4GK2A

Human epha3 kinase domain in complex with ligand 66
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
265
Chain Sequence
VHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRLKIITNLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords EPH receptor A3
publication title Optimization of Inhibitors of the Tyrosine Kinase EphB4. 2. Cellular Potency Improvement and Binding Mode Validation by X-ray Crystallography.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 265
sequence length 295
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gk2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gk2A01
4DE4A 3PPKA 3EFLA 3QAME 5E8TA 4C35A 1X8BA 2R3MA 4RJ6A 2GNIA 4U40A 1M17A 1OIUA 4UZHA 5AV1A 1ZY4A 3AT4A 4CFMA 2BKKA 4U79A 5J95A 3SDJA 3IG7A 3M1SA 3KMMA 1UU8A 2IVVA 5C4KA 4EYJA 3NWWA 3TNQB 4CT2A 5FDPA 5AWMA 1Z9XA 3R9DA 4USFA 1WBPA 2Z2WA 5CZHA 3LFSA 4D9UA 4NIFB 1O9UA 5BQ0A 1Z57A 3I60A 4QMVA 4LUEA 4RX9A 5L8JA 2GFCA 3MFTA 1J1BA 1NVQA 4BWKA 4NUSA 3BGQA 3BHYA 4AQCA 4OUCA 3I6UA 5C26A 5IQAA 3EL7A 2IZSA 3HMPA 3IW4A 3TV6A 4F6SA 1H8FA 3LXPA 2WFYA 3GQIA 1OBDA 4PPCA 2PSQA 3NEWA 4DHFA 1WBWA 2Y9QA 2WMQA 4D2SA 1M2PA 4PV0A 4RG0A 2JAMA 4X2JA 3GC8A 3QFVA 3VBVA 3ZO1A 1NT2A 3DJ6A 5EQYA 2NNWB 4FKPA 1IASA 3U51A 3GT8A 3FPQA 4CEGA 4I5HA 4ZY6A 2R0UA 3TT0A 4O0UA 4AWIA 3DZOA 2C0TA 4QP1A 4DH8A 1XO2B 2YIWA 2X4FA 3MTFA 3K3JA 3SQQA 3U9CA 3DAKA 3VVHA 3PRIA 4M0ZA 5EQPA 3L9PA 4D0WA 4EOMA 2Y6MA 2WMVA 2XNEA 1MRVA 2DQ7X 2OI4X 3OFMA 4AACA 1ATPE 2UZTA 3LXLA 3HV7A 3WZKA 2BZKB 2VTPA 4LMNA 5CQWA 4YLKA 1EH4A 5DH3A 5FWKK 2A4LA 4ZJJA 4AU8A 4C36A 4YJTA 3VUIA 4G16A 5EOLA 5GIOE 4M13A 2PMNX 1IAHA 2VRXA 3GVUA 4QT1A 2CGUA 2RG6A 5GINE 4CFUA 4DEDA 4RX7A 4DINA 4EH9A 4LOPA 4QTDA 1OB3A 3F2AA 5CU6A 1Q8ZA 2CGVA 3DFAA 4LRMA 5JRQA 4QYEA 5HTCA 1MQ4A 4IWPA 4U43A 2X9FA 3F9NA 5M4IA 1SZMA 3BLHA 2WMRA 1PXLA 2QO7A 3R71A 4FUYA 3VS4A 3ZU7A 3BV3A 3EJ1A 4BBFA 4GKHA 1G5SA 4BCJA 5IQEA 5AUUA 3E8DA 4ZP5A 4B4LA 3PZEA 3QZHA 3DLSA 3K5UA 4BIEA 4ORKA 4G3GA 2QG5A 3L8VA 2IVUA 3C50A 4KKHA 3PXKA 2QURA 4BWPA 4CKJA 1Q61A 4MTAA 4MQ2A 5FRIA 4ZSEA 5TKDA 3VS7A 3MPAA 2WMBA 1BUHA 4XV9A 1PF8A 3QX4A 1UWHA 2C47A 2J7TA 4R3PA 5FP6A 3V04A 1QPEA 4FVPA 2ETRA 3C0GA 2PVLA 4E6AA 4Q5HA 3UO5A 5HX8A 3LE6A 4II5A 1G8AA 3Q60A 4UMUA 4EK6A 5CNNA 4DAWA 3DAJA 4QYHA 4X2NA 1YDRE 3SHEA 2XYNA 3K3IA 1KE5A 3SA0A 4FVRA 4BF2A 4AW1A 1XWSA 5DEYA 2QHMA 2XNGA 3OWLA 3OOGA 5IG1A 3GCVA 1H07A 1KV1A 2CGXA 2OJ9A 3AGLA 3JXWA 1H00A 4A9TA 3ATSA 4ZMEA 3IW8A 1XKKA 3UO4A 4K33A 3ET7A 4KS8A 3BU5A 4PUZA 4HZSA 4NTSA 3QUDA 4AOIA 5I9YA 4WNKA 1PXNA 4XP2A 4FTUA 3VS1A 3RAKA 4CD0A 1YWVA 5BVNA 4FSTA 4FSMA 4OTQA 4F70A 1ZOGA 2YA9A 5CU2A 4OT5A 2VX0A 2Z7QA 1ZWSA 5JQ5A 5JFSA 3DNDA 5EHLA 3DY7A 4CXAA 5AM6A 3FE3A 4WKQA 4JR3A 2J90A 2REIA 5T68A 4L6QA 3GU6A 2X1NA 3UZRA 1YOMA 2RFNA 4QP4A 2WMAA 3BLRA 4OW8A 3U55A 4E4NA 2YM7A 4Y8DA 3VF8A 2BHHA 2FYSA 3C4CA 1XH4A 3CIKA 3COHA 4IBMA 1BI8A 2XKFA 3RCJA 3VBQA 3VHKA 4P5ZA 2ITYA 3QTQA 3RTPA 2C5OA 4PL5A 5M53A 4RVMA 4V01A 2IZUA 5KHXA 1UA2A 3DQWA 5M06A 3KCFA 5FDXA 3NW6A 3O8UA 2GU8A 2RFSA 4Q5EA 4EHZA 4X21A 3OT8A 4DEEA 4EH2A 5AJQA 2PUNA 3BHTA 4R7HA 3JPVA 4GU9A 3VS5A 2IW9A 2CLXA 3SXRA 3WF9A 4YGAA 4EC9A 3EQIA 4FTKA 4JRNA 1H0WA 2OKRA 2RG5A 3FLNC 3ODYX 4FV2A 3OHTA 4L45A 4NWMA 3OW4A 3U4WA 4RLLA 2BIKB 1JAMA 4UXQA 4BGQA 5J9LA 2FB8A 3IGOA 2C0IA 4D9TA 4OTFA 3LFDA 4QPMA 4EZ5A 1OIRA 4L3LA 2J0MB 4AP7A 3BYUA 3VBWA 5IPJA 3POZA 5EDPA 3UYTA 4YR8A 3MH1A 2WTKB 1WMKA 4MXXA 4K6ZA 3HEGA 3R73A 3P79A 2BILB 5KE0A 1Q8YA 1ZY5A 2F7ZE 2GTMA 3IQ7A 3PXRA 4NW5A 3DB6A 3KN6A 4FT5A 5AUYA 4YUQA 5HBJA 5IUGA 3GU8A 3OEFX 1TQPA 5IH5A 2IJMA 2F2UA 3TN8A 2QOIA 4DT8A 2VN9A 3A7IA 4XV3A 4DH3A 3V8WA 2JKMA 1SM2A 3NLBA 1WCCA 2BDFA 2J9MA 4K9YA 4XNEA 4XP0A 5EI6A 5LMAA 3IW6A 4BCOA 2FSTX 4FTQA 1BYGA 5CF6A 2UVZA 1R3CA 4G9CA 2ZB0A 2OO8X 4FIHA 2YWVA 4O7RA 2VNWA 5DR6A 4H39A 5M08A 3QGYA 3NR9A 4TYHA 5CTPA 5I9VA 2CHLA 1YOJA 3KKVA 2XIZA 5IF1A 4NTTA 4Z7GA 1XBBA 4HPTE 2O8YA 2WAJA 3LJ1A 5F94A 3UBDA 4RIYA 5I3OA 3ORLA 3DKFA 2VO3A 4DTKA 3NYNA 3NNWA 2Y4PA 5DR9A 3NVKI 2C1AA 3O0GA 3Q04A 2QR8A 5EM8A 4D2PA 2X8EA 1JQHA 3LCDA 3AC4A 3MVLA 3S2PA 3BEGA 3VIDA 4CV8A 1JSVA 4BTFA 3NVMB 2EU9A 4E5AX 4L53A 3JUHA 3KF4A 1PKGA 1A06A 4GK3A 1R78A 1RQQA 3AC5A 3JYAA 4FKJA 4U9AA 2VUWA 4RFZA 2PUUA 3SW4A 4XOZA 1RE8A 3OMVA 5AR7A 4R77A 2Y4IB 1AQ1A 1H1QA 4PDSA 3W55A 5FBOA 4L8MA 4U5JA 5A46A 3QHWA 4JIAA 4L46A 5TE0A 4D0XA 3NNXA 4ZY5A 5ETCA 5J87A 1UKHA 4JRVA 4N6YA 1L3RE 1H1WA 3R63A 3LW0A 3PXFA 5EI2A 2OSCA 2GQSA 2HZ0A 3UG1A 4ANBA 3R30A 4J95A 3RAHA 3LCKA 4TNBA 5IA5A 2G2HA 3WIKA 1BI7A 4BDJA 4F7JA 4OGRA 1UU3A 2HK5A 2XB7A 1E1XA 2ZV2A 1L8TA 5BUEA 4GVAA 4R78A 4FC0A 2W9ZB 3AG9A 5ANOA 2W4JA 4FF8A 3ZFYA 3Q3BA 1REKA 1OIQA 2W1FA 3BEAA 3HLLA 2JIIA 3MH2A 4IX4A 4IZYA 5GHVA 3O7LB 4PY1A 2QU6A 3P78A 4C4EA 3VO3A 3LMIA 3NYOA 2YZAA 3Q4UA 1Y6BA 4BTKA 4DYMA 3CJFA 3LIJA 1W98A 2C68A 4U97A 4ANLA 4IAAA 2CNUA 5LMKC 5HE2A 2J0LA 5JGAA 4JDJA 1SVHA 4UXLA 1F5QA 4DG2E 4DGOA 5E8UA 4CNHA 1V0OA 4E6CA 4AF3A 2WU6A 2X39A 2JKKA 3FMNA 5GJDA 2J0KA 1BLXA 4ZTNA 5D7AA 3D14A 4EOSA 5DEWA 4UBAA 3OT3A 2GS2A 4YURA 4IJPA 4ZEGA 2X2KA 4J71A 3OW3A 5AR4A 1H4LA 3ORIA 4F6UA 1Q8TA 2W4OA 4O6EA 5AAFA 3RK9A 2QOFA 3QA8A 2BRBA 5ITAA 3K5VA 4N57A 4JR7A 3U54A 4CYIA 4BR3A 2XK3A 4PX6A 4BCMA 3QXOA 4CFNA 2GQRA 5LCKA 4ACGA 3Q6UA 3AC1A 3FLSA 4KWPA 5E8ZA 3NSZA 2UW0A 3G0FA 2JFMA 3G51A 4IFGA 4C37A 5L2WA 5HLWA 2VTAA 1BL6A 4CRLA 4X6RA 4MBIA 3Q6WA 5IA1A 4O7NA 2B9JA 2JBPA 4O6LA 4DEAA 3F5GA 4TY1A 3ZZWA 4FIIA 4APPA 3DKOA 3EKNA 2NRYA 3PIZA 5BYYA 3O7LD 4S2ZA 4QO9A 3G0EA 4XG2A 1OI9A 4D4VA 2P0CA 4UEUA 5FUTA 2WPAA 4O0XA 5M09A 1YW2A 2QOQA 2GDOA 3FLWA 3HA8A 4DFUA 4YJQA 2UZBA 5HGIA 3FC1X 4FSUA 3E3PA 3BRBA 3DTWA 4RIYB 1IEPA 3A61A 2VTTA 4I94A 2ZDUA 4E4LA 5CY3A 3I6WA 5K4JA 4FSYA 4AA0A 3VWAA 4BL1A 3ALNA 3MB6A 3MDYA 4JLCA 3NUPA 4RIXB 5ANGA 5IEXA 4ZJIA 3F3WA 4EK4A 4FG7A 4RX5A 4WG3A 2RSVA 3BHVA 3KVXA 3LFBA 1ZOHA 5AAEA 2QR7A 4DGLC 3CPCA 1VR2A 2R3FA 3L8SA 2HW6A 4Y95A 1Q24A 1XBCA 5M51A 4EBVA 2IW6A 3I81A 3NPCA 3UP2A 3W2OA 2YITA 4PMPA 1KUTA 3F2RA 2OWBA 4RC2A 3TJCA 4BKJA 4BN1A 4JQ8A 4NKSA 2UZVA 2ZM1A 4IVAA 1OL5A 3IONA 5EW3A 3SLSA 4BHZA 5EH0A 4BKYA 1H1RA 3NMUF 5B7VA 4RJ7A 5FEEA 3NUNA 5J8IA 4MWHA 2OIQA 4JVGA 5ANDA 2BZHB 4GU6A 4AZTA 2PVYA 2BROA 2JGZA 2XKCA 1XJDA 5E8SA 3UP7A 1A48A 3ZXTA 2P2IA 3TNHA 4AGDA 3G6GA 3QQJA 2BFYA 3SOCA 2G2IA 2FO0A 3ORKA 3C5IA 3H30A 2VWZA 4FV1A 2DYLA 3AT2A 3FI8A 4E5WA 3R02A 2E9OA 4I92A 4IE9A 2WKMA 2HW7A 3PJCA 5FGKA 3BWFA 5IA3A 2RKUA 5CAVA 3G5DA 4ANOA 4BDDA 1FVVA 4J99A 1UU7A 3OP5A 4M69A 4RVLA 3PIYA 1JKSA 4MAOA 4QMYA 4RZWA 3OD6X 3KULA 3ZLSA 4D4YA 4D2WA 4L9IA 2ACXA 1GZOA 4LRJA 4QYFA 5HIEA 5JK3A 1WBTA 5FP5A 5J5TA 4FE2A 3D94A 2UZEA 4OBQA 3ETAA 3ZXZA 4G34A 4DH1A 2GNGA 4Z55A 3QQFA 3CQUA 3F66A 2YM8A 4PPAA 4HVSA 4RT7A 1O6LA 2QLQA 2XCKA 2R7BA 4C02A 4CKIA 2C5XA 4JT3A 4EOKA 5AAGA 4R8QA 5DT4A 5CSPA 4TTHB 3LFCA 4U42A 1FVTA 1H08A 5AP0A 5EKNA 3PXZA 4L3PA 4LGHA 3B2WA 4DG3E 1IA9A 1F3MC 4YZBA 2IO6A 3OCTA 3CLYA 2AUHA 5DVRA 5FEDA 4PF4A 3FMEA 2E9NA 3PVWA 2UUEA 2VTLA 5HOAA 5HG8A 3P7CA 5AIRA 4W9XA 4QQTA 3TZ7A 4AZEA 4J7BA 3EQPA 4QOXA 3OZ6A 2C6IA 3MWUA 4FTJA 3I1AA 3BZ3A 2OW3A 3IW5A 4GK2A 2XNNA 4LI5A 4DG0E 2FH9A 4OTPA 4R5SA 4DEHA 3ZONA 1J1CA 5M55A 3RZBA 3S00A 4FSWA 2VO0A 3UOHA 2WHBA 4MBJA 3O96A 3CBLA 1GOLA 4PTEA 2BFXA 2R3IA 1FOTA 1OKYA 1H0VA 2UW9A 2YIYA 3Q5ZA 3D4QA 1V0PA 4L42A 2QNJA 4QP9A 5E91A 4BTMA 4D4SA 3TIZA 3I79A 4YSMA 5E8WA 4KUJA 3CY2A 3Q52A 3LCOA 1JVPP 2WZJA 4ZAUA 2FSMX 2VWXA 3UODA 4O96A 3TJDA 3LFFA 3KRWA 4IQ6A 4A7CA 4YP8A 4J97A 2X2LA 2C6EA 5C01A 5HCXA 3MY5A 4BBEA 2HXQA 4CLJA 2YFXA 3QRJA 4HYIA 3HAVA 4ZLZA 1HCLA 4QP8A 5I4NA 4FEXA 2P3GX 4QP6A 4PTCA 4L3JA 3VNTA 1LPUA 3OXTA 3MGYA 2O3PA 4JBVA 4DH7A 5KMJA 1S9JA 3OWJA 2OH4A 3L9LA 2XKDA 2CMWA 3KY2A 4MD9E 4R1YA 5L2QA 2J5EA 3ENMA 3P7AA 3AT3A 4P5QA 3ZSHA 4BCHA 4E1ZA 3ALOA 2H6DA 2HENA 3MBLA 4RIOA 4H05A 4IH8A 4MXOA 4WUNA 4LG4A 2W1IA 4D1SA 1T46A 4M68A 2JDVA 4MF0A 2WO6A 5TF9A 2CJMA 4ZZNA 3EQHA 5BVOA 4ZTHA 3R7EA 2GNHA 4CG9A 4U0IA 3KXXA 3WF7A 3NIEA 3BE2A 3GCUA 4KS7A 4BCGA 2XIKA 3R9OA 4QTEA 2QOOA 4YZNA 2YAKA 4A4LA 2JBOA 4RMZA 2JDSA 3P1AA 3RZFA 3DBCA 3LQ8A 3M11A 4O1OA 3UQFA 5DHJA 1TQMA 1F0QA 3FUPA 4GVJA 3H0ZA 4N70A 4NFNA 5DT0A 2XNPA 2B54A 3BQRA 4G2FA 3VW8A 5HIDA 2W1EA 4LL5A 4FT0A 5CAQA 1FVRA 3PSBA 1PY5A 4XBRA 3EOCA 2ERKA 4OAUC 3QQHA 3ANRA 3BGPA 4C2WA 4CVAA 2X7FA 2ZJWA 2PVMA 4QTBA 2CDZA 1LUFA 3UO6A 4D4RA 4M69B 5CNOA 3TUDA 4XLIA 3W8LA 4FEQA 5BVWA 3R2YA 3KULB 2YJRA 3PPZA 4I6QA 4RWLA 4OT6A 5A54A 2XJ2A 3FI4A 3FMMA 4R1VA 3PFQA 1G8SA 3VS0A 4D1ZA 5AR8A 2A2AA 5E1SA 3BQCA 2OIBA 1ZYCA 4JQ7A 5K0KA 4C4GA 3MVHA 3DK3A 3FKLA 5IQCA 5EYKA 3IO7A 4TWCA 5LWMA 5CSVA 4DBXA 2I1MA 4FL2A 4ASZA 2YM3A 4UYAA 5D11A 2QLUA 4QP3A 5D9HA 4I6HA 4XMOA 1XH7A 1B39A 4K18A 3D5VA 3LMGA 3CSVA 1LP4A 2UZLA 4FKOA 5ANJA 2R3OA 3RK7A 2NP8A 4AT5A 1WFCA 3ZH8A 4MXZA 4NFMA 2CKOA 2CPKE 2AC3A 4LL0A 1KV2A 4RA5A 2LAVA 1Q8WA 4BZDA 1CDKA 4ZSGA 2JDOA 4W4VA 4KIPA 1ZZ2A 4IC8A 4EC8A 3CGFA 3FYJX 4KBCA 4HVDA 2YCFA 3D7ZA 5IQBA 3FL4A 2PVFA 5HTBA 2B9HA 4X6QC 1PXMA 3PWYA 4F9AA 5ICPA 5BUIA 3GOPA 3MIAA 3TWJA 3IW7A 4M66A 5HLNA 5LOHA 4IX5A 5J79A 3JY0A 2JFLA 4MBLA 3RPVA 2HCKA 5IDNA 3AGMA 3QCSA 2O0UA 3SAYA 1AD5A 5C1QB 3CGOA 2WGJA 3DT1A 4IAIA 5J9ZA 4AN3A 5F1ZA 4S32A 2HY0A 3FZ1A 5A4EA 3L9NA 4QYGA 1IG1A 3KRJA 4FSZA 1NA7A 4YPSA 5HX6A 3FV8A 4EH3A 1ERKA 3TXOA 3C4WA 4O7ZA 4G3FA 2HELA 4J52A 1TQIA 1ZARA 2QOBA 4O82A 2RGPA 5KMNA 2G9XA 3AMAA 2PVNA 3CTJA 5K9IA 3VBXA 1WBSA 4QQCA 3PJ8A 4FG8A 2QONA 4TNDA 4F7SA 5H8GA 4R7BA 5I9WA 2R0IA 3A7JA 3DNEA 4I24A 3CQEA 4U80A 3UNJA 3C7QA 3PVUA 3NAXA 3AMYA 4AGUA 4USEA 5C4LA 4MF1A 5GZ8A 3U6HA 3IGGA 4CFVA 3NAYA 4CRSA 4FV6A 3VF9A 4FIJA 1JBPE 1OECA 3MYGA 1E1VA 4TZRA 1REJA 3RP9A 3KQ7A 4BCPA 5BYLA 4QMZA 5I9ZA 4WA9A 5K5XA 4Q9SA 4AFEA 3PY3A 4S30A 3KXZA 4GKIA 5J5SA 3QWJA 4NT4A 4QP7A 5IEVA 4FEVA 1ZLTA 2X7OA 2OH0E 4EH5A 5A4CA 3O17A 3LLAA 5CWZA 3QLFA 5TO8A 2ONLC 3TCPA 4F1TA 4YTIA 3DK7A 3PIXA 3GCSA 5KNJA 5FM3A 3RGFA 4M12A 4AAAA 2XYUA 2I0HA 4IVDA 4YBKA 3TTIA 2PZYA 5AUWA 1UKIA 3M42A 4IB5A 3OUKA 4I93A 5C8KA 4O81A 2X9EA 3AC3A 4IJ9A 3HRCA 3ORTA 4ONAA 4FIFA 1R39A 2IZRA 3HNGA 2WOUA 2O65A 3D5WA 5IEYA 4FGBA 2P2HA 3O8PA 3GP0A 3PJ3A 4K11A 3PWDA 3QD2B 2QD9A 4AG8A 2EUFB 4FKQA 4DGMA 3ZMMA 3U6JA 3AD6A 4FKIA 4BYJA 3IDCA 3ZRLA 3E62A 3DV3A 3I0QA 3PXQA 2OZOA 4BDCA 2OGVA 3DB8A 4K0YA 3OC1A 4IACA 1RW8A 1SVGA 2VGOA 5AA9A 3NS9A 4RPVA 1DS5A 5DN3A 4TN6A 1H1PA 2QI8A 5CF5A 3ZLXA 5AA8A 4FTMA 1PHKA 4XJ0A 1YXTA 1QPCA 4B8MA 4DH5A 2UW7A 1JWHA 2V7OA 4NM5A 5AP4A 2W06A 3CS9A 5HQ0A 3EYGA 3P23A 1PXKA 3W10A 4IX3A 4YPDA 4A9YA 4DGGA 5BX0A 5HORA 4O21A 5FTGA 4I41A 2RL5A 3ACJA 4DLJA 1VZOA 2CKQA 3COKA 3ID6C 4GFOA 4C33A 4C59A 2BZJA 2DUVA 2HAKA 5D10A 2X7GA 3QD0A 4QP2A 4OBPA 3VQHA 3KF7A 1WVWA 3EQBA 3GEQA 3DZQA 3KGAA 4Z9LA 3ZRKA 3TDVA 4YC3A 4Y85A 1GJOA 3NNVA 4R5YA 4CSVA 5HNGA 4QD6A 1YXXA 1KE7A 2C4GA 5AV0A 3WYYA 4P4CA 3LZBA 4BBMA 5LVNA 3TZ8A 4FEUA 2V22A 3GU7A 4LRKA 3ZLYA 4HVIA 4IM3A 4M7IA 3QWKA 1KWPA 3MI9A 4S33A 5FBNC 4EUUA 2BCJA 3D9VA 3CJGA 4R7IA 4PRJA 4AGCA 3TUCA 5J1VA 2ESMA 3Q4TA 2X6EA 3RWPA 4YU2A 4E5BA 3ZUVA 4KRDA 2V62A 4DEIA 5JFXA 4IAKA 4FSRA 4QMWA 3R9HA 3D2IA 4G31A 3U6IA 4UWYA 4XG4A 3QCQA 2GSFA 4DCAA 1OL2A 3OCSA 4JAJA 4C2VA 3EFJA 4OTWA 3PE2A 4FZFB 4U6RA 2C6LA 4JG7A 5AR3A 2YDJA 1AGWA 4WSQA 3NUAA 1OIYA 2XF0A 2X4ZA 2JC6A 4GFGA 4ZSLA 2R3GA 3FLYA 3SC1A 4O7LA 2BIYA 3G2FA 3LFQA 1GIJA 5IMEA 4YO4A 4PMTA 4V0GB 4O0YA 5L2SA 3R8UA 5M4FA 5B2KA 2XMYA 2WIHA 4I5MA 3RI1A 3FY0A 4B8LA 3F7ZA 3NUSA 4FICA 4RZVA 1ZXEA 3NRMA 4YZDA 2YABA 5KHWA 3AC2A 3DA6A 1XH9A 3H9FA 4U3YA 3ROCA 3ORNA 3TZ9A 1QPJA 4X3FC 1JKLA 2NO3A 1Q62A 4YMJA 1DI8A 2WELA 1YI6A 3CPBA 5AP5A 2VTRA 4F9WA 3FHRA 3RPSA 4NKAA 2C1BA 2JIVA 2EXCX 4NM7A 2ITOA 2XZSA 3CD3A 3U8WA 3ATTA 3QTUA 1JSUA 2R7IA 4OR5A 2JITA 4MWIA 5KMMA 4TL0A 4LM5A 3W2SA 3S1HA 2ONLA 2WQBA 3R01A 5HO6A 2WEVA 4ACDA 4ENYA 3UOJA 1LR4A 4F7NA 4JBPA 3HV3A 5EOBA 5BYZA 2PTKA 4QMPA 3O71A 4IWDA 4ANMA 3ANQA 3V6SA 2J2IB 2VTMA 3QQKA 2JIUA 2PE1A 4PMMA 3AQVA 4CZUA 3TL8A 4KBAA 5M56A 2XEYA 3PZHA 1W82A 3VRYA 3ZSIA 2JLDA 4AA4A 1R0PA 4IVBA 3ULIA 2PUIA 3A7HA 2H9VA 4EKLA 4UWBA 3WF8A 5TT7A 3SXSA 3BKBA 4WSYA 4EBWA 2W1DA 1Q97A 3BLQA 2C6MA 3RINA 3LFAA 3QHRA 4IDTA 4UALA 3VULA 5KUPA 3LQ5A 2XRWA 1UVRA 4FSQA 5CEPA 3I7BA 3FQHA 5EG3A 3VUHA 4ALVA 3PTGA 4YHJA 2OIDA 3MW1A 3VW6A 5JSMA 3HVCA 4FZ7A 4JDKA 4QMOA 4TWOA 4KA3A 4MD7E 4DITA 4G6OA 2YEXA 1YWRA 3A4PA 4IB3A 4LYNA 1H01A 2V5QA 5FXSA 3HKOA 2W5AA 3GI3A 4FZ6A 4FV4A 1YRPA 5BUJA 5HI2A 4OAVB 3MV5A 3QZGA 1OMWA 4LGGA 4HGSA 2XK7A 4ZSAA 4E4MA 5IA2A 3RPOA 5ACBC 3SKCA 4CFXA 3VUMA 3VC4A 4M8TA 4TRLA 4YTFA 3MPTA 2LGCA 1V0BA 5J1WA 4JOAA 1OKZA 1KE6A 5BVFA 2W1ZA 2Y8OA 2VO7A 3PUPA 2V7AA 4O7TA 3FPMA 4RIXA 4LV8A 1Q3WA 2IWIA 2XM9A 3I5NA 4EHVA 4I5CA 2R2PA 4ANQA 4EORA 3SGCA 5AUXA 4J96A 3MY1A 2I0VA 4AGWA 5HU9A 5AX3A 3F3VA 3TKHA 4A06A 3QALE 2XK9A 4HNIA 5JQ8A 2RF9A 4O0TA 3JS2A 3P7BA 3P4KA 4ZLOA 5IA0A 5L2IA 3RPRA 2ZM3A 5HVKA 3JVRA 4FK6A 1ZYLA 3R8MA 1UNHA 4DEGA 3HV5A 5HTIA 4JL9A 3QC9A 3O8TA 4PMSA 1OUYA 5L8LA 2YM4A 4RA4A 4BDIA 2ZYBA 4H36A 4EL9A 3BYVA 3UNZA 2PZIA 4YJVA 3UMWA 4EQCA 2WMXA 1CKPA 4MCVA 4YZMA 3PY0A 5EK7A 1H28A 3VS3A 5HD4A 2C0OA 5IMXA 3PSCA 3EYHA 4QMXA 1B38A 3R04A 4JXFA 4BC6A 3F88A 5AADA 4U41A 1HOWA 2BRGA 4YC8A 5ANIA 5GJFA 4S31A 4MNEA 3DXPA 5CT0A 2XNMA 3L8XA 4D5KA 1DAYA 1NXKA 3TI1A 4CFFA 5B2LA 5IA4A 4O86A 3QTXA 3ZC5A 3GUBA 4FKVA 4JJRA 2BRHA 2UW8A 4YHFA 3UVQA 3C5UA 1O6YA 3ZEPA 3F82A 5HO8A 2ZB1A 3FMLA 5KZIA 3ZFXA 4FKGA 3ZFMA 2ETKA 3HYHA 4GL9A 5FEQA 5CENA 4GG7A 2ERZE 3FI2A 3H9RA 4FT9A 4QNAA 5HNBA 3SXFA 2QG7A 1ZMUA 4X3FA 4DFLA 2A1AB 2AYPA 3H9OA 3K2LA 5DOSA 4D55A 3CTHA 4EOJA 2PZ5A 2GQGA 4XEYA 4C8BA 1XQZA 3Q5IA 4WT6A 2G15A 2G1TA 4CKRA 1URCA 1JKKA 1U5RA 2QKWB 3QKKA 4F0FA 4GH2A 4FV0A 2PVJA 2UVYA 3GFWA 5CAUA 3UVPA 2BDWA 5CS6A 2YAAA 1KE9A 1VEBA 2VAGA 2J50A 2PHKA 3E5AA 3E88A 3FHIA 4KABA 2B55A 3NZ0A 4KKEA 4OTDA 1ZYDA 3A62A 4QTCA 1TVOA 4GS6A 2YN8A 4O84A 2WD1A 3BGZA 4XBUA 2W1CA 3QRIA 4PTGA 3IOPA 2CSNA 1NVSA 1J3HA 4FEWA 4JDIA 2YJSA 4AX8A 2OF2A 2PY3A 5L3AA 1YXUA 2XIXA 2Z7SA 2QO9A 3HDNA 2WOTA 4RVKA 4U81A 3UOKA 3MJ1A 2VWVA 4LOQA 3UTOA 3R0TA 3ZBXA 4EH4A 4F64A 3DPKA 4O7YA 4O7WA 5AP7A 3KREA 4ITHA 4RSSA 3EHAA 2YDKA 5BVDA 4HJOA 5CF8A 1GZ8A 3WE8A 4C38A 4G3EA 4EQMA 3CQWA 4DFYA 5E9EA 4N4SA 1OVEA 2Z8CA 3G9LX 3N4VA 4ASXA 2QKRA 3UC4A 1WZYA 1UV5A 3QQLA 4MK0A 1LEZA 3BX5A 2VTHA 1Q4LA 4EOLA 5DR2A 4O0VA 1CSNA 4ERKA 2E9PA 2EB3A 2UZNA 4PDYA 1FGKA 3NUUA 2ITNA 3NUYA 2BR1A 4Q2AA 3D83A 4CG8A 4RFYA 3BYSA 1CMKE 5FQDC 4WOVA 3V01A 4U45A 4ACMA 4IAYA 5J7BA 3DOGA 3DBDA 2VU3A 3E92A 5AUVA 1OKWA 2A0CX 3EQCA 4CQGA 4D2RA 4JI9A 4FSNA 2BTSA 5FD2A 4LOOA 4ANNA 3BHUA 3GB2A 3OXZA 3RWQA 3QQGA 3PXYA 1A9UA 3I4BA 1PXIA 4KSPA 1WVXA 4EWQA 2WTIA 1MP8A 4ZZOA 1WVYA 5E7RA 4I23A 3MY0A 4HZRA 5HESA 3ZC6A 4IAFA 2WIPA 5CX9A 4UV0A 4EI4A 2CKPA 3W2RA 3KXMA 4XX9A 3ORPA 4NEUA 2BALA 5JZNA 5CI6A 4TKSA 3AMBA 2DS1A 3MPMA 1UWJA 5EDQA 2I7QA 3O51A 3R1SA 3LM5A 4GG5A 3FY2A 4KNBA 4MEDA 4V05A 3HGKA 4YHTA 4IZ5A 3VBTA 4MNEB 3N4TA 2GTNA 3QRTA 3FC2A 4DLIA 1K9AA 3SW7A 3QLGA 4JS8A 2HZIA 1U59A 2PE0A 2R3JA 2V55A 4HYSA 3COMA 3C4FA 4U44A 5E8YA 3ORZA 5EHOA 5IU2A 1M14A 3QC4A 4EYMA 2BAQA 2PVHA 3AOXA 4TYIA 2OU7A 1ZYSA 5HE3A 3ZEWA 4EOIA 3E87A 5AP6A 2C6KA 3BV2A 4FTAA 3KL8A 2J0JA 3ZOSA 3V8SA 3CC6A 3EQFA 2B7AA 4KSQA 5ETIA 3F2NA 3MFSA 3TTJA 4UYNA 1PRYA 4X3FB 2SRCA 3BPRA 3DXNA 2ZV7A 4RWJA 3RBWA 5HZNA 4F6WA 2UW3A 3HX4A 2BKZA 3SG8A 3MSSA 3QZIA 4MHAA 3V51A 1OKVA 5E1EA 4KIKA 3LHJA 2RFDA 4X2KA 5DIAA 5DRDA 5A3XA 5HBEA 5CZIA 5BMMA 5LXMA 4NCTC 3MJ2A 2IW8A 3RCDA 3THBA 5LMKA 5HE1A 1P14A 2C3IB 2GMXA 2IZTA 2WB8A 3KMWA 5TOZA 5B2MA 2XVDA 3CXWA 4GMYA 5KZ0A 4E8AA 4F09A 3KXNA 4OTHA 3TDWA 3MESA 5DBXA 3RM6A 4BB4A 3Q9XA 4XV1A 3WZEA 3EN6A 3MVMA 4QMSA 2XJ0A 4YNOA 2XRUA 1PMEA 4DFXE 3AD5A 1ZMWA 4FL3A 4HCUA 2WTWA 1V1KA 5DA3A 2FSLX 5HG5A 2R64A 1OUKA 3LPBA 4BCQA 2QOCA 4HGEA 4C3RA 1VJYA 1R0EA 2BAJA 4TXCA 5HICA 4AT3A 4ZLYA 5DMZA 4RJ3A 4RQVA 4DGNA 3VN9A 3EZRA 1Q41A 1MQBA 5KBQA 5KMKA 2X0GA 3QA0A 3UIMA 2OJFE 3N9XA 5CVFA 4M3QA 5M4UA 3S3IA 5HEZA 4GJ3A 3EL8A 3RNYA 4YTHA 3NX8A 3BU6A 4D28A 2C3KA 1PXJA 4L00A 2F4JA 2YIXA 1G3NA 2YM5A 3R1NA 4OTIA 4I21A 1UNGA 2R3PA 1URWA 4A4XA 5AFVA 1BX6A 1Y6AA 2ITVA 5I3RA 1J7UA 3CP9A 3SD0A 2BDJA 5ETAA 4GJ2A 5KKRB 3OS3A 3HL7A 4FIEA 4O7VA 5IKWA 1MUOA 2R4BA 1APME 3PA4A 3Q2MA 4HOKA 3QZFA 4MNFA 5C8MA 4D1XA 3R7IA 3UIXA 5M4CA 4C7TA 2Y0AA 4G6NA 4DA5A 1YQJA 5KX8A 4RFMA 5HVYA 3TG1A 1RJBA 3H4JA 3A99A 5D41A 2IPXA 2BRNA 4NL0A 1O6KA 5AUTA 3A8XA 3HMNA 2C6TA 3FXWA 5BNJA 2WQEA 3KRLA 4FZAB 4WNMA 4EJ7A 2VTQA 3PJ1A 2J51A 4FOBA 4J98A 2HY81 2R3LA 2WTDA 4RVTA 4W4YA 4E93A 3OBJA 4ASDA 3EZVA 1FBNA 3KRRA 4GRBA 4WBBB 1Q5KA 1OITA 3F5XA 2Z7RA 3GQLA 3T3VA 3TIYA 4FKLA 4O0WA 3WE4A 2FUMA 4HNFA 1PKDA 3V5QA 4AN9A 3WOWA 4NH1A 4N6ZA 3ORMA 3COIA 1OPKA 3VBYA 4G3CA 4XG6A 4I22A 1CM8A 2XKEA 3V5LA 3LKMA 4YLJA 2VTIA 2WMUA 3U87A 2YLFA 3CKXA 2HZ4A 3H10A 2BRMA 3E8NA 4BVUA 2QVSE 2W0JA 3F61A 4I3ZA 4DEBA 1Q3DA 5F9EA 4F99A 3BE9A 5HHWA 4RC4A 4MYGA 2O2UA 2ITPA 2W4KA 2ZM4A 3DU8A 1FQ1B 3PLAE 4AZWA 4QMNA 2YIRA 3S95A 5IQDA 4GYGA 4MXYA 4YJOA 3ZS5A 4FI1A 4GIIA 4RJ4A 3QKLA 1Y8GA 3DGKA 4O0SA 4ACHA 1YOLA 4MKCA 2B9IA 3FQSA 4HYUA 5AV2A 5AP2A 3MS9A 3PP1A 4UY9A 5BVEA 2QU5A 2JKOA 3RK5A 4A4OA 3QTIA 1W8CA 3EN9A 3GU5A 4Y73A 3KA0A 3R9NA 4GCJA 4C57A 3W33A 4YSJA 4KIKB 4L67A 2R3QA 3R7YA 3Q4CA 3RNIA 3UQCA 2OXDA 4B0GA 3TNPC 3ODZX 2ZVAA 3OXIA 3GU4A 4BCIA 4KAOA 4F7LA 3R6XA 3A7FA 2BMCA 3B2TA 4I0RA 5IZFA 2Q83A 5JFWA 1FMKA 1KOAA 5HG7A 4USDA 1YKRA 4TW9A 4I5PA 4Y5QA 2Q0BA 3HZTA 3D5UA 4IFCA 3FMDA 5AV4A 1OM1A 1VYWA 4L52A 4CGAA 5AM7A 5T3QA 3GC9A 1WBNA 2YISA 3QYWA 4O2ZA 4RBLA 4QNYA 4CCBA 3HMOA 1BKXA 4WNPA 4F65A 5JGBA 3G6HA 2X8IA 4IIRA 5CYIA 2PUPA 2O63A 4XCUA 5LQFA 3IK3A 1KE8A 1M7QA 4Z3VA 4FNWA 4BRXA 2XIYA 4JQEA 5D1JA 5M57A 2OK1A 2XEZA 2YLEA 2HZNA 3O2MA 4N0SA 4DFZE 5CANA 2A19B 3JY9A 5DT3A 2XA4A 5K5NA 1P4FA 2VZ6A 3QF9A 4WIHA 4G5PA 3D2KA 5CAPA 3OUNB 4CCUA 3EMGA 4EOOA 1ZMVA 3C1XA 4YC6A 4PNKA 3TUBA 2R3HA 4LQMA 4Y83A 5E8XA 2OXYA 3UZPA 5LVOA 3I0OA 4Q9ZA 3E7OA 4XG7A 3ZRMA 2OICA 3ZSGA 3UQGA 1PW2A 4O1PA 1KOBA 3QTZA 4BDKA 4BGGA 2RIOA 1JNKA 4RX8A 5H3QA 5IH6A 3CR0A 4X0MA 4YLLA 3ROYA 5KMLA 3F69A 2PULA 1OGUA 3ZO4A 4GEOA 4L7SA 2EWAA 5AP3A 4WRSA 5JZJA 4W9WA 4YZCA 5KO1A 3VUKA 3ELJA 3Q2JA 4UB7A 1PMUA 2BUJA 2C6DA 3MIYA 3TNIA 4K77A 1J91A 3FJQE 3MH0A 3EQRA 1CKJA 2VWIA 5AIKA 4UN0C 4F4PA 4M67A 5FM2A 4C3FA 3DBEA 2F9GA 4FL1A 4RJ5A 4ZY4A 5IQGA 2RFEA 3QTSA 4O2PA 4RC3A 1W0XC 4BCKA 5CAOA 4BY9E 3QTWA 3PJ2A 3QD4A 5GZAA 4FNXA 5KKRC 4V0GA 2YWPA 4YJSA 5CXZA 4HW7A 3PSDA 4FA2A 1XR1A 4IWQA 3UYSA 2JDTA 4G3DA 2VTSA 4FYNA 4IB0A 4ITIA 4O83A 4QQ5A 3OTUA 4FV5A 1WAKA 1XBAA 3FEGA 4EHEA 5E92A 4BDFA 3R8PA 4NJDA 3KB7A 4HGTA 2BTRA 4H3BA 4ALUA 4EH6A 4OLIA 3S0OA 3FMKA 5LARA 5L6PA 3D5XA 3C4EA 3NDMA 5F4NA 1P5EA 2X8DA 4GT5A 3ACKA 5A4LA 2CN5A 4C4HA 4XRLA 4BHNA 4ZK5A 3Q96A 2JAVA 3QX2A 5CVHA 3E63A 3VJNA 4MH7A 2XH5A 4PDOA 1QPDA 4WG5A 5JH6A 5HBHA 2PPQA 3FYKX 3C4ZA 4NZWB 1Q99A 2W05A 3LQ3A 1JSTA 5EM7A 3UDBA 5DYJA 3BI6A 3OWKA 4YJUA 3EN5A 4O22A 3VHEA 5BMSA 4EJNA 5FXQA 5A6OA 3GBZA 3F3UA 4CLIA 4DF3A 2YZLA 5CSHA 3OCGA 4HCTA 1J7LA 4D58A 5I9UA 4KD1A 3VAPA 3QUEA 1R1WA 2J5FA 2R3NA 3KC3A 4P7EA 4KINA 2VO6A 3N51A 3TEIA 1XH5A 3V6RA 4I1ZA 4H3QA 5EW8A 3F5UA 1IAJA 4BI0A 4EHGA 4DTBA 3LFEA 3SOAA 2EVAA 4C58A 5ACKA 1SVEA 4HGLA 3EH9A 1MRYA 5BVKA 4C4FA 5CALA 3WILA 3W32A 5CSXA 3QCXA 1OL7A 3QUPA 1W7HA 4FK3A 4B99A 4XG9A 3GC0A 2WQOA 2XS0A 3PG3A 2GS7A 2Y6OA 5E4HA 2OF4A 5EDRA 4DCEA 3KXGA 5HNIX 4JNWA 4Y72A 4FKRA 4A07A 4L43A 5DWRA 3QYZA 5EFQA 3ZO3A 2WXVA 3LCSA 4AE6A 4W4WA 5K3YA 4UMTA 3W16A 2W5HA 3F6XA 4QMTA 4WUAA 4ZTSA 4BFMA 2KTYA 2WNTA 1WBOA 5DFPA 4AOTA 1M7NA 3ENHA 1PMNA 3GOKA 3O23A 4FV7A 3FLZA 4UZDA 3IKAA 4FTRA 2QOHA 1U54A 1DAWA 2WTCA 3FXZA 3PY1A 5I5ZA 3VS2A 4H3PA 1ZOEA 3HP5A 3H0YA 5DE2A 4KIQA 3FLQA 3F3TA 3RAWA 1Z5MA 4ZTMA 2B4SB 5ETFA 3QL8A 4AUAA 4ENXA 3FMHA 3P86A 3R7GA 3GCQA 3FWQA 5CU3A 4E4XA 4E6DA 3LVPA 4O0RA 3UPZA 3CTQA 3G90X 1IRKA 4B9DA 2CCHA 3ZUTA 4DT9A 2PL0A 2XNBA 3V5TA 3ZCLA 3EWHA 4BDGA 2B1PA 4FNYA 2X6DA 3E8CA 4G17A 1YHSA 3G9NA 4UX9A 2R9SA 3L9MA 2O5KA 3C13A 4E6QA 4TPTA 1SMHA 4J53A 5DGZA 3HRFA 3QKMA 5HLPA 3ORXA 3PP0A 2I6LA 3DK6A 5LVPA 2ZV8A 4AA5A 5IISA 2E9UA 3KU2A 4CV9A 3DKGA 4GT4A 4GSBA 3TM0A 2OJJA 5JRSA 5GZ9A 3RJCA 4R3CA 2FA2A 3P0MA 2CNVA 4PP7A 3JR1A 3QBNA 4UMRA 3MB7A 4P90A 2Z7LA 2I0YA 3WZJA 3NYVA 3LMHA 3HUCA 3DBFA 4I0TA 2EXMA 2PZRA 1YVJA 4F0IA 3Q53A 4GW8A 5DI1A 4ASEA 3F3ZA 3R8ZA 5CQUA 5L4QA 1PJKA 2ITXA 3PRFA 2FGIA 4PL3A 5HIBA 2XUUA 3QQUA 3LM0A 3KCKA 3A8WA 2HWPA 2G01A 2ZAZA 5CU4A 4ZTQA 1B6CB 2C6OA 2C5YA 2HWOA 4I4FA 1JKTA 2YHVA 4ZS0A 5KBRA 5CF4A 3DKCA 2BHEA 3BIZA 4IC7A 3MH3A 3S4QA 3IS5A 1XH6A 3HA6A 5A4QA 2PVRA 3W2QA 4KB8A 3D15A 4W8EA 3WF5A 3PDTA 2CN8A 4CFWA 5A14A 3Q9ZA 1J7IA 1K2PA 3R2BA 3C9WA 2ZMDA 2XCHA 1SNXA 5ANKA 2YCQA 4EK3A 3V5JA 2Q0NA 4AE9A 4R6VA 2R3RA 1KSWA 1YI3A 5C8NA 4BIBA 3V3VA 4ZTLA 3I7CA 2VWBA 1CKIA 4A9SA 3ULZA 5CASA 1W83A 2YM6A 2W96B 1I09A 5KMIA 3R8LA 5IDPA 1P4OA 4NK9A 5EYCA 3MFUA 1HCKA 3UG2A 3IOKA 4FX3A 4EK5A 3R21A 4ZIMA 4BDAA 3HUBA 1CTPE 4QPSA 4YJPA 4EZ3A 4JG8A 1Y57A 2ITWA 3N4UA 4ZMFA 4Y5HA 4QMUA 2WTJA 3LOKA 2GNLA 5IUIA 5DG5A 1YI4A 2J0IA 1H1SA 5EYMA 2R5TA 3FDNA 2X2MA 4BICA 3IPHA 4FKWA 2W5BA 3R1QA 4GIHA 1JPAA 2NRUA 3GFEA 3NUXA 2OXXA 3F5PA 4EK8A 2QQ7A 5A4TA 1M52A 1U54B 2GHLA 4IXPA 2EXEA 4WD5A 4WO5A 3A4OX 2WMSA 2ITUA 3A2CA 3GXLA 3OOMA 4KIOA 4F08A 3PYYA 3RALA 1XH8A 4YZ9A 3EN4A 4CTCA 3AC8A 3FAAA 2P33A 3FMJA 3PPJA 4H1JA 2GNJA 2H96A 2HYYA 3U4UA 1E9HA 3HMMA 4IADA 2JD5A 4OTRA 4BIDA 3E3BX 3ZZEA 3GNIB 5D7VA 1BMKA 4AN2A 2ZDTA 4U7ZA 3PE1A 3ZUUA 5HO7A 2V0DA 4TT7A 4JG6A 4C4JA 1U46A 1OPJA 3E64A 4FBXA 4GFMA 4QTAA 2W99B 3HRBA 3WI6A 2H34A 2J4ZA 2UZUE 3GC7A 1QCFA 3IECA 4A9RA 4HPUE 4UMPA 4RJ8A 4ID7A 3GENA 4IANA 5FLFA 4CTBA 1S9IA 2O64A 4FTCA 5AR2A 2HXLA 3DFCB 4EQUA 2UVXA 4ZTRA 3EB0A 3K54A 2DWBA 5DPVA 2P4IA 4M97A 3EIDA 3FZRA 4BDHA 1QMZA 4IM2A 2Y7JA 2VTNA 4FIGA 5EKOA 3TV4A 2UW6A 3ZHPC 4FR4A 4PQNA 4XG8A 3KEXA 1TKIA 4APCA 5T6KA 4NSTA 5IH4A 5AP1A 3NIZA 5CSWA 2UZOA 2UZWE 4AW0A 5JFVA 4IB1A 3E7VA 5JT2A 5GIPE 4LV5A 4BYIA 3L8PA 1I44A 5LVMA 2OLCA 2PU8A 4JBOA 2VX3A 3R22A 5H9BA 3R7OA 2I40A 3CD8A 3DBQA 4R3RA 4BWXA 4JX7A 4C62A 4IAZA 1FPUA 3OCBA 5JEBA 3POOA 4AFJA 4XH6A 3LJ0A 3LXKA 4D2TA 3VQUA 3VRZA 4U8ZA 2WU7A 2YACA 4BDEA 3NNUA 3CEKA 2ITZA 5KMOA 2VWUA 4XV2A 4O7SA 2WQNA 4FOCA 3DJ7A 4HCVA 4HYHA 5F20A 2VTOA 3RAIA 5B0XA 3V5WA 2YDIA 4AW2A 5K4IA 3NCGA 2C3JA 3Q9WA 4XS2A 2XNOA 3ZBFA 3R28A 4S34A 2UW4A 2YCSA 5C9CA 3UOLA 4YTCA 4C61A 3H3CA 3EN7A 3UZTA 3VUTA 3MVJA 3P9JA 3KXHA 3C4XA 4IDVA 3WZDA 4Z7HA 2C69A 2OZAA 3BYOA 2W7XA 3PG1A 1GZNA 2IVTA 2W9FB 3FZOA 3LFNA 1OBGA 1YHWA 5JKGA 1STCE 2B53A 5JGDA 5I9XA 2FVDA 3QTRA 4FZDB 4IEBA 2C3LA 4EWHA 3TKUA 3LXNA 4ZZMA 3WZUA 4ERWA 5J9YA 1PXOA 3R1YA 3AXWA 5GNKA 3REPA 4D2VA 4FT3A 1YDSE 5F95A 5L8KA 2PE2A 1YXSA 3PA5A 1UU9A 3KK8A 3FZTA 5HVJA 3PLSA 4G1WA 2W17A 3GCPA 3OBGA 2QOLA 1PXPA 1Y91A 4J8MA 4W4XA 2NPQA 5CT7A 4BI1A 2C30A 4PDPA 3BCEA 3HP2A 2VGPA 4EOQA 5LCJA 4EH7A 5FXRA 4FODA 2GCDA 2ZMCA 5HU3A 3VS6A 4TWPA 2JKQA 3WIGA 4X7QA 4AXAA 4LGDA 2GS6A 2PMIA 1SNUA 2F2CB 3MA3A 1GAGA 4DC2A 4ZXTA 4WHZA 4DBNA 3DDPA 3DTCA 4WNOA 4IZAA 3DLZA 1T45A 3D7TA 2YERA 4RLKA 5HCZA 5ANEA 4XHKB 5HG9A 3HECA 4NYEA 3RVGA 2AC5A 3DAEA 5HE0A 2VWYA 4G6LA 3KRXA 5DLSA 2WQMA 4V04A 3DQXA 4F9YA 1XHAA 2F7EE 3UNKA 2PMOX 4C3PA 3ZDIA 5A6NA 4TYHB 2OBJA 4QMMA 4BZOA 2VTJA 3T9IA 3CE3A 5LJJA 3EQDA 3FL5A 3OEZA 4IHPA 1GNGA 3A60A 4QPAA 4QYYA 5GJGA 2QC6A 1QL6A 3EKKA 4IZ7A 3E93A 3ERKA 4F1MA 3HAMA 3FSKA 3F7WA 1YXVA 4DTAA 3FI3A 3R7UA 4RGJA 2QODA 1YWNA 3GGFA 3WBLA 2XK8A 1GZKA 2B0QA 4L44A 4IMYA 2CNQA 3BELA 3VJOA 3NCZA 4L7FA 3Q9YA 3RM7A 3IDPA 3NGAA 4IW0A 4YBJA 2C5VA 4L01A 1IR3A 3HV4A 4CT1A 4MX9A 4QQJA 5CI7A 3A7GA 3ZTXA 2JDRA 2OJGA 5TR6A 5CEOA 4C34A 3RKBA 3FXXA 2BPMA 3RHKA 4EH8A 4U3ZA 3KK9A 4ZSJA 4EONA 4X3JA 5EM6A 4E7WA 2HOGA 4UMQA 3BBWA 4IWOA 3WARA 2CLQA 4LFIA 4CQEA 3QD3A 1FGIA 4AZFA 3SVVA 1NY3A 2A27A 2Z60A 4QRCA 3NW7A 4B7TA 4EZ7A 3NYXA 4NU1A 5H2UA 2UZDA 1Q8UA 3P5KA 4E20A 2GFSA 3O50A 2QCSA 3C0HA 4W8DA 5AUZA 4XG3A 5G1XA 4FV9A 4AT4A 2P55A 3M2WA 3PA3A 4P2KA 4Z16A 2KULA 1OL1A 2PMLX 3EFWA 3VUDA 4ACCA 4YNEA 4B6LA 2XIRA 3QRKA 4BGHA 2BVAA 4CMUA 1IA8A 4MQ1A 2OFVA 5E8VA 3IDBA 4ANSA 4F63A 2F57A 2B9FA 4JX3A 4G9RA 5IQFA 4IVCA 4CYJA 4WG4A 4CMTA 4YJRA 2PWLA 2VWWA 2WTVA 1SYKA 3EFKA 2QHNA 5H8EA 3R83A 5J7HA 3QCYA 4E73A 4QMQA 4HVGA 5AEPA 2IVSA 4PNIA 3CKWA 1MRUA 2OZAB 4DN5A 4JBQA 3LLTA 5D12A 3ZYAA 5CU0A 5EW9A 3FZSA 5IQHA 2ETMA 4I0SA 3BU3A 2XBAA 1ZYJA 3EQGA 4FTIA 5HKMA 3ZO2A 5LVLA 3T3UA 4YJNA 5EHYA 2ITTA 4MD8E 5G6VA 4X2GA 3KFAA 2B52A 2PZPA 5CXHA 5DRBA 3C51A 3T8OA 3TZMA 4PL4A 4PPBA 5E90A 4EKKA 5K0XA 3WYXA 2QOKA 5H8BA 2E2BA 2VV9A 4I6FA 4LMUA 4GV1A 2X81A 4XUFA 3CCNA 4NM0A 4FYOA 4F0GA 3U9NA 1ZRZA 4M14A 1GY3A 4MVFA 4H58A 4TYEA 5EM5A 5AX9A 3UIUA 4PWNA 4K2RA 4CZYB 2W1GA 2VX1A 3PVGA 1P2AA 1DM2A 2BAKA 1Y8YA 4NJ3A 4RIWA 3W2PA 2OJIA 3D7TB 3B8RA 3UMXA 4TYGA 2CKEA 2PYWA 2GHGA 5EI8A 5M07A 3RMFA 3NW5A 1M2QA 3UPXA 4C0TA 3OF0A 4NM3A 3HDMA 5CEKA 4RWIA 3MFRA 2WMTA 4EEVA 2J6MA 4FG9A 4OBOA 4ZOGA 2ITQA 2F7XE 3CY3A 3DS6A 2PK9A 3BWJA 3TNWA 5M44A 4DFBA 2IG7A 2XM8A 1NW1A 4L68A 3OG7A 2W1HA 1H24A 1K3AA 1M2RA 3JVSA 4FUXA 3FBVA 3SRVA 1ZZLA 2BZIB 4AW5A 3RPYA 3QXPA 2XK4A 3W18A 4BCFA 2HIWA 2VD5A 1JLUE 3OROA 4GUBA 4MXAA 2IN6A 1NVRA 4FNZA 4QMLA 2G2FA 1H26A 3OTVA 3DCVA 3P08A 3B8QA 4ZJVA 4CMOA 4IX6A 3VUGA 2CCIA 2E9VA 5CVGA 1U4DA 5L6WL 4J8NA 3FKOA 5EQEA 4JAIA 4YO6A 4CZTA 4OTGA 2XK6A 3C0IA 3MTLA 4FVQA 4FKUA 4TWNA 4NIFA 4GT3A 1PYXA 2F49A 4E26A 2H8HA 3DJ5A 4F9BA 1H25A 5KCVA 3ITZA 3FSFA 1OPLA 4Y46A 1PYEA 4FTNA 2GPHA 3QRUA 2OFUA 3KVWA 3MA6A 4EUTA 1UNLA 5DNRA 3LAUA 4RWKA 2ZV9A 5FTOA 1LEWA 4XRJA 5AMNA 5FG8A 3LJ2A 3L1SA 2OG8A 4O27B 4D5HA 3W1FA 5L6OA 3W8QA 4AZVA 5A9UA 4FGRA 2GNFA 3D0EA 3V8TA 3HV6A 3II5A 3MN3A 1FINA 2I0EA 3SX9A 5CEMA 1DI9A 2FSOX 4FT7A 3UVRA 4FV8A 2QO2A 4O91A 4XP3A 3SV0A 1VYZA 1PMVA 5CEIA 4WBOA 1ZAOA 5C27A 3KN5A 4G5JA 4XLVA 4AS0A 3TKIA 4FV3A 1RDQE 4H1MA 4KRCA 5JMSA 4C4IA 4RRVA 2CGWA 4MXCA 4X2FA 4FMQA 4EOPA 2WMWA 3ZLWA 2WTKC 1WBVA 2PVKA 3OY3A 3ZM4A 2EB2A 4GK4A 3HMIA 5CLPA 4M84A 4GUEA 5IUHA 5CEQA 2YCRA 5HD7A 4A9UA 4BZNA 3I5ZA 4AOJA 3E8EA 4WRGA 1FMOE 3Q32A 2GHMA 4NCTA 5FTQA 1ND4A 3R00A 2UV2A 4I6BA 1OZ1A 4J1RA 4NW6A 4TYJA 4XOYA 2R3KA 3FZPA 3KMUA 4M0YA 5HCYA 3WF6A 3G15A 5L2TA 3W2CA 2JEDA 4BI2A 3SG9A 4F1OA 5BPYA 3G33A 1JOWB 4ITJA 3ZDUA 2Z02A 4M15A 5IQIA 3ZM9A 4I4EA 4KKGA 1OL6A 3TACA 4RQKA 3BYMA 3FKNA 3LCTA 4UWCA 2WEIA 3V5PA 4ARKA 3OVVA 4HVHA 1YDTE 4PP9A 4K8AA 3R8VA 3UC3A 4KBKA 3TV7A 4BDBA 3DDQA 4K1BA 4RIWB 4BTJA 1GIIA 2YIQA 3OY1A 4FKTA 2XBJA 3DXQA 4FTTA 3QU0A 4E3CA 2XJ1A 3BHHA 3R7VA 2ZOQA 5LMBA 5EYDA 3QGWA 5AR5A 5JN2A 4O38A 2XP2A 5LWNA 4JIKA 3Q4ZA 1YHVA 4I20A 5AV3A 1U5QA 3UIBA 4BCNA 3BBTB 1H27A 1BL7A 4JDHA 3T9TA 3FQEA 4IM0A 4DFNA 1GIHA 4LUDA 4BKZA 4F9CA 5C03A 4FTOA 3UJGA 4FTLA 4FKSA 4XYFA 2UW5A 3SRVB 3UE4A 3R9RA 3OWPA 1W84A 4ZS4A 2C5NA 2VNYA 2Y4IC 4ALWA 4GYIA 3UGCA 3RHXA 4AZSA 5I0BA 3AD4A 3PVBA
chains in the Genus database with same CATH superfamily
4DE4A 3PPKA 3EFLA 3QAME 5E8TA 4C35A 1X8BA 2R3MA 4RJ6A 2GNIA 4U40A 1M17A 1OIUA 4UZHA 5AV1A 1ZY4A 3AT4A 4CFMA 2BKKA 4U79A 5J95A 3SDJA 3IG7A 3M1SA 3KMMA 1UU8A 2IVVA 5C4KA 4EYJA 3NWWA 3TNQB 4CT2A 5FDPA 5AWMA 1Z9XA 3R9DA 4USFA 1WBPA 2Z2WA 5CZHA 3LFSA 4D9UA 4NIFB 1O9UA 5BQ0A 1Z57A 3I60A 4QMVA 4LUEA 4RX9A 5L8JA 2GFCA 3MFTA 1J1BA 1NVQA 4BWKA 4NUSA 3BGQA 3BHYA 4AQCA 4OUCA 3I6UA 5C26A 3AKLA 5IQAA 3EL7A 2IZSA 3HMPA 3IW4A 3TV6A 4F6SA 1H8FA 3LXPA 2WFYA 3GQIA 1OBDA 4PPCA 2PSQA 3NEWA 4DHFA 1WBWA 2Y9QA 2WMQA 4D2SA 1M2PA 4PV0A 4RG0A 2JAMA 4X2JA 3GC8A 3QFVA 3VBVA 3ZO1A 1NT2A 3DJ6A 5EQYA 2NNWB 4FKPA 1IASA 3U51A 3GT8A 3FPQA 4CEGA 4I5HA 4ZY6A 2R0UA 3TT0A 4O0UA 4AWIA 3DZOA 2C0TA 4QP1A 4DH8A 3KIOC 1XO2B 2YIWA 2X4FA 3MTFA 3K3JA 3SQQA 3U9CA 3DAKA 3VVHA 3PRIA 4M0ZA 5EQPA 3L9PA 4D0WA 4EOMA 2Y6MA 2WMVA 2XNEA 1MRVA 2DQ7X 2OI4X 3OFMA 4FRFA 4AACA 1ATPE 2UZTA 3LXLA 3HV7A 3WZKA 2BZKB 2VTPA 4LMNA 5CQWA 4YLKA 1EH4A 5DH3A 5FWKK 2A4LA 4ZJJA 4AU8A 4C36A 4YJTA 3VUIA 4G16A 5EOLA 5GIOE 4M13A 2PMNX 1IAHA 2VRXA 3GVUA 4QT1A 2CGUA 2RG6A 5GINE 4CFUA 4DEDA 4RX7A 4DINA 4EH9A 4LOPA 4QTDA 1OB3A 3F2AA 5CU6A 1Q8ZA 2CGVA 3DFAA 4LRMA 5JRQA 4QYEA 5HTCA 1MQ4A 4IWPA 4U43A 2X9FA 3F9NA 5M4IA 1SZMA 3BLHA 2WMRA 1PXLA 2QO7A 3R71A 4FUYA 3VS4A 3ZU7A 3BV3A 2AQXA 3W0QA 3EJ1A 4BBFA 4GKHA 1G5SA 4BCJA 5IQEA 5AUUA 3E8DA 4ZP5A 4B4LA 3PZEA 3QZHA 3DLSA 3K5UA 4BIEA 4ORKA 1W2CA 4G3GA 2QG5A 3L8VA 2IVUA 3C50A 4KKHA 3PXKA 2QURA 4BWPA 4CKJA 1Q61A 3NFGB 4MTAA 3AKKA 4MQ2A 5FRIA 4ZSEA 5TKDA 3VS7A 3MPAA 4AXEA 2WMBA 1BUHA 4XV9A 1PF8A 3QX4A 1UWHA 2C47A 1ST0A 2J7TA 4R3PA 5FP6A 3V04A 1QPEA 4FVPA 2ETRA 3C0GA 2PVLA 4E6AA 4Q5HA 3UO5A 5HX8A 3LE6A 4II5A 1G8AA 3Q60A 4UMUA 4EK6A 5CNNA 4DAWA 3DAJA 4QYHA 4X2NA 1YDRE 3SHEA 2XYNA 3K3IA 2XAMA 1KE5A 3SA0A 4FVRA 4BF2A 4AW1A 1XWSA 5DEYA 2QHMA 2XNGA 3OWLA 3OOGA 5IG1A 3GCVA 1H07A 1KV1A 2CGXA 2OJ9A 3AGLA 3JXWA 1H00A 4A9TA 3ATSA 4ZMEA 3IW8A 1XKKA 3UO4A 4K33A 3ET7A 4KS8A 3BU5A 4PUZA 4HZSA 4NTSA 3QUDA 4AOIA 5I9YA 4WNKA 1PXNA 4XP2A 4DHIB 4FTUA 3VS1A 3RAKA 4CD0A 1YWVA 5BVNA 4FSTA 4FSMA 4OTQA 4F70A 1ZOGA 2YA9A 5CU2A 4OT5A 2VX0A 2Z7QA 1ZWSA 5JQ5A 5JFSA 3DNDA 5EHLA 3DY7A 4CXAA 5AM6A 3FE3A 4WKQA 4JR3A 2J90A 2REIA 5T68A 4L6QA 3GU6A 2X1NA 3UZRA 1YOMA 2RFNA 4QP4A 2WMAA 3BLRA 4OW8A 3U55A 4E4NA 2YM7A 4Y8DA 3VF8A 2BHHA 2FYSA 3C4CA 1XH4A 3CIKA 3COHA 4IBMA 1BI8A 2XKFA 3RCJA 3VBQA 3VHKA 4P5ZA 2ITYA 3QTQA 3RTPA 2C5OA 4PL5A 5M53A 4RVMA 4V01A 2IZUA 5KHXA 1UA2A 3DQWA 5M06A 3KCFA 5FDXA 3NW6A 3O8UA 2GU8A 2RFSA 4Q5EA 4EHZA 4X21A 3OT8A 4DEEA 4EH2A 5AJQA 2PUNA 3BHTA 4R7HA 3JPVA 4GU9A 3VS5A 2IW9A 2CLXA 3SXRA 3WF9A 4YGAA 4EC9A 3EQIA 4FTKA 4JRNA 1H0WA 2OKRA 2RG5A 3FLNC 3ODYX 4FV2A 3OHTA 4L45A 4NWMA 3OW4A 3U4WA 4RLLA 2BIKB 1JAMA 4UXQA 4BGQA 5J9LA 2FB8A 3IGOA 2C0IA 4D9TA 4OTFA 3LFDA 4QPMA 4EZ5A 1OIRA 4L3LA 2J0MB 1XMLA 4AP7A 3BYUA 3VBWA 5IPJA 3POZA 5EDPA 3UYTA 4YR8A 3MH1A 2WTKB 1WMKA 4MXXA 4K6ZA 3HEGA 3R73A 3P79A 2BILB 5KE0A 1Q8YA 1ZY5A 2F7ZE 2GTMA 3IQ7A 3PXRA 4NW5A 3DB6A 3KN6A 4FT5A 5AUYA 4YUQA 5HBJA 5IUGA 3GU8A 3OEFX 1TQPA 5IH5A 2IJMA 2F2UA 3TN8A 2QOIA 4DT8A 2VN9A 3A7IA 4XV3A 4DH3A 3V8WA 2JKMA 1SM2A 3NLBA 1WCCA 2BDFA 2J9MA 4K9YA 4XNEA 4XP0A 5EI6A 5LMAA 3IW6A 4BCOA 2FSTX 4FTQA 1BYGA 5CF6A 2UVZA 1R3CA 4G9CA 2ZB0A 2OO8X 4FIHA 3VONA 2YWVA 4O7RA 2VNWA 5DR6A 4H39A 5M08A 3QGYA 3NR9A 4TYHA 5CTPA 5I9VA 2CHLA 1YOJA 3KKVA 2XIZA 5IF1A 4DDIA 4NTTA 4Z7GA 1XBBA 4HPTE 2O8YA 2WAJA 3LJ1A 5F94A 3UBDA 4RIYA 5I3OA 3ORLA 3DKFA 2VO3A 4DTKA 3NYNA 3NNWA 2Y4PA 5DR9A 3NVKI 2C1AA 3O0GA 3Q04A 2QR8A 5EM8A 4D2PA 3PFYA 2X8EA 1JQHA 3LCDA 3AC4A 3MVLA 3S2PA 3BEGA 3VIDA 4CV8A 1JSVA 4BTFA 3NVMB 2EU9A 4E5AX 4L53A 3JUHA 3KF4A 1PKGA 1A06A 4GK3A 1R78A 1RQQA 3AC5A 3JYAA 4FKJA 4U9AA 2VUWA 4RFZA 2PUUA 3SW4A 4XOZA 1RE8A 3OMVA 5AR7A 4R77A 2Y4IB 1AQ1A 1H1QA 4PDSA 3W55A 5FBOA 4L8MA 4U5JA 5A46A 3QHWA 4JIAA 4L46A 5TE0A 4D0XA 3NNXA 4ZY5A 5ETCA 5J87A 1UKHA 4JRVA 4N6YA 1L3RE 1H1WA 3R63A 3LW0A 3PXFA 5EI2A 2OSCA 2GQSA 2HZ0A 3UG1A 4ANBA 3R30A 4J95A 3RAHA 3LCKA 4TNBA 5IA5A 2G2HA 3WIKA 1BI7A 4BDJA 4F7JA 4OGRA 1UU3A 2HK5A 2XB7A 1E1XA 2ZV2A 1L8TA 5BUEA 4GVAA 4R78A 4FC0A 2W9ZB 3AG9A 5ANOA 2W4JA 4FF8A 3ZFYA 3Q3BA 1REKA 1OIQA 2W1FA 3BEAA 3HLLA 2JIIA 3MH2A 4IX4A 4IZYA 5GHVA 3O7LB 4PY1A 2QU6A 3P78A 4C4EA 3VO3A 1TFFA 3LMIA 3NYOA 2YZAA 3Q4UA 1Y6BA 4BTKA 4DYMA 3CJFA 3LIJA 1W98A 2C68A 4U97A 4ANLA 4IAAA 2CNUA 5LMKC 5HE2A 2J0LA 5JGAA 4JDJA 1SVHA 4UXLA 1F5QA 4DG2E 4DGOA 5E8UA 4CNHA 1V0OA 4E6CA 4AF3A 2WU6A 2X39A 2JKKA 3FMNA 5GJDA 2J0KA 1BLXA 4ZTNA 5D7AA 3D14A 4EOSA 5DEWA 4UBAA 3OT3A 2GS2A 4YURA 4IJPA 4ZEGA 2X2KA 4J71A 3OW3A 5AR4A 1H4LA 3ORIA 4F6UA 1Q8TA 2W4OA 4O6EA 5AAFA 3RK9A 2QOFA 3QA8A 2BRBA 5ITAA 3K5VA 4N57A 4JR7A 3U54A 4CYIA 4BR3A 2XK3A 4PX6A 4BCMA 3QXOA 4CFNA 2GQRA 5LCKA 4ACGA 3Q6UA 3AC1A 3FLSA 4KWPA 5E8ZA 3NSZA 2UW0A 3G0FA 2JFMA 3G51A 4IFGA 4C37A 5L2WA 5HLWA 2VTAA 1BL6A 4CRLA 4X6RA 4MBIA 3Q6WA 5IA1A 4O7NA 2B9JA 2JBPA 4O6LA 4DEAA 3F5GA 4TY1A 3ZZWA 4FIIA 4APPA 3DKOA 3EKNA 2NRYA 3PIZA 5BYYA 3O7LD 4S2ZA 4QO9A 3G0EA 4XG2A 1OI9A 4D4VA 2P0CA 4UEUA 5FUTA 2WPAA 4O0XA 5M09A 1YW2A 2QOQA 2GDOA 3FLWA 3HA8A 4DFUA 4YJQA 4O4FA 2UZBA 5HGIA 3W0SA 3FC1X 4FSUA 3E3PA 3BRBA 3DTWA 4RIYB 1IEPA 3A61A 2VTTA 4I94A 2ZDUA 4E4LA 5CY3A 3I6WA 5K4JA 4FSYA 4AA0A 3VWAA 4BL1A 3ALNA 3MB6A 3MDYA 4JLCA 3NUPA 4RIXB 5ANGA 5IEXA 4ZJIA 3F3WA 4EK4A 4FG7A 4RX5A 4WG3A 2RSVA 3BHVA 3KVXA 3LFBA 1ZOHA 5AAEA 2QR7A 4DGLC 3CPCA 1VR2A 2R3FA 3TMOA 3L8SA 2HW6A 4Y95A 1Q24A 1XBCA 5M51A 4EBVA 2IW6A 3I81A 3NPCA 3UP2A 3W2OA 2YITA 4PMPA 1KUTA 3F2RA 2OWBA 4RC2A 3TJCA 4BKJA 4BN1A 4JQ8A 4NKSA 2UZVA 2ZM1A 4IVAA 1OL5A 3IONA 5EW3A 3SLSA 4BHZA 5EH0A 4BKYA 1H1RA 3NMUF 5B7VA 4RJ7A 5FEEA 3NUNA 5J8IA 4MWHA 2OIQA 4JVGA 5ANDA 2BZHB 4GU6A 4AZTA 2PVYA 2BROA 2JGZA 2XKCA 1XJDA 5E8SA 3UP7A 1A48A 3ZXTA 2P2IA 3TNHA 4AGDA 3G6GA 3QQJA 2BFYA 3SOCA 2G2IA 2FO0A 3ORKA 3C5IA 3H30A 2VWZA 4FV1A 2DYLA 3AT2A 3FI8A 4E5WA 3R02A 2E9OA 4I92A 4IE9A 2WKMA 2HW7A 3PJCA 5FGKA 3BWFA 5IA3A 2RKUA 5CAVA 3G5DA 4ANOA 4BDDA 1FVVA 4J99A 1UU7A 3OP5A 4M69A 4RVLA 3PIYA 1JKSA 4MAOA 4QMYA 4RZWA 3OD6X 3KULA 3ZLSA 4D4YA 4D2WA 4L9IA 2ACXA 1GZOA 4LRJA 4QYFA 5HIEA 5JK3A 1WBTA 5FP5A 5J5TA 4FE2A 3D94A 2UZEA 4OBQA 3ETAA 3ZXZA 4G34A 4O4EA 4DH1A 2GNGA 4Z55A 3QQFA 3CQUA 3F66A 2YM8A 4PPAA 4HVSA 4RT7A 1O6LA 2QLQA 2XCKA 2R7BA 4C02A 4CKIA 2C5XA 4JT3A 4EOKA 5AAGA 4R8QA 5DT4A 5CSPA 4TTHB 3LFCA 4U42A 1FVTA 1H08A 5AP0A 5EKNA 3PXZA 4L3PA 4LGHA 2ZFYA 3B2WA 4DG3E 1IA9A 1F3MC 4YZBA 2IO6A 3OCTA 3CLYA 2AUHA 5DVRA 5FEDA 4PF4A 3FMEA 2E9NA 3PVWA 2UUEA 2VTLA 5HOAA 5HG8A 3P7CA 5AIRA 4W9XA 4QQTA 3TZ7A 3UDTA 4AZEA 4J7BA 3EQPA 4QOXA 3OZ6A 2C6IA 3MWUA 4FTJA 3I1AA 3BZ3A 2OW3A 3IW5A 4GK2A 2XNNA 4LI5A 4DG0E 2FH9A 4OTPA 4R5SA 4DEHA 3ZONA 1J1CA 5M55A 3RZBA 3S00A 4FSWA 2VO0A 3UOHA 2IF8A 2WHBA 4MBJA 3O96A 3CBLA 1GOLA 4PTEA 2BFXA 2R3IA 1FOTA 1OKYA 1H0VA 2UW9A 2YIYA 3Q5ZA 3D4QA 1V0PA 4L42A 2QNJA 4QP9A 5E91A 4BTMA 4D4SA 3TIZA 3I79A 4YSMA 5E8WA 4KUJA 3CY2A 3Q52A 3LCOA 1JVPP 2WZJA 4ZAUA 2FSMX 2VWXA 3UODA 4O96A 3TJDA 3LFFA 3KRWA 4IQ6A 4A7CA 4YP8A 4J97A 2X2LA 2C6EA 5C01A 5HCXA 3MY5A 4BBEA 2HXQA 4CLJA 2YFXA 3QRJA 4HYIA 3HAVA 4ZLZA 1HCLA 4QP8A 5I4NA 4FEXA 2P3GX 4QP6A 4PTCA 4L3JA 3VNTA 1LPUA 3OXTA 3MGYA 2O3PA 4JBVA 4DH7A 5KMJA 1S9JA 3OWJA 2OH4A 3L9LA 2XKDA 2CMWA 3KY2A 4MD9E 4R1YA 5L2QA 2J5EA 3ENMA 3P7AA 3AT3A 4P5QA 3ZSHA 4BCHA 4E1ZA 3ALOA 2H6DA 2HENA 3MBLA 4RIOA 4H05A 4IH8A 4MXOA 4WUNA 4LG4A 2W1IA 4D1SA 1T46A 4M68A 2JDVA 4MF0A 2WO6A 5TF9A 2CJMA 4ZZNA 3EQHA 5BVOA 4ZTHA 3R7EA 2GNHA 4CG9A 4U0IA 3KXXA 3WF7A 3NIEA 3BE2A 3GCUA 4KS7A 4BCGA 2XIKA 3R9OA 4QTEA 2QOOA 4YZNA 2YAKA 4A4LA 2JBOA 4RMZA 2JDSA 3P1AA 3RZFA 3DBCA 3LQ8A 3M11A 4O1OA 3UQFA 5DHJA 1TQMA 1F0QA 3FUPA 4GVJA 3H0ZA 4N70A 4NFNA 5DT0A 2XNPA 2B54A 3BQRA 4G2FA 3VW8A 5HIDA 2W1EA 4LL5A 4FT0A 5CAQA 1FVRA 3PSBA 1PY5A 4XBRA 3EOCA 2ERKA 4OAUC 3QQHA 3ANRA 3BGPA 4C2WA 4CVAA 2X7FA 2ZJWA 2PVMA 4QTBA 2CDZA 1LUFA 3UO6A 4D4RA 4M69B 5CNOA 3TUDA 4XLIA 3W8LA 4FEQA 5BVWA 3R2YA 3KULB 2YJRA 3PPZA 4I6QA 4RWLA 4OT6A 5A54A 2XJ2A 3FI4A 3FMMA 4R1VA 3PFQA 1G8SA 3VS0A 4D1ZA 5AR8A 2A2AA 5E1SA 3BQCA 2OIBA 1ZYCA 4JQ7A 5K0KA 4C4GA 3MVHA 3DK3A 3FKLA 5IQCA 5EYKA 3IO7A 4TWCA 5LWMA 5CSVA 4DBXA 2I1MA 4FL2A 4ASZA 2YM3A 4UYAA 5D11A 2QLUA 4QP3A 5D9HA 4I6HA 4XMOA 1XH7A 1B39A 4K18A 3D5VA 3LMGA 3CSVA 1LP4A 2UZLA 4FKOA 5ANJA 2R3OA 3RK7A 2NP8A 4AT5A 1WFCA 3ZH8A 4MXZA 4NFMA 2CKOA 2CPKE 2AC3A 4LL0A 1KV2A 4RA5A 2LAVA 1Q8WA 4BZDA 1CDKA 4ZSGA 2JDOA 4W4VA 4KIPA 1ZZ2A 4IC8A 4EC8A 3CGFA 3FYJX 4KBCA 4HVDA 2YCFA 3D7ZA 5IQBA 3FL4A 2PVFA 5HTBA 2B9HA 4X6QC 1PXMA 3PWYA 4F9AA 5ICPA 5BUIA 3GOPA 3MIAA 3TWJA 3IW7A 4M66A 5HLNA 5LOHA 4IX5A 5J79A 3JY0A 2JFLA 4MBLA 3RPVA 2HCKA 5IDNA 3AGMA 3QCSA 2O0UA 3SAYA 1AD5A 5C1QB 3CGOA 2WGJA 3DT1A 4IAIA 5J9ZA 4AN3A 5F1ZA 4S32A 2HY0A 3FZ1A 5A4EA 3L9NA 4QYGA 1IG1A 3KRJA 4FSZA 1NA7A 4YPSA 5HX6A 3FV8A 4EH3A 1ERKA 3TXOA 3C4WA 4O7ZA 4G3FA 2HELA 4J52A 1TQIA 1ZARA 2QOBA 4O82A 2RGPA 5KMNA 2G9XA 3AMAA 2PVNA 3CTJA 5K9IA 3VBXA 1WBSA 4QQCA 3PJ8A 4FG8A 2QONA 4TNDA 4F7SA 5H8GA 4R7BA 5I9WA 2R0IA 3A7JA 3DNEA 4I24A 3CQEA 4U80A 3UNJA 3C7QA 3PVUA 4DHZA 3NAXA 3AMYA 2NYAA 4AGUA 4USEA 5C4LA 4MF1A 5GZ8A 3U6HA 3IGGA 4CFVA 3NAYA 4CRSA 4FV6A 4QDEA 3VF9A 4FIJA 1JBPE 1OECA 3MYGA 1E1VA 4TZRA 1REJA 3RP9A 3KQ7A 4BCPA 5BYLA 4QMZA 5I9ZA 4WA9A 5K5XA 4Q9SA 4AFEA 3PY3A 4S30A 3KXZA 4GKIA 5J5SA 3QWJA 4NT4A 4QP7A 5IEVA 4FEVA 1ZLTA 2X7OA 2OH0E 4EH5A 5A4CA 3O17A 3LLAA 5CWZA 3QLFA 5TO8A 2ONLC 3TCPA 4F1TA 4YTIA 3DK7A 3PIXA 3GCSA 5KNJA 5FM3A 3RGFA 4M12A 4AAAA 2XYUA 2I0HA 4IVDA 4YBKA 3TTIA 2PZYA 5AUWA 1UKIA 3M42A 4IB5A 3OUKA 4I93A 5C8KA 4O81A 2XALA 2X9EA 3AC3A 4IJ9A 3HRCA 3ORTA 4ONAA 3PUFC 4FIFA 1R39A 2IZRA 3HNGA 2WOUA 2O65A 3D5WA 5IEYA 4FGBA 2P2HA 3O8PA 3GP0A 3PJ3A 4K11A 3PWDA 3QD2B 2QD9A 4AG8A 2EUFB 4FKQA 4DGMA 3ZMMA 3U6JA 3AD6A 4FKIA 4BYJA 3IDCA 3ZRLA 3E62A 3DV3A 3I0QA 3PXQA 2OZOA 4BDCA 2OGVA 3DB8A 4K0YA 3OC1A 4IACA 1RW8A 1SVGA 2VGOA 5AA9A 3NS9A 4RPVA 1DS5A 5DN3A 4TN6A 1H1PA 2QI8A 5CF5A 3ZLXA 5AA8A 4FTMA 1PHKA 4XJ0A 1YXTA 1QPCA 4B8MA 4DH5A 2UW7A 1JWHA 2V7OA 4NM5A 5AP4A 2W06A 3CS9A 5HQ0A 3EYGA 3P23A 1PXKA 3W10A 4IX3A 4YPDA 4A9YA 4DGGA 5BX0A 5HORA 4O21A 5FTGA 4I41A 2RL5A 3ACJA 4DLJA 1VZOA 2CKQA 3COKA 3ID6C 4GFOA 4C33A 4C59A 2BZJA 2DUVA 2HAKA 5D10A 2X7GA 3QD0A 4QP2A 4OBPA 3VQHA 3KF7A 1WVWA 3EQBA 3GEQA 3DZQA 3KGAA 4Z9LA 3ZRKA 3P5JC 3TDVA 4YC3A 4Y85A 1GJOA 3NNVA 4R5YA 4CSVA 5HNGA 4QD6A 1YXXA 1KE7A 2C4GA 5AV0A 3WYYA 4P4CA 3LZBA 4BBMA 5LVNA 3TZ8A 4FEUA 2V22A 3GU7A 4LRKA 3ZLYA 4HVIA 4IM3A 4M7IA 3QWKA 1KWPA 3MI9A 4S33A 5FBNC 4EUUA 2BCJA 3D9VA 3CJGA 4R7IA 4PRJA 4AGCA 3TUCA 5J1VA 2ESMA 3Q4TA 2X6EA 3RWPA 4YU2A 4E5BA 3ZUVA 4KRDA 2V62A 4DEIA 5JFXA 4IAKA 4FSRA 4QMWA 3R9HA 3D2IA 4G31A 3U6IA 4UWYA 4XG4A 3QCQA 2GSFA 4DCAA 1OL2A 3OCSA 4JAJA 4C2VA 3EFJA 4OTWA 3PE2A 4FZFB 4U6RA 2C6LA 4JG7A 5AR3A 2YDJA 1AGWA 4WSQA 3NUAA 1OIYA 2XF0A 2X4ZA 2JC6A 4GFGA 4ZSLA 2R3GA 3FLYA 3SC1A 4O7LA 1TZDA 2BIYA 3G2FA 1GIJA 3LFQA 5IMEA 1ST4A 4YO4A 4PMTA 4V0GB 4O0YA 5L2SA 3R8UA 5M4FA 5B2KA 2X0PA 2XMYA 2WIHA 4I5MA 3RI1A 3FY0A 4B8LA 3F7ZA 3NUSA 4FICA 4RZVA 1ZXEA 3NRMA 4YZDA 2YABA 5KHWA 3NFFB 3W0MA 3AC2A 3DA6A 1XH9A 3H9FA 4U3YA 3ROCA 3ORNA 3TZ9A 1QPJA 4X3FC 1JKLA 2NO3A 1Q62A 4YMJA 1DI8A 2WELA 1YI6A 4DDGA 3CPBA 5AP5A 2VTRA 4F9WA 3FHRA 3RPSA 4NKAA 2C1BA 2JIVA 2EXCX 4NM7A 2ITOA 2XZSA 3CD3A 3U8WA 3ATTA 3QTUA 1JSUA 2R7IA 4OR5A 2JITA 4MWIA 5KMMA 4TL0A 3ML1A 4LM5A 4BJJA 3W2SA 3S1HA 2ONLA 2WQBA 3R01A 5HO6A 2WEVA 4ACDA 4ENYA 3UOJA 1LR4A 4F7NA 4JBPA 3HV3A 5EOBA 5BYZA 2PTKA 4QMPA 3O71A 4IWDA 4ANMA 3ANQA 3V6SA 2J2IB 2VTMA 3QQKA 2JIUA 2PE1A 4PMMA 3AQVA 4CZUA 3TL8A 4KBAA 5M56A 2XEYA 3PZHA 1W82A 3VRYA 3ZSIA 2JLDA 4AA4A 1R0PA 4IVBA 3ULIA 2PUIA 3A7HA 2H9VA 4EKLA 4UWBA 3WF8A 5TT7A 3SXSA 3BKBA 4WSYA 4EBWA 2W1DA 1Q97A 3BLQA 2C6MA 3RINA 3LFAA 3QHRA 4IDTA 4UALA 3VULA 5KUPA 3LQ5A 2XRWA 1UVRA 4FSQA 5CEPA 3I7BA 3FQHA 5EG3A 3VUHA 4ALVA 3PTGA 4YHJA 2OIDA 3MW1A 3VW6A 5JSMA 3HVCA 4FZ7A 4JDKA 4QMOA 4TWOA 4KA3A 4MD7E 4DITA 4G6OA 2YEXA 1YWRA 3A4PA 4IB3A 4LYNA 1H01A 2V5QA 5FXSA 3HKOA 2W5AA 3GI3A 4FZ6A 4FV4A 1YRPA 5BUJA 5HI2A 4OAVB 3MV5A 3QZGA 1OMWA 4LGGA 4HGSA 2XK7A 4ZSAA 4E4MA 5IA2A 3RPOA 5ACBC 3SKCA 4CFXA 3VUMA 3VC4A 4M8TA 4TRLA 4YTFA 3MPTA 2LGCA 1V0BA 5J1WA 4JOAA 1OKZA 1KE6A 5BVFA 2W1ZA 2Y8OA 2VO7A 3PUPA 2V7AA 4O7TA 3FPMA 4RIXA 4LV8A 1Q3WA 2IWIA 2XM9A 3I5NA 4EHVA 4I5CA 2R2PA 4ANQA 4EORA 3SGCA 5AUXA 1VLRA 4J96A 3MY1A 2I0VA 4AGWA 5HU9A 5AX3A 3F3VA 3TKHA 4A06A 3QALE 2XK9A 4HNIA 5JQ8A 2RF9A 4O0TA 3JS2A 3P7BA 3P4KA 4ZLOA 5IA0A 5L2IA 3RPRA 2ZM3A 5HVKA 3JVRA 4FK6A 1ZYLA 3R8MA 1UNHA 4DEGA 3HV5A 5HTIA 4JL9A 3QC9A 3O8TA 4PMSA 1OUYA 5L8LA 2YM4A 4RA4A 4BDIA 2ZYBA 4H36A 4EL9A 3BYVA 3UNZA 2PZIA 4YJVA 3UMWA 4EQCA 2WMXA 1CKPA 4MCVA 4YZMA 3PY0A 5EK7A 1H28A 3VS3A 5HD4A 2C0OA 5IMXA 3PSCA 4F78A 3EYHA 4QMXA 1B38A 3R04A 4JXFA 4BC6A 3F88A 5AADA 4U41A 1HOWA 2BRGA 4YC8A 5ANIA 5GJFA 4S31A 4MNEA 3DXPA 5CT0A 2XNMA 3L8XA 4D5KA 1DAYA 1NXKA 3TI1A 4CFFA 5B2LA 5IA4A 4O86A 3QTXA 3ZC5A 3GUBA 4FKVA 4JJRA 2BRHA 2UW8A 4YHFA 3UVQA 3C5UA 1O6YA 3ZEPA 3F82A 5HO8A 2ZB1A 3FMLA 5KZIA 3ZFXA 4FKGA 3ZFMA 2ETKA 3HYHA 4GL9A 5FEQA 5CENA 4GG7A 2ERZE 3FI2A 3H9RA 4FT9A 4QNAA 5HNBA 3SXFA 2QG7A 1ZMUA 4X3FA 4DFLA 2A1AB 2AYPA 3H9OA 2AEGA 3K2LA 4BJJB 5DOSA 4D55A 3CTHA 4EOJA 2PZ5A 2GQGA 4XEYA 4C8BA 1XQZA 3Q5IA 4WT6A 2G15A 2G1TA 4CKRA 1URCA 1JKKA 1U5RA 2QKWB 3QKKA 4F0FA 4GH2A 4FV0A 2PVJA 2UVYA 3GFWA 5CAUA 3UVPA 2BDWA 5CS6A 2YAAA 1KE9A 1VEBA 2VAGA 2J50A 2PHKA 3E5AA 3E88A 3FHIA 4KABA 3UDSA 2B55A 3NZ0A 4KKEA 4OTDA 1ZYDA 3A62A 4QTCA 1TVOA 4GS6A 2YN8A 4O84A 2WD1A 3BGZA 4XBUA 2W1CA 3QRIA 4PTGA 3IOPA 2CSNA 1NVSA 1J3HA 1OGYA 4FEWA 4JDIA 2YJSA 4AX8A 2OF2A 2PY3A 5L3AA 1YXUA 2XIXA 2Z7SA 2QO9A 3HDNA 2WOTA 4RVKA 4U81A 3UOKA 3MJ1A 2VWVA 4LOQA 3UTOA 3R0TA 3ZBXA 4EH4A