3E92A

Crystal structure of p38 kinase in complex with a biaryl amide inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
350
structure length
348
Chain Sequence
QERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDELKILDFGLAHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Kinase array design, back to front: Biaryl amides
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 348
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e92A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e92A01
3QRJA 1OZ1A 4M8TA 3R2BA 3F69A 2NPQA 3BGPA 4IAFA 4PV0A 5C03A 4A4XA 3LFNA 4M66A 5CF8A 2YEXA 4EHZA 4JDKA 4F6SA 5EW3A 2ZV9A 2G01A 4ACMA 2VTHA 4IDVA 4P90A 3ZH8A 4A9UA 2PE2A 4U79A 3ANQA 4FV0A 3SXRA 4Y5QA 3VW8A 4DAWA 5AP7A 4JRVA 3C5UA 5E8YA 5L2QA 4QTEA 5GINE 2OIDA 3P08A 3P78A 3HX4A 4EOKA 2QNJA 2XRUA 4DA5A 5TE0A 4S2ZA 2OWBA 4L3JA 1BL7A 3OG7A 3UOLA 5GZAA 3TDVA 3KULA 3GC8A 1JKSA 3HUBA 4NYEA 4GW8A 2F4JA 4EUUA 3HV5A 2IZTA 2W1IA 2Y4IC 4ITJA 1STCE 4IAYA 1OUYA 2YM3A 3WE4A 4C2WA 3D9VA 4O0XA 4JL9A 3W2CA 3W2RA 3E8EA 4HJOA 3LFQA 3VBTA 4EZ5A 1BI8A 1OECA 2DYLA 4EK6A 2HIWA 2PVKA 3KRWA 4QMQA 2ZDTA 4BHZA 1REJA 3G9NA 2PZ5A 3RBWA 2R7IA 2RSVA 4PRJA 4QQCA 5JFXA 5E90A 2HY0A 3LJ2A 4LFIA 3F5PA 3PY1A 4XEYA 3S0OA 3LM0A 1UKHA 4J7BA 4U43A 5HCXA 3C4EA 3FXXA 1JAMA 2WTIA 3PE1A 4LQMA 3NUUA 3A62A 2OIBA 3L8SA 3MVHA 3HMOA 4BI1A 4F9YA 2QG5A 1ZYCA 4MNFA 1G8SA 2CKEA 2VTMA 4RLKA 1XH6A 3A2CA 4FA2A 4EH5A 3PZEA 2VO7A 2WMVA 4HYSA 3MFRA 1WMKA 3UQCA 1OVEA 2QHNA 1YWVA 3OS3A 3VF9A 4Y83A 1P4FA 2YDJA 3Q04A 4GK3A 1MRUA 1EH4A 5BUIA 5M4IA 4Y95A 3O51A 4ZTMA 3NW5A 5A4TA 5KMLA 3JVRA 2WMAA 5CTPA 2XEZA 3KN6A 4WNOA 3R8LA 4ZZNA 3RAHA 1SMHA 3EIDA 3LVPA 2XH5A 3OVVA 4R3RA 4MF1A 1LEZA 5CF5A 1IAHA 2Z7RA 2G2FA 5CAUA 1P4OA 2OSCA 3RPVA 1R3CA 1ZAOA 1DM2A 4OTRA 4UY9A 4DBXA 4XG3A 3R8ZA 3HVCA 5CY3A 2ZM4A 1KV2A 1WBOA 3EOCA 3JR1A 4O7NA 1ZZ2A 4IX3A 5AIRA 2JKMA 3A8WA 4KRDA 1K2PA 4HW7A 5BNJA 3BHVA 5FDPA 3PP0A 2BVAA 3I60A 4QP4A 3HEGA 1YXVA 4E4NA 3UQGA 2WTVA 5EM7A 4QYEA 4FSNA 5ANKA 5LQFA 2ITXA 4F6UA 1PXKA 3UZPA 3VUKA 2A27A 5B2KA 1OM1A 3N9XA 5KMJA 2BAKA 1P5EA 3OCGA 1OIYA 4EOSA 1IRKA 3CEKA 4RWLA 5HG9A 3PJ8A 2GQGA 3ZSGA 3JY0A 3QWKA 4BHNA 5F4NA 2FSTX 3NRMA 4XRJA 3LXNA 3DCVA 2P3GX 5A9UA 4DGOA 3CE3A 3UVRA 5AV3A 3FYKX 5FGKA 4CFXA 2QC6A 3NGAA 3R8PA 2ONLC 3EN4A 1H1PA 2PSQA 4LV8A 1A9UA 4F64A 4G9CA 3EJ1A 3QHRA 4PP7A 3Q2MA 1Y8GA 2BRGA 4OTQA 3O23A 4I22A 4C2VA 2FSMX 4TYIA 5JZNA 5CU3A 3V6SA 4L7FA 3QTUA 4NM3A 4OAVB 2QOKA 3JYAA 4LGDA 4FI1A 5DHJA 2YIRA 4WHZA 4E93A 4GRBA 4FZ6A 3TUDA 2UZBA 3QGWA 5J95A 5C9CA 3D5WA 5LMBA 3U4WA 1Y8YA 5LVNA 2C0IA 4EEVA 4HZRA 1YDRE 2QODA 4FTLA 5CF6A 4EH2A 3DAEA 3VBQA 4XG2A 2VU3A 3FHIA 4U42A 4YO6A 2CLQA 4YJVA 4CQGA 1W83A 2I0VA 2Q0NA 2IJMA 4WBOA 4ZEGA 3H10A 2XKDA 3FQSA 5CZIA 1VEBA 1PXJA 4XG8A 5FEEA 4DHFA 4ZMFA 2G2IA 4L52A 5H2UA 3FXZA 1OL1A 4DFXE 2WTJA 3NYXA 3TXOA 4O7WA 5A4LA 4O27B 1AQ1A 3GU7A 4FYOA 5TF9A 3POZA 3U4UA 4FV8A 4TPTA 4F1TA 5DEYA 4NZWB 4YR8A 4BR3A 3AC8A 1H8FA 2YACA 3ZO4A 3RAKA 5AP0A 4X6RA 1R0EA 3RALA 5AP3A 3IGGA 2JC6A 3NNXA 3AOXA 1ATPE 5EW8A 3W2OA 3F9NA 1A48A 1YKRA 1BKXA 1ZYDA 3OXIA 2YCSA 4O1PA 3FZRA 1Q8ZA 3K3IA 1WBVA 3QYZA 3MI9A 3V6RA 3AD5A 1WBTA 2W05A 3BIZA 5AX9A 4AT5A 4RZVA 2A4LA 4HVDA 1Z57A 3FV8A 4FBXA 1QPEA 5FTQA 2XCHA 2GHGA 4M0ZA 4BDBA 4FNZA 3CTHA 4YC6A 4G3EA 5H8GA 4BCQA 1OUKA 2UZVA 4BCIA 5DNRA 1UU8A 3G0FA 3A4OX 1H0WA 4MKCA 2JFMA 4D1ZA 4PX6A 5KKRB 4WKQA 4QMYA 4FKRA 4YHTA 3UDBA 4WUNA 3ZONA 2YWVA 1KV1A 5LMKC 2PVMA 3AG9A 3DJ5A 4ARKA 3VNTA 4HNIA 3F3TA 5EDPA 4ONAA 3R9RA 2UZTA 4E6AA 1WVWA 3VS2A 2ZB1A 2RFNA 4IB3A 4TNDA 3SHEA 3GU4A 3Q9YA 5AIKA 4RA4A 2CDZA 3QD2B 4IAKA 3UPXA 4LGHA 3CTJA 2VWYA 1ZARA 3RAIA 2R4BA 5JEBA 3IPHA 3UG2A 4EH9A 2OXYA 4KD1A 1TQIA 3VULA 2GQRA 2I6LA 4CFNA 3W32A 3FL4A 3Q6WA 4GIHA 1WZYA 2B9HA 5AM7A 4DFUA 3OEZA 4OTFA 3B8QA 3BEAA 3GU5A 4AGWA 5DEWA 4AZEA 1ND4A 3TKHA 3L9LA 2R0IA 4M97A 3ALNA 5FEQA 4E5BA 2I0HA 3VW6A 1R1WA 1UVRA 1QCFA 4ENXA 2YM5A 4FSYA 4FTAA 4XOYA 2OGVA 1JKKA 2YDKA 3R28A 4HVHA 4FKLA 4LOOA 3ZM4A 1Q24A 2UVXA 4J95A 3DA6A 5EI8A 3SAYA 3PUPA 4PL4A 4RX8A 3P79A 5HNIX 4ANNA 4DEBA 2IZSA 2PVHA 4IB1A 5GIPE 4W8DA 5EM5A 5C1QB 4GFGA 3RCJA 4J8NA 3MJ1A 5LMAA 1JVPP 4CRLA 4QMZA 4FKPA 2PZRA 4B8MA 4FSWA 2EU9A 4J99A 4RWIA 5ETFA 4D5HA 3U6HA 3ATTA 5AR2A 3VBWA 3ORKA 2YLEA 5KZ0A 1YWRA 4PUZA 3CJGA 3Q4ZA 2QOFA 3RAWA 3GU6A 4TW9A 4EUTA 5EKOA 1UNGA 4Z7HA 3A7JA 4AACA 3TN8A 2XIRA 4BCMA 1W8CA 3S1HA 3A7HA 4G6LA 3RWPA 3T9IA 3SVVA 4B6LA 4OBPA 3BGZA 4RC4A 5IF1A 1G3NA 1DS5A 4FIHA 4FTJA 4CMOA 4TNBA 5AFVA 1H25A 2OICA 2W9FB 2ZM3A 1U46A 3QZHA 5M44A 3MN3A 3H0YA 3PXKA 3QQFA 4TYGA 4Z3VA 5CSPA 5CT0A 4EKLA 4Z9LA 3QAME 3R04A 5HGIA 4EQMA 4UWBA 3QKKA 2WAJA 4C8BA 3KC3A 4I5PA 3R6XA 3NCZA 1FOTA 2PVLA 3W2PA 2WMWA 4EQUA 3KL8A 4KIKB 2UVYA 4RVKA 1MRYA 4TWOA 2W4KA 4AA5A 3LM5A 3MB7A 4FTMA 2RGPA 5D9HA 4JX3A 3FMLA 3AQVA 5E8SA 2C0OA 3LJ0A 4U97A 2QO9A 2RFSA 4EH4A 4L68A 3DOGA 2QOBA 4Q9SA 3SC1A 3VUDA 3ZC5A 4F1MA 1YI6A 4D4VA 3TV4A 3IONA 3K54A 4IX6A 1H24A 4RT7A 2IO6A 4CZUA 5L2IA 1RQQA 3QKLA 4RJ6A 4DEEA 4CLIA 2OF4A 5A4CA 3LMHA 1ZY5A 2GNFA 5K5NA 3E3PA 1M17A 2HWOA 2F2CB 3R9HA 2BALA 3M1SA 3HA6A 3DTCA 4GJ3A 1H00A 4E5WA 4YTCA 3R1SA 2VWUA 1WAKA 4GT5A 4II5A 5T6KA 3MPTA 4F9CA 3KRLA 4Z7GA 4C4IA 1H4LA 4AOTA 3E8DA 4FZAB 3BX5A 2WOTA 1IG1A 3TACA 5TOZA 1IA9A 4C4FA 3GCQA 4GG5A 3NVKI 4TWPA 1Q8WA 2EWAA 5K4IA 4QRCA 4YPSA 4TTHB 4X2FA 5HICA 1O6KA 3BHUA 3AGLA 4EL9A 1CSNA 3MJ2A 4X3FC 2IG7A 5HIDA 2RFDA 3ZO3A 3DU8A 4O0YA 5CAOA 4CSVA 4FEWA 2IWIA 4HGSA 4ANOA 3PY0A 3MH3A 1JWHA 4QMLA 5CZHA 4ZS4A 4UB7A 4F4PA 1G8AA 3I5NA 2WTWA 4DH7A 3I81A 1RDQE 3CCNA 4QYGA 4DTAA 2BIYA 4ZJJA 1Y6AA 4D9TA 3AMBA 4E8AA 3EYGA 4KIKA 2Z7LA 4NW5A 4L7SA 4G6NA 4DGMA 5KMOA 2J0MB 3E8CA 4HYUA 3GI3A 3TT0A 3Q60A 4D5KA 4BC6A 3SA0A 3F5UA 2HZIA 3HECA 4LG4A 3VS0A 4BDEA 2WMUA 1OL2A 3NYNA 3TV7A 4ZZOA 3O50A 3PWYA 4ZLZA 3UNKA 2UW7A 3DKCA 3I7CA 2XF0A 5AP2A 3ZBFA 3LMGA 3RK9A 2H96A 4EHGA 5AM6A 3UIMA 4O84A 4AUAA 1ZYLA 3HZTA 4D0XA 2UW4A 3ZSHA 5E4HA 2DWBA 2BTRA 3BZ3A 5JZJA 2VTTA 3W33A 4TWNA 3LFSA 3ZRLA 5AMNA 4QP3A 5F9EA 3QLFA 5HVYA 2AC3A 4FG9A 3QA8A 2F49A 5AWMA 3PJCA 1BL6A 4LM5A 5HBHA 3UIXA 4AU8A 3LJ1A 4N70A 2VZ6A 3R73A 4V05A 4Q9ZA 3O8PA 4CT2A 1CKIA 2C0TA 4IE9A 4IAAA 5T3QA 4L44A 4PF4A 5JGBA 3FKOA 4Y46A 1BLXA 2C1BA 2WQMA 4BTJA 3DLSA 3R7OA 4IH8A 5AX3A 1Q3WA 1Y57A 3NUSA 2OH4A 4K11A 4L9IA 1E1XA 4QTDA 4RJ4A 4TRLA 3ZLSA 4PMPA 2C6KA 4KS8A 5IQGA 2BILB 2X6DA 2YDIA 1QPJA 3MDYA 3VUMA 5BPYA 5A4EA 1YXSA 4OUCA 4NL0A 5DR6A 1ZRZA 4TYJA 4FVRA 5CU0A 4FG7A 4E20A 1IASA 3K5UA 2F7EE 3AC1A 3MY1A 4RX5A 2OJGA 3HAVA 3W1FA 2IN6A 4FV2A 5HKMA 4PTGA 3BI6A 3FLZA 4JX7A 2YABA 1Y6BA 3FMJA 1OL5A 5DG5A 2X8DA 3UTOA 3V5LA 1WBNA 4E5AX 1PMEA 3D5XA 2J6MA 4R8QA 5FWKK 4FF8A 3HMIA 4X21A 3OTVA 3RZFA 4E73A 3UO5A 2W1HA 3PVWA 4F7NA 5I9UA 1KE8A 3CGFA 4H3PA 4L67A 3PXZA 4CCUA 3S00A 4ZIMA 5HE1A 5I9ZA 5CEKA 2W1CA 3D7ZA 3VS6A 4FKUA 1U54B 5IA1A 4ZSGA 3AC2A 3PPJA 3PXQA 4BBFA 5IEXA 3T3UA 4QMUA 3Q3BA 1U5RA 1M14A 3LCOA 3P5KA 4PTEA 2EXCX 3OWKA 3LCTA 4L01A 4EOQA 5LWMA 1WBSA 3KCKA 3KEXA 4NKSA 3FSFA 3PJ3A 2BHEA 1FVTA 1PYXA 3PVUA 3AXWA 4RFMA 1NVRA 4ZTSA 4K8AA 3WBLA 3QYWA 4CG9A 3MY5A 5HVJA 1FQ1B 2ITOA 2NRUA 2OJFE 1W84A 2BUJA 3NSZA 5DT4A 2H9VA 2E2BA 2O65A 5JN2A 2WXVA 1NW1A 2GQSA 4FKWA 2E9VA 3FZOA 5IA5A 3JS2A 4PDOA 3U6IA 4MEDA 4ANQA 3M2WA 4F7JA 3EFKA 3I0QA 4QQ5A 5D7AA 5HBJA 4H3BA 4I0TA 3TZ7A 4AZTA 4YJUA 3GQIA 2QU6A 2CGXA 2R9SA 2XEYA 3BBTB 3G33A 3H30A 4IZ7A 4NJDA 5JT2A 1DI8A 3LQ8A 1YXTA 2J5EA 4DFNA 2VWVA 4LL0A 1H1RA 4D2SA 4BDGA 3IDPA 3GP0A 4YZBA 2WTKC 2IVTA 4JR3A 5GHVA 2WO6A 3FZSA 4FEVA 1APME 3II5A 3C0HA 5AA8A 4MAOA 3FLYA 4XRLA 4CYJA 4I5CA 5HO7A 2AUHA 2C5VA 5HU3A 2XJ0A 3F3VA 4IWDA 2P33A 3E63A 3CC6A 4RJ5A 4XCUA 4PNIA 4D2RA 2PMNX 5M53A 1W82A 5FLFA 3QUDA 4I23A 2XUUA 3S3IA 4F08A 4FTOA 3GEQA 4I93A 5AEPA 2HXLA 3NZ0A 3FPQA 5EHOA 4BDCA 3QL8A 1XBCA 1OPJA 5I9YA 4BKYA 2BZHB 4U9AA 5DH3A 5AUWA 2JAVA 4IC8A 5JRSA 1XWSA 3SG8A 4AN9A 3W8QA 4NSTA 1T46A 3OHTA 5GJDA 1H1QA 2PTKA 4O38A 4U44A 3G9LX 5ANOA 3TG1A 3LPBA 4NM7A 4NKAA 3D5UA 2CNUA 3P1AA 3ZBXA 2CGUA 2Y6MA 3I0OA 5HE3A 3R21A 1UU3A 2NP8A 4RRVA 5AADA 5HD4A 2BAQA 4LV5A 4XP3A 2ZOQA 3PXFA 5AR4A 4BIEA 5F20A 4EWQA 1M7QA 3BQCA 3ZCLA 2JIIA 4OLIA 3EWHA 4W9XA 1XHAA 4IB0A 3BGQA 4L6QA 2C3LA 5D1JA 5IH5A 2VTJA 2QONA 4BIDA 4TWCA 2CLXA 3H4JA 3TJCA 4DG3E 2VTAA 2PVYA 3EL8A 2C69A 4O83A 1B39A 3E87A 3H0ZA 2OFVA 2X2KA 4MD8E 3KQ7A 4YSMA 3ATSA 2XNEA 1M52A 4BDDA 4CVAA 2HENA 4F6WA 5JK3A 4JQ8A 5IQFA 4AE6A 5IEVA 2JLDA 3LMIA 2C5XA 3HV3A 1Z5MA 3R9DA 2Y4PA 2HELA 3GOPA 2OI4X 4RFYA 3FMKA 3H9FA 3T9TA 2XM8A 3U51A 3ZS5A 3CY3A 4U45A 3GB2A 3QD0A 2GNHA 4QMVA 2C3JA 4WO5A 3GXLA 3Q5IA 4BN1A 3P7BA 5CI6A 4CV8A 3NUYA 3QQGA 1J1CA 4BZOA 3BHTA 2Y9QA 2IZRA 4W4VA 4IM0A 3KXGA 4BWPA 2CGWA 1F3MC 4F0IA 2OLCA 2YITA 3JXWA 2IZUA 5CSXA 5FD2A 2ZYBA 3UVQA 3FZTA 4U7ZA 5HO8A 3ZZEA 4FKGA 3QBNA 3QQJA 4WRGA 1CKPA 4O2ZA 2B0QA 5DLSA 4LOQA 4E6QA 2GS2A 1ZOHA 3BYUA 3ZXTA 4D2WA 3TZ8A 2BPMA 4UXLA 4XHKB 4AF3A 3IS5A 3EN5A 3E5AA 5AUZA 2QOQA 5IUIA 5BQ0A 2W0JA 3LCDA 3LCKA 3DY7A 2I0YA 5E91A 5TKDA 4BKJA 3FLWA 2XK9A 3GGFA 4GT3A 4Q2AA 4DINA 1I09A 3DFCB 5LOHA 4FIFA 3UGCA 3TCPA 5L2SA 4TL0A 4HOKA 1UU7A 3QZGA 4PL5A 3KXNA 3F3ZA 1T45A 4J8MA 5JH6A 2QOLA 2DS1A 4AGDA 2O0UA 2YM6A 4H05A 3A7GA 4ZJIA 4N4SA 3HMMA 5F95A 1Q5KA 2JFLA 4HCUA 4W4XA 5LXMA 2J4ZA 4S34A 5DIAA 3WZJA 1UNLA 5CASA 4AN3A 4UALA 5HVKA 5A6OA 3FWQA 5ACKA 4NU1A 4H1JA 3EZRA 4NCTC 2OU7A 3SRVA 4NTTA 2BZIB 5CWZA 3QQHA 2JITA 2W4JA 2WTDA 2O8YA 2R3JA 4W8EA 4ZSLA 3QF9A 3SXFA 3V8TA 3PA4A 4CKJA 3DK3A 5DT3A 4BY9E 3MBLA 1OIUA 5KNJA 3L9MA 4PDSA 2ZVAA 4FSUA 4RQVA 3ZEWA 3H3CA 4K1BA 2XBAA 3F7ZA 4GCJA 1KOBA 3Q4UA 2JKKA 2QOHA 2PUIA 3WARA 2UW3A 4MBIA 3LOKA 3Q96A 5H9BA 2QO7A 3G51A 2XNNA 5ETIA 5HE2A 3ZHPC 5CAQA 1V1KA 3MW1A 4ACCA 2C3IB 2OZOA 4HCVA 3LXLA 3FMNA 5GZ9A 2J5FA 2JGZA 3PIXA 1J7UA 2JEDA 4JVGA 4JIAA 3SX9A 4YNOA 2GNGA 3MS9A 5EDRA 1I44A 1PKGA 3R8MA 3R8VA 3EZVA 4FSZA 2I1MA 5IISA 5IUHA 3NMUF 4UEUA 4Z16A 2FUMA 3GCSA 5AR7A 2XIKA 3LQ3A 2R7BA 3GBZA 4LRJA 3DS6A 4ZK5A 4CD0A 4FKVA 5HTCA 2XCKA 3QTZA 3ZLYA 4BWKA 4N0SA 5FP6A 4USFA 3QTWA 4GVAA 5FM3A 3BELA 4FTTA 1VR2A 4JT3A 2JDTA 5CQUA 3PSBA 3TI1A 2WQNA 3P0MA 3V3VA 4QQJA 3RHKA 4FIIA 3HRCA 3OC1A 5KMIA 2WGJA 4L3PA 4WBBB 3KRJA 2CKOA 1FINA 3GCUA 3GQLA 4YJSA 4YZ9A 1MUOA 2JD5A 1JSVA 2UVZA 1U5QA 3HDMA 4OTGA 2UZDA 3AT4A 4QPAA 4F9WA 4E4LA 4EHEA 3LFEA 4QP2A 3GENA 4IAIA 2PUNA 4NFNA 4RJ7A 2PZPA 2BR1A 2ITZA 5HIEA 2F7XE 3BE9A 2P0CA 4L43A 5EYMA 4D4SA 4DEDA 2B1PA 2GNJA 4JS8A 4CLJA 2RIOA 4ZAUA 5LJJA 3WILA 1MQBA 3C51A 1JKLA 3O7LB 3P4KA 2YJSA 4FVQA 3SOCA 1OKVA 4KBKA 1PMNA 4U81A 2X0GA 3UNJA 1LR4A 2F2UA 3ETAA 4RVLA 3UJGA 5LVMA 3KVXA 3KB7A 3BU5A 4K0YA 2QCSA 2YIQA 1HCLA 4BBEA 3DNDA 4RJ8A 1YDSE 3VC4A 3LXPA 4MNEB 5IQDA 3ZEPA 2VX3A 5IH6A 3FHRA 3RKBA 3K2LA 2WQEA 1R78A 3HKOA 4FV5A 4QOXA 3RP9A 5I0BA 5EKNA 3VVHA 4C0TA 1YXXA 2EUFB 4X2JA 3L8PA 5FTGA 3FL5A 1ZYJA 3F88A 3VF8A 4RPVA 2YZLA 3VUTA 4DH1A 5LARA 5KMKA 1ZWSA 3PYYA 4F1OA 4RVTA 4I6FA 1GZNA 3G15A 3NUPA 2OXDA 3COMA 3IW4A 3Q9WA 4R7IA 4CZYB 3DK7A 1M2QA 3TZ9A 2CPKE 3BYVA 4FL1A 4EI4A 2OXXA 5K0KA 4QYFA 1NVSA 4RIXB 4PMMA 4S33A 1GZKA 3WIKA 4ALUA 1Q97A 2AC5A 3C0GA 5E7RA 4OGRA 5HBEA 5J7BA 1Q62A 4RLLA 4G5JA 2BDJA 4FZFB 2EB2A 2BFXA 4R5YA 3LLAA 5IDPA 2V55A 3E3BX 3LIJA 2QI8A 4WNPA 2ZDUA 4MX9A 3QLGA 2QOCA 4XX9A 4OBQA 2VO0A 3R9OA 2C68A 2BRHA 4BCNA 2UW9A 4R78A 3IDCA 1SNXA 3QRTA 4ZOGA 4UYNA 2F57A 3P7AA 4JR7A 3UOHA 2XJ2A 3TNPC 2IPXA 4BCFA 4PY1A 4RIYB 4O22A 5M06A 2R3NA 2XK7A 3A4PA 5M07A 2UZOA 4WSYA 2EVAA 5HHWA 2O64A 3MH0A 4IFGA 4YZNA 3W10A 4EK5A 5FP5A 4FV6A 3C4FA 2C3KA 2B9IA 4W9WA 4Y5HA 2JAMA 3DAKA 4FT9A 1QPCA 4K9YA 3RM6A 1W7HA 1OPLA 1B38A 3EQDA 4RFZA 4MNEA 3TDWA 3SOAA 4FTCA 2DQ7X 3DK6A 5HTIA 3HNGA 4YTFA 2J0KA 4FSRA 5J7HA 3DGKA 3P9JA 4ZSJA 4IIRA 3R7IA 4F70A 3MGYA 2XNOA 4DEAA 3O71A 4FNYA 4ORKA 3EKKA 4GG7A 5E1EA 4BDFA 4G3CA 4HPUE 2H8HA 4BCJA 3PXRA 3CSVA 1PXIA 4ITIA 3OXTA 4AW5A 3K3JA 3RNYA 1YDTE 2R3MA 4RIXA 4BCPA 4DITA 4O86A 2BDFA 4ZSEA 3F5GA 4GU9A 5HG5A 4I6BA 4UYAA 5J9ZA 3KXZA 4D2VA 3MWUA 2CJMA 2HZ0A 3R7UA 3ZYAA 5HG8A 2XNMA 3DPKA 5T68A 2JKOA 3MV5A 1SVEA 3TUBA 4AZSA 2YISA 4DG0E 1OL6A 3FBVA 4P2KA 2WB8A 3FZPA 2YA9A 3BU3A 5DWRA 5GJGA 1MRVA 3P86A 5KE0A 1WVYA 4I0RA 4AT4A 1XH8A 5I9WA 5CS6A 2PU8A 1PF8A 4FV4A 5A4QA 1XH7A 2NRYA 4QMXA 5TO8A 3B2WA 3OMVA 3PG3A 4RIYA 5CLPA 3ZUTA 3FI8A 4ACHA 4AZWA 4PL3A 2Z8CA 4QYYA 1KE6A 3TV6A 3G6HA 1FBNA 3OY3A 2GHMA 4XV2A 2YM7A 4LMNA 3HLLA 4CFUA 4FEXA 3UO6A 3R7YA 3IW7A 4YZCA 1YI4A 4MD9E 3GNIB 2VTPA 5EK7A 4EWHA 5KHWA 2XZSA 5K4JA 2J0LA 4PTCA 2PMLX 1Q8YA 2XB7A 3QRUA 2UZUE 3D4QA 4H39A 1LEWA 5CU6A 5FXSA 2I7QA 2BFYA 4R1VA 3ZRKA 1TKIA 2VWXA 5GJFA 1WBWA 4X0MA 2ZM1A 3D94A 2W9ZB 4I92A 5HIBA 4ALVA 5AP6A 2XNGA 4CCBA 3K5VA 2VRXA 4CRSA 3UOKA 4CTBA 1OMWA 1S9IA 3C5IA 3SGCA 3QU0A 1PHKA 2CSNA 4QTBA 3CJFA 4FNXA 3U55A 3BQRA 3ZUVA 4FEQA 2H6DA 5C4LA 2VX0A 3FQEA 2GNLA 1H01A 1Q4LA 1PY5A 3R9NA 2Q83A 3ROCA 2W1ZA 5AP1A 1JKTA 2PHKA 3DQWA 2ITQA 2P4IA 2XA4A 1W0XC 3LW0A 5I3RA 5GZ8A 4UX9A 3MSSA 4FIJA 5AAGA 4GIIA 3RPSA 3Q2JA 3WF8A 3KMUA 2HZNA 4KWPA 5TT7A 4XLVA 4AXAA 1LUFA 3O8UA 3OP5A 1J91A 4E26A 4FYNA 3OWJA 3QTRA 3R7VA 4PDPA 1SNUA 3FY2A 3QTQA 2QKWB 4QMPA 2PVRA 4IBMA 2IW9A 3OXZA 3W18A 3E88A 1H26A 4E6CA 3MFUA 1IA8A 4MXOA 4P7EA 3DBQA 4QQTA 3I6WA 5C8KA 4QNYA 4DCEA 2QQ7A 1NXKA 3S2PA 3PTGA 2JBPA 2ITVA 4XBUA 2JDRA 1P14A 3RPYA 4YUQA 1H07A 4EKKA 3ANRA 3PFQA 4CTCA 3U6JA 4B8LA 4FZ7A 5JKGA 5M4FA 2FGIA 4JBOA 3TUCA 4TN6A 3PA5A 4V01A 2R3PA 4CFFA 1Q99A 3BYMA 4FIEA 4J71A 4CFWA 3CQUA 3KMMA 4FUYA 5HG7A 5DVRA 4L3LA 3VQUA 5J5TA 3MIAA 4DLIA 3DNEA 4O0RA 4JDJA 3VUIA 4EOMA 5B2MA 1XKKA 3UO4A 4DH8A 3LCSA 3EQPA 4FV3A 3V5JA 1KSWA 2X4ZA 3JUHA 4JNWA 3V04A 4ERWA 3BKBA 1ZOEA 4C02A 4KIOA 5M55A 4UMTA 3ZM9A 3LQ5A 3DFAA 4C33A 2B9JA 2Y4IB 5DN3A 3M42A 3D5VA 2OKRA 4KKHA 4GKIA 4DFLA 3FYJX 4QMTA 1JOWB 4DCAA 3ZDUA 4NM5A 4XV3A 2W17A 3UPZA 5CVHA 4JAIA 4ZJVA 3I4BA 4PWNA 5AUVA 2FVDA 3OCSA 3R1QA 5JRQA 4AA4A 4I21A 2R3QA 3T3VA 2IW8A 3VWAA 3ZFXA 4UMPA 5D41A 3VJOA 4MXZA 4USDA 5DMZA 4Y8DA 3IECA 3KXMA 3FLSA 4QP9A 3IOPA 4M68A 4GK2A 2V62A 5TR6A 3UBDA 3WF6A 4C38A 3C4WA 3KXXA 4A07A 3R2YA 2QOIA 2J51A 5JFWA 4GL9A 4X7QA 3DKGA 3TTJA 4ASZA 3F3UA 5KO1A 1BMKA 4ZTLA 3PA3A 4BIBA 3RK7A 3UC4A 5IKWA 5HQ0A 3R01A 3CQWA 2QR8A 3KVWA 4J96A 3ZO1A 2XK6A 3TJDA 2J50A 4PNKA 3A60A 2BKZA 2W99B 1FVRA 1ZY4A 1PRYA 4C3PA 3L9PA 1BUHA 4W4WA 3RI1A 2YIXA 3DAJA 2R3FA 3QQLA 2WTCA 2C6IA 4A7CA 5HX6A 5LCJA 4X2NA 3GC0A 4AOJA 2EXMA 3KFAA 3MA6A 3TNHA 4O2PA 3FKLA 4AOIA 5B7VA 2W06A 2UZEA 4JQ7A 3Q32A 3UP2A 5HLWA 5IH4A 1DAYA 5AR8A 5IZFA 2CHLA 2XBJA 5E8TA 3ID6C 3HV6A 5E8ZA 2C6OA 4FUXA 2PMIA 4D9UA 1UV5A 2YZAA 3GC7A 3MH2A 3AMAA 4I3ZA 1H27A 3TIZA 3VN9A 2VNYA 5HCZA 3QTXA 4BRXA 4G34A 3ORNA 4FV7A 5CX9A 5CXHA 4DGGA 2WIHA 3OBGA 4BYIA 4QT1A 4XV9A 2LGCA 3R7GA 4DH5A 2ZMDA 3EYHA 4HVSA 5J5SA 2G9XA 2HXQA 4D1SA 3ZRMA 4C36A 3TNWA 5L4QA 2I40A 3ORLA 2FB8A 4ZY5A 3BBWA 2VX1A 4CMTA 4JBVA 2W5HA 3PWDA 5DPVA 3NR9A 4ZY4A 4AZFA 3RTPA 5L8JA 3EQGA 3QC9A 1CKJA 2VGOA 3MA3A 4O0UA 4WIHA 4XG4A 5HD7A 5CEQA 5JQ5A 4AS0A 4I4EA 2PL0A 4L53A 3ZO2A 3ACKA 2PE1A 3FKNA 2ETKA 2PMOX 5M08A 2OBJA 2R5TA 3DLZA 3IW8A 3OTUA 2W7XA 3PP1A 2GFCA 1RW8A 2OK1A 4XOZA 4C4GA 3OWLA 2QR7A 5LCKA 2JBOA 4BZNA 2VTQA 4IVAA 3H9OA 5IQCA 2ETRA 2Q0BA 3GUBA 3KK8A 3QWJA 4G3DA 4I20A 4ZTNA 5FQDC 4YLKA 4QTCA 5B0XA 4FKQA 5FDXA 4JG7A 1PMUA 4EHVA 3WOWA 4FE2A 4C58A 4KKGA 1BX6A 3DZQA 3NAXA 4B9DA 4CEGA 5L8KA 5IA2A 3DB8A 5K3YA 4W4YA 5AA9A 3E92A 4JI9A 3RPOA 4PMTA 4GV1A 3AT2A 2ITUA 3KKVA 3WF5A 3SXSA 3JY9A 3F6XA 2EXEA 2YIYA 3OEFX 4FVPA 3IGOA 3RNIA 5K5XA 3MY0A 4D58A 1QL6A 2WPAA 2XMYA 2ZV2A 2NNWB 3NX8A 3RK5A 1CM8A 2HW6A 3GFEA 3WE8A 4AX8A 5IMXA 5FBOA 5L6OA 4HYHA 1KUTA 1V0OA 5CXZA 4YTIA 3QD3A 4RSSA 5AV0A 4X2KA 4DYMA 3Q9XA 4FSTA 4AP7A 4KINA 4E4XA 2B4SB 2OG8A 3MESA 3MFSA 4YPDA 5EFQA 1WFCA 3C13A 4ZXTA 3VUHA 2WEVA 1JPAA 3U9CA 5EI2A 4C4HA 2CMWA 4CV9A 4FV9A 2PULA 3CD8A 3SDJA 5C4KA 3A7IA 3FC1X 4IJ9A 1ERKA 3DBDA 2PVJA 4JOAA 3AD6A 5EI6A 1NY3A 4BDKA 2W1FA 5IQEA 1Q61A 1YW2A 4O0WA 1OBGA 3JVSA 3PIZA 3REPA 2OJJA 2ETMA 4U5JA 3O7LD 4FT3A 4IB5A 3DJ7A 2GDOA 4R77A 3QX4A 3FMEA 3V8SA 3OFMA 5KBRA 4BCKA 1JLUE 3FMDA 1U54A 3EN6A 3R22A 3I5ZA 1W98A 4CGAA 4FKIA 3IKAA 5F1ZA 4C62A 3PXYA 4BDAA 3L9NA 3OOGA 3QGYA 4RZWA 5E8XA 5ETCA 3ITZA 3R83A 3V5WA 4AW0A 4JXFA 4R3PA 4YZDA 2R0UA 3MB6A 3R7EA 4E6DA 4DTKA 3SW4A 4FKJA 2C6DA 3UODA 4XBRA 4FX3A 5FXRA 4DBNA 5D7VA 4DGNA 5CF4A 1XH5A 5BYYA 4FV1A 4WOVA 5A54A 4YJPA 3WYYA 1R39A 4V0GB 5BVFA 4JQEA 2AYPA 3BHYA 2ITPA 3EQCA 3FXWA 3VAPA 3EQBA 2WELA 3NCGA 4O6LA 3VS4A 2FSOX 3LXKA 3KN5A 4O96A 3RHXA 3E7OA 4F0FA 2WMRA 1NVQA 3FEGA 5C01A 4EQCA 5AV4A 2YLFA 4DFYA 4EH7A 3VRYA 2RG5A 5KKRC 2X9FA 3GT8A 1SM2A 3QQUA 4IHPA 4JG8A 4MBLA 5F94A 5IUGA 5DR2A 2ITWA 4MQ2A 4G9RA 3QCSA 2QURA 3UC3A 3Q5ZA 4AT3A 4MXAA 3OZ6A 5KMMA 1FVVA 3EN9A 1M7NA 3ORTA 3OCTA 4E1ZA 2WU6A 3AGMA 1FMKA 2V5QA 4IX5A 4JJRA 4MQ1A 4NFMA 4XYFA 4USEA 5L2WA 3ROYA 1YOLA 2XIXA 2WOUA 4U80A 5B2LA 4FSQA 2Y8OA 4L8MA 1ZYSA 5KHXA 5K9IA 4C4JA 4L45A 5HORA 4J52A 4O7SA 2CNQA 2ERZE 5FEDA 2PUPA 4RA5A 4M12A 2B54A 2R3KA 2WU7A 3ORIA 4HGTA 4IM2A 4NUSA 4QTAA 4XUFA 4YBJA 4EOPA 3AC4A 4BVUA 1DAWA 5I4NA 1SYKA 4FTQA 3PJ2A 3HRBA 4EBVA 2R3HA 5E92A 2VTSA 3MPMA 4C59A 1Q8TA 4CFMA 4FT0A 5G6VA 2GS6A 4KAOA 1XQZA 1DI9A 3NW6A 3EFJA 5I9XA 5HCYA 5EM6A 1IEPA 4OW8A 1SZMA 2R3IA 3KY2A 4M67A 2HW7A 4JAJA 4S30A 1PXOA 4V0GA 3ZMMA 3ZLWA 3WZDA 3A7FA 4UZHA 5LVOA 3BYSA 3TKIA 3DXQA 1VYWA 4FODA 1RE8A 3D2KA 4AFEA 3CBLA 5FM2A 5HNBA 4EJ7A 3MPAA 4RX7A 1WVXA 3L8XA 4A9YA 4EZ7A 2WZJA 4IM3A 4G5PA 4EK4A 3NIZA 3N4UA 2ERKA 4O0VA 3W55A 3D7TB 1QMZA 3PIYA 2E9NA 1CDKA 3MVLA 1Y91A 2Z7SA 3FE3A 4MWHA 4YZMA 3MTFA 1BI7A 1XR1A 3G6GA 1XH9A 5CU4A 2JDOA 3LFDA 2B7AA 2VWBA 1L3RE 4N6ZA 4FR4A 5EYDA 4MBJA 4U3YA 3KRRA 5KCVA 1UA2A 4MXXA 4MYGA 4ZLYA 1ZLTA 2GPHA 4YP8A 2KTYA 1ZOGA 3B2TA 3CD3A 4YC3A 4O91A 3PRFA 1FGKA 4M0YA 1M2RA 4IZAA 5FXQA 5GNKA 1U4DA 2P55A 3C1XA 2W5BA 5AJQA 4DEIA 2RF9A 3SV0A 3CXWA 4AN2A 2XKFA 4IXPA 4YC8A 5D12A 1IAJA 2E9UA 4I94A 4AQCA 5DOSA 5HLNA 3UMXA 4B99A 1OKWA 3Q4CA 1F5QA 2FO0A 2VTRA 2Z7QA 4TYEA 3PSDA 4UZDA 2G2HA 4QPSA 5I3OA 4E4MA 2YM4A 5CNNA 2W5AA 4KABA 1WBPA 4M13A 4AA0A 3S95A 3LLTA 4G17A 4DN5A 1KWPA 5JSMA 4FTKA 4NT4A 4P5QA 4UXQA 5HNGA 2CN8A 3E8NA 5HTBA 1FPUA 3MFTA 3ET7A 4X3FB 3LKMA 4YO4A 2F7ZE 1V0BA 3FZ1A 5CT7A 5DGZA 2BAJA 4IWPA 2VNWA 2R3LA 4BKZA 3R1YA 4O82A 3D7TA 4BBMA 4GEOA 2J9MA 3S4QA 3FDNA 4IEBA 3NUNA 2GTNA 4P5ZA 4DLJA 2VV9A 5G1XA 3N4TA 4F63A 4N57A 1PXNA 4GFOA 4O7ZA 4EZ3A 3DB6A 3HMNA 2I0EA 3VHKA 3C0IA 1GZ8A 3GVUA 3PG1A 4KA3A 3ZC6A 3Q53A 4LL5A 4RWKA 2HYYA 3ODYX 3HMPA 3ZZWA 2QO2A 3FSKA 3ERKA 2RL5A 4IACA 4O7TA 4R1YA 4QMNA 1PKDA 4X2GA 2GS7A 4R7HA 3ELJA 3HL7A 4R3CA 5M56A 3RM7A 4I6HA 2XYNA 3FC2A 3IOKA 3BHHA 2HWPA 2X9EA 4GUBA 1YOMA 2IVSA 3FMHA 4BFMA 2E9OA 4KBAA 2OH0E 2R3GA 4KIQA 4J97A 1BYGA 2OW3A 3OF0A 4QMWA 3VS1A 5AAEA 3F2AA 2CKQA 3BRBA 3G0EA 2KULA 3D15A 3FUPA 1OIRA 4RJ3A 3QUPA 4ANSA 4ASEA 4MD7E 2B53A 4HVIA 5IQHA 4O7LA 3F5XA 3VIDA 4C4EA 2CNVA 1A06A 2XYUA 4KS7A 5IMEA 3OUNB 3P7CA 4A4LA 4EH6A 4DFZE 4V04A 4MXYA 4RQKA 3OWPA 4OTWA 4X3FA 4UBAA 5IA0A 5EH0A 1OBDA 1JNKA 4LRKA 4FZDB 5C26A 4QP7A 2WMTA 4MVFA 5D10A 3ZSIA 3HRFA 3RMFA 3QC4A 2J0IA 4YJTA 4A9RA 5C8MA 3G5DA 1XBAA 4WD5A 4IANA 4GU6A 4C57A 5I5ZA 3NUXA 3ZLXA 3LE6A 2QHMA 2XIYA 2QD9A 4DEGA 3OOMA 4G3GA 3L8VA 5J8IA 4FOCA 4FL3A 1YHWA 4QMSA 4OTHA 3M11A 5EHLA 4RC2A 5DA3A 4FKTA 5EDQA 4FTUA 4O1OA 3DQXA 5HESA 4D4YA 4PDYA 4KRCA 1VYZA 4XV1A 3EB0A 4YHJA 4BI2A 3TTIA 1JSUA 2HAKA 4OBOA 3I1AA 1UWJA 3KK9A 3V51A 3DXPA 2J2IB 4G16A 3CPBA 4C34A 2BMCA 2UW6A 2W1EA 3QFVA 1LP4A 4UWYA 5L6PA 4N6YA 4G3FA 3R02A 2PZIA 3ENHA 4I5MA 4KKEA 3ULIA 3W2SA 1YQJA 4K2RA 4D55A 3V5QA 4Q5HA 2ZB0A 5JGDA 4C7TA 5CNOA 1UKIA 4J1RA 3WIGA 3GU8A 4TY1A 5AR5A 3C4ZA 4OT6A 5AP4A 4EONA 5M09A 2QU5A 4YBKA 1GZOA 1Z9XA 4U0IA 2UW8A 4QP6A 2RG6A 4QMOA 2VTIA 4H3QA 4XLIA 4DEHA 4UN0C 3V5TA 5H8BA 4LMUA 5E1SA 3RPRA 1UWHA 3V5PA 3DZOA 4EOIA 2YAAA 2P2IA 4KIPA 2BTSA 3EFLA 3WI6A 2C5NA 2V7OA 5AV1A 2O5KA 3CPCA 4B0GA 4BZDA 4ZP5A 2X8IA 4AG8A 4BCOA 4ZMEA 3FMMA 2UZWE 2VAGA 4D28A 1PMVA 2VD5A 4OTDA 1E1VA 1V0PA 3EQHA 3NNWA 4YURA 2CCHA 3DT1A 2O3PA 4I6QA 2X39A 2PWLA 5ANJA 5BUEA 2PPQA 4I24A 3LFAA 4FKSA 4F0GA 5BVNA 5J1VA 4EOJA 2UV2A 2CN5A 2X6EA 3NYOA 3RINA 3A61A 3FQHA 2RFEA 3WZEA 3UYTA 1O6YA 3KXHA 4IVBA 2VWWA 2WTKB 5BVWA 3EH9A 3PLAE 4GSBA 3ZTXA 2GHLA 4FTIA 4EYJA 5A46A 5GIOE 3MVJA 2X4FA 3I6UA 4DTBA 3HP2A 4YLJA 4CXAA 2UZLA 3CLYA 2XNBA 3G2FA 4OTIA 3C4CA 4RGJA 4LOPA 3BE2A 1GY3A 3QZIA 2ITNA 4G31A 4IJPA 1MQ4A 2XRWA 3KA0A 4L42A 3POOA 3QCQA 4BDIA 2IW6A 3OT3A 2VUWA 1Q3DA 4AW1A 3UZRA 3T8OA 3HV7A 2X1NA 4UMRA 4OAUC 4BTKA 4ZLOA 3DDPA 2BHHA 4Q5EA 1SVGA 4AGUA 1YOJA 4EOOA 5D11A 4IWQA 3F2RA 4IADA 1O6LA 1VZOA 2B52A 2PUUA 3ZDIA 4MK0A 2C4GA 3F82A 4LRMA 5DI1A 4FC0A 4EJNA 5H8EA 3R63A 4HCTA 5DYJA 3TZMA 3IW5A 1TQPA 2OJ9A 5CVGA 2R3RA 3N51A 4YMJA 1GIHA 3EKNA 3MH1A 5CEPA 4DT9A 3F66A 4APPA 4ZS0A 4BICA 1ZMUA 5IQAA 2X8EA 4AE9A 2W1DA 3HP5A 4D2TA 5KZIA 4R6VA 4E7WA 5HZNA 4IWOA 3NVMB 3NS9A 4O6EA 4NK9A 4RWJA 5J79A 4Z55A 2ZJWA 4HNFA 3VUGA 2VN9A 2SRCA 1KOAA 4GYIA 2UW0A 4IDTA 4DC2A 2Y0AA 2ZAZA 3NYVA 2OJIA 2VWIA 3OW4A 3RGFA 5IU2A 3ALOA 4QMMA 4A9SA 4NTSA 4F99A 4AGCA 3QCYA 4F9BA 2X81A 2PYWA 4KSQA 2VGPA 4RIWB 3WZKA 2XNPA 3QXOA 4WRSA 4CKIA 5EW9A 5BYZA 1F0QA 2XKCA 3Q9ZA 5E8WA 5AR3A 3UE4A 4IW0A 1OIQA 3OUKA 5AAFA 5IPJA 2QG7A 3KF4A 3NPCA 4C3RA 3N4VA 4RVMA 4UWCA 4XG7A 4XS2A 3CS9A 4GJ2A 2BZKB 4CMUA 4MHAA 4WNMA 2XP2A 3ZFYA 3SLSA 3LFFA 3QD4A 4ENYA 4LUDA 2WEIA 2XK3A 3P23A 2HOGA 5LWNA 2BROA 4IVCA 3THBA 1KE5A 1TVOA 2F9GA 3UP7A 4WG3A 2J90A 3ORXA 2WIPA 2HY81 2BCJA 5DR9A 2G15A 2RKUA 2X7GA 4PMSA 4GUEA 3GFWA 2VO6A 2FSLX 3HGKA 4FEUA 3QHWA 4C61A 4DG2E 3HUCA 2GTMA 4FSMA 4QNAA 4APCA 4PPBA 3MYGA 4FNWA 4RMZA 4D1XA 5HX8A 2WMXA 5DFPA 1U59A 4WG4A 2X7FA 4DE4A 1B6CB 1AD5A 3E7VA 3FAAA 4ZTRA 3OCBA 4PP9A 3IO7A 3EQRA 4RG0A 4XJ0A 4GMYA 4IZ5A 3ACJA 4WNKA 4EOLA 3KMWA 4EH3A 5C8NA 3DBEA 3F3WA 2C6TA 4UV0A 3QRIA 5A3XA 2QVSE 2A0CX 3A99A 2J7TA 4M84A 5E8UA 5HO6A 4O0SA 4ZZMA 5AUTA 4JIKA 4KUJA 4GH2A 3PDTA 4ACDA 3DJ6A 4KNBA 4U40A 5IEYA 4R7BA 3SG9A 4YSJA 3U8WA 5BVEA 3E93A 4BWXA 1TQMA 3VS7A 4F65A 3NUAA 5A6NA 5DRDA 3RZBA 4YGAA 4O21A 4EC8A 5A14A 1FGIA 4XG6A 1H0VA 2FH9A 2X2MA 4RIWA 1PW2A 2Y7JA 4S31A 5ACBC 3BWFA 1HOWA 3DXNA 3WYXA 3ZXZA 3PSCA 3AC3A 3KGAA 3C9WA 4PQNA 3QTIA 4UMUA 3Q52A 3R00A 3C50A 3LFBA 3VBVA 5CSHA 2C6EA 4GT4A 3VJNA 2VWZA 3CKXA 4LI5A 4ACGA 4ASDA 3MIYA 2YCRA 4A4OA 3UZTA 1KE9A 2GFSA 3IQ7A 3SKCA 3QXPA 2VO3A 4TKSA 1GOLA 4A9TA 5BVKA 1GNGA 1HCKA 3OW3A 3PVBA 3TNIA 3ENMA 4MCVA 2WQBA 4NH1A 3NEWA 5L8LA 5IA4A 2ZV8A 1URCA 4MXCA 4QP8A 5CI7A 4IAZA 5BMSA 3PLSA 5ETAA 3NIEA 3SQQA 5CANA 2V22A 4WG5A 5FTOA 4C3FA 5K0XA 2GSFA 4MH7A 4GFMA 3GC9A 5C27A 4J98A 3MTLA 4GVJA 4XP2A 1SVHA 4FG8A 4OR5A 3QQKA 5ITAA 5JFVA 2YJRA 1X8BA 4QPMA 3BYOA 4YU2A 1K9AA 1CMKE 1FMOE 3UMWA 2PE0A 2QLQA 2X2LA 3EMGA 4DGLC 5EG3A 3ORPA 5HOAA 4F7SA 4F9AA 3BU6A 2JIVA 3R30A 1PXLA 2Z2WA 1LPUA 2ESMA 4PPCA 5CVFA 3W16A 4DT8A 4FOBA 1OPKA 2BRBA 4EK8A 4EK3A 3RJCA 2ZMCA 3E64A 3CR0A 4DH3A 4BL1A 1G5SA 3PVGA 5J9YA 1OKYA 4GK4A 4YJRA 4I5HA 3SW7A 1YWNA 2XJ1A 5KBQA 2BKKA 2JKQA 3FLNC 4S32A 3V8WA 3NWWA 4XH6A 3FY0A 5CALA 3VRZA 3TM0A 3D83A 3QALE 1J3HA 1URWA 5ANEA 4LYNA 4K77A 2WFYA 3R71A 4YLLA 2CGVA 2X7OA 2WKMA 3CTQA 3COKA 5J1WA 1WCCA 2PY3A 2R3OA 2HCKA 3VHEA 3VQHA 3GCPA 4JG6A 4OTPA 4Y73A 2C47A 4JRNA 4RC3A 5BYLA 5BX0A 3HA8A 2PVNA 4NCTA 5IA3A 3WF9A 5M51A 2JDSA 2W1GA 4IFCA 5ANIA 3O17A 3ZUUA 3HAMA 2CKPA 1XH4A 3ZOSA 3UIUA 4BGQA 3O0GA 4BB4A 4DFBA 2PZYA 3PPKA 4NIFB 2YCFA 1VJYA 1Q8UA 4FT5A 3W2QA 2YWPA 4BGHA 1M2PA 4O7YA 3G90X 4NM0A 2C6LA 4X3JA 3Q4TA 2QLUA 3TWJA 2YAKA 3SD0A 2P2HA 3CKWA 3EN7A 3UVPA 3DBFA 3KCFA 4FK6A 5J87A 5IQBA 3VBXA 4MTAA 2OF2A 4B7TA 4RX9A 3VO3A 5CEIA 1OGUA 3EQIA 3F2NA 2GCDA 4G6OA 1RJBA 5M4UA 3RCDA 1J7LA 3FI2A 4HPTE 4IX4A 1YXUA 5EYCA 4HGLA 4RBLA 2A19B 3DKOA 5EOLA 4WUAA 3FI4A 2R2PA 3BV2A 1OL7A 5IDNA 4HGEA 4M69B 2PK9A 5AV2A 5EQPA 3QUEA 5KMNA 1PXPA 4JDHA 4ANBA 3VS5A 2C1AA 4CYIA 4ASXA 5LVPA 3PZHA 3R0TA 2YIWA 3D14A 3PY3A 4NJ3A 3RWQA 5M4CA 3DV3A 4PPAA 4I0SA 3COIA 4F09A 4EYMA 4J53A 4D0WA 4U41A 3IG7A 1Q41A 1UU9A 2R64A 3U87A 3KF7A 3RVGA 2E9PA 4WA9A 3AC5A 3TIYA 3EHAA 4EBWA 1YVJA 5BVDA 3QX2A 3WZUA 2YHVA 4AW2A 2XKEA 3BLQA 3R1NA 3W8LA 3KRXA 1H08A 3OBJA 3FJQE 2O63A 2OFUA 4NIFA 4QYHA 4E3CA 1OB3A 2QOOA 2HZ4A 1OKZA 3DKFA 3GOKA 3LAUA 3VBYA 4H36A 4CT1A 4CKRA 3O2MA 1NA7A 5EQEA 1PYEA 3OROA 4AAAA 4YTHA 4TYHB 4AWIA 5DE2A 3Q6UA 3BPRA 3BEGA 3C4XA 4YJOA 5IG1A 5L2TA 3H9RA 3HYHA 4K6ZA 5BMMA 3NDMA 2WMBA 4JLCA 2O2UA 4BCHA 2FA2A 1KE7A 2W4OA 3HDNA 4FGRA 5L6WL 2PVFA 5EOBA 3CQEA 3PRIA 3C7QA 4FIGA 4GYGA 2VTLA 3CY2A 3UYSA 2B9FA 2HK5A 2DUVA 4O0TA 5AUUA 3BWJA 4TZRA 1R0PA 2VTOA 4LUEA 5J9LA 2YCQA 2YFXA 2ITTA 3QZFA 3QCXA 2C30A 3KU2A 4M69A 4NW6A 3FLQA 2H34A 3QRKA 4FTRA 4U6RA 1XJDA 4L00A 5CSVA 1ZXEA 4WSQA 3A8XA 5EM8A 5AUXA 4AFJA 3D0EA 4BTMA 4C35A 4CFVA 4EH8A 4ERKA 3I7BA 3O8TA 5ICPA 4G2FA 2IVVA 1S9JA 3EFWA 1GIJA 2ONLA 3ORMA 4Y72A 1PXMA 4NWMA 3EQFA 4KB8A 3BLRA 3CIKA 1J7IA 3FI3A 2XIZA 3KREA 4FKOA 3U9NA 5KX8A 4O81A 4KSPA 3UOJA 2FYSA 2Y6OA 2OZAB 4I1ZA 5JGAA 2V0DA 1IR3A 1JQHA 2WNTA 2Z60A 4HYIA 4HVGA 4QD6A 2REIA 1O9UA 4ALWA 4HZSA 3LHJA 5ANDA 5HEZA 2ACXA 1NT2A 3AD4A 3VS3A 3WF7A 4I41A 2XK4A 4MWIA 3L1SA 4ZTHA 1UNHA 2GU8A 2WMSA 3UG1A 3NNVA 5FG8A 2BDWA 3EL7A 3JPVA 3QTSA 3IW6A 4ANLA 5FBNC 1YHSA 3R8UA 4RIOA 4F7LA 4TYHA 4O7VA 3CGOA 4A06A 4YHFA 1XO2B 5HU9A 3DTWA 4JDIA 3O96A 5H3QA 1MP8A 1L8TA 1JSTA 3TL8A 4BF2A 3HV4A 2JIUA 3PJ1A 1K3AA 5CYIA 2EB3A 4G1WA 5DRBA 3COHA 3QKMA 1OI9A 1ZMVA 5KUPA 5JFSA 3UQFA 2XM9A 5I9VA 4M15A 1ZZLA 4P4CA 5HI2A 5CAVA 4FK3A 5CSWA 4B4LA 4O7RA 1P2AA 4QO9A 3ORZA 3AMYA 5DT0A 3BV3A 3E62A 5EHYA 3F7WA 4ZTQA 2WQOA 4BGGA 3ZU7A 1XBBA 3UNZA 2B55A 1YHVA 5HE0A 3TNQB 4C37A 4FMQA 2WD1A 4TT7A 3TKUA 2OIQA 2YERA 2Z02A 1GJOA 4IQ6A 4K18A 3AT3A 3U54A 5AP5A 3NW7A 2OZAA 3LFCA 3IDBA 3ULZA 2QKRA 1H28A 1AGWA 5DBXA 1PJKA 5CEMA 4U8ZA 3BLHA 3LZBA 4CNHA 5ANGA 4XP0A 1GAGA 2YM8A 4M3QA 2W96B 4FT7A 1H1WA 4LGGA 4ID7A 2OO8X 4IC7A 4KBCA 3NAYA 5LMKA 5HLPA 4BYJA 4YJQA 4H1MA 3BCEA 3ODZX 4M7IA 1GIIA 1YI3A 4ZY6A 3I79A 3DDQA 1E9HA 4D2PA 2IVUA 3D2IA 3DBCA 5E8VA 4ANMA 2A1AB 3FPMA 4OT5A 4GKHA 2WHBA 4JBQA 4L46A 5CAPA 4GS6A 4JBPA 4BDJA 1OITA 2A2AA 5BUJA 5LVLA 2C5YA 5CQWA 5CENA 5AUYA 2WMQA 4YJNA 2XS0A 5IQIA 4DF3A 5EYKA 3V01A 4MF0A 2YN8A 2C6MA 4YNEA 3TEIA 2GMXA 2C5OA 2UZNA 2VTNA 3IK3A 3SRVB 1J1BA 2ZV7A 2V7AA 2UW5A 2ITYA 5JMSA 4BCGA 4X6QC 4I4FA 1REKA 4ITHA 4CZTA 3PE2A 3QA0A 1ZMWA 3KULB 4FTNA 3OT8A 4M14A 3UIBA 2XVDA 4U3ZA 5FUTA 5FRIA 5JQ8A 4EORA 3NNUA 2XK8A 4FGBA 4NEUA 4QP1A 4WT6A 2BIKB 2NO3A 4BTFA 4H58A 4R5SA 4XG9A 2G1TA 5EQYA 4ZSAA 4BDHA 2JDVA 4BI0A 2CCIA 3F61A 1YRPA 3PPZA 3OY1A 4IMYA 4TXCA 2BRMA 4UMQA 4FL2A 2GNIA 2BZJA 2LAVA 5L3AA 2UUEA 4Y85A 5CU2A 4IVDA 4CQEA 1CTPE 3NLBA 2J0JA 1H1SA 4AZVA 1JBPE 5BVOA 4XNEA 5CEOA 4XMOA 5E9EA 1QPDA 4D4RA 3B8RA 4CG8A 4IZYA 2BRNA 3OD6X 4EC9A 3CP9A 5M57A 3ZFMA 3MVMA 3GCVA 4FICA 4K33A
chains in the Genus database with same CATH superfamily
3QRJA 1OZ1A 4M8TA 3R2BA 3F69A 2NPQA 3BGPA 4IAFA 4PV0A 5C03A 4A4XA 3LFNA 4M66A 5CF8A 2YEXA 4EHZA 4JDKA 4F6SA 5EW3A 2ZV9A 2G01A 4ACMA 2VTHA 4IDVA 4P90A 3ZH8A 4A9UA 2PE2A 4U79A 3ANQA 4FV0A 3SXRA 4Y5QA 3VW8A 4DAWA 5AP7A 4JRVA 3C5UA 5E8YA 5L2QA 4QTEA 5GINE 2OIDA 3P08A 3P78A 3HX4A 4EOKA 2QNJA 2XRUA 4DA5A 5TE0A 4S2ZA 2OWBA 4L3JA 1BL7A 3OG7A 3UOLA 5GZAA 3TDVA 3KULA 3GC8A 1JKSA 3HUBA 4NYEA 4GW8A 2F4JA 4EUUA 3HV5A 2IZTA 2W1IA 2Y4IC 4ITJA 1STCE 4IAYA 1OUYA 2YM3A 3WE4A 4C2WA 3D9VA 4O0XA 4JL9A 3W2CA 3W2RA 3E8EA 4HJOA 3LFQA 3VBTA 4EZ5A 1BI8A 1OECA 2DYLA 4EK6A 2HIWA 2PVKA 3KRWA 4QMQA 2ZDTA 4BHZA 1REJA 3G9NA 2PZ5A 3RBWA 2R7IA 2RSVA 4PRJA 4QQCA 5JFXA 5E90A 2HY0A 3LJ2A 4LFIA 3F5PA 3PY1A 4XEYA 3S0OA 3LM0A 1UKHA 4J7BA 4U43A 5HCXA 3C4EA 3FXXA 1JAMA 2WTIA 3PE1A 4LQMA 3NUUA 3A62A 2OIBA 3L8SA 3MVHA 3HMOA 4BI1A 4F9YA 2QG5A 1ZYCA 4MNFA 1G8SA 2CKEA 2VTMA 4RLKA 1XH6A 3A2CA 4FA2A 4EH5A 3PZEA 2VO7A 2WMVA 4HYSA 3MFRA 1WMKA 3UQCA 1OVEA 2QHNA 1YWVA 3OS3A 3VF9A 4Y83A 1P4FA 2YDJA 3Q04A 4GK3A 1MRUA 1EH4A 5BUIA 5M4IA 4Y95A 3O51A 4ZTMA 3NW5A 5A4TA 5KMLA 3JVRA 4FRFA 2WMAA 5CTPA 2XEZA 3KN6A 4WNOA 3R8LA 4ZZNA 3RAHA 1SMHA 3EIDA 3LVPA 2XH5A 3OVVA 4R3RA 3BLAA 4MF1A 1LEZA 5CF5A 1IAHA 2Z7RA 2G2FA 5CAUA 1P4OA 2OSCA 3RPVA 1R3CA 1ZAOA 1DM2A 4OTRA 4UY9A 4DBXA 4XG3A 3R8ZA 3HVCA 5CY3A 2ZM4A 1KV2A 1WBOA 4AXEA 3EOCA 3JR1A 4O7NA 1ZZ2A 4IX3A 5AIRA 2JKMA 3A8WA 4KRDA 1K2PA 4HW7A 5BNJA 3BHVA 5FDPA 3PP0A 2BVAA 3I60A 4QP4A 3HEGA 1YXVA 4E4NA 3UQGA 2WTVA 5EM7A 4QYEA 4FSNA 5ANKA 5LQFA 2ITXA 4F6UA 1PXKA 3UZPA 3VUKA 2A27A 5B2KA 1OM1A 3N9XA 5KMJA 2BAKA 1P5EA 3OCGA 1OIYA 1G8KA 4EOSA 1IRKA 3CEKA 4RWLA 5HG9A 3PJ8A 2GQGA 3ZSGA 3JY0A 3QWKA 4BHNA 5F4NA 2FSTX 2XAMA 3NRMA 4XRJA 3LXNA 3DCVA 2P3GX 5A9UA 4DGOA 3CE3A 3UVRA 5AV3A 3FYKX 5FGKA 4CFXA 2QC6A 3NGAA 3R8PA 2ONLC 3EN4A 1H1PA 2PSQA 4LV8A 1A9UA 4F64A 4G9CA 3EJ1A 3QHRA 4PP7A 3Q2MA 1Y8GA 2BRGA 4OTQA 3BL7A 3O23A 4I22A 4C2VA 2FSMX 4TYIA 5JZNA 5CU3A 3V6SA 4L7FA 3QTUA 4NM3A 4OAVB 2QOKA 3JYAA 4LGDA 4FI1A 5DHJA 2YIRA 4WHZA 4E93A 4GRBA 4FZ6A 3TUDA 2UZBA 3QGWA 5J95A 5C9CA 3D5WA 5LMBA 3U4WA 1Y8YA 5LVNA 2C0IA 4EEVA 4HZRA 1YDRE 2QODA 4FTLA 5CF6A 4EH2A 3DAEA 3VBQA 4XG2A 2VU3A 3FHIA 4U42A 4YO6A 2CLQA 4YJVA 4CQGA 4DDIA 1W83A 2I0VA 2Q0NA 2IJMA 4WBOA 4ZEGA 3H10A 2XKDA 3FQSA 5CZIA 1VEBA 3W0SA 1PXJA 4XG8A 5FEEA 4DHFA 4ZMFA 2G2IA 4L52A 5H2UA 3FXZA 1OL1A 4DFXE 2WTJA 3NYXA 3TXOA 4O7WA 5A4LA 4O27B 1AQ1A 3GU7A 4FYOA 5TF9A 3POZA 3U4UA 4FV8A 4TPTA 4F1TA 5DEYA 4NZWB 4YR8A 4BR3A 3AC8A 1H8FA 2YACA 3ZO4A 3RAKA 5AP0A 4X6RA 1R0EA 3RALA 5AP3A 3IGGA 2JC6A 3NNXA 3AOXA 1ATPE 5EW8A 3W2OA 3F9NA 1A48A 1YKRA 1BKXA 1ZYDA 3OXIA 2YCSA 4O1PA 3FZRA 1Q8ZA 3K3IA 1WBVA 3QYZA 3MI9A 3V6RA 3AD5A 1WBTA 2W05A 3BIZA 5AX9A 4AT5A 4RZVA 2A4LA 4HVDA 1Z57A 3FV8A 4FBXA 1QPEA 5FTQA 2XCHA 2GHGA 4M0ZA 4BDBA 4FNZA 3CTHA 4YC6A 4G3EA 5H8GA 4BCQA 1OUKA 2UZVA 4BCIA 5DNRA 1UU8A 3G0FA 3A4OX 1H0WA 2IEWA 2JFMA 4MKCA 4PX6A 4D1ZA 5KKRB 4AXCA 4WKQA 4QMYA 4FKRA 4YHTA 3UDBA 4WUNA 3ZONA 2YWVA 1KV1A 5LMKC 2PVMA 3AG9A 3DJ5A 4ARKA 5BV3A 3VNTA 4HNIA 3F3TA 5EDPA 4ONAA 3R9RA 2UZTA 4E6AA 1WVWA 3VS2A 2ZB1A 2RFNA 4IB3A 4TNDA 3SHEA 3GU4A 3Q9YA 5AIKA 4RA4A 2CDZA 3QD2B 4IAKA 3UPXA 4LGHA 3CTJA 2VWYA 1ZARA 3RAIA 2R4BA 3KIOC 5JEBA 3IPHA 3UG2A 4EH9A 2OXYA 4KD1A 1TQIA 3VULA 2GQRA 2I6LA 4CFNA 3W32A 3FL4A 3Q6WA 4GIHA 1WZYA 2B9HA 5AM7A 4DFUA 3OEZA 4OTFA 3B8QA 3BEAA 3GU5A 4AGWA 5DEWA 4AZEA 1ND4A 3TKHA 3L9LA 2R0IA 4M97A 3ALNA 5FEQA 4E5BA 2I0HA 3VW6A 1R1WA 1UVRA 1QCFA 4ENXA 2YM5A 4FSYA 4FTAA 4XOYA 2OGVA 1JKKA 2YDKA 3R28A 4HVHA 4FKLA 4LOOA 3ZM4A 1Q24A 2UVXA 4J95A 3DA6A 5EI8A 3SAYA 3PUPA 4PL4A 4RX8A 3P79A 5HNIX 4ANNA 4DEBA 2IZSA 2PVHA 4IB1A 5GIPE 4W8DA 5EM5A 5C1QB 4GFGA 3RCJA 4J8NA 3MJ1A 5LMAA 1JVPP 4CRLA 4QMZA 4FKPA 2PZRA 4AXDA 4B8MA 4FSWA 2EU9A 4J99A 4RWIA 5ETFA 4D5HA 3U6HA 3ATTA 5AR2A 3VBWA 3ORKA 2YLEA 5KZ0A 1YWRA 4PUZA 3CJGA 3Q4ZA 2QOFA 3RAWA 3GU6A 4TW9A 4EUTA 5EKOA 1UNGA 4Z7HA 3A7JA 4AACA 3TN8A 2XIRA 4BCMA 1W8CA 3S1HA 3A7HA 4G6LA 3UDZA 3RWPA 3T9IA 3SVVA 4B6LA 4OBPA 3BGZA 4RC4A 5IF1A 1G3NA 1DS5A 4FIHA 4FTJA 4CMOA 4TNBA 5AFVA 1H25A 2OICA 2W9FB 2ZM3A 1U46A 3QZHA 5M44A 3MN3A 3H0YA 3PXKA 3QQFA 4TYGA 4Z3VA 5CSPA 5CT0A 4EKLA 4Z9LA 3QAME 3R04A 5HGIA 4EQMA 4UWBA 3QKKA 2WAJA 4C8BA 3KC3A 4I5PA 3R6XA 3NCZA 1FOTA 2PVLA 3W2PA 2WMWA 4EQUA 3KL8A 4KIKB 2UVYA 4RVKA 1MRYA 4TWOA 2W4KA 4AA5A 3LM5A 3MB7A 4FTMA 2RGPA 5D9HA 4JX3A 3FMLA 3AQVA 5E8SA 2C0OA 3LJ0A 4U97A 2QO9A 2RFSA 4EH4A 4L68A 3DOGA 2QOBA 4Q9SA 3SC1A 3VUDA 3ZC5A 4F1MA 1YI6A 4D4VA 3TV4A 3IONA 3K54A 4IX6A 1H24A 4RT7A 2IO6A 4CZUA 5L2IA 1RQQA 3QKLA 4RJ6A 4DEEA 4CLIA 2OF4A 5A4CA 3LMHA 1ZY5A 2GNFA 5K5NA 3E3PA 1M17A 2HWOA 2F2CB 3R9HA 2BALA 3M1SA 3HA6A 3DTCA 4GJ3A 1H00A 4E5WA 4YTCA 3R1SA 2VWUA 1WAKA 4GT5A 4II5A 5T6KA 3MPTA 4F9CA 3KRLA 4Z7GA 4C4IA 1H4LA 4AOTA 3E8DA 4FZAB 3BX5A 2WOTA 1IG1A 3TACA 5TOZA 1IA9A 4C4FA 3GCQA 4GG5A 3P5JC 3NVKI 4TWPA 1Q8WA 2EWAA 5K4IA 4QRCA 4YPSA 4TTHB 4X2FA 5HICA 1O6KA 3BHUA 3AGLA 4EL9A 1CSNA 3MJ2A 4X3FC 2IG7A 5HIDA 2RFDA 3ZO3A 3DU8A 4O0YA 5CAOA 4CSVA 4FEWA 2IWIA 4HGSA 4ANOA 3PY0A 3MH3A 1JWHA 4QMLA 5CZHA 4ZS4A 4UB7A 4F4PA 1G8AA 3I5NA 2WTWA 4DH7A 3I81A 1RDQE 3CCNA 4QYGA 4DTAA 2BIYA 4ZJJA 1Y6AA 4D9TA 3AMBA 4E8AA 3EYGA 4KIKA 2Z7LA 4NW5A 4L7SA 4G6NA 4DGMA 5KMOA 2J0MB 3W0OA 3E8CA 4HYUA 3GI3A 3TT0A 3Q60A 4D5KA 4BC6A 3SA0A 3F5UA 2HZIA 3HECA 4LG4A 3VS0A 4BDEA 2WMUA 1OL2A 3NYNA 3TV7A 4ZZOA 3O50A 3PWYA 4ZLZA 3UNKA 2UW7A 3DKCA 3I7CA 3VONA 2XF0A 5AP2A 3ZBFA 3LMGA 3RK9A 2H96A 4EHGA 5AM6A 3UIMA 4O84A 4AUAA 1ZYLA 3HZTA 4D0XA 2UW4A 3ZSHA 5E4HA 2DWBA 2BTRA 3BZ3A 5JZJA 2VTTA 3NFGB 3W33A 4TWNA 3LFSA 3ZRLA 5AMNA 4QP3A 5F9EA 3QLFA 5HVYA 2AC3A 4FG9A 3QA8A 2F49A 5AWMA 3PJCA 1BL6A 4LM5A 5HBHA 3UIXA 4AU8A 3LJ1A 4N70A 2A98A 2VZ6A 3R73A 4V05A 4Q9ZA 3O8PA 4CT2A 1CKIA 2C0TA 4IE9A 4IAAA 5T3QA 4L44A 4PF4A 5JGBA 3FKOA 4Y46A 1XMMA 1BLXA 2C1BA 2WQMA 4BTJA 3DLSA 3R7OA 4IH8A 5AX3A 1Q3WA 1Y57A 3NUSA 2OH4A 4K11A 4L9IA 1E1XA 4QTDA 4RJ4A 4TRLA 3ZLSA 4PMPA 2C6KA 4KS8A 5IQGA 2BILB 2X6DA 2YDIA 1QPJA 3MDYA 3VUMA 5BPYA 5A4EA 1YXSA 4OUCA 4NL0A 5DR6A 1ZRZA 4TYJA 4FVRA 5CU0A 4FG7A 4E20A 1IASA 3K5UA 1W2CA 2F7EE 3AC1A 3MY1A 4RX5A 2OJGA 3HAVA 3W1FA 2IN6A 4FV2A 5HKMA 4PTGA 3BI6A 3FLZA 4JX7A 2YABA 1Y6BA 3FMJA 1OL5A 5DG5A 2X8DA 3UTOA 3V5LA 1WBNA 4E5AX 1PMEA 3D5XA 2J6MA 4R8QA 5FWKK 4FF8A 3HMIA 4X21A 3OTVA 3RZFA 4E73A 3UO5A 2W1HA 3PVWA 4F7NA 5I9UA 1KE8A 3CGFA 4H3PA 4L67A 3PXZA 4CCUA 3S00A 4ZIMA 5HE1A 5I9ZA 5CEKA 2W1CA 3D7ZA 3VS6A 4FKUA 1U54B 5IA1A 4ZSGA 3AC2A 3PPJA 3PXQA 4BBFA 5IEXA 3T3UA 4QMUA 3Q3BA 1U5RA 1W2DA 1M14A 3LCOA 3P5KA 4PTEA 2EXCX 3OWKA 3LCTA 4L01A 4EOQA 5LWMA 1WBSA 3KCKA 3KEXA 4NKSA 3FSFA 3PJ3A 2BHEA 1FVTA 1PYXA 3PVUA 3AXWA 4RFMA 1NVRA 4ZTSA 4K8AA 3WBLA 3QYWA 2AQXA 3MY5A 4CG9A 5HVJA 1FQ1B 2ITOA 2NRUA 2OJFE 1W84A 2BUJA 3NSZA 5DT4A 2H9VA 2E2BA 2O65A 5JN2A 2WXVA 1NW1A 2GQSA 4FKWA 2E9VA 3FZOA 5IA5A 3JS2A 4PDOA 3U6IA 4MEDA 4ANQA 3M2WA 4F7JA 3EFKA 3I0QA 4QQ5A 5D7AA 5HBJA 4H3BA 4I0TA 3TZ7A 4AZTA 4YJUA 3GQIA 2QU6A 2CGXA 2R9SA 2XEYA 3BBTB 3G33A 3H30A 4IZ7A 4NJDA 5JT2A 1DI8A 3LQ8A 1YXTA 2J5EA 4DFNA 2VWVA 4LL0A 1H1RA 4D2SA 4BDGA 1ST4A 3IDPA 3GP0A 4YZBA 2WTKC 2IVTA 4JR3A 5GHVA 2WO6A 3FZSA 4FEVA 1APME 3II5A 3C0HA 5AA8A 4MAOA 3FLYA 4XRLA 4CYJA 4I5CA 5HO7A 2AUHA 2C5VA 5HU3A 2XJ0A 3F3VA 4IWDA 2P33A 3E63A 3CC6A 4RJ5A 4QDVA 4XCUA 4PNIA 4D2RA 2PMNX 5M53A 3AKLA 1W82A 5FLFA 3QUDA 4I23A 2XUUA 3S3IA 4F08A 4FTOA 3GEQA 4I93A 5AEPA 4FJVA 2HXLA 3NZ0A 3FPQA 5EHOA 4BDCA 3QL8A 1XBCA 1OPJA 5I9YA 4BKYA 2BZHB 4U9AA 5DH3A 5AUWA 2JAVA 4IC8A 5JRSA 1XWSA 3SG8A 4AN9A 3W8QA 4NSTA 1T46A 3OHTA 5GJDA 1H1QA 2PTKA 4O38A 4U44A 3G9LX 5ANOA 3TG1A 3LPBA 4NM7A 4NKAA 3D5UA 2CNUA 3P1AA 3ZBXA 2CGUA 2Y6MA 3I0OA 5HE3A 3R21A 1UU3A 2NP8A 4RRVA 5AADA 5HD4A 2BAQA 4LV5A 4XP3A 2ZOQA 3PXFA 5AR4A 4BIEA 5F20A 4EWQA 1M7QA 3BQCA 3ZCLA 3AKKA 2JIIA 4OLIA 1TFFA 3EWHA 4W9XA 1XHAA 4IB0A 3BGQA 4L6QA 2C3LA 5D1JA 5IH5A 2VTJA 2QONA 4BIDA 4TWCA 2CLXA 3H4JA 3TJCA 4DG3E 2VTAA 2PVYA 3EL8A 2C69A 4O83A 1B39A 3E87A 3H0ZA 2OFVA 2X2KA 4MD8E 3KQ7A 4YSMA 3ATSA 2XNEA 1M52A 4BDDA 4CVAA 2HENA 4F6WA 5JK3A 4JQ8A 5IQFA 4AE6A 5IEVA 2JLDA 3LMIA 2C5XA 3HV3A 1Z5MA 3R9DA 2Y4PA 2HELA 3GOPA 2OI4X 4RFYA 3FMKA 3H9FA 3T9TA 2XM8A 3U51A 3ZS5A 3CY3A 4U45A 3GB2A 3QD0A 2GNHA 4QMVA 2C3JA 4WO5A 3GXLA 3Q5IA 4BN1A 3P7BA 5CI6A 4CV8A 3NUYA 3QQGA 1J1CA 4BZOA 3BHTA 2Y9QA 2IZRA 4W4VA 4IM0A 3KXGA 4BWPA 2CGWA 1F3MC 4F0IA 2OLCA 2YITA 3JXWA 2IZUA 5CSXA 5FD2A 2ZYBA 3UVQA 3FZTA 4U7ZA 5HO8A 3ZZEA 4FKGA 3QBNA 3QQJA 4WRGA 1CKPA 4O2ZA 2B0QA 5DLSA 4LOQA 4E6QA 2GS2A 1ZOHA 3BYUA 3ZXTA 4D2WA 3TZ8A 2BPMA 4UXLA 4XHKB 4AF3A 3IS5A 3EN5A 3E5AA 5AUZA 2QOQA 5IUIA 5BQ0A 2W0JA 3LCDA 3LCKA 3DY7A 2I0YA 5E91A 5TKDA 4BKJA 3FLWA 2XK9A 3GGFA 4GT3A 4Q2AA 4DINA 1I09A 3DFCB 5LOHA 4FIFA 3UGCA 4QEBA 3TCPA 5L2SA 4TL0A 4HOKA 1UU7A 3QZGA 4PL5A 3KXNA 3F3ZA 1T45A 4J8MA 5JH6A 2QOLA 2DS1A 4AGDA 2O0UA 2YM6A 4H05A 3A7GA 4ZJIA 4N4SA 3HMMA 5F95A 1Q5KA 2JFLA 4HCUA 4W4XA 5LXMA 2J4ZA 4S34A 5DIAA 3WZJA 1UNLA 5CASA 4AN3A 4UALA 5HVKA 5A6OA 3FWQA 5ACKA 4NU1A 4H1JA 3EZRA 4NCTC 2OU7A 3SRVA 4NTTA 2BZIB 5CWZA 3QQHA 2JITA 2W4JA 2WTDA 2O8YA 2R3JA 4W8EA 4ZSLA 3QF9A 3SXFA 3V8TA 3PA4A 4CKJA 3DK3A 5DT3A 4BY9E 3MBLA 1OIUA 5KNJA 3L9MA 4PDSA 2ZVAA 4FSUA 4RQVA 3ZEWA 3H3CA 4K1BA 2XBAA 3F7ZA 4GCJA 1KOBA 3Q4UA 2JKKA 2QOHA 2PUIA 3WARA 2UW3A 4MBIA 3LOKA 3Q96A 5H9BA 2QO7A 3G51A 2XNNA 5ETIA 5HE2A 3ZHPC 5CAQA 1V1KA 3MW1A 4ACCA 2C3IB 2OZOA 4HCVA 3LXLA 3FMNA 5GZ9A 2J5FA 2JGZA 3PIXA 1J7UA 2JEDA 4JVGA 4JIAA 3SX9A 4YNOA 2GNGA 3MS9A 5EDRA 1I44A 1PKGA 3R8MA 3R8VA 3EZVA 4FSZA 2I1MA 5IISA 5IUHA 3NMUF 4UEUA 4Z16A 2FUMA 3GCSA 5AR7A 2XIKA 3LQ3A 2R7BA 3GBZA 4LRJA 3DS6A 4ZK5A 4CD0A 4FKVA 5HTCA 4AXFA 2XCKA 3QTZA 3ZLYA 4BWKA 4N0SA 5FP6A 4USFA 3QTWA 4GVAA 5FM3A 3BELA 4FTTA 1VR2A 4JT3A 2JDTA 5CQUA 3PSBA 3TI1A 2WQNA 3P0MA 3V3VA 4QQJA 3RHKA 4FIIA 3HRCA 3OC1A 5KMIA 2WGJA 4L3PA 4WBBB 3KRJA 2CKOA 1FINA 3GCUA 3GQLA 4YJSA 4YZ9A 1MUOA 2JD5A 1JSVA 4O4CA 2UVZA 1U5QA 3HDMA 4OTGA 2UZDA 3AT4A 4QPAA 4F9WA 4E4LA 4EHEA 3LFEA 4QP2A 3GENA 4IAIA 2PUNA 4NFNA 4RJ7A 2PZPA 2BR1A 2ITZA 5HIEA 2F7XE 3BE9A 2P0CA 4L43A 5EYMA 4D4SA 4DEDA 2B1PA 2GNJA 4JS8A 4CLJA 2RIOA 4ZAUA 5LJJA 3WILA 1MQBA 3C51A 1JKLA 3O7LB 3P4KA 2YJSA 4FVQA 3SOCA 1OKVA 4KBKA 1PMNA 4U81A 2X0GA 3UNJA 1LR4A 2F2UA 3ETAA 4RVLA 3UJGA 5LVMA 3KVXA 3KB7A 3BU5A 2AEGA 4K0YA 2QCSA 2YIQA 1HCLA 4BBEA 3DNDA 4RJ8A 1YDSE 3VC4A 3LXPA 4MNEB 5IQDA 3ZEPA 2VX3A 5IH6A 3FHRA 3RKBA 3K2LA 2WQEA 1R78A 3HKOA 4FV5A 4QOXA 3RP9A 5I0BA 5EKNA 3VVHA 4C0TA 1YXXA 2EUFB 4X2JA 3L8PA 5FTGA 3FL5A 1ZYJA 3F88A 3VF8A 4RPVA 2YZLA 3VUTA 4DH1A 5LARA 5KMKA 1ZWSA 3PYYA 4F1OA 4RVTA 4I6FA 1GZNA 3G15A 3NUPA 2OXDA 3COMA 3IW4A 3Q9WA 4R7IA 4CZYB 3DK7A 1M2QA 3TZ9A 2CPKE 3BYVA 2XALA 4FL1A 4EI4A 2OXXA 5K0KA 4QYFA 1NVSA 4RIXB 4PMMA 4S33A 1GZKA 3WIKA 4ALUA 1Q97A 2AC5A 3C0GA 5E7RA 4OGRA 5HBEA 5J7BA 1Q62A 4RLLA 4G5JA 2BDJA 4FZFB 2EB2A 2BFXA 4R5YA 3LLAA 5IDPA 2V55A 3E3BX 3LIJA 2QI8A 4WNPA 2ZDUA 4MX9A 3QLGA 2QOCA 4XX9A 4OBQA 2VO0A 3R9OA 2C68A 2BRHA 4BCNA 2UW9A 4R78A 3IDCA 1SNXA 3QRTA 4ZOGA 4UYNA 4JMQA 2F57A 3P7AA 4JR7A 3UOHA 2XJ2A 3TNPC 2IPXA 4BCFA 4PY1A 4RIYB 4O22A 5M06A 2R3NA 2XK7A 3A4PA 5M07A 2UZOA 4WSYA 2EVAA 5HHWA 2O64A 3MH0A 4IFGA 4YZNA 3W10A 4EK5A 5FP5A 4FV6A 3C4FA 2C3KA 2B9IA 4W9WA 4Y5HA 2JAMA 3DAKA 4FT9A 1QPCA 4K9YA 3ML1A 3RM6A 1W7HA 1OPLA 2X0OA 1B38A 3EQDA 4RFZA 4MNEA 3TDWA 3SOAA 4FTCA 2DQ7X 3DK6A 5HTIA 3HNGA 4YTFA 2J0KA 4FSRA 5J7HA 3DGKA 3P9JA 4ZSJA 4IIRA 3R7IA 4F70A 3MGYA 2XNOA 4DEAA 3O71A 4FNYA 4ORKA 3EKKA 4GG7A 5E1EA 4BDFA 4G3CA 4HPUE 2H8HA 4BCJA 3PXRA 3CSVA 1PXIA 4ITIA 3OXTA 4AW5A 3K3JA 3RNYA 1YDTE 2R3MA 4RIXA 4BCPA 4DITA 4O86A 2BDFA 4ZSEA 3F5GA 4GU9A 5HG5A 4I6BA 4UYAA 5J9ZA 3KXZA 4D2VA 3MWUA 4O4FA 2CJMA 2HZ0A 3R7UA 3ZYAA 5HG8A 2XNMA 3DPKA 5T68A 2JKOA 3MV5A 1SVEA 3TUBA 4AZSA 2YISA 4DG0E 1OL6A 3FBVA 4P2KA 2WB8A 3FZPA 2YA9A 3BU3A 5DWRA 5GJGA 1MRVA 3P86A 3W0RA 5KE0A 1WVYA 4I0RA 4AT4A 1XH8A 5I9WA 5CS6A 2PU8A 1PF8A 4FV4A 5A4QA 1XH7A 2NRYA 4QMXA 5TO8A 3B2WA 3OMVA 3PG3A 4RIYA 5CLPA 3ZUTA 3FI8A 4ACHA 4AZWA 4PL3A 2Z8CA 4QYYA 1KE6A 3TV6A 3G6HA 1FBNA 3OY3A 2GHMA 4XV2A 2YM7A 4LMNA 3HLLA 4CFUA 4FEXA 3UO6A 3R7YA 3IW7A 4YZCA 1YI4A 4MD9E 3GNIB 2VTPA 5EK7A 4EWHA 5KHWA 2XZSA 5K4JA 2J0LA 4PTCA 2PMLX 1Q8YA 2XB7A 3QRUA 2UZUE 3D4QA 4H39A 1LEWA 5CU6A 5FXSA 2I7QA 2BFYA 4R1VA 3ZRKA 1TKIA 2VWXA 5GJFA 1WBWA 4X0MA 2ZM1A 3D94A 2W9ZB 4I92A 5HIBA 4ALVA 5AP6A 2XNGA 4CCBA 3K5VA 2VRXA 4CRSA 3UOKA 4CTBA 1OMWA 1S9IA 3C5IA 3SGCA 3QU0A 1PHKA 2CSNA 4QTBA 3CJFA 4FNXA 3U55A 3BQRA 3ZUVA 4FEQA 2H6DA 5C4LA 2VX0A 3FQEA 2GNLA 1H01A 1Q4LA 1PY5A 3R9NA 2Q83A 3ROCA 2W1ZA 5AP1A 1JKTA 2PHKA 3DQWA 2ITQA 2P4IA 2XA4A 1W0XC 3LW0A 5I3RA 5GZ8A 4UX9A 3MSSA 4FIJA 5AAGA 4GIIA 3RPSA 3Q2JA 3WF8A 3KMUA 2HZNA 4KWPA 5TT7A 4XLVA 4AXAA 1LUFA 3O8UA 3OP5A 1J91A 4E26A 4FYNA 3OWJA 3QTRA 3R7VA 4PDPA 1SNUA 3FY2A 3QTQA 2QKWB 4QMPA 2PVRA 4IBMA 2IW9A 3OXZA 3W18A 3E88A 1H26A 4E6CA 3MFUA 1IA8A 4MXOA 4P7EA 3DBQA 4QQTA 3I6WA 5C8KA 4QNYA 4DCEA 2QQ7A 1NXKA 3S2PA 3PTGA 2JBPA 2ITVA 4XBUA 2JDRA 1P14A 3RPYA 4YUQA 1H07A 4EKKA 3ANRA 3PFQA 4CTCA 3U6JA 4B8LA 4FZ7A 5JKGA 5M4FA 2FGIA 4JBOA 3TUCA 4TN6A 3PA5A 4V01A 2R3PA 4CFFA 1Q99A 3BYMA 4FIEA 4J71A 4CFWA 3CQUA 3KMMA 4FUYA 5HG7A 5DVRA 4L3LA 3VQUA 5J5TA 3MIAA 4DLIA 3DNEA 4O0RA 4JDJA 3VUIA 4EOMA 5B2MA 1XKKA 3UO4A 4DH8A 3LCSA 3EQPA 4FV3A 3V5JA 1KSWA 2X4ZA 3JUHA 4JNWA 3V04A 4ERWA 3BKBA 1ZOEA 4C02A 4KIOA 5M55A 4UMTA 3ZM9A 3LQ5A 3DFAA 4C33A 2B9JA 2Y4IB 5DN3A 3M42A 3D5VA 2OKRA 4KKHA 4GKIA 4DFLA 3FYJX 4QMTA 1JOWB 4DCAA 3ZDUA 4NM5A 4XV3A 2W17A 3UPZA 5CVHA 4JAIA 4ZJVA 3I4BA 4PWNA 5AUVA 2FVDA 3OCSA 3R1QA 5JRQA 4AA4A 4I21A 2R3QA 3T3VA 2IW8A 3VWAA 3ZFXA 4UMPA 5D41A 3VJOA 4MXZA