4GK2A

Human epha3 kinase domain in complex with ligand 66
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
265
Chain Sequence
VHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRLKIITNLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPH receptor A3
publication title Optimization of Inhibitors of the Tyrosine Kinase EphB4. 2. Cellular Potency Improvement and Binding Mode Validation by X-ray Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 265
sequence length 295
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gk2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gk2A01
4FL3A 3ATTA 3AT3A 4FZDB 3MPTA 4IC7A 3OWPA 4LV8A 4YU2A 2WZJA 3BLHA 1GY3A 3R73A 4K33A 4OTIA 4S33A 1GIHA 5AIRA 4M68A 5ACBC 3RAKA 5JGDA 3FLQA 5C8MA 5IEXA 3HZTA 3PVGA 3UGCA 3SXFA 5LJJA 3CY2A 3EHAA 4U44A 2HZ0A 3BGPA 3O71A 4MHAA 3PFQA 5AUUA 3REPA 4AN2A 3R1YA 5A4LA 5FM3A 1DAYA 5H3QA 4FI1A 3SG9A 3F5XA 1OIQA 4FUYA 5EHLA 2YABA 1GIIA 4C4EA 3E7OA 5CZHA 2BZHB 3L8SA 4DFXE 2AC3A 4L3PA 4BDFA 3OY3A 5A46A 3ZXTA 3R02A 4FKPA 1P4OA 3OTVA 3KULA 3PVBA 1IRKA 3FLYA 3OFMA 4B99A 2J0LA 4FKWA 2HELA 4AFEA 5M09A 4RZWA 4KA3A 2W1FA 2UZTA 2VNYA 3WI6A 4EK4A 4HW7A 1GIJA 4AA5A 5CU0A 1XBAA 4JAIA 5CLPA 4IZAA 5HBJA 5CF8A 2YM7A 2HY0A 4PMTA 3RK9A 4EK5A 5BMSA 5E1SA 3VUKA 3AT2A 5KKRC 4X21A 4I5PA 2H96A 1WBPA 1DS5A 4FSYA 3CKXA 2Y7JA 2QOQA 4Y73A 3QHWA 4IC8A 3NLBA 2FUMA 5EQEA 3N4VA 5CS6A 4IIRA 3BE9A 3BWJA 3CD3A 2W06A 4Y95A 4FMQA 3U54A 4WSYA 2J5EA 3ZRLA 4MF0A 2J7TA 5K0XA 4M14A 3FI8A 4GEOA 3MW1A 3FQEA 4R5SA 4IVBA 5CVGA 3BHTA 4X3FB 4EOMA 1YVJA 2UW8A 4F9AA 3RGFA 5I9WA 4IBMA 2XK9A 4XHKB 5BX0A 3LMHA 2X7FA 4XEYA 3EOCA 2YISA 3I5ZA 3UOLA 4BCJA 4A7CA 2OZOA 3BYOA 3N51A 2Q0BA 4Z55A 2QQ7A 2E9UA 3MFTA 4MXAA 3E92A 2ONLA 4AS0A 4MAOA 4RFYA 4X6QC 4F63A 5EQPA 4AG8A 3ALNA 3R00A 5M44A 4BDHA 5FDXA 4TWOA 4D2WA 3EN7A 3KXNA 1WMKA 2PMNX 1TVOA 1OPKA 3PVWA 2XNGA 3FKNA 3Q60A 4FX3A 4OUCA 4WUNA 5IMEA 4ZTHA 4HVHA 2X8IA 3POOA 2HW7A 5E8XA 3GCPA 3R1SA 4EH7A 3VUTA 3RBWA 1KE7A 4J99A 4TPTA 3CQEA 3SV0A 3VRYA 4AW1A 4BYJA 4D0WA 4AGDA 5JEBA 4UYAA 4YNOA 3QD4A 3QQFA 3KREA 2RFNA 4NZWB 2W5BA 2JAVA 4QP2A 3A7HA 3BZ3A 5KMJA 3DK3A 4MD9E 4I5MA 3I60A 4YHTA 5KCVA 2Q83A 4AAAA 4G9CA 4I0RA 4I5CA 4ZSEA 3O7LB 4ACCA 5K5NA 3SW4A 4XS2A 3VUIA 4JRVA 3A7JA 3QZGA 3MY0A 2XBAA 4XOYA 1L8TA 3SRVB 2XM8A 2CKPA 1YW2A 1TKIA 3II5A 4ID7A 4BBFA 5HLWA 5H9BA 3QXOA 4YZBA 3F3WA 4EI4A 4I41A 3VUMA 3O2MA 5HG8A 2IO6A 3ZONA 5AM7A 1NVSA 4F1MA 3SXSA 2QU5A 5DIAA 4G1WA 4YBKA 3QX4A 5GNKA 1UWJA 4L45A 3ZM4A 4EOJA 3DT1A 3RCJA 4EOKA 1UVRA 1TQPA 5TR6A 4M97A 5HD4A 5BVDA 4G6LA 3VN9A 5IQAA 1B38A 3DAKA 3GC7A 3JY9A 3ZM9A 2J0MB 3HA8A 4FTJA 3C5IA 2VWUA 2XKFA 4QMUA 3UO5A 2QOHA 3VUGA 1Q5KA 3DS6A 1CKPA 3D5XA 1OL5A 4A4OA 4RQKA 3H3CA 5DEYA 4IZ5A 5A4QA 2BVAA 4JDKA 4UMRA 1CTPE 3GQLA 5DT0A 3COKA 3RM7A 4IACA 1IEPA 2QOBA 2WMBA 2ETRA 2B52A 3FHIA 3RK5A 4E8AA 4MD8E 5KZ0A 4CFXA 3R1NA 4RLLA 4XX9A 1OL1A 3BYMA 4IX5A 2GFCA 3LJ2A 3OW4A 2J2IB 5EM6A 2QG5A 3MB6A 2R3HA 3PYYA 3G15A 3QAME 2AC5A 3DKGA 3DK7A 4C02A 3BYSA 4BRXA 3F88A 4PRJA 2CDZA 3KB7A 3D4QA 1BYGA 4P4CA 5EI6A 3BGZA 1A48A 2NNWB 1PMUA 1BI7A 2VWXA 3LJ1A 3RWPA 2R0UA 2E9OA 5AP6A 4GKIA 2XRUA 4U40A 2GHGA 4BDJA 1VJYA 2C5XA 5FDPA 3QD2B 1YOLA 3IONA 1I09A 3WBLA 2XJ1A 4KSQA 3M11A 4IWOA 4XG7A 2WOUA 3DXNA 3QWJA 4IVDA 3ZLYA 4C59A 2VTHA 4R1VA 3TV4A 4EQUA 4NW5A 2C0IA 3GU8A 5ANJA 2OXDA 4L7SA 5DT3A 5C4LA 3U4WA 2R7IA 2CHLA 3R9NA 3Q9YA 4OBPA 5T3QA 1OZ1A 4O7WA 3C1XA 5EHYA 3R7VA 4TT7A 3U55A 3R7IA 2JDRA 1R0PA 4E4NA 2HY81 2ITPA 2BKZA 3DTCA 2VTQA 4IQ6A 4F64A 1REJA 4GMYA 4GW8A 2W17A 4XMOA 4BHZA 2XNOA 4FG9A 4P90A 3ZLXA 1OKYA 1ZYSA 4PDYA 2OO8X 3F3UA 3QZIA 4FEWA 4I1ZA 1MRYA 5CSWA 3F5UA 4TYHB 4PTEA 4F9CA 4B8MA 4RT7A 4YJVA 4WSQA 4I6QA 3NYOA 3KF4A 1BUHA 4FT3A 2YCQA 3D2IA 3W8LA 2JDVA 3GU6A 1H0VA 5IPJA 4ANSA 4QTDA 4AZEA 4D1SA 5HQ0A 3PXQA 3HRFA 4BZOA 1H24A 5C1QB 4J97A 3F2NA 3UO6A 4AN3A 2ETKA 4C38A 2XYNA 3U6IA 1TQIA 4NFNA 4CZUA 4F4PA 1ZOHA 4DN5A 2WMXA 4IFCA 3UPXA 2JLDA 4FG8A 5KHXA 3CKWA 4IWPA 3OVVA 3FWQA 4EQMA 3UNJA 4EH2A 4PQNA 4WBBB 3PXZA 4YSJA 1SVHA 4ZZMA 2E2BA 2VGOA 3LM0A 3IGOA 3ID6C 5FTGA 1U46A 5FQDC 5HG9A 3AC5A 2ZYBA 3U8WA 5JQ8A 5L6PA 4WO5A 2OLCA 3V5LA 3RWQA 4FVPA 1GZ8A 4NEUA 2G9XA 3PPZA 2XNBA 3QKKA 2SRCA 4YZCA 3UMWA 3W55A 5KMIA 3H30A 2O0UA 4FIHA 3F2RA 2W96B 4ZSAA 3PZHA 4M3QA 2GS2A 3VJNA 3IKAA 5HVYA 3BPRA 2XNEA 2R3MA 4W4WA 4HZSA 3QQGA 3TZMA 3GT8A 3FE3A 2OJFE 5A4TA 4IB1A 2O3PA 3FZPA 4LOQA 2R2PA 3QCQA 3TNWA 3VBVA 1Z57A 3GENA 2R0IA 1OBDA 4MXZA 4O7LA 3K54A 4U7ZA 3QTUA 2WTIA 3L9NA 3O0GA 2R3PA 2PU8A 4IM2A 4DFYA 1M2RA 2IVUA 2ZOQA 2VV9A 4QYFA 4J8MA 5I4NA 2GNHA 4XG8A 2Y4PA 4QQJA 2CCHA 2RSVA 4HGTA 2C6OA 4KRCA 4MF1A 5EDRA 3NUAA 4ARKA 1XH4A 2PVRA 2CMWA 3PRIA 2X2LA 5GJGA 4ZP5A 1Q8ZA 3C5UA 4KIQA 5EYCA 4ANMA 4JX3A 1U54B 2BHEA 2I6LA 3TNPC 3H4JA 2PVMA 4BDAA 4PUZA 4E6AA 5CAUA 4AZSA 4GKHA 4FV6A 2GTMA 4D58A 4IW0A 4F08A 2JAMA 4GG7A 3FLNC 3DQXA 3LE6A 1PYXA 2VTTA 4YTIA 2PUIA 2HZNA 4C3FA 3EQDA 3WILA 4DHFA 5FXQA 3DB8A 2YM5A 1F5QA 3TZ9A 4O7VA 2EXEA 3QHRA 3K2LA 5AV2A 1Y91A 4RJ5A 3WF6A 3LFNA 5C26A 1XH6A 4J53A 4YC6A 3OXZA 4TNDA 5AX3A 5JFXA 3ZDIA 3HKOA 4IB0A 3ZLWA 3KK8A 5H2UA 2YIWA 2YDIA 2YAKA 4G16A 2OWBA 3IDPA 3MTLA 4FUXA 4V04A 4NK9A 4O0UA 5ITAA 4KIKA 5F9EA 4FEVA 2XBJA 3E93A 4WG4A 5CF5A 5HIBA 4CMTA 4EEVA 3VBTA 5M06A 2CJMA 4IEBA 2W4OA 3GFWA 2WTDA 4Z3VA 3PXRA 2QO9A 3GNIB 4HGSA 4K1BA 2VWZA 5IKWA 3ZU7A 4TRLA 2I40A 2BZKB 3C4WA 4MYGA 3EN4A 3HMNA 3QALE 4ZTNA 4C57A 1RW8A 3MTFA 4O2PA 4AP7A 4C34A 2ETMA 3I4BA 1H4LA 3VS4A 3IG7A 4O0XA 2FA2A 3LVPA 3R01A 3R21A 4WT6A 3TWJA 4TWCA 4WIHA 4AFJA 1REKA 3ZH8A 3VUHA 3K5VA 2YN8A 4D4VA 4DEHA 4A9TA 1OL2A 4ALVA 1WVYA 4D1ZA 5CEMA 2PZYA 2IVTA 2XH5A 3QBNA 2IVVA 3NZ0A 3MH1A 4C3PA 4IX6A 1XBBA 1FVVA 3KF7A 3PPKA 3MJ2A 1OITA 5DR6A 4QYHA 3RNIA 3COHA 4DEBA 3HGKA 1P4FA 3OXTA 2RFSA 3BLRA 3BV2A 4FYOA 4RVLA 5AMNA 3QTQA 4JDJA 4XNEA 5D7VA 5KE0A 4AA4A 1WBOA 3ET7A 3MWUA 4PNIA 5E7RA 3W2CA 4C35A 4ZJVA 2W1IA 5K5XA 3FPMA 4AOIA 1B6CB 4K6ZA 3PSBA 2QI8A 3R8MA 3FMDA 3ZZEA 2Z7SA 4FSWA 3FZSA 3FY0A 1LEZA 3G51A 4ONAA 3TTIA 3ORZA 4ZLOA 2JIIA 3EZVA 2H9VA 3MSSA 4ZTSA 1ZYCA 3CJGA 5CEPA 2PE1A 3G5DA 4EKKA 3E7VA 4S31A 3HYHA 2UVZA 3RPOA 4FGBA 4B0GA 2OKRA 4HGLA 4XG3A 3GP0A 3F5GA 3IW6A 3S2PA 2IPXA 2OIQA 3W10A 3ZLSA 4LUEA 4P5ZA 5GIPE 4I6HA 3DBDA 3NEWA 3IS5A 1FPUA 2QKRA 2R64A 4I3ZA 2LAVA 5CVHA 4PDSA 3VNTA 1OIRA 4IWDA 4GRBA 3OWLA 4CRSA 3P7CA 2WU6A 4CKIA 4IANA 3FDNA 4MH7A 4DGNA 4QP9A 5F95A 2W9ZB 3WIKA 3QUEA 4GL9A 1NY3A 5CAVA 4KABA 1Q41A 3CQWA 1RDQE 1UNHA 3AD5A 5H8EA 2W1GA 4BL1A 3F6XA 3UNZA 3FLWA 4QPMA 3G33A 4CTBA 4UV0A 5K9IA 3E8NA 3Q4TA 3HUBA 5KBRA 5GJDA 1OB3A 3UC3A 4C4HA 3A4PA 3E5AA 4ZEGA 2PUUA 5CU3A 3KRJA 1OIUA 2C1BA 1Y8GA 4BKYA 2YIQA 5CAPA 3QKLA 3AMYA 3ANQA 5CQUA 3R8PA 3TN8A 1M2QA 4O7ZA 5E8YA 4R78A 1FVRA 2C0OA 2PUNA 1R3CA 4IAZA 4CZTA 3R71A 5HG5A 5DRBA 1H26A 2WTCA 2WU7A 2X9FA 2C6MA 2XCKA 3BV3A 3C9WA 3EFLA 3NIZA 4GK2A 2IG7A 5HD7A 1QMZA 2VTSA 3RTPA 4RZVA 4ERWA 3T9TA 4K9YA 4WRSA 5I3OA 4ITJA 4JR7A 4L01A 4PTCA 4RFMA 3TV7A 2R3RA 1O6YA 2ITZA 3PJ8A 2FH9A 3Q9XA 5HO8A 4AZTA 4BCGA 3NCZA 5DPVA 4E6CA 4U45A 4O0YA 4BGHA 3DLZA 4QQCA 5LWMA 3S3IA 2IVSA 4RVMA 3EZRA 3Q04A 3MN3A 3I6UA 4E73A 2VTAA 4Z7GA 2QKWB 3LCOA 1R1WA 3EFKA 4FTQA 5M57A 4JQ7A 2RL5A 3A8WA 4FV9A 5E8TA 4FZFB 2GSFA 4QMNA 2OK1A 1WVXA 4HYIA 4F65A 4B9DA 5KKRB 1G5SA 4EC9A 4EUTA 2F9GA 4LRMA 2CKOA 4XBUA 4ZY4A 2HWOA 4UZHA 5L2TA 2ZJWA 3ORLA 2YM3A 1PMVA 1PXIA 2R3NA 1WBSA 1JBPE 2C6IA 4CCUA 2XJ0A 3ZYAA 1XH7A 1G8SA 3FI2A 3SAYA 2C30A 3RK7A 4USFA 4RWJA 3LCSA 4KINA 3KXMA 3R9OA 4AN9A 1G8AA 1VZOA 1WBVA 1YDRE 3F2AA 5DBXA 4E5WA 1E1VA 4S32A 3VBYA 1KV1A 4FOBA 2NO3A 2XIXA 4AZVA 3A61A 4RPVA 4W4YA 3FZ1A 4OW8A 4YJSA 4DG2E 2V62A 2ZAZA 4WUAA 2PHKA 2CCIA 3QLFA 4E6QA 1F0QA 3R22A 4H39A 3UP2A 4F09A 5E4HA 4APCA 1JKKA 5TT7A 5GINE 2WEIA 3W2RA 4QTEA 1H1SA 3ERKA 3IW7A 3ZO2A 4D28A 3HA6A 4FGRA 2YHVA 3ZBFA 4FTTA 5IQFA 3BHHA 5AUWA 4BCHA 3DCVA 3KKVA 4BGQA 4DEAA 4GUEA 5ANKA 3HLLA 2IW8A 4FEUA 3T3VA 5LMBA 2XRWA 4ZK5A 4DH8A 2Q0NA 2BDWA 4UMTA 3OZ6A 5E8ZA 4IDVA 1TQMA 2IW6A 5CNNA 2W05A 5IUGA 2YIYA 3P5KA 3VO3A 4DEDA 4QYYA 1OGUA 4GV1A 3NUYA 3HECA 4WNOA 3G90X 3QFVA 4TNBA 4XUFA 3FQSA 2CGVA 5HBHA 1T45A 3RINA 3T9IA 3U87A 4BCFA 1UA2A 4YTFA 4NT4A 4Q5HA 1JKTA 4GT4A 4YZNA 4KSPA 3GVUA 3TNHA 3DBEA 3F3TA 3ZTXA 5C03A 2RG5A 4J7BA 4O0VA 2X39A 2DS1A 4RX8A 3HP5A 3QQHA 4O6EA 5HX6A 4JG6A 4QTCA 3H9OA 3E3BX 1UNGA 4M8TA 2F49A 3FMKA 5CWZA 2QHNA 1PXJA 4H36A 1L3RE 4FOCA 2LGCA 4WD5A 3D5UA 2ITWA 1IAJA 3VJOA 3LIJA 2JC6A 2QOOA 3BU5A 2C5OA 3WE8A 2JBPA 1U4DA 3ORIA 4PY1A 4R3PA 3FAAA 4UWBA 5F94A 3FXZA 4QQTA 4FKIA 3IDCA 1YWVA 1U5QA 3MPMA 4QNAA 5GZAA 3I5NA 1ZYJA 2W1HA 4B8LA 4OTDA 4Q9ZA 2WNTA 3LXKA 5DA3A 3Q9ZA 4QD6A 1OKWA 4O2ZA 4CQEA 4JQEA 4YLLA 4CKRA 3CD8A 3PY3A 4LQMA 3RPSA 1H25A 2YM6A 4U80A 4DITA 3N4UA 3GBZA 3UDBA 4EZ7A 2OI4X 4K18A 2RGPA 2CPKE 2ZM4A 2ACXA 3DV3A 2BHHA 4KNBA 5DWRA 4FKJA 3LCTA 3DNDA 3EQPA 3QTWA 4G17A 5CEIA 1QPDA 4DEEA 1MQBA 2I0VA 4MD7E 2JKOA 3KMMA 3CTJA 3KCFA 3R2BA 3PWDA 4DT9A 1PY5A 4Y83A 3I0QA 4F7NA 1P2AA 5L8KA 3NYXA 4MKCA 1UV5A 4RJ6A 4DGMA 5AFVA 5EM5A 2OZAA 4MXOA 3W2PA 3SOAA 2F7EE 3D5VA 4G3DA 4L44A 3ODYX 1KE5A 1OM1A 3LLAA 3L9LA 4I94A 3P9JA 4RIWA 4YO4A 4DA5A 3VS5A 3VS2A 4HVGA 4CKJA 1VR2A 2XEYA 5T68A 4X2FA 3A7FA 3BRBA 1FINA 3TT0A 5J79A 4MTAA 1JQHA 3ZSGA 1URWA 3CBLA 4W8EA 4YUQA 3CP9A 4XLVA 2XKEA 2HOGA 2WAJA 2XUUA 3QQKA 4N0SA 5M4IA 3LCDA 2UZBA 5A9UA 4NKSA 2C0TA 1AGWA 3BQCA 3RJCA 4F6SA 2HENA 4N4SA 2FSTX 4JQ8A 4YSMA 5FEDA 4O96A 5GJFA 3P0MA 1P5EA 3O8TA 4FZAB 3AC1A 4BDGA 4G31A 3G9NA 4XG6A 5HEZA 3BEAA 2A4LA 2XNNA 4KKHA 4ACGA 3GQIA 3O51A 3ZRKA 3V04A 1P14A 1BI8A 2R4BA 5CF6A 5HGIA 4R8QA 3TI1A 2QVSE 3V5TA 1OKVA 2QCSA 2B9JA 5AP2A 4CSVA 3DJ5A 5CSPA 3BWFA 4L53A 5M4UA 4IAAA 3HP2A 3Q2MA 4IJ9A 3DAEA 5FEQA 5D11A 2VTJA 5IF1A 4Z9LA 2A1AB 4JJRA 3CEKA 1J91A 3PP1A 4TW9A 4O6LA 3ZO3A 3C50A 3RHKA 2YJRA 4UWYA 4QT1A 2R3LA 2W4KA 1H1WA 3DPKA 3KFAA 2QLUA 2C1AA 2P55A 2R3QA 3MFUA 4RVTA 3MDYA 3Q4CA 2YWVA 4MVFA 3C0GA 4BKZA 3PA3A 2BTSA 2W7XA 4N6YA 5ANDA 1BMKA 3OS3A 4C8BA 5C8NA 4RX7A 5AP0A 3PJCA 4U3ZA 3VC4A 3D9VA 2P33A 4X2NA 2OF4A 3F7ZA 2VO0A 4DTAA 3A99A 4FSNA 2UV2A 2PVKA 1H8FA 3PLSA 5EM7A 3U6JA 2UW3A 4YP8A 5I3RA 3V6RA 5AR3A 5A6NA 3PE2A 3VS0A 3VF8A 2ERKA 1OI9A 4FV7A 2QR7A 3IW4A 1ERKA 4QMLA 2OIDA 3SKCA 3AD6A 3F7WA 4IMYA 4YPDA 2R3JA 1IAHA 1MRVA 1PXNA 4NM5A 3WZJA 1YDSE 3LFEA 4C37A 2X9EA 3VHKA 1WFCA 2VX0A 4JBOA 4FTNA 3HAMA 3KEXA 3VBQA 5GZ8A 4R3RA 3C4EA 1PKDA 4MBIA 4O82A 2REIA 1M7QA 5AUTA 4M15A 2FB8A 3OBGA 3CS9A 4GT5A 3SGCA 4C62A 3V5QA 4BZDA 5CU6A 5AUVA 2DYLA 2J6MA 2GNGA 3SHEA 4YZDA 3EIDA 1ZOGA 4PMPA 2BRBA 3WZUA 2XB7A 3GCSA 5DR9A 2WMUA 5AWMA 5H8BA 1E9HA 1UU3A 2GCDA 1DI8A 2ZDTA 3LPBA 3EQIA 2VTNA 4CFWA 2Z60A 4DG0E 3NPCA 1MUOA 2GPHA 4YJRA 2XK3A 2P4IA 2NP8A 4DTKA 3WYXA 1FMKA 4EYMA 2V5QA 4FV0A 2C3JA 2Y4IC 4U9AA 5AV3A 3TCPA 4DEIA 5AP4A 4MCVA 4O1OA 3NYNA 3DNEA 2QC6A 3NUNA 4D55A 1XJDA 4IFGA 2BKKA 3ZXZA 2BMCA 2QOIA 4FTMA 3EYHA 4U79A 3ZFXA 2C5NA 5EI8A 3P1AA 2OJ9A 3RALA 2CGUA 3AMBA 3Q53A 4FNYA 4L43A 1GJOA 5AP1A 4ANLA 1O6LA 5M08A 2YLEA 2Y0AA 2WMQA 3D94A 3CPBA 4LV5A 4PP9A 2O2UA 4FIFA 2UW5A 3FYJX 3TL8A 3D14A 4YMJA 2PZPA 5EOLA 2YWPA 3ETAA 3R0TA 1NVQA 3B8QA 2PVYA 3R1QA 5DI1A 5BNJA 1APME 2Y6OA 2WQNA 1GZOA 3HVCA 1Q8WA 2R9SA 2GS6A 3O96A 3QD3A 4AE9A 5ACKA 1K9AA 4P5QA 1XH9A 2GMXA 1IG1A 2RG6A 5CASA 4FTRA 5L4QA 2P0CA 4FK3A 4N6ZA 1XO2B 4UMPA 1MP8A 1XH5A 3BHVA 3DOGA 3HDMA 1YXTA 4O7YA 2WQOA 4F9BA 2ITOA 2W4JA 3PJ1A 5HU9A 5IUHA 3HV6A 5ETFA 3FPQA 1UU7A 3TJDA 4OAUC 3RZBA 3RI1A 3E8CA 3UG2A 4F7SA 5M53A 2EXCX 3PXYA 2JGZA 3KULB 5E92A 1Q24A 4NUSA 4BI2A 2XS0A 4RA4A 5JT2A 3DBCA 4G3FA 2C3IB 5K3YA 3A60A 4FZ7A 5CX9A 1KOBA 3Q6WA 2ZV9A 2VWWA 1Z9XA 1YXXA 1A06A 2P2HA 3R30A 2C6DA 2DUVA 3R7OA 3SG8A 3GCVA 3HDNA 1OKZA 4AGCA 2ZM1A 1Q61A 1BL6A 4C4GA 1Q4LA 1Q8UA 5FGKA 4EZ3A 2WPAA 5HOAA 5TKDA 2HWPA 4QP4A 5CANA 3R8ZA 4FYNA 1J1BA 3AMAA 2FSMX 3KGAA 3Q52A 4PWNA 5CENA 4ZZOA 4EHVA 5HCXA 4GH2A 3W2SA 4RFZA 2PWLA 3DBQA 3O7LD 5IZFA 5LVOA 1B39A 3A7IA 3AG9A 4JXFA 4M0ZA 4O0TA 3S4QA 4C58A 4D2VA 5M4CA 4C33A 2EU9A 2PVLA 4FKQA 4EHZA 2CNQA 3U9CA 3GCQA 2JKMA 3FLZA 4JBVA 4JG7A 3QGYA 2EWAA 3LFBA 2QONA 5LXMA 1UKHA 4PPCA 4LGHA 5HHWA 3P23A 2ITNA 4FIIA 2UZNA 2PSQA 3EQFA 3JVSA 3PG3A 2I1MA 4OLIA 4J95A 4BCKA 4DINA 4QMWA 2JBOA 4H1JA 4ZY5A 5I9YA 2GHLA 2VTOA 3HV3A 3GXLA 4IB5A 4V01A 2BPMA 3D7ZA 3NW7A 5M51A 3OOMA 3HMMA 4EC8A 3EFJA 4L6QA 4IWQA 4GFOA 5CT0A 1RQQA 3LZBA 4YHFA 5LVMA 2VTRA 3Q96A 5ANGA 4QMVA 3RVGA 4EOIA 3ZMMA 1OPLA 2BROA 2B4SB 1Z5MA 4ZSLA 2PZIA 3F66A 4OT5A 3ODZX 3DAJA 2JKKA 1FGIA 4DC2A 3LFAA 3IOPA 3BGQA 2DWBA 5AADA 2WMWA 3BU3A 4RJ3A 4JG8A 5L6OA 3UQGA 2QG7A 4HZRA 4LUDA 2G2IA 4TWPA 5FBOA 4XP3A 3E64A 3ZS5A 4BHNA 3FKLA 3OCSA 3UZPA 5AAGA 2ITUA 5I9VA 5EW8A 2QNJA 4Q2AA 3VIDA 1CMKE 4FKTA 4QMPA 2BR1A 2WMSA 4EH5A 4DF3A 1V0BA 1H28A 3NNWA 4J96A 2OJJA 1ZZLA 4GYIA 2PULA 4ZJIA 4NW6A 3ITZA 1J3HA 3DXQA 3QX2A 5J8IA 3L8XA 3P4KA 1OL6A 4EOSA 2PVFA 1HCKA 3HV4A 4W9WA 4D2TA 2OJIA 3WIGA 3HMIA 4K77A 4YJUA 5B2LA 2J9MA 2OICA 5D1JA 4AW2A 3BE2A 1QPCA 1ZYDA 3DU8A 3GB2A 4FG7A 4MWIA 5E8SA 2QURA 5EYDA 5AM6A 1DAWA 1JKLA 3LXPA 5ETCA 1NXKA 2IZTA 3DBFA 3ORXA 5K4JA 3UIUA 5J1WA 2PE2A 4D5HA 2XK7A 4DFBA 4JBPA 4TYGA 1NW1A 1H27A 4GIIA 3VBXA 4ITHA 3CPCA 4AF3A 1ZLTA 2GS7A 3TIZA 5JFSA 4RSSA 1F3MC 1CKIA 3I7CA 4XV9A 2WFYA 2C68A 4UALA 3NUUA 5M55A 3BI6A 2O5KA 4EZ5A 5HNIX 3PPJA 3ZZWA 5LOHA 1H1QA 2I0EA 2UW9A 4EJNA 2B9HA 3VW6A 5GHVA 2BCJA 3FC1X 5AR2A 5HTBA 2XVDA 3ACKA 2PPQA 3HAVA 2UZLA 2PY3A 3FMMA 4LI5A 3W16A 3CIKA 4O86A 3AT4A 4FTLA 3D5WA 4I23A 3BKBA 3VQHA 3V51A 3KU2A 2GDOA 3EMGA 3L1SA 4O38A 4E4XA 4CV8A 3EWHA 3QF9A 3PIZA 4USDA 3ZOSA 4M0YA 3S1HA 3QGWA 2PVNA 4L46A 4N57A 3MVMA 5BVNA 1AD5A 5CAQA 4U0IA 4HYUA 2V7AA 3PJ3A 4EOPA 3DLSA 3MH0A 1VYZA 5L8JA 4FKVA 5ETIA 4EOLA 2YDJA 4XOZA 3AQVA 5AR7A 3VQUA 4EJ7A 2R3IA 3MESA 5AA9A 4YR8A 4H3PA 4D4RA 2B54A 4QQ5A 3UTOA 3O50A 3DFCB 3QXPA 5C27A 3EL8A 2CN5A 2VAGA 4QMXA 3UBDA 3DFAA 2PL0A 3COMA 4QP6A 1SMHA 3L9MA 2Z2WA 5HO6A 1PW2A 3KXHA 4O0WA 1PHKA 4EONA 4PMSA 3ORTA 2JDSA 1OBGA 5EI2A 4C4FA 3GU4A 3BLQA 4PTGA 4W8DA 5TOZA 4DGLC 4U43A 3SD0A 4U3YA 3Q4ZA 4E7WA 3PJ2A 3BU6A 3EQHA 4O81A 5IQBA 3LFCA 3NCGA 4O7TA 2Z7LA 1GAGA 5CYIA 4RG0A 4UX9A 2BZJA 3BYUA 4G34A 4YLJA 2X6DA 4ASXA 3GOPA 4EK6A 4AWIA 4GU9A 4D4YA 5M07A 3MH2A 3KMWA 4E4MA 3CR0A 2WO6A 1J7LA 5KMNA 4ZTLA 5CSVA 5AA8A 5DE2A 1GOLA 3PSCA 4D9TA 1YOJA 3ANRA 3C51A 2X1NA 4DEGA 4YURA 3QTZA 1FVTA 2W0JA 2ZMCA 1H1RA 2UVXA 3OTUA 4CMUA 2NPQA 4XBRA 3QA8A 4IDTA 5CXZA 2BRHA 5EDPA 1A9UA 1QPJA 5LVPA 3V5PA 5DGZA 4QO9A 3L9PA 4XLIA 1JWHA 1BX6A 2IZUA 2C69A 2VX3A 4JAJA 4DFZE 5J9ZA 5DG5A 4OTQA 3I0OA 3N4TA 4TZRA 3TDWA 2CLQA 3W2OA 3OXIA 4C2WA 4FE2A 5D12A 2XK4A 3G0FA 3DA6A 3DKCA 3ENMA 3LQ3A 4ZLYA 3KY2A 3V8WA 4GFMA 2GU8A 3C4CA 3KRXA 3JUHA 4CFUA 5LCKA 3NNXA 4PL3A 4AACA 1YXVA 2XF0A 2ITXA 3W32A 3RHXA 1YHWA 1SZMA 4QRCA 4AT4A 3NVMB 1KE8A 4G6OA 3LFFA 5KX8A 2JKQA 3LQ8A 5BVOA 5LMKC 3FMJA 4EH3A 5ICPA 1UKIA 3V6SA 2IN6A 2CSNA 5AR4A 5AUXA 5BUIA 2QOKA 4QTBA 1FQ1B 4XG2A 3UIXA 3RAIA 4QMYA 1O6KA 2G1TA 3NYVA 4IM0A 3FKOA 3Q3BA 5J7BA 3TM0A 2JEDA 5AUZA 2FSLX 4I0SA 4AXAA 2YCFA 4IH8A 3QQLA 2NRYA 3PIYA 4M12A 4FV4A 4BIEA 1R78A 4P2KA 1V0PA 3HV5A 5AEPA 4I4EA 4D2SA 5LQFA 4EBVA 4OR5A 2VTLA 4C4JA 1JKSA 5I9ZA 3GC9A 4DFNA 4BCPA 4PX6A 3RAHA 4IX4A 4LMNA 1CSNA 3F9NA 4NYEA 4F9YA 2RF9A 3MFSA 3OT3A 3FXXA 3OY1A 4IXPA 4RMZA 4QP8A 5EDQA 4AW0A 2J0IA 3ULIA 4ZSGA 3G6GA 1GZNA 1UU9A 2C4GA 2J5FA 4PL4A 4ZTQA 5I9XA 4YTCA 4CG9A 1PXPA 4AT5A 4BTKA 3BYVA 4U8ZA 4TYEA 2FO0A 4CLJA 4JIKA 4NJ3A 5TF9A 1OIYA 3W33A 2AUHA 4DBXA 3IW8A 4L67A 2B9FA 3E62A 4GFGA 4EH9A 4O7NA 4IX3A 3UYTA 1OL7A 3ZSHA 4BDCA 5IA2A 3NR9A 2GQGA 1FMOE 4FSQA 2PE0A 3C7QA 3MJ1A 2JD5A 3MFRA 3QQUA 4FTCA 3OG7A 5I0BA 1GNGA 2H6DA 2VRXA 4RIYA 1PXLA 1ZWSA 3M42A 3PG1A 2ZB0A 1PXOA 3P7AA 2J0KA 3K3IA 4FICA 2VTMA 2V55A 5K4IA 5A4CA 1H08A 2O65A 3H0YA 3Q5IA 4GIHA 4TXCA 5LARA 3LOKA 2J4ZA 3TTJA 5B7VA 5IUIA 2ZVAA 3PDTA 1Y6BA 3QUDA 4BBMA 3ROCA 2X8EA 4KIKB 4BKJA 2WMTA 1PJKA 2UUEA 4FNZA 4QMTA 5HKMA 1NA7A 2HZIA 2IZRA 2Z8CA 2PTKA 2QR8A 4UB7A 4IAKA 5KMOA 1M7NA 3F61A 4W9XA 4CXAA 4F9WA 5BVFA 4MNFA 3Q6UA 3FSKA 4NSTA 4F6WA 2BUJA 4EWHA 4F1TA 3P79A 4NM7A 4RJ7A 1V0OA 3ORMA 3R8UA 4CRLA 4FV1A 3P78A 1NT2A 4HCTA 4O1PA 5EHOA 3WF5A 3DKOA 3EQCA 3LQ5A 1URCA 3FEGA 4XV3A 3BHUA 5IA0A 2VN9A 4BCOA 1I44A 5BYZA 4C2VA 3QCSA 2RFEA 4RA5A 1W84A 1KWPA 2CGXA 1ND4A 5HE1A 1MRUA 3FSFA 4J52A 2BFYA 4PF4A 4JBQA 5DLSA 5CXHA 2B9IA 4H05A 2XCHA 3VWAA 4D4SA 3GGFA 3FZTA 1W98A 2VU3A 3Q5ZA 4YJQA 4B4LA 3A7GA 3EN6A 4I6BA 2C5VA 4I20A 4KD1A 2WMVA 4L8MA 2OGVA 3TKIA 4B7TA 2C5YA 4O84A 4U81A 4CFMA 1H1PA 4RWIA 2WHBA 4FL2A 3NW5A 5HU3A 1WVWA 4UZDA 5DYJA 2VO6A 4IAIA 3D2KA 3VS1A 1RJBA 4A9YA 2XYUA 3LM5A 2VO7A 3NAXA 5FTOA 4CQGA 3UYSA 1KV2A 3R83A 2XJ2A 3NNVA 5DT4A 2WTWA 3JXWA 4ASZA 5HVKA 4X7QA 2VO3A 1OMWA 3EH9A 3JYAA 3ACJA 4KKEA 3QTXA 5IG1A 4CFFA 2BZIB 5DNRA 2C6LA 4O91A 2C3LA 2OSCA 3MB7A 5AAFA 2ITYA 4FKRA 4IHPA 4BCNA 4ZY6A 3R6XA 2JFMA 3SXRA 3NDMA 3UZRA 2WQBA 4LOOA 3PXFA 2EB3A 2FSOX 4WG3A 1XR1A 2V0DA 3R2YA 5CU2A 5DOSA 5E91A 1J7UA 2YACA 4EORA 1YXSA 4NL0A 4BB4A 5LVNA 4TY1A 1IR3A 5DMZA 3KXXA 4RIXA 4E26A 3E87A 4BGGA 1X8BA 4FKSA 1R39A 4D0XA 2YCRA 4K8AA 3PTGA 3RKBA 1K3AA 3GU7A 4FTIA 4BTMA 3MVJA 2XMYA 4DGGA 5KZIA 4R1YA 3V01A 4L00A 4ZJJA 3HEGA 4BZNA 5EW9A 2YITA 5D10A 3PLAE 3AOXA 4FIGA 4XJ0A 4M66A 3CQUA 2XIYA 5CVFA 4A9UA 5JSMA 1Q3WA 4Y5HA 2FYSA 1PMNA 4ZIMA 3TZ8A 1W0XC 5D41A 5IQCA 3G2FA 2QOFA 3JVRA 3ZHPC 4ZTRA 4ANOA 1FOTA 3IOKA 1M52A 4FTAA 1PXMA 5HCZA 5T6KA 3CY3A 3LMGA 4FV2A 5FD2A 4ZS0A 4O7SA 1Q99A 2GNLA 4KWPA 4X2KA 2O8YA 3KRWA 3GU5A 2C6KA 3T8OA 3V8TA 5DVRA 4ORKA 4D5KA 4GT3A 4BTJA 4RX9A 3ZFMA 4U5JA 2QODA 4FSZA 1VYWA 4LOPA 5M4FA 3CLYA 4QMZA 2BIKB 4UBAA 2EUFB 4XG4A 2Y9QA 4DGOA 3UIMA 4IVCA 1JNKA 2G2HA 4P7EA 1CM8A 2QO2A 4OBQA 1IA9A 2XP2A 4JDHA 4AGUA 4H1MA 4QOXA 2A27A 1ZXEA 1YHVA 4GJ3A 3ORKA 2YDKA 3ZUUA 2GFSA 3HNGA 5F1ZA 4A06A 4C0TA 2RIOA 3A2CA 1QPEA 3MGYA 4JT3A 2XZSA 4LYNA 3C4ZA 5DFPA 3KRRA 1UNLA 2JDOA 2JFLA 3UG1A 1SYKA 1WZYA 3RAWA 5J95A 4O7RA 4JOAA 4DAWA 1HCLA 1BKXA 3COIA 1OECA 3N9XA 2R5TA 3KL8A 4EBWA 2X8DA 3OUNB 3BIZA 5E1EA 5KNJA 4PMMA 2VTPA 1FGKA 2ITTA 2J0JA 3OC1A 3ELJA 4M69A 2ZV8A 3HRCA 3OWKA 5GZ9A 5J5SA 4CYJA 1PKGA 1YI6A 4K11A 3WARA 4H3BA 4QPAA 1STCE 1V1KA 1XQZA 5IU2A 1XWSA 1W82A 2F4JA 2WTKC 4I0TA 2PMOX 1OUYA 4FT7A 2UZUE 3G9LX 1Q8YA 2F2CB 2VZ6A 5HE2A 3UIBA 3VF9A 3DQWA 2XIZA 4CNHA 4Q9SA 4O0RA 3L8VA 5AIKA 2BALA 5CSHA 5C4KA 3UE4A 2IZSA 3QLGA 4YJTA 2VWVA 2ITQA 2O63A 3EQBA 3HUCA 3P7BA 3P86A 3QRJA 1Q8TA 4BI1A 4JS8A 3OCTA 5E8WA 3I79A 3QRTA 4PPAA 3NX8A 1CDKA 2B7AA 4JI9A 5CQWA 5HVJA 1OUKA 4I92A 1ZMUA 3RM6A 3ZC5A 2OXXA 4BDIA 2E9PA 4IZ7A 4DYMA 3ZDUA 4MK0A 1U5RA 2F7XE 4USEA 3ZRMA 3OOGA 2WELA 4ZMEA 4GK4A 2R3KA 4F99A 4TL0A 4I93A 3AGLA 4O27B 4AW5A 3GUBA 4BDEA 4BN1A 2OF2A 3ROYA 5L2QA 4BDKA 4IZYA 2ZB1A 5BMMA 2A2AA 3V8SA 4FTOA 1YWRA 1XHAA 4UYNA 5HI2A 4TN6A 4ENXA 4ASDA 5IA4A 4QNYA 2HW6A 4M84A 4ZS4A 3FJQE 3TIYA 2X7GA 4DBNA 2GNFA 4FIJA 4ALUA 2WIPA 4KUJA 4D2PA 1JOWB 2QOLA 4YBJA 4DH1A 4LGDA 3CSVA 1OVEA 2UZDA 3FL5A 1ATPE 4EK3A 4BICA 3F82A 3NUXA 3WF9A 3UOJA 3MPAA 4FL1A 4RIXB 2Z7RA 2X0GA 1PRYA 3JR1A 3C13A 3OCGA 4APPA 2YFXA 4AA0A 4R5YA 2IJMA 4V0GA 3G0EA 4X3JA 4X2GA 5CEKA 2YM8A 3PVUA 4G5PA 5JGBA 5M56A 4YHJA 2WMAA 5IQDA 2WXVA 4PPBA 3AC2A 4QTAA 3PE1A 4MXYA 1LUFA 1XKKA 3VVHA 5A6OA 5HORA 1YRPA 3QA0A 2Y6MA 1S9JA 2PK9A 4JX7A 3R04A 4KBAA 4BIDA 4LL5A 3GI3A 4C7TA 2WTVA 5KHWA 1PXKA 4HYSA 3R7UA 3UOHA 5KO1A 3TKUA 1QCFA 2HXQA 5FTQA 3TZ7A 2HYYA 4PDOA 3M1SA 4Z7HA 4HVSA 5LMKA 2CKEA 1CKJA 1RE8A 4Y5QA 4AQCA 5KBQA 5AAEA 2XK6A 3NGAA 5IH5A 3AC3A 3PA4A 2AYPA 2HCKA 3LCKA 4FNXA 4LFIA 4ALWA 4F0GA 4OAVB 4BDDA 3QRIA 4O83A 3FLSA 3E88A 4PV0A 4WOVA 2JDTA 3JPVA 4CEGA 5FEEA 4CFNA 5FXRA 2H34A 2OFUA 4XV2A 3OEFX 4CD0A 3IK3A 4CLIA 1DM2A 5KUPA 4XRLA 4GK3A 2ZV7A 4II5A 4DG3E 1M14A 4TYHA 3DGKA 2OZAB 4NTSA 3R63A 4YO6A 3V5JA 5IQHA 4EOQA 4HNFA 3A62A 5EG3A 4Y85A 4RIWB 2B53A 4FT0A 4BYIA 4EQCA 2X81A 5CALA 1BL7A 5BVKA 3FYKX 4BFMA 2KTYA 2BRMA 3E8DA 3LJ0A 5CSXA 3ZSIA 1JSVA 3KQ7A 4GVAA 3I7BA 4FODA 1H01A 3C0IA 4LL0A 5JQ5A 4DFLA 3NNUA 5DHJA 4M69B 4QP1A 5JRQA 3NMUF 4AOJA 3ZEWA 4CZYB 3S00A 5JN2A 3NUSA 3OROA 3H9RA 4BIBA 1YHSA 4ITIA 2UW4A 3DKFA 5HIDA 3R7YA 3VS6A 4NU1A 4C4IA 4J1RA 4NJDA 2R3FA 3HMOA 4F0FA 5F4NA 4J71A 3PIXA 2P3GX 3GC0A 4WNMA 2PMIA 3SOCA 3AC8A 4TTHB 4G5JA 4WG5A 3HX4A 1IASA 3FMNA 4U41A 4XCUA 1XBCA 5D9HA 1PYEA 3OCBA 4BWXA 2QHMA 5IA5A 3IW5A 2VX1A 4FV5A 4E5AX 3KCKA 3UVQA 4E93A 4ASEA 3QZFA 3OP5A 2F2UA 2W1EA 2YIRA 2F7ZE 4YJPA 4JR3A 3PWYA 3QYWA 4NM3A 4XRJA 3RNYA 3UPZA 3CGFA 3DY7A 4Y46A 4GS6A 2CKQA 4KS8A 3EKNA 3GOKA 3FC2A 1PMEA 1WBNA 4FSUA 4MWHA 4NIFA 4RWKA 4HVIA 2WKMA 4H3QA 5BQ0A 3O8PA 5DRDA 4ANQA 4WNKA 4FV3A 3WZEA 3U4UA 4NCTC 5AJQA 5HE3A 1SVEA 4S2ZA 3WOWA 4A4LA 3QKMA 4QMOA 1LEWA 2H8HA 3WZKA 3SX9A 4A9RA 4G6NA 3VW8A 3NAYA 5FWKK 2BRNA 2ZMDA 3ORNA 5L8LA 4HCUA 3MVHA 3DTWA 4RBLA 1LPUA 4W4VA 5HNGA 2GNIA 1PF8A 2CNVA 1U54A 4BWPA 3SW7A 3L8PA 4OTHA 5HTIA 2RKUA 2J50A 3IECA 4IB3A 1ZZ2A 4A07A 4DH3A 5JMSA 3QTRA 2W5HA 3CGOA 5J87A 4F0IA 3QZHA 1SNXA 3DDPA 1M17A 4RIOA 3JY0A 4L7FA 5LMAA 4YNEA 3QUPA 4V0GB 5JRSA 4FT9A 4K0YA 2W1CA 3LFQA 4YC8A 4I5HA 4LGGA 5CI7A 4D2RA 5CT7A 3NW6A 2XEZA 5C8KA 4Q5EA 2CNUA 3FI4A 4HGEA 3VRZA 4OTRA 4CVAA 2XKDA 2XKCA 1K2PA 3C4XA 4YTHA 2O64A 4XG9A 2GQSA 2UW6A 3AXWA 3NUPA 3POZA 4CYIA 2PUPA 1ZOEA 3EKKA 3D15A 2PMLX 3SLSA 4TWNA 1YWNA 2FVDA 1KUTA 2OXYA 4EK8A 2EXMA 2RFDA 4QYEA 3EQRA 1YQJA 4U97A 4GYGA 3FL4A 1Q62A 4RRVA 5E9EA 3OF0A 5L3AA 4WKQA 1ZARA 4FVRA 5EM8A 4FZ6A 3C4FA 2YJSA 5IEVA 2I0YA 2C47A 4JNWA 4MX9A 2G2FA 5AP5A 4IAFA 4W4XA 4UXQA 4D9UA 3UMXA 3Q9WA 5J9YA 4OBOA 4EL9A 4TKSA 4LG4A 3VBWA 4G3GA 5CF4A 5IDPA 2HIWA 3EN9A 4BWKA 3TKHA 4CTCA 3UQCA 4L42A 4DLIA 1W7HA 3M2WA 3VUDA 4EHEA 4LMUA 1ZY5A 3QTIA 4X3FC 3FMEA 2UZOA 5HO7A 4FA2A 4G3EA 3SVVA 4BR3A 4EH8A 1Q3DA 1UWHA 2UVYA 3QCYA 4AE6A 2HXLA 3QC9A 4LRJA 3PSDA 4BCIA 4FVQA 4U6RA 3CC6A 3W2QA 3PZEA 5LCJA 5EOBA 3K3JA 5FBNC 1XH8A 3SDJA 4R3CA 3FY2A 5I9UA 4C61A 1EH4A 4BDBA 5A4EA 5CEQA 5AV4A 4WRGA 2YZAA 5EK7A 4Y72A 5EH0A 4YLKA 3MS9A 5ANOA 3KK9A 5BPYA 3B2WA 5HLNA 3TUBA 2FGIA 5C9CA 3E8EA 3LAUA 3BCEA 2G15A 4KBCA 2ERZE 3S0OA 3ZO1A 2E9VA 3DK6A 2WQMA 1ZY4A 4FIEA 3QCXA 2GQRA 1E1XA 1WAKA 5BUJA 5IA3A 3K5UA 1S9IA 4E5BA 2XK8A 3R7EA 4I21A 3KN5A 2W5AA 4KKGA 5I5ZA 4AZWA 4CGAA 5CI6A 4S30A 2EB2A 3CCNA 4ZSJA 1JLUE 4BC6A 3A4OX 4J8NA 3UODA 5IH6A 4BTFA 4TYJA 3EN5A 5AV0A 1ZRZA 5BYLA 2YA9A 3NIEA 3ZBXA 1KOAA 3NRMA 3NS9A 4M13A 4RC2A 4AOTA 5JZJA 3ZO4A 4NIFB 3ZUVA 2JIUA 4GCJA 1U59A 2J90A 3WF8A 5IA1A 2QU6A 2OU7A 4ZXTA 4BVUA 1LP4A 2BILB 3RMFA 4QMQA 5JGAA 3HV7A 4YGAA 3Q4UA 1SVGA 4ACMA 4E6DA 1WCCA 5GIOE 3B2TA 2VUWA 3GCUA 4EYJA 3P08A 3CTQA 2PZ5A 4L68A 4KBKA 2A19B 4HJOA 3OWJA 1ZMVA 2UW0A 1KSWA 3LXLA 4KAOA 5G6VA 1KE6A 4JLCA 4JL9A 5B2MA 3FZRA 1ZMWA 4YC3A 3F3ZA 3GFEA 5L2IA 5LWNA 3O23A 2PYWA 4PDPA 4IJPA 4DTBA 5EYMA 3DZQA 3OBJA 4E4LA 2PVJA 3ZC6A 3LLTA 4RC3A 3TV6A 4R7BA 2WGJA 3BBTB 3VAPA 3A8XA 5IQGA 3QU0A 4FSTA 2I7QA 1FBNA 2BFXA 4IM3A 4EH4A 4TYIA 3TJCA 3D83A 4PNKA 2YZLA 1Y8YA 2GHMA 2ZDUA 4L52A 4F70A 5A14A 1R0EA 2OH4A 3QRUA 5AP3A 3U9NA 2W1DA 4E1ZA 4UXLA 1WBWA 3CXWA 3MBLA 3GEQA 2P2IA 2X4FA 4R77A 2PZRA 4FF8A 4MQ2A 5FP6A 1H00A 5IISA 4NWMA 1SNUA 3KC3A 3RZFA 3LKMA 5FP5A 5JKGA 1YOMA 2J51A 4IADA 3QQJA 5TO8A 3V3VA 4KRDA 2GNJA 3MY5A 4X2JA 4E3CA 3V5WA 4DH7A 4CT2A 2I0HA 2W1ZA 2YEXA 4A9SA 4FKGA 3QYZA 5AV1A 2OW3A 5CU4A 4FKUA 3E3PA 2CGWA 4B6LA 4WHZA 3FQHA 2CN8A 4KB8A 4C3RA 4OTGA 3TEIA 4AUAA 3OEZA 3G6HA 5HE0A 4RJ4A 3UC4A 3KN6A 4FT5A 4XP2A 1SM2A 5E90A 4L3JA 4RGJA 3TXOA 2JIVA 4ZTMA 4CFVA 1Y6AA 4F6UA 3UO4A 3PUPA 4HCVA 3LXNA 4MBLA 2WQEA 2YLFA 3E63A 4H58A 4D1XA 4YJOA 1HOWA 3QC4A 3EL7A 2HAKA 3KA0A 3WYYA 4QPSA 1GZKA 5G1XA 4DE4A 3I6WA 3MA3A 5ANIA 5JFWA 5E8UA 5JK3A 2WMRA 2R7BA 3KMUA 3ENHA 4BY9E 2Y8OA 2A0CX 2X2KA 4QYGA 2C6TA 3W18A 2ONLC 4GJ2A 5CTPA 2OFVA 2VTIA 1W83A 3DJ7A 4O21A 2W9FB 4GG5A 4GVJA 4WA9A 5DR2A 5K0KA 2XNPA 2DQ7X 4WNPA 5FG8A 4I6FA 1W8CA 2BTRA 4CMOA 3LFSA 3PA5A 3KXGA 3O8UA 3NVKI 2YERA 4E20A 2JITA 4NM0A 5HIEA 4EUUA 1JAMA 4YJNA 2YIXA 3B8RA 3BEGA 3IGGA 2WIHA 1UU8A 4RWLA 4J98A 3Q32A 4UY9A 5J5TA 2R3OA 3UP7A 4OTWA 3MVLA 3MI9A 5AX9A 4G3CA 5HZNA 3R8VA 5J9LA 2X6EA 4FTKA 3AGMA 5A3XA 2GTNA 3F5PA 3FV8A 4FSRA 3TNIA 4QP7A 3LHJA 4ZLZA 4G9RA 5AP7A 2BIYA 4F1OA 2XIKA 4FC0A 4HVDA 3IPHA 4AU8A 4N70A 4I22A 3AC4A 3DDQA 3RPRA 1J1CA 2WTKB 3R7GA 3RPVA 5KMMA 5AUYA 3OUKA 4F7LA 1YDTE 5L2SA 3PP0A 3EFWA 4AX8A 2OH0E 2OBJA 5HCYA 4O22A 5HLPA 2X4ZA 3F69A 4ENYA 4FNWA 3PRFA 4K2RA 3DXPA 2OJGA 2BRGA 3EJ1A 3QD0A 5CNOA 5IDNA 1VEBA 4DLJA 3FUPA 1KE9A 2BAJA 3VULA 3TUDA 4LM5A 3DB6A 5EW3A 2UW7A 1OPJA 2YCSA 3ZFYA 4MEDA 1ZAOA 2UZVA 2BDJA 4M67A 3QTSA 4MXCA 3UVPA 3AD4A 2WTJA 3BELA 2XM9A 2ITVA 5IQEA 1T46A 3D0EA 1H0WA 5L2WA 4A4XA 1ZYLA 1M2PA 3FXWA 3EB0A 4KIOA 4RJ8A 4U42A 5JFVA 3MY1A 1NVRA 4V05A 3TNQB 4NCTA 3BX5A 2C3KA 4MXXA 3FMHA 4RLKA 5L6WL 3IDBA 3HL7A 3RPYA 4GU6A 3SC1A 4AGWA 4S34A 4MNEA 2IWIA 4DH5A 5EKNA 1MQ4A 5AR8A 2X7OA 3CTHA 3UNKA 2PVHA 4EKLA 4EWQA 4RX5A 1AQ1A 4ZOGA 2Z7QA 5ETAA 2E9NA 3U51A 4BBEA 5B0XA 5IH4A 4F7JA 4JRNA 5LVLA 3D7TA 3CE3A 5KMLA 5E8VA 2KULA 4GSBA 3DJ6A 5CEOA 4FEXA 2ZM3A 4OTPA 4LRKA 4PP7A 5EYKA 4ZMFA 3TDVA 4BCMA 2B0QA 4CCBA 4XV1A 5HX8A 5EQYA 5F20A 3LFDA 3ZUTA 5HTCA 3R9RA 3BQRA 3VS7A 2EVAA 2QO7A 3QRKA 2VWIA 3KVXA 5HG7A 3KRLA 4RQVA 5CY3A 1BLXA 5BVEA 4KS7A 4M7IA 5CAOA 2VWBA 4MBJA 3C0HA 3IQ7A 4R7HA 2HZ4A 3LW0A 5AR5A 1WBTA 4BF2A 1YI3A 2CLXA 2Z02A 1G3NA 4QP3A 2YAAA 1O9UA 4EHGA 1LR4A 1J7IA 2B55A 5HBEA 2W99B 2HK5A 2QLQA 4NH1A 4ZAUA 2NRUA 2VD5A 4JIAA 3WF7A 3FMLA 2BDFA 5DH3A 4DCAA 2VNWA 3NWWA 3EYGA 4NFMA 3HRBA 4RC4A 5J1VA 2BAKA 2ESMA 2QD9A 5JZNA 2R3GA 1JPAA 2XA4A 2UZWE 2V22A 4XP0A 2X2MA 4HPTE 1YI4A 4UWCA 4OT6A 5FRIA 4ZZNA 4FK6A 3OHTA 2WEVA 4FKOA 4R6VA 4I24A 4DFUA 3H0ZA 1DI9A 3QL8A 4O0SA 1Q97A 2V7OA 4OTFA 4WBOA 2Y4IB 3U6HA 3MH3A 4PL5A 3WE4A 4FR4A 4ERKA 5J7HA 4RVKA 3PY0A 5HESA 3R8LA 3ULZA 5BYYA 3FBVA 5IQIA 3ZCLA 1JVPP 4XYFA 4ANNA 4FKLA 4IVAA 4QMMA 4EOOA 3WZDA 4I4FA 1YXUA 4YZ9A 3I81A 5IEYA 3HMPA 3FZOA 3CJFA 3H9FA 3R9DA 3TACA 4JVGA 4X3FA 4Z16A 4CG8A 4DT8A 4ACHA 3ATSA 5FM2A 5JH6A 5C01A 3QWKA 2G01A 3TUCA 4MQ1A 3GC8A 3O17A 1YKRA 3R9HA 4C36A 5BVWA 3PY1A 3FI3A 4R7IA 3OT8A 4FEQA 4JDIA 2WB8A 4IAYA 4X0MA 3ORPA 3I1AA 4AZFA 4CT1A 4ANBA 5HNBA 4AT3A 4G2FA 3TG1A 3NSZA 3RP9A 4HYHA 4OGRA 4RIYB 2OIBA 3JS2A 5BUEA 3VS3A 3BBWA 4GUBA 2WD1A 4FV8A 1JSUA 3UZTA 2B1PA 3VHEA 4EH6A 4ACDA 1JSTA 1QL6A 3MA6A 4HPUE 5EFQA 5FXSA 3PXKA 5DEWA 2C6EA 1IA8A 5IMXA 4X6RA 3F3VA 2ZV2A 3MIAA 5DN3A 4QMSA 3H10A 3EQGA 4HNIA 5TE0A 3MV5A 3S95A 2F57A 4YPSA 4UMUA 5H8GA 3MIYA 3MYGA 4IE9A 4L3LA 2IW9A 3W8QA 5A54A 5EKOA 3ZEPA 2VWYA 3BHYA 3FHRA 1H07A 2QOCA 3DZOA 5CZIA 3W1FA 4NKAA 3R28A 4HOKA 5D7AA 4CV9A 3SA0A 3LMIA 2VGPA 2WOTA 4FSMA 2YM4A 3ALOA 4DCEA 5ANEA 4KIPA 3THBA 4YZMA 3UVRA 4UMQA 5B2KA 4NTTA 3UQFA 3OW3A 5HICA 3SRVA 2OG8A 2UZEA 2XNMA 4BCQA 5KMKA 3OMVA 4MNEB 3KXZA 5FUTA 5FLFA 3RCDA 4UN0C 4BI0A 4XH6A 1Y57A 4UEUA 3SQQA 3UJGA 3UOKA 3IO7A 3T3UA 3OD6X 3D7TB 4FBXA 4L9IA 4FTUA 3Q2JA 3KVWA 4Y8DA 2BAQA 2XIRA
chains in the Genus database with same CATH superfamily
2XAOA 4FL3A 3ATTA 3AT3A 4FZDB 3MPTA 4IC7A 3OWPA 4LV8A 4YU2A 2WZJA 3BLHA 1GY3A 3R73A 4K33A 4OTIA 4S33A 1GIHA 5AIRA 4M68A 5ACBC 3RAKA 5JGDA 3FLQA 5C8MA 5IEXA 3HZTA 3PVGA 3UGCA 3SXFA 5LJJA 3CY2A 3EHAA 4U44A 4AXCA 2HZ0A 3BGPA 3O71A 4MHAA 3PFQA 5AUUA 3REPA 4AN2A 3R1YA 5A4LA 5FM3A 1DAYA 5H3QA 4FI1A 3SG9A 3F5XA 1OIQA 4FUYA 5EHLA 2YABA 1GIIA 4C4EA 3E7OA 5CZHA 2BZHB 3L8SA 4DFXE 2AC3A 4L3PA 4BDFA 3BL9A 3OY3A 5A46A 3ZXTA 3R02A 4FKPA 1P4OA 3OTVA 3KULA 3PVBA 1IRKA 3FLYA 3OFMA 4B99A 2J0LA 4FKWA 2HELA 4AFEA 5M09A 4RZWA 4KA3A 2W1FA 2UZTA 2VNYA 3WI6A 4EK4A 4HW7A 1GIJA 4AA5A 5CU0A 1XBAA 4JAIA 5CLPA 4IZAA 5HBJA 5CF8A 2YM7A 2HY0A 4PMTA 3RK9A 4EK5A 5BMSA 5E1SA 3VUKA 3AT2A 5KKRC 4X21A 4I5PA 2H96A 1WBPA 1DS5A 4FSYA 3CKXA 2Y7JA 2QOQA 4Y73A 3QHWA 4IC8A 3NLBA 2FUMA 5EQEA 3N4VA 5CS6A 4IIRA 3BE9A 3BWJA 3CD3A 2W06A 4Y95A 4FMQA 3U54A 4WSYA 2J5EA 3ZRLA 4MF0A 2J7TA 5K0XA 4M14A 3FI8A 4GEOA 3MW1A 3FQEA 4R5SA 4IVBA 5CVGA 3BHTA 4X3FB 4EOMA 1YVJA 2UW8A 4F9AA 3RGFA 5I9WA 4IBMA 2XK9A 4XHKB 5BX0A 3LMHA 2X7FA 4XEYA 1XMMA 3EOCA 2YISA 3I5ZA 3UOLA 4BCJA 4A7CA 2OZOA 3BYOA 3N51A 2Q0BA 4Z55A 2QQ7A 2E9UA 3MFTA 4MXAA 3E92A 2ONLA 4AS0A 4MAOA 4RFYA 4X6QC 4F63A 5EQPA 4AG8A 3ALNA 3R00A 5M44A 4BDHA 5FDXA 4TWOA 4D2WA 3EN7A 3KXNA 1WMKA 2PMNX 1TVOA 1OPKA 3PVWA 2XNGA 3FKNA 3Q60A 4FX3A 4OUCA 4WUNA 5IMEA 4ZTHA 4HVHA 2X8IA 3POOA 2HW7A 5E8XA 3GCPA 3R1SA 4EH7A 3VUTA 3RBWA 1KE7A 4J99A 4TPTA 3CQEA 3SV0A 3VRYA 4AW1A 4BYJA 4D0WA 4AGDA 5JEBA 4UYAA 4YNOA 3QD4A 3QQFA 3KREA 2RFNA 4NZWB 2W5BA 2JAVA 4QP2A 3A7HA 3BZ3A 5KMJA 3DK3A 4MD9E 4I5MA 3I60A 4YHTA 5KCVA 2Q83A 4AAAA 4G9CA 4I0RA 4I5CA 4ZSEA 3O7LB 4ACCA 5K5NA 3SW4A 4XS2A 3VUIA 4JRVA 3A7JA 3QZGA 3MY0A 2XBAA 4XOYA 1L8TA 3SRVB 2XM8A 1XMLA 2CKPA 1YW2A 1TKIA 3II5A 4ID7A 4BBFA 5HLWA 5H9BA 3QXOA 4YZBA 3F3WA 4EI4A 4I41A 3VUMA 3O2MA 5HG8A 2A98A 2IO6A 3ZONA 5AM7A 1NVSA 4F1MA 3SXSA 2QU5A 5DIAA 4G1WA 4YBKA 3QX4A 5GNKA 1UWJA 4L45A 3ZM4A 4EOJA 3DT1A 3RCJA 4EOKA 1UVRA 1TQPA 5TR6A 4M97A 5HD4A 5BVDA 4G6LA 3VN9A 5IQAA 1B38A 3DAKA 3GC7A 3JY9A 3ZM9A 2J0MB 3HA8A 4FTJA 3C5IA 2VWUA 2XKFA 4QMUA 3UO5A 2QOHA 3VUGA 1Q5KA 3DS6A 1CKPA 3D5XA 1OL5A 4A4OA 4RQKA 3H3CA 5DEYA 4IZ5A 5A4QA 2BVAA 4JDKA 4UMRA 1CTPE 3GQLA 5DT0A 3COKA 3RM7A 4IACA 1IEPA 2QOBA 2WMBA 2ETRA 2B52A 3FHIA 3RK5A 4E8AA 4MD8E 5KZ0A 4CFXA 3R1NA 4RLLA 4XX9A 1OL1A 3BYMA 4IX5A 2GFCA 3LJ2A 3OW4A 2J2IB 5EM6A 2QG5A 3MB6A 2R3HA 3PYYA 3G15A 3QAME 2AC5A 3DKGA 3DK7A 4C02A 3BYSA 4BRXA 3F88A 4PRJA 2CDZA 3KB7A 3D4QA 1BYGA 4P4CA 5EI6A 3BGZA 1A48A 2NNWB 4QDVA 1PMUA 1BI7A 2VWXA 3LJ1A 3RWPA 2R0UA 2E9OA 5AP6A 4GKIA 2XRUA 4U40A 2GHGA 4BDJA 1VJYA 2C5XA 5FDPA 3QD2B 1YOLA 3IONA 1I09A 3WBLA 2XJ1A 4KSQA 3M11A 4IWOA 4XG7A 3TMOA 2WOUA 3DXNA 3QWJA 4IVDA 3ZLYA 4C59A 2VTHA 4R1VA 3TV4A 4EQUA 3VONA 4NW5A 2C0IA 3GU8A 5ANJA 2OXDA 4L7SA 5DT3A 5C4LA 3U4WA 2R7IA 2CHLA 3R9NA 3Q9YA 4OBPA 5T3QA 1OZ1A 4O7WA 3C1XA 5EHYA 3R7VA 4TT7A 3U55A 3R7IA 2JDRA 1R0PA 4E4NA 2HY81 2ITPA 2BKZA 3DTCA 2VTQA 4IQ6A 4F64A 1REJA 4GMYA 4GW8A 2W17A 4XMOA 4BHZA 2XNOA 4FG9A 4P90A 3ZLXA 1OKYA 1ZYSA 4PDYA 2OO8X 3F3UA 3QZIA 4FEWA 4I1ZA 1MRYA 5CSWA 3F5UA 4TYHB 4PTEA 4F9CA 4B8MA 4RT7A 4YJVA 4WSQA 4I6QA 3NYOA 3KF4A 1BUHA 4FT3A 2YCQA 3D2IA 3W8LA 2JDVA 3GU6A 1H0VA 5IPJA 4ANSA 4QTDA 4AZEA 4D1SA 5HQ0A 3PXQA 3HRFA 4BZOA 1H24A 5C1QB 4J97A 3F2NA 3UO6A 4QDEA 4AN3A 2ETKA 4C38A 2XYNA 3U6IA 1TQIA 4NFNA 4CZUA 4F4PA 1ZOHA 4DN5A 2WMXA 4IFCA 3UPXA 2JLDA 4FG8A 5KHXA 3CKWA 4IWPA 3OVVA 3FWQA 4EQMA 3UNJA 4EH2A 4PQNA 4WBBB 3PXZA 4YSJA 1SVHA 4ZZMA 2E2BA 2VGOA 3LM0A 3IGOA 3ID6C 5FTGA 1U46A 5FQDC 5HG9A 3AC5A 2ZYBA 3U8WA 5JQ8A 5L6PA 4WO5A 2OLCA 3V5LA 3RWQA 4FVPA 1GZ8A 4NEUA 2G9XA 3PPZA 2XNBA 3QKKA 2SRCA 4YZCA 3UMWA 3W55A 5KMIA 3H30A 2O0UA 4FIHA 3F2RA 2W96B 4ZSAA 3PZHA 4M3QA 2GS2A 3VJNA 3IKAA 5HVYA 3BPRA 2XNEA 2R3MA 4W4WA 4HZSA 3QQGA 3TZMA 3GT8A 3FE3A 2OJFE 5A4TA 4IB1A 2O3PA 3FZPA 4LOQA 2R2PA 3QCQA 3TNWA 3VBVA 1Z57A 3GENA 2R0IA 1OBDA 4MXZA 4O7LA 3K54A 4U7ZA 3QTUA 2WTIA 3L9NA 3O0GA 2R3PA 2PU8A 4IM2A 4DFYA 1M2RA 2IVUA 2ZOQA 2VV9A 4QYFA 4J8MA 5I4NA 2GNHA 4XG8A 2Y4PA 4QQJA 2CCHA 2RSVA 4HGTA 2C6OA 4KRCA 4MF1A 5EDRA 3NUAA 4ARKA 1XH4A 2PVRA 2CMWA 3PRIA 2X2LA 5GJGA 4ZP5A 1Q8ZA 3C5UA 4KIQA 5EYCA 4ANMA 4JX3A 1U54B 2BHEA 2I6LA 3TNPC 3H4JA 2PVMA 4BDAA 4PUZA 4E6AA 5CAUA 4AZSA 4GKHA 4FV6A 2GTMA 4D58A 4IW0A 4F08A 2JAMA 4GG7A 3FLNC 3DQXA 3LE6A 1PYXA 2VTTA 4YTIA 2PUIA 2HZNA 4C3FA 3EQDA 3WILA 4DHFA 5FXQA 3DB8A 2YM5A 1F5QA 3TZ9A 4O7VA 2EXEA 3QHRA 3K2LA 5AV2A 1Y91A 4RJ5A 3WF6A 3LFNA 5C26A 1XH6A 4J53A 4YC6A 3OXZA 4TNDA 5AX3A 5JFXA 3ZDIA 3HKOA 4IB0A 3ZLWA 3KK8A 5H2UA 2YIWA 2YDIA 2YAKA 4G16A 2OWBA 3IDPA 3MTLA 4FUXA 4V04A 4NK9A 4O0UA 5ITAA 4KIKA 5F9EA 4FEVA 2XBJA 3E93A 4WG4A 5CF5A 5HIBA 4CMTA 4EEVA 3VBTA 5M06A 2CJMA 4IEBA 2W4OA 3GFWA 4AQKA 2WTDA 4Z3VA 3PXRA 2QO9A 3GNIB 4HGSA 4K1BA 2VWZA 5IKWA 3ZU7A 4TRLA 2I40A 2BZKB 3C4WA 4MYGA 3EN4A 3HMNA 3QALE 4ZTNA 4C57A 1RW8A 3MTFA 4O2PA 4AP7A 4C34A 2ETMA 3I4BA 1H4LA 3VS4A 3IG7A 4O0XA 3W0NA 2FA2A 3LVPA 3R01A 3R21A 4WT6A 5BV3A 3TWJA 4TWCA 4WIHA 4AFJA 1REKA 1TZDA 3ZH8A 3VUHA 3K5VA 2YN8A 4D4VA 4DEHA 4A9TA 1OL2A 4ALVA 1WVYA 4D1ZA 5CEMA 2PZYA 2IVTA 2XH5A 3QBNA 2IVVA 3NZ0A 3MH1A 4C3PA 4IX6A 1XBBA 1FVVA 3KF7A 3PPKA 3MJ2A 1OITA 5DR6A 4QYHA 3RNIA 3COHA 4DEBA 3HGKA 1P4FA 3OXTA 2RFSA 3BLRA 3BV2A 4FYOA 4RVLA 5AMNA 1ST0A 3QTQA 4JDJA 4XNEA 5D7VA 5KE0A 4AA4A 1WBOA 3ET7A 3MWUA 4PNIA 5E7RA 3W2CA 4C35A 4ZJVA 2W1IA 5K5XA 3FPMA 4AOIA 1B6CB 4K6ZA 3PSBA 2QI8A 3R8MA 3FMDA 3ZZEA 2Z7SA 4FSWA 3FZSA 3FY0A 1LEZA 3G51A 4ONAA 3TTIA 3ORZA 4ZLOA 2JIIA 3EZVA 2H9VA 3MSSA 4ZTSA 1ZYCA 3CJGA 5CEPA 2PE1A 3G5DA 4EKKA 3E7VA 4S31A 3HYHA 2UVZA 3RPOA 4FGBA 4B0GA 2OKRA 4HGLA 4XG3A 3GP0A 3F5GA 3IW6A 3S2PA 2IPXA 2OIQA 3W10A 3ZLSA 4LUEA 4P5ZA 5GIPE 4I6HA 3DBDA 3NEWA 3IS5A 1FPUA 2QKRA 2R64A 4I3ZA 2LAVA 5CVHA 4PDSA 3VNTA 1OIRA 4IWDA 4GRBA 3OWLA 4CRSA 3P7CA 2WU6A 4CKIA 4IANA 3FDNA 4MH7A 4DGNA 4QP9A 5F95A 2W9ZB 3WIKA 3QUEA 4GL9A 1NY3A 5CAVA 4KABA 1Q41A 3CQWA 1RDQE 1UNHA 3AD5A 5H8EA 2W1GA 4BL1A 3AKJA 3F6XA 3UNZA 3FLWA 4QPMA 3G33A 4CTBA 4UV0A 5K9IA 3E8NA 3Q4TA 3HUBA 5KBRA 5GJDA 1OB3A 3UC3A 4C4HA 3A4PA 3E5AA 4ZEGA 2PUUA 5CU3A 3KRJA 1OIUA 2C1BA 1Y8GA 4BKYA 2YIQA 5CAPA 3QKLA 3AMYA 3ANQA 5CQUA 3R8PA 3TN8A 1M2QA 4O7ZA 5E8YA 4R78A 1FVRA 2C0OA 2PUNA 1R3CA 4IAZA 4CZTA 3R71A 5HG5A 5DRBA 1H26A 2WTCA 2WU7A 2X9FA 2C6MA 2XCKA 3BV3A 3C9WA 3EFLA 3NIZA 4GK2A 2IG7A 5HD7A 1QMZA 2VTSA 3RTPA 4RZVA 4ERWA 3T9TA 4K9YA 4WRSA 5I3OA 4ITJA 4JR7A 4L01A 4PTCA 4RFMA 3TV7A 2R3RA 1O6YA 2ITZA 3PJ8A 2FH9A 3Q9XA 5HO8A 4AZTA 4BCGA 3NCZA 5DPVA 4E6CA 4U45A 4O0YA 4BGHA 3DLZA 4QQCA 5LWMA 3S3IA 2IVSA 4RVMA 3EZRA 3Q04A 3MN3A 3I6UA 4E73A 2VTAA 4Z7GA 2QKWB 3LCOA 1R1WA 3EFKA 4FTQA 5M57A 4JQ7A 2RL5A 3A8WA 4FV9A 5E8TA 4FZFB 2GSFA 4QMNA 2OK1A 1WVXA 4HYIA 4F65A 4B9DA 5KKRB 1G5SA 4EC9A 4EUTA 2F9GA 4LRMA 2CKOA 4XBUA 4ZY4A 2HWOA 4UZHA 5L2TA 2ZJWA 3ORLA 2YM3A 1PMVA 1PXIA 2R3NA 1WBSA 1JBPE 2C6IA 4CCUA 2XJ0A 3ZYAA 1XH7A 1G8SA 3FI2A 3SAYA 2C30A 3RK7A 4USFA 4RWJA 3LCSA 4KINA 3KXMA 3R9OA 4AN9A 1G8AA 1VZOA 1WBVA 1YDRE 3F2AA 5DBXA 4E5WA 1E1VA 4S32A 3VBYA 1KV1A 4FOBA 2NO3A 2XIXA 4AZVA 3A61A 4RPVA 4W4YA 3FZ1A 4OW8A 4YJSA 4DG2E 2V62A 2ZAZA 4WUAA 2PHKA 2CCIA 3QLFA 4E6QA 1F0QA 2XARA 3R22A 4H39A 3UP2A 4F09A 5E4HA 4APCA 1JKKA 5TT7A 5GINE 2WEIA 3W2RA 4QTEA 1H1SA 3ERKA 3IW7A 3ZO2A 4D28A 3HA6A 4FGRA 2YHVA 3ZBFA 4FTTA 5IQFA 3BHHA 5AUWA 3UDSA 4BCHA 3DCVA 3KKVA 4BGQA 4DEAA 4GUEA 5ANKA 3HLLA 2IW8A 4FEUA 3T3VA 5LMBA 2XRWA 4ZK5A 4DH8A 2Q0NA 2BDWA 4UMTA 3OZ6A 5E8ZA 4IDVA 1TQMA 2IW6A 5CNNA 2W05A 5IUGA 2YIYA 3P5KA 3VO3A 4DEDA 4QYYA 1OGUA 4GV1A 3NUYA 3HECA 4WNOA 3G90X 3QFVA 4TNBA 4XUFA 3FQSA 2CGVA 5HBHA 1T45A 3RINA 3T9IA 3U87A 4BCFA 1UA2A 4AXDA 4YTFA 4NT4A 4Q5HA 1JKTA 4GT4A 4YZNA 4KSPA 3GVUA 3TNHA 3DBEA 3F3TA 3ZTXA 5C03A 2RG5A 4J7BA 4O0VA 2X39A 2DS1A 4RX8A 3HP5A 3QQHA 4O6EA 5HX6A 4JG6A 4O4BB 4QTCA 3H9OA 3E3BX 1UNGA 4M8TA 2F49A 3FMKA 5CWZA 2QHNA 1PXJA 4H36A 1L3RE 4FOCA 2LGCA 4WD5A 3D5UA 2ITWA 3W0RA 1IAJA 3VJOA 3LIJA 2JC6A 2QOOA 3BU5A 2C5OA 3WE8A 2JBPA 1U4DA 3ORIA 4PY1A 4R3PA 3FAAA 4UWBA 5F94A 3FXZA 4QQTA 4FKIA 3IDCA 1YWVA 1U5QA 3MPMA 4QNAA 5GZAA 3I5NA 1ZYJA 2W1HA 4B8LA 4OTDA 4Q9ZA 2WNTA 3LXKA 5DA3A 3Q9ZA 4QD6A 1OKWA 4O2ZA 4CQEA 4JQEA 4YLLA 4CKRA 3CD8A 3PY3A 4LQMA 3RPSA 1H25A 2YM6A 4U80A 4DITA 3N4UA 4O4FA 3GBZA 3UDBA 4EZ7A 2OI4X 4K18A 2RGPA 2CPKE 2ZM4A 2ACXA 3DV3A 2BHHA 4KNBA 5DWRA 4FKJA 3UDTA 3LCTA 3DNDA 3EQPA 3QTWA 4G17A 5CEIA 1QPDA 4DEEA 1MQBA 2I0VA 4MD7E 2JKOA 3KMMA 3CTJA 3KCFA 3R2BA 3PWDA 4DT9A 1PY5A 4Y83A 3I0QA 4F7NA 1P2AA 5L8KA 3NYXA 4MKCA 1UV5A 4RJ6A 4DGMA 5AFVA 5EM5A 2OZAA 4MXOA 3W2PA 3SOAA 2F7EE 3D5VA 4G3DA 4L44A 3ODYX 1KE5A 1OM1A 3LLAA 4F78A 3L9LA 4I94A 3P9JA 4RIWA 4YO4A 4DA5A 3VS5A 3VS2A 4HVGA 4CKJA 1VR2A 2XEYA 5T68A 4X2FA 3A7FA 3BRBA 1FINA 3TT0A 5J79A 4MTAA 1JQHA 3ZSGA 1URWA 3CBLA 4W8EA 4YUQA 3CP9A 4XLVA 2XKEA 2HOGA 2WAJA 2XUUA 3QQKA 4N0SA 5M4IA 3LCDA 2UZBA 5A9UA 4NKSA 2C0TA 1AGWA 3BQCA 3RJCA 4F6SA 2HENA 4N4SA 2FSTX 4JQ8A 4YSMA 5FEDA 4O96A 5GJFA 3P0MA 1P5EA 3O8TA 4FZAB 3AC1A 4BDGA 4G31A 3G9NA 4XG6A 5HEZA 3BEAA 2A4LA 2XNNA 4KKHA 4ACGA 3GQIA 3O51A 3ZRKA 3V04A 1P14A 1BI8A 2R4BA 3BL7A 5CF6A 5HGIA 4R8QA 3TI1A 2QVSE 3V5TA 1OKVA 2QCSA 2B9JA 5AP2A 4CSVA 3DJ5A 5CSPA 3BWFA 4L53A 5M4UA 4IAAA 3HP2A 3Q2MA 4IJ9A 3DAEA 5FEQA 5D11A 2VTJA 5IF1A 4Z9LA 2A1AB 4JJRA 3CEKA 1J91A 3PP1A 4TW9A 4O6LA 3ZO3A 3C50A 3RHKA 2YJRA 4UWYA 4QT1A 2R3LA 2W4KA 1H1WA 3DPKA 3KFAA 2QLUA 2C1AA 2P55A 2R3QA 3MFUA 4RVTA 3MDYA 3Q4CA 2YWVA 4MVFA 3C0GA 4BKZA 4QEBA 3PA3A 2BTSA 2W7XA 4N6YA 5ANDA 1BMKA 3OS3A 4C8BA 5C8NA 4RX7A 5AP0A 3PJCA 4U3ZA 3VC4A 3D9VA 2P33A 4X2NA 2OF4A 3F7ZA 3NFFB 2VO0A 4DTAA 3A99A 4FSNA 3W0MA 2UV2A 2PVKA 1H8FA 3PLSA 5EM7A 3U6JA 2UW3A 4YP8A 5I3RA 3V6RA 5AR3A 5A6NA 3PE2A 3VS0A 3VF8A 2ERKA 1OI9A 4FV7A 2QR7A 3IW4A 1ERKA 4QMLA 2OIDA 3SKCA 3AD6A 3F7WA 4IMYA 4YPDA 2R3JA 1IAHA 1MRVA 1PXNA 4NM5A 3WZJA 1YDSE 3LFEA 4C37A 2X9EA 3VHKA 1WFCA 2VX0A 4JBOA 4FTNA 3HAMA 3KEXA 3VBQA 5GZ8A 4R3RA 2AEGA 3C4EA 1PKDA 4MBIA 4O82A 2REIA 1M7QA 5AUTA 4M15A 2FB8A 3OBGA 3CS9A 4GT5A 3SGCA 4C62A 3V5QA 4BZDA 5CU6A 5AUVA 2DYLA 2J6MA 2GNGA 3SHEA 4YZDA 3EIDA 1ZOGA 4PMPA 2BRBA 3WZUA 2XB7A 3GCSA 5DR9A 2WMUA 5AWMA 5H8BA 1E9HA 1UU3A 2GCDA 1DI8A 2ZDTA 3LPBA 3EQIA 2VTNA 4CFWA 2Z60A 4DG0E 3NPCA 1MUOA 2GPHA 4YJRA 2XK3A 2P4IA 2NP8A 3PUFC 4DTKA 3WYXA 1FMKA 4EYMA 2V5QA 4FV0A 2C3JA 2Y4IC 4U9AA 4BJJB 5AV3A 3TCPA 4DEIA 5AP4A 4MCVA 4O1OA 3NYNA 3DNEA 2QC6A 3NUNA 4D55A 1XJDA 4IFGA 2BKKA 3ZXZA 2BMCA 2QOIA 4FTMA 3EYHA 4U79A 3ZFXA 2C5NA 5EI8A 3P1AA 2OJ9A 3RALA 2CGUA 3AMBA 3Q53A 4FNYA 4L43A 1GJOA 5AP1A 4ANLA 1O6LA 5M08A 2YLEA 2Y0AA 2WMQA 3D94A 3CPBA 4LV5A 4PP9A 2O2UA 4FIFA 2UW5A 3FYJX 3TL8A 3D14A 4YMJA 2PZPA 5EOLA 2YWPA 3ETAA 3R0TA 1NVQA 3B8QA 2PVYA 3R1QA 5DI1A 5BNJA 1APME 2Y6OA 2WQNA 1GZOA 3HVCA 1Q8WA 2R9SA 2GS6A 3O96A 3QD3A 4AE9A 5ACKA 1K9AA 4P5QA 1XH9A 2GMXA 1IG1A 2RG6A 5CASA 4FTRA 5L4QA 2P0CA 4FK3A 4AAYA 4N6ZA 1XO2B 4UMPA 1MP8A 1XH5A 3BHVA 3DOGA 3HDMA 1YXTA 3KIOC 2WQOA 4O7YA 4F9BA 2ITOA 2W4JA 3PJ1A 5HU9A 5IUHA 3HV6A 5ETFA 3FPQA 1UU7A 3TJDA 4OAUC 3RZBA 3RI1A 3E8CA 3UG2A 4F7SA 5M53A 2EXCX 3PXYA 2JGZA 3KULB 5E92A 1Q24A 4NUSA 4BI2A 2XS0A 4RA4A 5JT2A 3DBCA 4G3FA 2C3IB 5K3YA 3A60A 4FZ7A 5CX9A 1KOBA 3Q6WA 2ZV9A 2VWWA 1Z9XA 1YXXA 1A06A 2P2HA 3R30A 2C6DA 2DUVA 3R7OA 3SG8A 3GCVA 3HDNA 1OKZA 4AGCA 2ZM1A 1Q61A 1BL6A 4C4GA 1Q4LA 1Q8UA 5FGKA 4EZ3A 2WPAA 5HOAA 5TKDA 2HWPA 4QP4A 5CANA 3R8ZA 4FYNA 1J1BA 3AMAA 2FSMX 3KGAA 3Q52A 4PWNA 5CENA 4ZZOA 4EHVA 5HCXA 4GH2A 3W2SA 4RFZA 2PWLA 3DBQA 3O7LD 5IZFA 5LVOA 1B39A 3A7IA 3AG9A 4JXFA 4M0ZA 4O0TA 3S4QA 4C58A 4D2VA 5M4CA 4C33A 2EU9A 2PVLA 4FKQA 4EHZA 2CNQA 3U9CA 3GCQA 2JKMA 3FLZA 4JBVA 4JG7A 3QGYA 2EWAA 3LFBA 2QONA 5LXMA 1UKHA 4PPCA 4LGHA 5HHWA 3P23A 2ITNA 4FIIA 2UZNA 2PSQA 3EQFA 3JVSA 3PG3A 2I1MA 4OLIA 4J95A 4BCKA 4DINA 4QMWA 2JBOA 4H1JA 4ZY5A 5I9YA 2GHLA 2VTOA 3HV3A 3GXLA 4IB5A 4V01A 2BPMA 3D7ZA 3NW7A 5M51A 3OOMA 3HMMA 4EC8A 4I6LA 3EFJA 4L6QA 4IWQA 4GFOA 5CT0A 1RQQA 3LZBA 4YHFA 5LVMA 2VTRA 3Q96A 5ANGA 4QMVA 3RVGA 4EOIA 3ZMMA 1OPLA 2BROA 2B4SB 1Z5MA 4ZSLA 2PZIA 3F66A 4OT5A 3ODZX 3DAJA 2JKKA 3ML1A 1FGIA 4DC2A 3LFAA 3IOPA 3BGQA 2DWBA 5AADA 2WMWA 3BU3A 4RJ3A 4JG8A 5L6OA 3UQGA 2QG7A 1VLRA 4HZRA 4LUDA 2G2IA 4TWPA 5FBOA 4XP3A 3E64A 3ZS5A 4BHNA 3FKLA 3OCSA 3UZPA 5AAGA 2ITUA 5I9VA 5EW8A 2QNJA 4Q2AA 3VIDA 1CMKE 4FKTA 4QMPA 2BR1A 2WMSA 4EH5A 4DF3A 1V0BA 1H28A 3NNWA 4J96A 2OJJA 1ZZLA 4GYIA 2PULA 4ZJIA 4NW6A 3ITZA 1J3HA 3DXQA 3QX2A 5J8IA 3L8XA 3P4KA 1OL6A 4EOSA 2PVFA 4O4DA 1HCKA 3HV4A 4W9WA 4D2TA 2OJIA 3WIGA 3HMIA 4K77A 4YJUA 5B2LA 2J9MA 2OICA 5D1JA 4AW2A 3BE2A 1QPCA 1ZYDA 3DU8A 3GB2A 4FG7A 4MWIA 5E8SA 2QURA 5EYDA 5AM6A 1DAWA 1JKLA 3LXPA 5ETCA 1NXKA 2IZTA 3DBFA 3ORXA 5K4JA 3UIUA 5J1WA 2PE2A 4D5HA 2XK7A 4DFBA 4JBPA 4TYGA 1NW1A 1H27A 4GIIA 3VBXA 4ITHA 3CPCA 4AF3A 1ZLTA 2GS7A 3TIZA 5JFSA 4RSSA 1F3MC 1CKIA 3I7CA 4XV9A 2WFYA 2C68A 4UALA 3NUUA 5M55A 3BI6A 2O5KA 4EZ5A 5HNIX 3PPJA 3ZZWA 5LOHA 1H1QA 2I0EA 2UW9A 4EJNA 2B9HA 3VW6A 5GHVA 2BCJA 3FC1X 5AR2A 5HTBA 2XVDA 3ACKA 2PPQA 3HAVA 2UZLA 2PY3A 3FMMA 4LI5A 3W16A 3CIKA 4O86A 3AT4A 4FTLA 3D5WA 4I23A 3BKBA 3VQHA 3V51A 3KU2A 2GDOA 3EMGA 3L1SA 4O38A 4E4XA 4CV8A 3EWHA 3QF9A 3PIZA 4USDA 3ZOSA 4M0YA 3S1HA 3QGWA 2PVNA 4L46A 4N57A 3MVMA 5BVNA 1AD5A 5CAQA 4U0IA 1W2FA 2V7AA 3PJ3A 4HYUA 4EOPA 3DLSA 3MH0A 1VYZA 5L8JA 4FKVA 5ETIA 4EOLA 2YDJA 4XOZA 3AQVA 5AR7A 3VQUA 4EJ7A 2R3IA 3MESA 5AA9A 4YR8A 4H3PA 4D4RA 2B54A 4QQ5A 3UTOA 3O50A 3DFCB 3QXPA 5C27A 3EL8A 2CN5A 2VAGA 4QMXA 3UBDA 3DFAA 2PL0A 3COMA 4QP6A 1SMHA 3L9MA 2Z2WA 5HO6A 1PW2A 3KXHA 4O0WA 1PHKA 2ZFYA 4EONA 4PMSA 3ORTA 2JDSA 1OBGA 5EI2A 4C4FA 3GU4A 3BLQA 4PTGA 4W8DA 5TOZA 4DGLC 4U43A 3SD0A 4U3YA 3Q4ZA 4E7WA 3PJ2A 3BU6A 3EQHA 4O81A 5IQBA 3LFCA 3NCGA 4O7TA 2Z7LA 1GAGA