MWHA 5EHYA 3K5UA 4DTBA 5ETCA 4IVBA 2R4BA 5FEEA 3IDBA 3BU3A 4IVDA 4O7WA 3BWJA 2XK3A 2RFNA 4TYHA 4DHFA 4EKKA 1J7UA 1CKJA 2H9VA 3DZOA 3P0MA 1PXNA 1M52A 5DE2A 3UODA 4APPA 5BUIA 3WZJA 3UG2A 3NUYA 5HHWA 3VAPA 3LVPA 5KUPA 4F08A 1WBVA 5AP4A 5AA9A 1NVSA 2CCHA 3A7HA 4M66A 2XKCA 4G2FA 3LFSA 5EK7A 3ZLXA 3P79A 1BL6A 2C0IA 4S2ZA 3U55A 5F20A 4YZBA 3FLZA 4IB1A 4F9YA 3TM0A 3EL7A 4PDSA 4YLLA 2GNJA 3FJQE 3UZRA 2OW3A 3K2LA 4IVAA 2YEXA 3PA3A 5T6KA 3RPOA 4AGCA 4BBEA 4DEGA 2OZAB 1KE9A 3EQGA 3DDQA 2P55A 1XH6A 1B6CB 2PTKA 3D5UA 3JUHA 4Z7HA 1X8BA 4CFNA 2UW3A 4O0VA 4M84A 4DG3E 3JR1A 3KA0A 5HBEA 5BVDA 5AP3A 2BKZA 4IFGA 3D15A 1TQMA 4L43A 5E1EA 3V8SA 4DGOA 4IMYA 5BVNA 2GQSA 3TDVA 3UOKA 5L2SA 3I81A 4FG7A 5HIEA 3SG8A 5CU2A 5M4CA 3A4PA 5J9LA 4E4NA 3LFEA 2IW8A 5K4JA 3FAAA 2Q0NA 4JI9A 4FSQA 5C1QB 2Z7SA 3BGPA 2F57A 5H8EA 3G0EA 3Q60A 4OLIA 3FI2A 3NUSA 5EH0A 4H39A 4E6CA 4H3BA 5EFQA 4MKCA 2QG7A 1PXLA 3FC2A 3H9FA 4RC3A 4ZSGA 3UYSA 2J90A 1Z57A 4KS8A 3QD4A 3QLFA 4FYNA 4I24A 4O1OA 3FMNA 3QRIA 3UMXA 3QALE 4B8LA 2BRGA 1Y6AA 4FTOA 5EDRA 3VW6A 2W5HA 3BE2A 4Q9SA 4YHTA 4BCQA 1NY3A 5HI2A 2R3HA 4QMWA 3RAKA 4EJ7A 3QKLA 1UU7A 3R7EA 5CZHA 5J7BA 4M69B 3RMFA 4EYJA 1P14A 1GZKA 4RQVA 4FTIA 5CYIA 3U6IA 4RWLA 3TKIA 5KBQA 1FGKA 3D4QA 4FV4A 4GYGA 5DR6A 4DT9A 3Q5IA 3O17A 3O71A 4TNBA 4IJPA 2B9FA 1FOTA 3IO7A 3QRTA 3VUMA 4QYGA 4UEUA 3PPZA 3MYGA 4CZUA 3ZDIA 4EKLA 3MW1A 5CX9A 5I5ZA 3IECA 5K0KA 2F7EE 2YAKA 5M07A 3PY3A 2CSNA 3COKA 2PVMA 1IA9A 3PXRA 1UWJA 3CCNA 4UMUA 3I6UA 4GVJA 4HYSA 3PXKA 3GI3A 1RQQA 3RPRA 3MGYA 2G2IA 1LEWA 2QCSA 3BHHA 3KK8A 3GC8A 4FTJA 2YIXA 4XV9A 3W2RA 4BKJA 4UALA 4H36A 3GU5A 1J91A 3QCQA 4FTQA 3BGZA 3ELJA 3LFNA 4FTTA 3HDMA 5DIAA 4YJPA 2VWWA 2C6DA 5C8MA 3QWKA 2WMBA 5L2QA 4I0RA 4DEEA 2X9EA 4YLJA 4XBUA 3VUKA 1GIJA 1Q41A 4AF3A 2UZOA 1Y8YA 3BPRA 4F0IA 4BZOA 3D7TB 3GNIB 3IG7A 4F7SA 5CU6A 2ZV2A 1M7NA 4FR4A 1K3AA 3LCKA 3LJ0A 4R77A 1UNGA 5H8GA 4EOLA 2X6DA 1PMEA 1H8FA 2GPHA 2GSFA 4FKIA 4GFMA 1PF8A 3UJGA 4NIFB 2QVSE 4PTGA 4HCTA 1H01A 3EQPA 4LV8A 3EQCA 4CNHA 5KHXA 4JT3A 4MF0A 3GQLA 1OZ1A 3TXOA 3R83A 3ZRLA 2YABA 4D58A 3IW8A 1JKLA 2ZV8A 4QO9A 4RJ8A 4ANMA 2JIVA 5HG8A 4QTEA 1Q5KA 4X2GA 1ZWSA 3CXWA 4IJ9A 4C37A 3BBTB 5E8UA 3DA6A 5CNNA 3QXPA 2WNTA 4YJOA 4ZS4A 4IZ5A 5KZIA 5GINE 2WQMA 3GVUA 2V62A 2PUIA 4FK3A 4TYGA 4FTLA 2YITA 5AX9A 3SAYA 4ZXTA 1H1WA 1WAKA 5KZ0A 5BMMA 4G34A 3C7QA 5LCKA 5C03A 1SMHA 3RK7A 3FPQA 5EYCA 3QXOA 3VS1A 3O0GA 4PV0A 5G1XA 5E8XA 5D7VA 3DLZA 3FZRA 1W7HA 5DBXA 1JNKA 5K5NA 1H24A 3ZS5A 5JQ5A 2GQRA 3C4CA 3PJ3A 2FA2A 1T46A 5HEZA 4OBOA 5EQEA 4FIFA 4QMYA 2BIYA 2YWPA 4RLKA 4ERKA 4O2ZA 4EUUA 3I0OA 2X1NA 4BCHA 2VWIA 1GOLA 2JBOA 2JDTA 2BHEA 2VTIA 3L9MA 4I20A 2EXMA 2BR1A 5T68A 4BI2A 4C57A 4ZY4A 2QQ7A 2ZMDA 4BCMA 4DEBA 3RM7A 4D9TA 3PXYA 4ZLZA 2QD9A 2XNEA 3PJ8A 4F70A 2FVDA 4UZDA 4ALUA 4C2WA 3HVCA 3EQHA 5L8KA 4NM7A 5AMNA 5FXQA 2O3PA 4CLJA 5I9UA 2YCSA 1GY3A 5DEYA 3PIZA 5DR2A 3AMAA 3BYSA 3V5LA 1OKYA 2PZIA 4FV8A 3ZHPC 4FZDB 1KV2A 3HMIA 3OEZA 3RZBA 5J9ZA 5FLFA 2CGVA 2O64A 3COIA 5HD7A 3M1SA 3Q3BA 5AV2A 3G5DA 5JRQA 5HX8A 4NW6A 3AC2A 4QP3A 5AIKA 1ZMUA 3PPKA 1F5QA 3KL8A 5CF6A 2IO6A 3KRXA 2W1GA 1R78A 3C4WA 4L3LA 4LGGA 4F6WA 1UVRA 3F2AA 2VTSA 3O96A 1IG1A 4TPTA 4XG4A 3ZRMA 3OVVA 4FI1A 5CF8A 4CMTA 2X8IA 2ZM3A 4CKJA 5M53A 3BGQA 4RJ5A 3EJ1A 4CCUA 4M7IA 1Q8ZA 4A4OA 2ETMA 4EHGA 5KMKA 4I6QA 2OJJA 2Z8CA 2VWVA 2ITPA 2WIHA 2IW6A 1M2QA 3DGKA 2RFDA 3L8XA 4OBQA 4C34A 5IA5A 4ZTMA 3UGCA 1H1RA 4C35A 3PA4A 1YHVA 3DCVA 5AR5A 2UVYA 3P7BA 4V0GB 3DNEA 4FSMA 3AD6A 5EYDA 3OT3A 3DDPA 4MNEB 4R8QA 5C01A 1ZXEA 3VS5A 4FKGA 2OIDA 4MNEA 1WVYA 4DGMA 3DB6A 3TUCA 2XNOA 3TG1A 5HTCA 4GT3A 3I79A 1ZARA 5AUTA 3NVKI 5LMBA 5HO8A 4DEHA 3V5JA 3D2IA 4R7BA 4YTFA 3P08A 3VN9A 3NNVA 3NW7A 5BVKA 5I9ZA 4YP8A 1FVRA 2XJ0A 3VUGA 4B99A 5CVGA 4GK2A 3VJOA 2YM8A 2ESMA 3FWQA 4GMYA 3HMPA 5E8TA 5L6PA 4RX9A 3DBEA 5HG5A 1OI9A 3Q4TA 2OZAA 2XB7A 4XG9A 4WIHA 3LPBA 5IF1A 4L3JA 5K9IA 4FVRA 3OW4A 4N70A 2BPMA 4AGWA 2WTWA 4O0SA 4ARKA 1ZOGA 3Q4CA 3EQRA
chains in the Genus database with same CATH superfamily
4IM2A 5B2KA 2RF9A 3ZZWA 4FTMA 4MAOA 3KCFA 1HOWA 5JFSA 2VRXA 3BLHA 2C0TA 5CSVA 4D2WA 2BDFA 4PPBA 4QQ5A 3OP5A 4U9AA 3PTGA 4GU9A 2W4OA 3NCGA 5BYZA 3QHRA 4IB0A 4R3PA 3FEGA 1QPJA 3RK5A 3CKWA 3FQEA 5CT0A 1YXTA 4FSTA 1YW2A 4RIWA 4WNKA 2VNWA 5EOLA 2DUVA 4E5AX 3A4OX 4GG7A 4G3CA 2YCRA 2XK9A 3CQUA 2WMUA 4X0MA 3S2PA 3W2SA 4DFXE 1PXOA 2Z7RA 4M13A 2QOQA 5CQWA 5CU4A 4EOKA 5IPJA 3N4UA 5GJGA 3BWFA 4QMZA 4O83A 1YXUA 3PXZA 4ZTLA 1RDQE 3H9RA 4PMTA 3UVPA 4ZMFA 2FB8A 2G9XA 4QTCA 1WBNA 4E5WA 4EQMA 3FI4A 5A54A 4XLVA 3CD3A 3TN8A 4AE9A 4XG2A 3DBFA 4BGQA 1J7IA 4EL9A 4O0YA 1XH8A 4ANNA 4D4RA 3QRKA 2QKRA 1WZYA 2VTJA 3LFQA 4MTAA 1URCA 1JWHA 2PZYA 4KKGA 2QURA 4M68A 4RA4A 5A3XA 2JKOA 4OTFA 2XIYA 4B7TA 2NO3A 5CVFA 4ZOGA 4EH6A 4BTFA 5IQCA 3G6GA 3PVBA 5AV4A 3ET7A 3QCSA 3UG1A 4UV0A 3A8XA 2Y6OA 4PMMA 5AAFA 2VWBA 4QMTA 4MWIA 5J95A 4EOQA 1F3MC 2C5VA 5GZAA 1RW8A 4YTHA 4QMSA 4UBAA 4EOSA 2J0LA 2UZUE 3VS0A 2FSTX 2XUUA 2C1AA 1V0OA 2B9HA 3NUUA 3VBYA 3R9NA 3FKLA 3FLSA 3ROCA 4J52A 3QLGA 4MHAA 2X39A 3D5VA 3IW5A 2Y4PA 3DV3A 3NRMA 4S32A 3WE4A 3WOWA 3EMGA 3ZUUA 3Q32A 2EU9A 2J5FA 4RT7A 3GC7A 5LCJA 2NNWB 3QTXA 2X4ZA 2XH5A 3IDPA 5DWRA 4FTUA 1BUHA 4WG4A 4E5BA 5CSPA 3RGFA 3PZEA 2G2FA 5IQHA 4O0WA 4RX7A 4D4YA 4RQKA 4X21A 3ANQA 3FZTA 3MA3A 3MFTA 3SRVA 5JK3A 2OXYA 1FQ1B 2I6LA 2GHLA 4EH7A 4ACGA 5AA8A 4A9RA 1A06A 3LOKA 2UZWE 2XRWA 2OH4A 4MXXA 5GNKA 3WF8A 2GTNA 1NW1A 3W18A 2F4JA 4JDHA 3FC1X 3R9RA 2FO0A 3HNGA 2OI4X 3NIEA 5FGKA 3RNIA 2PU8A 3O51A 1P2AA 3CJFA 4L52A 3KY2A 1PXPA 2W96B 4FSWA 4JRNA 5CALA 2PE1A 3HMNA 5KHWA 2HK5A 1GJOA 2FSLX 2VTPA 4YHJA 4PP9A 5AUVA 1PKDA 1ST4A 5CEMA 3BKBA 2CPKE 2FGIA 3WZEA 5HCXA 3U51A 2BVAA 3OUNB 5D9HA 3NW5A 2IZUA 2C30A 4QP4A 4F78A 4DFBA 3WIKA 4CTCA 4E4LA 4ZTNA 4IAAA 4BRXA 3KK9A 3PVUA 4IC7A 3VBTA 3CSVA 2XIZA 3LCSA 3R7IA 3OS3A 4DDIA 5J1VA 1W0XC 3FXXA 3BLRA 4FIIA 4NZWB 4ENYA 2OLCA 5C4LA 1FMKA 1QMZA 4QNYA 3WYYA 2IF8A 3QBNA 4EK3A 2UW0A 4ZMEA 4NCTA 4UY9A 1P4FA 4AN9A 3EZVA 2PMOX 3P86A 3I60A 3HRCA 3FZOA 4PDOA 5A4EA 5M06A 5CEQA 3ITZA 1NA7A 3R63A 1Y91A 5HO7A 2BHHA 2KTYA 3KRRA 3RJCA 3BV3A 4BKYA 4XYFA 5HD4A 3QRJA 1OIUA 2OH0E 3HEGA 4QMLA 3HAMA 3E8NA 2PZRA 5CEOA 2Z2WA 5BYYA 4WKQA 2HY0A 4X3JA 5F94A 4C36A 2XKFA 1BMKA 2X0OA 5AWMA 2OJFE 4EOPA 3KB7A 1H28A 2OU7A 3QFVA 3DXPA 5C26A 2W5AA 4WNMA 5DH3A 5EG3A 5AUWA 3TJDA 2I0VA 5KCVA 2B9JA 3D9VA 3V8WA 2BKKA 3HV6A 3VULA 5CAOA 1CMKE 4F7NA 3DJ7A 3TKHA 3W0MA 1YOJA 4Q5HA 2QI8A 2NRYA 3F66A 3I1AA 4DINA 3RI1A 2GFSA 4DFZE 4CYIA 2IZSA 4G9CA 1ZYJA 1YI3A 4KIOA 4O0TA 5LXMA 5CI7A 2OZOA 3AMBA 3QWJA 4BJJB 2J0JA 2XKEA 3A60A 4D1SA 4NU1A 2XNGA 3BHYA 3ZUTA 3HV5A 1A48A 4GIHA 3DTWA 3NYXA 5AP2A 3R04A 2JFMA 4XG8A 2R3QA 4ZSJA 2BZIB 4G1WA 5A4CA 2C6LA 3M11A 4AX8A 3TZ7A 3JYAA 4L6QA 3M2WA 4D2SA 1XH4A 2R0UA 4HJOA 2WIPA 4RIYA 4YC6A 3RCDA 4G31A 4MXCA 2IJMA 2RIOA 3ORKA 1MQ4A 5F95A 4W8DA 1KUTA 3ZO3A 3V5TA 5LVNA 2C68A 1YWVA 4Z7GA 3L9LA 2YM3A 4FSRA 4RFYA 2WXVA 1JSTA 5CAVA 2PE0A 4EYMA 2DWBA 3PG3A 3TZMA 3UOHA 5FTQA 4ZLOA 5IQGA 5F1ZA 4IBMA 2ZMCA 3S0OA 5BMSA 3QTSA 3W0QA 2C6OA 2HY81 4N6ZA 2VX1A 5D12A 5CENA 3REPA 2W1CA 1UNHA 5IQAA 3E8CA 5LVPA 5LQFA 1UV5A 4L53A 4DHIB 4FKPA 5I4NA 3ENMA 4U6RA 2BAJA 3R1YA 4FGBA 4QPMA 4RFZA 5AP1A 4O7YA 4P90A 1XBAA 3P5KA 2XCKA 4UXQA 4AXAA 4E7WA 1V0PA 2OSCA 2PMLX 4IFCA 4EOOA 3OXIA 4F1TA 3C0IA 3UTOA 2WOTA 4IC8A 3MS9A 4XCUA 4FKQA 3HL7A 2HW6A 3W8LA 4DCEA 2OIBA 4E4XA 4PMSA 4YBKA 2VD5A 4QMMA 4CKIA 3ZCLA 3MPMA 1CDKA 3MB7A 3DK6A 3IQ7A 3PLAE 3KVWA 3PA5A 4K77A 4YO4A 2BRBA 3KULB 3VQHA 4FEXA 4E93A 2X8DA 5GZ9A 4YJQA 5E8SA 1XHAA 4PX6A 3MH1A 3Q2JA 1JKTA 1J1BA 2VTOA 4NJ3A 3GQIA 2QO9A 2ITOA 2R3FA 4PWNA 5ETIA 3OEFX 5BPYA 5GIPE 5E9EA 1W2DA 1XJDA 2E9UA 3MB6A 3GBZA 2CMWA 3HUCA 4WG5A 2VTMA 4U41A 4E4MA 4FT0A 5GZ8A 2IVUA 5M4UA 3DZQA 4AOJA 3N4VA 4MEDA 3LFDA 3MY5A 1OIYA 3SHEA 3QUDA 3IOKA 4R5SA 3CE3A 4DEDA 4G3FA 2JDVA 4XH6A 2WQBA 3HP5A 4PRJA 4EH5A 4AW2A 3DXNA 3U4UA 4ANLA 4DLJA 3E87A 2I40A 1YDSE 4AT4A 1XH7A 4WO5A 1CSNA 2HZ4A 3MY1A 3R00A 2G1TA 4U44A 5L8JA 3T9IA 5CZIA 2UVXA 3HV3A 3Q04A 4XG7A 1PJKA 5AUYA 3ZLYA 4DYMA 4F9AA 1KE7A 4FSUA 2XNBA 1FINA 4F1MA 4DT8A 1ZRZA 2JAMA 2RKUA 4CYJA 2W06A 4LM5A 3UC3A 4C8BA 2VN9A 1A9UA 4ERWA 4U7ZA 5DOSA 3PJCA 3DOGA 4LMUA 4M0YA 3CD8A 2A98A 4TWCA 3VUIA 3ODZX 1W83A 5H9BA 3F69A 1QCFA 3CP9A 3O50A 3VF9A 1TZDA 4DN5A 3FSFA 3SW7A 4NWMA 3KC3A 3VNTA 2QO2A 3OW3A 3N9XA 4RIYB 4ZP5A 4RC2A 3BIZA 5HE2A 4MF1A 4Y5QA 3UDBA 2H34A 2R0IA 5L2WA 4GKHA 2XYUA 4FV3A 1Q62A 4Q9ZA 3Q4ZA 3R02A 4D0WA 4USFA 2AQXA 4YPSA 2Q83A 3NIZA 3NGAA 5CF4A 5BV3A 2IZRA 4AUAA 3IONA 4GL9A 4XS2A 4DLIA 3BYVA 2CN8A 2J2IB 3GXLA 3R7OA 4UMPA 1WBOA 2AYPA 4C3FA 1NVQA 3H10A 3B8RA 4BZDA 3MIYA 4G3GA 4F0FA 5KKRB 4HGLA 4CFXA 3H3CA 3AT4A 5HLPA 3R8MA 4IADA 4K9YA 3OOGA 3MJ2A 5AP0A 3ZXTA 3PWDA 3Q52A 3R9HA 4BDKA 2R3NA 4NT4A 3QCYA 3GU7A 3OF0A 2BRMA 4TY1A 4FV7A 3NNWA 3ZLWA 5AR4A 3LE6A 3EFLA 3CTHA 1HCKA 4PQNA 3QTZA 2WQEA 3QQHA 3PWYA 2R3RA 3EN5A 5IMXA 3G15A 1SNXA 4D9UA 2E9PA 5CI6A 2C0OA 4JRVA 3EQIA 3OCSA 2C5XA 4K11A 4FV0A 4IX4A 4TRLA 3ATSA 1DAYA 4O0UA 1FVTA 1T45A 3KULA 3MVLA 4RSSA 4ZSLA 4ZZMA 2BCJA 2ERKA 2JDSA 1SVGA 3RPSA 2GHGA 4OTWA 5BX0A 4HZRA 4F65A 2BALA 4AE6A 4EOIA 1PY5A 1URWA 2F9GA 5L6WL 5JT2A 2Y8OA 2UZBA 2BZJA 4ZLYA 4G3DA 5J9YA 1R3CA 4NFNA 3WZDA 2R3JA 3BEAA 3DKFA 3R71A 2RL5A 5D1JA 5IQFA 4QD6A 4I0TA 3QD0A 5JSMA 2QLQA 2CLXA 1M14A 4JBQA 4TYHB 4JG6A 3F61A 1IR3A 5IDNA 2R5TA 4EK6A 3BQRA 4QDEA 1ZOHA 3GCSA 5A6OA 2A1AB 4F63A 4N57A 4MBLA 3DQXA 3IW7A 1YI6A 2GNGA 2ZB1A 3CGOA 4RWIA 3BU6A 3P7AA 4L45A 2PPQA 3Q9WA 1YDRE 3QC9A 4BHZA 3F3UA 1Q8YA 3PYYA 1Q8WA 3WF6A 5EQPA 5C9CA 5K5XA 4Q5EA 4AZWA 3BHTA 1EH4A 3EQDA 4OUCA 4HVIA 2JFLA 3C5IA 4FV1A 5DT0A 1U54B 3EN6A 2VWXA 5AP7A 4QP8A 4QQCA 3QGYA 2JBPA 3MH0A 2ITUA 2R3GA 3AC1A 2GHMA 4LGHA 5TO8A 4QYEA 4RJ3A 5HTBA 3POZA 2I0EA 4IZAA 3ZRKA 4BTMA 5E8YA 1WVXA 3ORZA 2PVRA 5FEDA 3SX9A 5AX3A 4U5JA 3A8WA 2OF4A 4WBBB 3MIAA 4AACA 4PL3A 4OT6A 2WEVA 1ZMWA 5HE0A 3FLYA 2VTQA 2ERZE 5JGDA 4QTBA 4UXLA 4F4PA 4HGSA 4MXYA 2YZAA 5HOAA 3SGCA 2IWIA 4QRCA 1W98A 5DMZA 4BDDA 3VS3A 5BUEA 4PPAA 2Z7LA 5EI6A 5E92A 4ZIMA 3R8LA 2UW7A 4ANQA 1QPDA 4GEOA 4BL1A 5IH4A 5HICA 4FEVA 3LXKA 1LEZA 2R3LA 4QMVA 3NUXA 4NYEA 4QTAA 2YCQA 4A06A 4RGJA 4ALVA 1TKIA 2RG5A 4KSPA 4L44A 5DLSA 5KX8A 1W84A 2I7QA 3FHRA 4BCFA 5AADA 2CGUA 4H1JA 2R2PA 5CU0A 3DK3A 4RPVA 2P3GX 3TNPC 4IWDA 4ALWA 3KRLA 2C47A 5GJDA 4X6RA 2X2KA 3WF5A 4FIJA 3SXRA 3HECA 4JR7A 3VHKA 4H3QA 1GZ8A 2HZ0A 3C51A 4O1PA 4R7HA 5FD2A 1PW2A 3QX4A 2J0IA 3F5UA 3LZBA 3D14A 1YWRA 2RFSA 4YBJA 5EHOA 4EH9A 5HX6A 1OL6A 1H0WA 3VRYA 4EC8A 5HVJA 3C4EA 1UNLA 2EXEA 5I9VA 4FE2A 3QKMA 2WMTA 3ORLA 4ACMA 3SQQA 3FMHA 2WMAA 2O5KA 4YC8A 2Z02A 1ZLTA 1SVEA 5FTGA 3OCGA 3EKKA 5IZFA 3GT8A 1I44A 2WMRA 2E2BA 2XK4A 2F2UA 2BTSA 3LXNA 2CNQA 2YM6A 2XAMA 4AFEA 3Q9YA 2XEZA 5CF5A 5CXZA 5AAEA 4PNKA 3FKNA 3ATTA 1IASA 3QQKA 4FNZA 4I3ZA 1FGIA 2G01A 2W05A 2YM7A 3RKBA 5IMEA 3NYNA 5L2TA 5LOHA 4LYNA 4EHZA 4CV8A 3U9CA 4ZZOA 2R64A 3MPTA 4AZVA 3NZ0A 4JS8A 4KIKB 2BZKB 4I94A 4IM3A 4IDTA 1XO2B 4L68A 3DFCB 1OUYA 2JC6A 1SZMA 1REJA 3BI6A 1IEPA 4O2PA 4ZJVA 1OGUA 2VGPA 1K2PA 3KF7A 4GSBA 3C4XA 4DFNA 2W9FB 1H0VA 4FL2A 5TR6A 3FV8A 2J5EA 2XJ1A 4O38A 3V6RA 5CSWA 3ZM9A 1PXIA 5DEWA 1JBPE 3TTIA 5B0XA 5KE0A 2WHBA 3Q6UA 4UB7A 3NW6A 4ACCA 2QOLA 4BGHA 3VS2A 3MESA 1MRVA 4R6VA 4BN1A 4LFIA 4D4SA 3PSCA 4FSNA 4JQEA 2ITVA 4BBMA 4DHJA 1WBSA 3QL8A 2WAJA 1QPCA 2W5BA 5BVOA 2IZTA 3GUBA 2HYYA 4KB8A 3RM6A 5HVKA 2ZV9A 4X7QA 2C3IB 2UVZA 5CXHA 3OTUA 4XBRA 2UZNA 5J1WA 3KRWA 4B0GA 4ANBA 3FZPA 3POOA 2ETRA 4KAOA 3SDJA 3NNXA 2VNYA 4GFOA 1YRPA 3HA6A 4I5PA 4O0RA 3TL8A 3ZSHA 4ENXA 4GG5A 3LM0A 5IQEA 2X4FA 3LJ2A 3C0HA 3UIMA 3A7FA 2RSVA 4FEWA 1FBNA 5L2IA 4FC0A 4ASEA 3AC8A 4AGUA 4FODA 2BROA 4O27B 2C3KA 4BWXA 1FMOE 3WF7A 5B2LA 3P4KA 3E62A 3T8OA 5EKOA 3RBWA 3MN3A 4O21A 3D5XA 4HCUA 1YXVA 4X6QC 4NCTC 3CQWA 1OIRA 2ZM1A 2WTKB 3TV4A 4EWQA 5BUJA 1H1QA 4W9WA 4RVTA 3IPHA 2C6TA 2R7IA 1VR2A 2A4LA 4M3QA 4DG0E 4TKSA 4FT9A 4KKEA 3VF8A 4FYOA 2QOKA 3R7GA 3R9OA 4QYHA 4Y72A 3WF9A 1ZMVA 3GEQA 4HVSA 4AP7A 3LQ3A 5IEYA 1PYEA 3H4JA 5DHJA 2OO8X 4QOXA 3SOAA 3ZM4A 4IEBA 4B9DA 3FI3A 1BL7A 4KSQA 4WRSA 4CFMA 5IQDA 3F7ZA 4L7FA 3R2YA 3QA0A 3UNJA 4ITHA 4L01A 3A2CA 4YC3A 4L67A 4C4IA 2O2UA 3BHUA 3E88A 5AUZA 3R22A 4TL0A 3O7LB 2OG8A 3DAEA 3GB2A 4JIAA 5FDXA 4EZ7A 5CAQA 3LFFA 5L6OA 4U3YA 4NKAA 3LFBA 3ORTA 4ONAA 3P23A 4XHKB 4CXAA 5LMKA 2V0DA 2XA4A 4Q2AA 4BCPA 3JY9A 2VZ6A 3FDNA 4FIEA 3ZH8A 4JDIA 4BYIA 5IKWA 5K4IA 5M08A 2PVLA 1E1VA 3UVQA 3ORNA 5DVRA 3VO3A 4DGNA 3VONA 4PMPA 2ETKA 2UZVA 3AD5A 3ZEWA 2BAKA 2YDIA 1R1WA 4F6UA 2FH9A 3GOKA 3TJCA 1H1SA 2CGWA 5DNRA 1MRUA 4AXDA 3EQFA 4XOYA 5IA0A 3G51A 3GC9A 4BIDA 1YQJA 5DYJA 5EM5A 5IUHA 4I6FA 3TZ8A 3FY0A 4DFLA 1XBCA 3QAME 4AZSA 2Y9QA 1G3NA 5IQBA 3C4ZA 4O7VA 3FBVA 4LUDA 4MQ1A 2BZHB 2IN6A 4PUZA 4RWJA 5JQ8A 1LP4A 4LL0A 3UC4A 2B53A 4BBFA 4U42A 4ZSEA 4OW8A 4WNPA 4BKZA 4CD0A 4FSZA 4PP7A 1OKVA 2YM4A 2W9ZB 3HA8A 5KMJA 4AA0A 3MJ1A 2W7XA 4BIEA 4EC9A 1H1PA 4IVCA 4C2VA 3BX5A 4PL5A 4BTJA 3EHAA 4J98A 1AGWA 1H07A 1LPUA 5HE3A 4IE9A 4YJRA 3DU8A 5I9WA 4B8MA 1IAJA 4B6LA 1W2FA 2NP8A 5TKDA 2X9FA 5CVHA 4OT5A 3ZYAA 2YJRA 2XIXA 2PL0A 5E8ZA 2VUWA 2X2MA 4FNXA 2PVHA 2QODA 2XRUA 5JFVA 2REIA 4UYNA 3D5WA 1PXJA 4MYGA 4RJ7A 1WCCA 3HAVA 4BDAA 4BDFA 2AUHA 5TE0A 2GNLA 3FZSA 3HX4A 3PXQA 4LOQA 4PDPA 2I0YA 4TNDA 3ZZEA 2V7OA 5HNGA 4GUBA 4GRBA 2PMNX 4IDVA 4K2RA 1LUFA 1U4DA 3RALA 4CLIA 4F09A 3U54A 1IRKA 2W1EA 3LIJA 4FF8A 3C13A 4MXZA 2NYAA 4QP7A 2CLQA 3ACKA 2YERA 4FZAB 2J51A 4BYJA 2HXLA 4FKUA 4D55A 4GKIA 4MK0A 5A9UA 4V0GA 4ASXA 3SG9A 3QF9A 4RRVA 4FJVA 3JPVA 1PKGA 3JXWA 4UYAA 5DN3A 3TNIA 3DK7A 4D5KA 3AKLA 4QQTA 4ZTHA 3UO6A 4QYYA 4O7RA 2H6DA 2VTRA 2A2AA 3OTVA 1XMLA 5JGBA 3W0PA 4BFMA 4BTKA 3RHXA 4BDJA 3ZC5A 4D2VA 5FRIA 4ID7A 1H26A 3B2WA 3PIYA 4ZY5A 5LVMA 4BGGA 3IKAA 2YLEA 3KN6A 3PUPA 4U40A 3VS4A 3ACJA 4GW8A 2KULA 3QTQA 3FMJA 3TIYA 3ZO2A 4OBPA 4XX9A 2E9NA 4OTIA 4DH8A 3QQLA 4KD1A 5C27A 1CKIA 3R7UA 3PUFC 3MTFA 4O7ZA 3RNYA 3R6XA 4CZYB 3D2KA 4RG0A 4J95A 2VTTA 1S9JA 4MD7E 4M15A 1PRYA 5IU2A 2QC6A 5HLNA 2BRHA 5M57A 1OPJA 2C6IA 3TNQB 4ANOA 1RE8A 5C4KA 4MD8E 5T3QA 5CLPA 4CKRA 3A7JA 4DBXA 2PVJA 3EWHA 4AAAA 2P2HA 4R3RA 5HGIA 2E9OA 4IX3A 4S33A 4E26A 3P5JC 4IZ7A 5HNBA 1OBDA 4EONA 5M4FA 1BI7A 2XKDA 5BVFA 4O7SA 3MH3A 4RX5A 3OCBA 4O7TA 3EOCA 3V5QA 3R28A 5AP6A 3LMHA 3QUPA 4CT2A 3CJGA 3E5AA 3HUBA 1BI8A 4P5QA 3ZSGA 1UU3A 1VJYA 2WU7A 3LKMA 3E63A 3P9JA 2X7GA 3IW4A 3V51A 2X0GA 3BEGA 5J79A 4IAFA 3KMWA 4FSYA 4D4VA 4RZVA 4ASDA 2WTCA 2O0UA 5HBHA 5KMOA 3KKVA 5LVLA 4WSQA 3NEWA 3RAWA 2QR8A 3V01A 1KWPA 5HESA 5HQ0A 5E4HA 3TTJA 3UO4A 4DTKA 3V5WA 3WYXA 5CANA 2WTKC 2ZJWA 3MI9A 2WO6A 1NVRA 3EFJA 5I0BA 2C5OA 4FTNA 2CDZA 3L1SA 2BRNA 1Y8GA 1M7QA 2RFEA 2XCHA 1E9HA 3C9WA 3NSZA 2EXCX 3R8VA 4BICA 2C4GA 4FK6A 4G6OA 3CC6A 3RAIA 3CTQA 3COMA 5HLWA 2QOBA 2P4IA 4C38A 5EDPA 4RIOA 4J71A 5ITAA 2HENA 2LAVA 3QQGA 4UX9A 4XG6A 1YVJA 5EHLA 2PVYA 2XIRA 5H3QA 1YDTE 2CCIA 4Y5HA 5L3AA 3O5AA 2H8HA 4PPCA 1YXXA 1XH5A 3AC5A 3COHA 3W2QA 4CFWA 3F5XA 4UMRA 3VBQA 3QTWA 3QUEA 3P1AA 2C69A 4I6HA 4JX3A 2W0JA 4EQCA 4IWPA 4GYIA 5EM7A 3DKOA 2R3KA 5CASA 3V5PA 5JRSA 2XMYA 3TUDA 4L3PA 5AV3A 3H30A 3QHWA 4FNYA 4RIXA 3AKJA 4ZEGA 4PTCA 1YI4A 2HIWA 5GJFA 4DDGA 4QDVA 5CS6A 5EI2A 3QKKA 2UW4A 2Y0AA 1V1KA 3MVJA 1KE6A 2HW7A 3KXMA 3SRVB 4AZFA 3PSBA 4BB4A 5HBJA 2IG7A 5AJQA 4KUJA 2VO6A 3OWKA 3G9NA 3R7YA 3QGWA 4XJ0A 3NUAA 4YZMA 3GGFA 3P78A 4KABA 5IUGA 3W10A 2JIUA 5CEKA 4XV2A 3F3TA 2BTRA 5KO1A 3TKUA 3Q9ZA 2WQNA 4X2NA 4TWNA 2X8EA 4HYIA 2J50A 4E6DA 3R0TA 4WSYA 3SKCA 4F1OA 3K54A 3UQGA 3EYGA 4KNBA 4NIFA 4TN6A 5AM7A 5M51A 3JVRA 4PL4A 4M0ZA 3EN4A 5IA1A 3R73A 5CWZA 4BDEA 2DYLA 2XP2A 3HMOA 5AR2A 3KQ7A 4FG9A 1VEBA 2W1IA 5HE1A 4K1BA 4CQGA 3UDTA 4YR8A 2JGZA 3MPAA 4LMNA 1TFFA 3QYWA 1H08A 4YJVA 2WFYA 3NWWA 4UWYA 3PXFA 2C6MA 3DXQA 4TYEA 3RVGA 3MBLA 3FMKA 1KE8A 5EM8A 4BWPA 5LVOA 3GFEA 4NKSA 3PZHA 3VUHA 4S31A 4LG4A 4UWBA 4I6LA 4ACHA 4N0SA 2XVDA 4D2RA 4C61A 2QOHA 4DAWA 2C3JA 5K3YA 4MD9E 4JXFA 1OL7A 5AM6A 2YIRA 1IA8A 3ZO1A 4HGEA 1PHKA 5ANKA 2YLFA 4FRFA 3OXTA 1YOMA 2WPAA 3NAXA 4MBIA 1OKWA 2YAAA 4I41A 4LRMA 2XNNA 4PDYA 1H4LA 4AW1A 2OFVA 1XR1A 4XUFA 2PK9A 5AR7A 1OUKA 2PVFA 3BZ3A 4F9WA 1OPKA 2XALA 5H2UA 4KRCA 4CMOA 3FYKX 3FMDA 4MXAA 4YTCA 4LQMA 3GOPA 3K3JA 5KNJA 1UWHA 3QU0A 1RJBA 3THBA 3BV2A 2DQ7X 3UIBA 4DCAA 4RZWA 3LXLA 3NCZA 2OICA 3PP0A 4FTRA 4HGTA 4IZYA 4JAIA 4XV1A 3ZFYA 4C4JA 3U6HA 3CPCA 4BDIA 2CNUA 3TCPA 1F0QA 5DG5A 2WEIA 3W55A 3ZTXA 2XF0A 4UN0C 1PMVA 4Z9LA 3UQFA 1ZZ2A 2W17A 1B38A 3IS5A 3ML1A 1DI9A 4BCIA 5HORA 3DTCA 4II5A 2J9MA 4DFUA 2HWOA 1G8JA 1ZY5A 5KMNA 1SVHA 3HDNA 3NUPA 4FUXA 4I5MA 4JBVA 4Z16A 3I7CA 3OROA 5EOBA 3OG7A 4RX8A 4AG8A 3PP1A 3DNDA 2VO3A 4FTKA 4JDKA 3SXSA 4USEA 4RIWB 3GU4A 3EN9A 3ODYX 1JLUE 5BQ0A 2CNVA 2OGVA 3F2RA 3KU2A 4J1RA 4D1ZA 4NK9A 3G33A 4N6YA 2WMXA 4CRLA 5DA3A 5HG9A 3F6XA 4MCVA 5M56A 1P5EA 4KIKA 3F9NA 3S95A 4WUNA 3S4QA 4KIPA 4I0SA 4V05A 2VX3A 4G16A 3LLAA 4G6LA 3F5PA 3MWUA 2JIIA 3NR9A 5C8KA 3E93A 4GK4A 4A4LA 2XBJA 4J8MA 5M44A 5KMIA 1Y57A 3AD4A 4CMUA 3CIKA 3TMOA 3C5UA 1WBTA 1PXKA 2CKEA 4RBLA 2WKMA 5JEBA 3E64A 3W0NA 2OXXA 4A9SA 3KEXA 1REKA 4QP9A 5LARA 2FUMA 3ULIA 4G9RA 1WFCA 2C6EA 3PE1A 3MVHA 4S34A 4ZS0A 5TF9A 4YJTA 2HCKA 3MY0A 3F2NA 2YIWA 4YNOA 1BYGA 4DGLC 1TQIA 3G9LX 4EZ5A 3ZDUA 3FHIA 5I9XA 4XP2A 3RP9A 3UMWA 4W9XA 2YIQA 3ALNA 2SRCA 3EQBA 3G90X 3Q53A 4RWKA 5JZJA 1WBPA 4BDCA 4CT1A 2V22A 3H0YA 4QMNA 2W1FA 4G3EA 3ZONA 4C62A 4PTEA 3VIDA 4K8AA 2PMIA 3UPZA 3Q4UA 2BFYA 1JSUA 1OB3A 2GS6A 3VQUA 2GCDA 4HZSA 4A07A 2BDJA 3C50A 1Q4LA 4O91A 4W4WA 3VWAA 3OWJA 3DAJA 4O84A 3E92A 5FTOA 4FKVA 4MNFA 4LI5A 3KIOC 4E6QA 3F5GA 3H9OA 3OHTA 3VBXA 1VYWA 2UW8A 2VWYA 2BIKB 3FYJX 3VVHA 1GNGA 5M55A 3EB0A 3DJ6A 1JAMA 5D10A 1UU8A 4X2JA 3CTJA 3UVRA 1NT2A 1UA2A 2JKQA 3T3UA 2ZFYA 3FL4A 4FTAA 4ZK5A 2X81A 4L7SA 4DEAA 4JQ7A