3E92A

Crystal structure of p38 kinase in complex with a biaryl amide inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
350
structure length
348
Chain Sequence
QERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDELKILDFGLAHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Kinase array design, back to front: Biaryl amides
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 348
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e92A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e92A01
2IW9A 3B8QA 5DBXA 5DOSA 2Z8CA 3P7AA 2QODA 5J7BA 3PG3A 2W4JA 5CQUA 2P0CA 3R7EA 4F6WA 3EJ1A 3O50A 3VAPA 4YU2A 4CYJA 3ZRKA 2ZV7A 4LMUA 4DEHA 1JOWB 3ZZEA 2EXMA 3OS3A 5DI1A 1OL5A 4CKIA 4FZAB 2XNEA 1QCFA 4BDBA 4YC6A 4FF8A 5EDQA 4D9TA 5LMKA 3BU6A 3F6XA 3NUYA 5J8IA 4G31A 4HCTA 4M13A 1P14A 1ZLTA 1SVHA 4AA0A 3OXZA 1M14A 3IPHA 3LOKA 4ZZMA 3QUEA 3SAYA 1FMOE 3NNWA 1WAKA 5F94A 3W32A 3WE4A 5FDXA 3SXFA 5D9HA 5K4IA 5JGDA 4G6LA 4FIGA 2UW6A 2PVNA 3Q52A 5E1EA 1GZOA 2YM3A 3UOHA 3HMIA 4E93A 4L3LA 4EK8A 4KKHA 2VTQA 4TYHA 2WO6A 2H8HA 5D11A 2X8DA 4DLIA 4D4YA 4BHNA 4O91A 2JIUA 2E2BA 2FGIA 3QTQA 4TPTA 1J3HA 3E93A 3HV5A 3GT8A 1H0VA 2C6DA 3IOPA 3ITZA 4IWQA 4ANOA 3K5UA 3QQFA 3E5AA 4MF1A 3ALOA 3W2SA 1JSVA 2ITPA 3C4WA 2PMLX 4JL9A 4WKQA 3C4ZA 3EFJA 4LOQA 4XS2A 5AA9A 2WXVA 2PE2A 3R7IA 4QTBA 1ZMUA 4RFMA 4I5HA 2OWBA 4NIFA 5AM7A 4O2PA 3RHKA 1B6CB 3VF8A 1PXPA 3H3CA 3TWJA 4BGGA 3ZDUA 5T6KA 3FSKA 1E9HA 2XK6A 4RJ8A 2JD5A 3L1SA 4AGUA 4YTIA 4RRVA 1Q8ZA 3BWJA 4RZVA 4ITIA 3PJ8A 4YZDA 3PA5A 4EHGA 4EH4A 4AP7A 4HNIA 1G8AA 5L8KA 1WVYA 2XNGA 4JQ7A 4CMOA 2F2CB 3R9OA 1I09A 1MRYA 2HY81 2QOLA 5EW8A 3SW7A 5HX6A 2XIYA 1YHWA 4O27B 3FPMA 4BTJA 3TG1A 5L3AA 4RZWA 3MB6A 3NCGA 3KRWA 2PZPA 3KRJA 4E73A 5DMZA 4RWKA 3T8OA 3TIYA 2QHNA 3TUBA 4FA2A 4NYEA 2WIHA 1JBPE 1OKZA 1RDQE 3R1QA 4N70A 4ZJJA 3HDMA 4FNXA 4GK4A 5LMKC 2VD5A 5BYLA 5CANA 4Z55A 5A4EA 5C1QB 5EG3A 1IRKA 1H1PA 1UU3A 3FY0A 2IWIA 5G1XA 2BRNA 2W1ZA 4RA4A 5IU2A 3W2QA 4JT3A 2WHBA 3U9CA 1Q8YA 5AEPA 5KZ0A 3GQLA 4AQCA 3KXZA 2PE0A 5A3XA 2PUNA 5I9WA 1NXKA 3UOLA 5IA5A 5IH4A 4FYNA 2ERKA 4I5MA 3V5WA 3R21A 1W82A 1IR3A 4XG8A 3WF8A 1IAHA 2WTDA 3FMLA 4TZRA 4OW8A 4BIBA 3PY1A 1OPLA 3LMHA 3DU8A 4YBKA 4YNEA 4BDCA 1OM1A 3BHTA 3OWPA 3QKLA 3VNTA 3EYGA 5B7VA 4P2KA 2VO7A 4RFZA 1W83A 3AMAA 1FINA 4RC3A 2PVYA 4R1YA 4AGCA 1R0PA 2QR7A 3VW8A 3NVMB 3KK9A 4CV8A 5DR6A 3ODYX 5FEEA 3FQSA 2Z7QA 4I4EA 5LVLA 4DGNA 4ZLYA 4PPAA 1XH7A 1A48A 3PVWA 3BQCA 4IEBA 3I4BA 2YISA 3ORIA 1Q24A 4ZTSA 4HJOA 5CF6A 4TYHB 2RIOA 3U6HA 3BYOA 3UYTA 4UXQA 3A61A 2BAKA 4XX9A 1OECA 2CN8A 1BI8A 2B9JA 3GU8A 3CJFA 4O0RA 4X2GA 5HNBA 3HRBA 4CV9A 3D0EA 4F9WA 3DXQA 3SHEA 4FTTA 2RFNA 1OGUA 5EM6A 2OFUA 5JK3A 4W4YA 4NM7A 1NT2A 2EU9A 2C0OA 1M2QA 3AQVA 3DCVA 4OLIA 5AV0A 3FZSA 5AAFA 1J7LA 2AUHA 2JFMA 2O5KA 4AUAA 5LCJA 4ID7A 4QYGA 2WTKB 1URWA 2C3KA 2PVJA 4NIFB 3FI4A 5CS6A 3VQHA 4AXAA 1APME 3LQ8A 4H1MA 1XWSA 2PUPA 5J7HA 4DBNA 2EWAA 2C5YA 2GPHA 3ZRLA 5BNJA 4NL0A 4O7LA 1GIIA 4WIHA 3PJ1A 4G5PA 4HGTA 4BCQA 3FZRA 3MDYA 3F61A 3B2WA 3FXZA 2SRCA 3NUUA 5EK7A 2P55A 4IHPA 3GGFA 2CNVA 5IA1A 4QMYA 1OBGA 3R7GA 1FQ1B 2G2FA 3A62A 2BRHA 4GH2A 4TYGA 4FMQA 5E8WA 4ZIMA 3UP2A 2YIWA 4E6DA 4EJNA 4FIJA 2B54A 2GDOA 2VTJA 5LCKA 3R7UA 4BDAA 2CGVA 3DAJA 4IM3A 2CNQA 4Z9LA 1H24A 2VWUA 4O7SA 4YGAA 2WEVA 3FC2A 2F57A 3DGKA 4JR3A 4L43A 4DFYA 4C38A 2WOTA 3EL7A 3G90X 1NVRA 4KS8A 2R3KA 3TM0A 3EQBA 3DK7A 4B6LA 2PZ5A 4BTKA 1XKKA 3GXLA 3D5UA 5CF5A 2OI4X 2R3LA 2V62A 2A1AB 2YCSA 4G9CA 2XJ2A 5FM3A 5IKWA 3FKLA 4FVPA 2B0QA 4FSYA 3UG1A 4XCUA 4M69A 4BHZA 3HAVA 2ITUA 5JFSA 5KMNA 3HAMA 5ANKA 3JVSA 2WMAA 5CF8A 2GS6A 2RSVA 4U81A 4RFYA 4ACMA 3BU3A 3GC7A 3TKIA 5KKRC 1Q41A 1XJDA 1BX6A 4GIIA 3OT3A 4AW1A 3QA8A 2F4JA 4PPBA 2VO0A 4FTOA 5AUVA 5I3OA 1QL6A 3TV6A 4WUAA 4C7TA 4WNPA 2W99B 5AX9A 4S34A 3EFKA 1OIRA 4KKEA 3U4WA 1PXOA 3DK3A 3LMGA 4GJ2A 4OBOA 4FKGA 3AC1A 3HZTA 3I1AA 5DNRA 3VBYA 5HBJA 4JS8A 5DN3A 2Z2WA 4J7BA 1YWVA 3UIBA 4CLJA 3TNIA 3LMIA 1STCE 4BKJA 1KV2A 3GQIA 4RWJA 3SD0A 2W1EA 4D2RA 3IDCA 3UVPA 3QQUA 5DH3A 5CAUA 3VUKA 2PL0A 3SC1A 4QD6A 4RBLA 3OTVA 5CVFA 3LFBA 5TKDA 3G15A 5KKRB 2QO9A 4G5JA 3F82A 4O0VA 4FV0A 3F5GA 5DFPA 2FH9A 5HBEA 3UP7A 2QVSE 5IEVA 5F1ZA 2W9ZB 3FYKX 4I0TA 1FVRA 2GHGA 2QLQA 3KVWA 4BF2A 1MP8A 3ZLXA 3AT3A 4XHKB 2BZHB 4DTAA 1Q4LA 2B4SB 3UG2A 5M56A 2OG8A 5CNOA 5BVNA 4UMQA 3ZUUA 5KMIA 4Y95A 4GVJA 4JJRA 2GNGA 5CEMA 3ID6C 2AYPA 4GCJA 2QO2A 4FYOA 3QGYA 4EZ7A 5HORA 2X2KA 4I0SA 3W2OA 5DG5A 5EKOA 3UE4A 5AUUA 3BLRA 3ELJA 1PHKA 4H3BA 3C0GA 3AG9A 4HW7A 2CKOA 3A7FA 3V5JA 1VEBA 1DI9A 3UO5A 3HRFA 4PDOA 1CM8A 1F0QA 1DS5A 3OOGA 3KMWA 4I23A 2W17A 4WRGA 1DM2A 4MNFA 2R9SA 2GNIA 3DY7A 4HYSA 5CI6A 1OL1A 4QYEA 5M51A 3BHHA 4FL2A 1VR2A 3LE6A 5KBQA 2HXLA 3NUXA 3P86A 2VWIA 2REIA 4BDGA 3WF7A 1FVVA 3PPKA 4QQ5A 4O7ZA 1K3AA 2W5AA 4IX6A 3Q04A 3GC8A 2VO6A 3ODZX 3P79A 4QP8A 3L8XA 4BTMA 4MWHA 5GZAA 1YXXA 4CQGA 3NW6A 4O96A 1KE9A 3QRJA 4CVAA 2XZSA 2V5QA 4BCKA 3R9NA 1WFCA 3Q4CA 1H26A 4QP1A 4RJ6A 4EHEA 4IM0A 3ALNA 2O64A 3FL4A 4XG2A 5CSXA 4TWCA 5DE2A 5FTQA 3V6SA 4EH5A 2R2PA 1OBDA 1P5EA 2X4FA 4RLKA 4R78A 4RVTA 2XNMA 3AC2A 4MEDA 3ETAA 5CNNA 5B2KA 1ZZLA 1WBVA 3U4UA 4DFZE 3BPRA 2R7BA 2R3QA 3K3JA 1GJOA 4M69B 5LVOA 3ANRA 3R73A 4I5CA 4F6SA 3R7YA 4D28A 4ANNA 4V05A 4K2RA 3FEGA 2YAAA 1JKLA 3SGCA 4EH8A 4B8MA 3HLLA 3FYJX 4YO6A 4F7LA 1XBCA 4MD8E 5HX8A 3I5NA 1YXUA 2XM8A 3Q9WA 4EOQA 3SVVA 2QG5A 2PE1A 4FEUA 3GFWA 2PMNX 3N51A 3K5VA 3C7QA 3R28A 4F0IA 5JGBA 4FI1A 4EC9A 1VYWA 3IONA 1ZMVA 2IVVA 3H0ZA 3UVRA 4CFMA 1JAMA 4JG6A 3ACJA 3KK8A 5CX9A 4QPMA 4CZUA 5ANIA 3EQDA 2I0YA 2VNWA 5DPVA 2YITA 4O0UA 4M8TA 4FKRA 4KRDA 2QC6A 4QP6A 5E8YA 5CEIA 4IB0A 2UW3A 1ZZ2A 2BFXA 1GAGA 3QRIA 4K6ZA 1BMKA 4OGRA 2FSLX 4BC6A 2R3FA 4F70A 3R04A 2IZSA 3F5UA 3F3TA 4YC8A 4CCUA 2BHEA 3OVVA 4R3CA 4X2JA 2OW3A 4F9AA 2YDKA 5CVGA 1PMVA 2WTWA 2XBJA 2GTMA 3D5WA 2W4OA 4CZTA 4TL0A 4BY9E 3TTIA 4FGBA 3C1XA 1TQIA 2CGUA 3FMHA 3LXNA 3ORXA 3GCVA 4GEOA 2FSOX 4LV8A 4NJ3A 4FSTA 4CRSA 3CC6A 4QYHA 3U6JA 3FI8A 1B39A 5HQ0A 2W4KA 2ZAZA 4MAOA 3Q4TA 4CT2A 5KHXA 2C6MA 2ZVAA 4EK6A 3CY3A 4FC0A 4ANSA 5A4LA 5CT7A 3EFLA 3VS3A 3L9LA 3EQGA 4QMZA 4MQ2A 3I6UA 2J0IA 3ZCLA 4FV2A 4WO5A 3F2NA 2YHVA 3KVXA 4RLLA 5CXHA 3VBQA 4TYEA 4BDIA 4BDKA 3HMPA 5IA4A 2JAVA 3TEIA 4TTHB 4M97A 2QU5A 3U9NA 4PP7A 5FEQA 4IZ7A 4C4EA 1JKTA 1TQMA 3AMBA 3F5XA 2WMQA 4RA5A 2DUVA 3GCQA 4CFVA 3OF0A 4ONAA 5CSVA 4CFXA 2UUEA 4FV5A 4ZSAA 4N6ZA 4BCIA 3PIYA 4FK3A 3G51A 2YWPA 3OY3A 2X9FA 4IAZA 3AGLA 4FG8A 4I0RA 4OTPA 5CQWA 3TV7A 4PP9A 2G01A 1H28A 4QQTA 2UW0A 3EQPA 3NSZA 1MUOA 5F4NA 3TI1A 3TUCA 3BYUA 2WELA 3GCSA 3S4QA 5GJDA 3AOXA 4GL9A 4U80A 5CU2A 2HIWA 5FTGA 2JAMA 3BU5A 4C35A 4FV1A 2JBOA 4EWHA 4FSNA 4QYYA 4DEEA 3HDNA 4EH7A 4DTBA 4CQEA 2F2UA 2J0JA 2X8EA 3FKOA 4IANA 5CY3A 5EM8A 3OCGA 4D2SA 4D0WA 2B7AA 5LVNA 4U3YA 4CXAA 1OPKA 3PFQA 4C3PA 2ONLA 3IG7A 4KIPA 1OMWA 4RJ4A 3AD4A 4KRCA 3A7JA 2UZVA 1QPDA 3MS9A 4YBJA 3Q96A 3H30A 5E8VA 2UV2A 4C4HA 2ZDTA 4EKLA 4DCEA 4A4OA 2GNJA 4N0SA 4V01A 4GFOA 2QR8A 5LOHA 4O7TA 5CZIA 4LOOA 2BIYA 5L6OA 4GRBA 1WBPA 3CLYA 2UW7A 4MKCA 4WUNA 4EC8A 3MI9A 5LWMA 4CD0A 4YTHA 2NPQA 3A7GA 5CENA 3VRYA 3JUHA 4FE2A 1LEZA 4TN6A 4BCNA 3KRLA 3ZEPA 1BKXA 3LFSA 4IWOA 4MNEA 4QMLA 3VS2A 2GTNA 2BROA 3L9MA 4WBBB 3DJ7A 5AX3A 1V0OA 3P0MA 5E4HA 5A14A 4MQ1A 2UZBA 2VTOA 3MJ1A 4QMOA 5KE0A 4AAAA 4EOMA 3Q2JA 5HIBA 3HMNA 4GG5A 4JIAA 4JR7A 3MH2A 4C4IA 3DTWA 1R3CA 3P1AA 4BDDA 3WZUA 3ZXZA 3CTQA 2YCRA 2NNWB 4XUFA 3UQCA 5HLNA 4YSMA 2W9FB 3U8WA 3PXFA 5DA3A 4H58A 2XEZA 1U5RA 3C4EA 3ZFXA 3UJGA 2OZAA 2QONA 2QURA 2PVLA 2C5OA 4LI5A 3E64A 3ZUVA 5LMBA 3MPTA 3R02A 4IX4A 3Q32A 5C8KA 1XBAA 3SX9A 4C3RA 3R30A 4ZK5A 3ORKA 4IXPA 1RJBA 3KC3A 3IW6A 4D4RA 3W1FA 1LP4A 2WMXA 3Q2MA 2C4GA 1ERKA 3RK5A 3OWJA 3G6HA 4M0YA 4PNIA 4RWIA 1KE8A 4BIEA 2ONLC 4NFMA 1ATPE 1O6LA 3SOAA 4JBOA 4ZMEA 3ZC6A 1REKA 4BI2A 1PXNA 3VQUA 3LFFA 3SW4A 5J87A 5GJGA 4AOIA 4AZEA 3UVQA 5L8JA 4EWQA 3EQCA 1TKIA 3DZQA 3QWJA 4CKRA 2ETRA 2ZOQA 2PUIA 4KAOA 3HV6A 1WZYA 3FAAA 4AE9A 3MTFA 3ZHPC 2WU7A 2E9NA 3EOCA 1ZMWA 5IH6A 5KBRA 3WI6A 3M2WA 4RG0A 3UNZA 2PVKA 3CPBA 3G9LX 3IK3A 4GG7A 2R3NA 4IX3A 1H08A 5D7VA 4O6LA 5C01A 3ZFYA 3UNJA 5HG5A 2C6LA 3R0TA 5L8LA 1M17A 3DKFA 3PJ2A 3EZRA 3UO6A 4P7EA 2HK5A 3TJDA 3FKNA 4FZFB 1UNHA 4CFWA 3O7LD 3T9IA 1UU8A 2F49A 4U8ZA 4WG5A 4L44A 4J52A 4IBMA 3THBA 2JBPA 3NNXA 3DZOA 4G6OA 4EBWA 4AGDA 1FBNA 1RQQA 4PDPA 5DWRA 3FC1X 5IMXA 3RKBA 4HVSA 4GSBA 3D7ZA 2A27A 2XKFA 3OC1A 3AXWA 3QCXA 3KGAA 5FLFA 3V5QA 4NSTA 4RJ5A 2I1MA 3DPKA 1WBSA 5EI2A 3MVHA 4UYNA 2UZWE 4BTFA 5IQCA 3O7LB 3DLSA 4J53A 3S0OA 3MFRA 3NAXA 3UZRA 3GENA 2IPXA 3OT8A 4M7IA 2UW9A 3S3IA 3TV4A 5I9YA 1A06A 4ZOGA 3WIKA 3OG7A 4MK0A 3ORPA 4UWBA 1YWNA 3U87A 3DNEA 3BZ3A 3MV5A 3VRZA 3UIMA 4MNEB 5C9CA 2XIXA 4BR3A 4QRCA 4NW6A 2X8IA 1MRVA 2EUFB 2CDZA 3M42A 3C50A 3FSFA 5FP6A 4J1RA 2A4LA 4BCGA 3RPRA 4AT3A 4C61A 5DEYA 4GK3A 3EN5A 1OKYA 4C37A 4G3CA 4PRJA 3DOGA 3HV7A 3OCSA 4QP2A 1Q8TA 2Y8OA 4YJSA 3UOJA 2ITQA 4C33A 4UMPA 5JFWA 3PY0A 5LMAA 1NA7A 4N57A 2Y4IC 5FUTA 3RZBA 2JKQA 4I6HA 3KXHA 2YN8A 5E9EA 5BPYA 3V8SA 2OZAB 3DKOA 4DG3E 2BVAA 2UZOA 2VX3A 3C51A 3QTZA 4FV6A 4E4XA 4EH2A 3EKKA 4YPSA 3FWQA 2QOBA 5TO8A 4NJDA 3ZSHA 1P2AA 4DHFA 1WVWA 4OTGA 4CKJA 3BELA 4K8AA 4LL0A 2QD9A 4M15A 4R7BA 4FT9A 3AMYA 4OTDA 3OZ6A 3QRUA 4O38A 4NM5A 4AW2A 2C5XA 2R3RA 2ITNA 1G5SA 2XP2A 2Y7JA 1YXTA 3PXYA 3QCYA 2B53A 5KX8A 3OXTA 4HZRA 3SKCA 2YM6A 3SXSA 4TNBA 4EOPA 4ZP5A 5DYJA 5CEOA 3PY3A 3RBWA 3MN3A 5M06A 3H9OA 1FMKA 3Q53A 2YLFA 1EH4A 3FMEA 1IG1A 2HZ0A 3HYHA 2Y4IB 4HGSA 2CGWA 1GZ8A 3PSBA 4KBAA 4XG3A 5FG8A 5A9UA 3UC4A 1J7UA 3OWLA 3LLTA 4TYIA 4ACDA 4OTRA 3UTOA 2VTSA 2JDSA 2C3JA 4YHTA 1H01A 2WTIA 4C2WA 4U43A 3TKUA 2YEXA 3QQKA 4P5ZA 4IB3A 4QMVA 5ACKA 3R7OA 4BCPA 2XH5A 3FZOA 3PE1A 2BRBA 4LG4A 2JIIA 4APCA 3OCTA 2WPAA 4JBVA 3PVGA 4V04A 3T3VA 3BRBA 3QA0A 3R63A 2ITWA 4L3JA 4M14A 4AN9A 3WZKA 2XKEA 3ZBFA 2IZUA 3FZPA 3ZSGA 3OMVA 4FSRA 3MIYA 5C4KA 3NZ0A 4O1OA 3P5KA 3QTWA 4QMUA 2VU3A 5HD4A 4BBFA 4DH3A 4FV3A 4QMTA 3VN9A 4I6FA 4J98A 4F64A 4UN0C 3GC0A 4FL3A 5KZIA 5A6NA 5T3QA 1F5QA 3WZDA 2J2IB 4GUEA 1F3MC 4XBRA 2VTLA 4FKSA 2OJFE 4KIOA 3C5UA 5ANOA 2VO3A 4HCUA 3RAHA 3CGFA 3COMA 5ETAA 4YMJA 4ZTMA 1Q97A 3IECA 1ND4A 3QTXA 1YQJA 4JI9A 1JSUA 3BGPA 3I0QA 1MRUA 3MYGA 3W2CA 3HECA 3MWUA 4HVGA 5KMOA 1LR4A 2OLCA 2UZLA 4XG4A 4BBEA 3ENMA 1ZY5A 2GCDA 3NUPA 3LJ1A 2B55A 2YIQA 3V01A 2H34A 4I1ZA 3VBXA 2XS0A 3FE3A 4D1XA 1AQ1A 4BRXA 4NUSA 4NKSA 3QZFA 4MD7E 4IAYA 2C6EA 1L3RE 1UWHA 3MVMA 3EQRA 3QKMA 4R8QA 4QP3A 5E92A 5AAGA 2ITXA 1CKJA 3CD8A 4S33A 4BGQA 4F9BA 4IWPA 1JQHA 2BPMA 4AWIA 4EK5A 3P23A 2X6EA 5E8TA 3FMJA 5FWKK 4MTAA 4FKOA 4FNWA 4FV4A 4R1VA 3QD2B 5EH0A 5GZ9A 3RAWA 3ZM4A 4DEGA 2WMTA 2CSNA 3QXPA 1DI8A 4J8MA 4D4VA 5M55A 4GMYA 4XV1A 2YIXA 2VWZA 3REPA 4D2TA 2YCFA 3EN4A 3QX2A 4M0ZA 3C0HA 3TXOA 3MJ2A 4L9IA 4AA5A 4EOJA 4UMUA 3PLSA 5L2TA 1XR1A 4F0GA 2RFSA 3N4VA 3JPVA 1QPJA 4RIYA 2WKMA 2FSMX 4M68A 3KQ7A 5A6OA 4KWPA 5AADA 3ZTXA 4HGLA 4X6RA 4IVBA 5ANGA 4Y73A 3W10A 2R4BA 2VGOA 3E8NA 3GC9A 3I0OA 3VUTA 2RFDA 3CP9A 4H36A 3QZGA 2JITA 4QYFA 2JDRA 4Y85A 2EXEA 5HTIA 3EMGA 5J79A 5C26A 3NPCA 2YABA 4IW0A 1ZYCA 2CKEA 3F66A 3P78A 5M09A 4K33A 1PMEA 3FLNC 5CU3A 2ZM3A 2OIDA 3EYHA 5EOLA 4AZVA 4DH5A 2C6TA 2W0JA 3TZMA 1BYGA 2ZV8A 3NUNA 5H8EA 4U97A 3IDPA 3MFTA 2KULA 3IGOA 5JEBA 2BUJA 4CG9A 4ACHA 4A9SA 4F65A 2Y9QA 3QCQA 4DG0E 2J5EA 2WTKC 4DTKA 3NNUA 3F2RA 5AUWA 1KV1A 4S31A 1YDSE 3VBTA 4IZYA 3CIKA 4B8LA 3MW1A 3M1SA 3I79A 3VC4A 5EQPA 3QC4A 2WD1A 5A4CA 4XV3A 2Y0AA 3A7IA 5IUGA 5IQBA 3V51A 1M7QA 4O7WA 4E6QA 2F7ZE 3G2FA 2QNJA 4XLIA 3B2TA 3E8DA 3OUNB 4FNZA 4U6RA 3VIDA 3M11A 4O6EA 2YZLA 3V8TA 2DYLA 2OF2A 4PL3A 5HVYA 5IA2A 4ASEA 4D1ZA 3BIZA 4RC4A 2WTCA 5J5TA 4G3EA 4J96A 4ZJIA 4WRSA 5BVEA 1BLXA 4F9YA 2P4IA 4FUXA 4AOTA 4ACCA 3WYYA 4UBAA 3G5DA 3G9NA 3O51A 4HYUA 2X0GA 4L3PA 3OY1A 4FKJA 2PVRA 4GKIA 5D7AA 4X7QA 4M12A 3P4KA 1YHVA 3F88A 3RNYA 2R3IA 5AV4A 4QTAA 4DFXE 3R8MA 3HVCA 3I5ZA 1LUFA 3CQWA 3ZO4A 4RX7A 2X7FA 2WIPA 2ZJWA 3CPCA 5J5SA 1UV5A 2WTVA 3EKNA 4U79A 4EZ5A 1R1WA 4XLVA 4MH7A 4LRMA 2HENA 4QP4A 4ZSEA 1FPUA 3ZO2A 3ERKA 2X2MA 3SDJA 3NMUF 4JRNA 3FLSA 4P5QA 4IZAA 4O7RA 4DT8A 4FKWA 4OTFA 5JMSA 4LOPA 3D14A 3R83A 3C5IA 4YJNA 3R9HA 3UPXA 3GU4A 5A4TA 4IVAA 5FM2A 1OL7A 5M4UA 1YDRE 5HICA 3DBQA 4PF4A 2KTYA 3VJOA 1NW1A 1Z5MA 4FT0A 4IVDA 4O0TA 4YPDA 3VO3A 4AG8A 5ETFA 4HVHA 5D12A 4BZDA 1Y6AA 4RGJA 2HWPA 5C27A 1DAWA 2EB2A 2G2HA 4RJ3A 2IN6A 2VX0A 3COHA 5CAQA 3S1HA 4OBQA 3SV0A 2IVTA 5BMSA 3BHUA 4RIYB 1BI7A 4GS6A 3RPVA 4DITA 2YLEA 4N6YA 2AC5A 3LM5A 4X3JA 4TWOA 3W8QA 1H4LA 1TQPA 2VTIA 3A8WA 3ZS5A 1SYKA 3C4FA 2OBJA 2UVZA 4FZDB 4DGOA 3CE3A 4ORKA 1GOLA 3FDNA 3DV3A 4R3PA 4XMOA 3AD6A 2PSQA 4IMYA 2YM4A 5F20A 4E5WA 2BFYA 5CTPA 2IW6A 1MQBA 2WMVA 5EHLA 3EN6A 5AV1A 1OI9A 2Z7SA 2RL5A 4O2ZA 5LXMA 2ITYA 2OGVA 4ERWA 5IH5A 3DJ6A 4DC2A 4O82A 4EK3A 3OXIA 1O6YA 4HVDA 4ZTRA 2Q0BA 3TNPC 3WIGA 4ZLOA 5I0BA 4ITHA 3RM7A 1OPJA 4U5JA 4L53A 4NU1A 4FGRA 3WE8A 3GUBA 3KF7A 1JVPP 5EI6A 1LPUA 2YJSA 2BDJA 4U40A 4YHJA 4EQCA 5K4JA 1UKIA 3QD3A 2VZ6A 2Z7RA 1ZYLA 3S00A 4W4VA 5EDPA 3R9RA 4FTJA 4I6QA 2A2AA 5AJQA 3RAKA 3UZTA 2PPQA 4A9YA 4ZLZA 4FSWA 4F1MA 3IW5A 4DLJA 5CU4A 1ZRZA 5DVRA 2IO6A 1XO2B 2OIQA 3O2MA 3RJCA 5CEQA 3VBVA 4C3FA 3RWPA 2GNLA 4E26A 4BICA 2XVDA 1JWHA 2XRWA 5HVJA 1CTPE 5DT4A 5CSWA 3R8PA 5IA0A 3ZOSA 4BYIA 3LFQA 4F63A 1WMKA 2BILB 3AC5A 4XP2A 5GZ8A 4IJPA 4X2KA 1YXVA 3CXWA 4DG2E 4MXCA 5HIEA 2W1HA 4JAIA 4X6QC 3ORZA 4MX9A 4TXCA 5I9ZA 4L67A 4ASXA 3TNQB 5IMEA 4DFUA 4FEVA 2B52A 2VWBA 3NYNA 2B9FA 5L2QA 3LFDA 4FVQA 5AUXA 3NRMA 5HG7A 4FIIA 1I44A 2JIVA 2R0IA 4AF3A 2WMRA 2VWVA 3U55A 1WBTA 1W0XC 4KSPA 2I6LA 5ANDA 1HOWA 4AS0A 1OB3A 3VS7A 5CEKA 4G2FA 4EUTA 3GU7A 2QLUA 4EYMA 1JNKA 1KE7A 4F7JA 2X81A 4D9UA 2VTNA 3NIEA 4A06A 5DRDA 4PTCA 3WF9A 3WARA 4EOIA 5J9ZA 2QKRA 4FL1A 3U54A 4FTKA 4YJOA 2PVMA 4ZMFA 4KABA 4YSJA 4X21A 2BIKB 2BKZA 4C59A 4HCVA 2C3LA 4JRVA 1KUTA 5CF4A 4FX3A 1PJKA 4ZJVA 3FZTA 2GU8A 2Z60A 4RIWA 3PLAE 1CKIA 1Y57A 3JY9A 3DB6A 3NDMA 4JBPA 2C69A 4BFMA 3VUDA 3LZBA 3TZ9A 3PWYA 5TOZA 4TWPA 3UC3A 5CSPA 1JKSA 4C58A 2NO3A 2AC3A 2EB3A 5I9VA 2BHHA 5M57A 2F7XE 4DH7A 4WNOA 3TUDA 3ET7A 3CY2A 3Q4ZA 4LMNA 4F1TA 3MFSA 4QMSA 5TR6A 3QTRA 5IPJA 4MXOA 4YC3A 3MPMA 4I22A 2XM9A 2OXXA 1PKDA 3NR9A 4MBIA 3HUCA 3KFAA 5EYDA 5A4QA 3C0IA 4OAVB 2WMUA 3H9RA 1YDTE 3RHXA 1T46A 4G34A 1LEWA 4I24A 4F0FA 5LJJA 2R3MA 5JGAA 5D1JA 4DA5A 3MESA 3R01A 4S32A 3RWQA 4S2ZA 1Q3WA 1WBNA 4YO4A 5HLWA 2VTRA 1SMHA 1SNUA 4R6VA 3QQGA 2YM5A 4GJ3A 3O8UA 1E1XA 5CSHA 3IQ7A 4M67A 1M2PA 2G15A 3GI3A 4ALVA 2VN9A 4XRLA 3FJQE 5EYKA 2W05A 3COIA 4CZYB 5CU6A 4AN3A 1FOTA 2R3HA 4TWNA 2OJGA 5AP5A 1WCCA 3KRRA 4U3ZA 5HE1A 3MIAA 2Y6MA 3KXGA 4TKSA 4QOXA 5H8BA 4FV9A 4PUZA 3O17A 2R5TA 4E8AA 5LWNA 5LQFA 4O7NA 2A19B 5JH6A 4FIFA 4H39A 1WBOA 2XNPA 5IISA 3LFNA 3EWHA 4P90A 2UVYA 3WZJA 2W1GA 5CAVA 3CS9A 3PXQA 4IAFA 3PDTA 2XNBA 1TVOA 2J9MA 4EK4A 1ZAOA 2CLXA 3VS5A 4ZS0A 1B38A 5FXSA 3TTJA 3RMFA 4CYIA 4IFCA 2W1FA 3F2AA 3TIZA 1ZYSA 4NEUA 2XF0A 3QYZA 4I5PA 4G9RA 5DT3A 5AR8A 3RK7A 2BTRA 4C4JA 2BKKA 1ZXEA 2WQNA 4FTQA 4JXFA 2JFLA 5EHYA 3UIXA 3UZPA 1CMKE 2YCQA 4JDIA 2QKWB 3OEFX 2O65A 3ZRMA 5M4FA 3HL7A 3BCEA 5HKMA 4ZSLA 5IEXA 4I4FA 4LRJA 4GW8A 2FUMA 4USDA 1OIUA 3FMNA 2VGPA 3OW4A 4RVLA 4XP3A 3I7BA 4FG9A 3PE2A 4D4SA 4FKUA 4ALUA 1XBBA 3D4QA 1URCA 2C6KA 4FSQA 4ZXTA 2GQRA 3GOPA 1ZOEA 3ORNA 4FBXA 2BRMA 2XNNA 1E1VA 4XNEA 2XA4A 5JT2A 2XKCA 4CT1A 2BALA 3ZXTA 5KMJA 3ANQA 4D55A 1CKPA 4G1WA 4ANBA 1ZOHA 5IEYA 2WQMA 1PYXA 2G1TA 1UNLA 3KULA 4PWNA 4Q5HA 5EW3A 3ZO1A 2CLQA 3UOKA 4BCHA 3F3UA 2BAQA 5HBHA 4AN2A 4GIHA 3TNHA 4RIWB 1OKVA 2FYSA 3FHRA 4DBXA 5IQDA 2VNYA 3POOA 1WVXA 5JZNA 3RTPA 3LQ5A 4PMPA 5M07A 4EOOA 5HZNA 4YZMA 3AT2A 3BLHA 4I21A 1UNGA 3MY0A 3ZYAA 4KIKA 2HY0A 2WQOA 2Y4PA 3R00A 4QP7A 5BVWA 4BDJA 3LFEA 4AOJA 3LCKA 4PNKA 4YZBA 1R78A 3EQHA 5DIAA 3V8WA 3VUIA 3DB8A 1PXJA 4FT7A 1H1SA 3R7VA 5IUHA 5M08A 5K5XA 3KXMA 4TT7A 4IE9A 2WMBA 3KKVA 4RIOA 4ZEGA 2OXYA 2FVDA 5I3RA 3PJ3A 1H25A 4EEVA 2YA9A 4Y8DA 3V5LA 1YOLA 3W2RA 2WFYA 3P7CA 2YM8A 4FNYA 2DWBA 4O22A 3S2PA 4J71A 2GHLA 1J91A 3BE2A 2X2LA 4WG4A 4KD1A 3BBTB 3PIZA 4IH8A 1PXKA 5EHOA 4EH6A 5A54A 2JDTA 4GV1A 3VS0A 3H9FA 3CCNA 3LJ0A 3PSCA 3PZHA 1M2RA 4DCAA 3TACA 2HZ4A 3QTSA 2PY3A 5G6VA 1NVSA 2YDIA 4USFA 2YFXA 2XB7A 5BVFA 3QLFA 2XBAA 3E63A 4GUBA 4EQUA 3HX4A 3ZDIA 5H3QA 3OBJA 2QI8A 4O7VA 2XMYA 2OK1A 3QLGA 5AM6A 3R1NA 5EDRA 3FLWA 3DNDA 1R39A 4PDYA 3R6XA 3FL5A 1H8FA 5FBNC 4EHVA 3G0FA 4UB7A 5JKGA 4CFFA 3PA4A 2C68A 4FT3A 4FTMA 4CNHA 3BHYA 5KHWA 2I0HA 2QQ7A 4PMSA 1KE6A 1K2PA 3QQJA 5FBOA 4K18A 4QO9A 4JG7A 4YLKA 5L6PA 4A7CA 1W8CA 3OP5A 4L46A 3DQWA 2P3GX 4L8MA 4AU8A 4CFUA 3DBEA 4Q9SA 5K9IA 2XK8A 3RNIA 3TDVA 3L9NA 4PMMA 3QXOA 4I92A 5IQAA 4OTIA 2C3IB 3NW5A 4IM2A 3KL8A 2G2IA 3ACKA 3EFWA 3UODA 4D2VA 3RAIA 4G16A 2XRUA 5HO6A 1AGWA 4JX3A 5BUJA 2W06A 3OW3A 4WSQA 4D2WA 3LHJA 4CFNA 2OFVA 4CEGA 4DFLA 5I9UA 2YZAA 1PXLA 2C1BA 4PY1A 5ACBC 1GIJA 2FO0A 5FQDC 2LAVA 4JNWA 1Z9XA 2BDFA 3EHAA 3G33A 4I94A 3KULB 3K3IA 4BDHA 4JIKA 5F9EA 4IB5A 4O7YA 5EQYA 4V0GA 3RGFA 3WBLA 5J9YA 3N4TA 4L52A 2ETMA 3HP2A 5E8SA 3V5PA 3NLBA 4H1JA 4KB8A 4OT5A 1H27A 5AP1A 2WOUA 4C57A 3E7VA 5E90A 4R77A 3UO4A 4XG7A 4EJ7A 4QQJA 3QWKA 4FKLA 2J6MA 2XYUA 4JX7A 1U54A 3AC8A 3SLSA 4BCOA 3FBVA 5CALA 2PHKA 5JRSA 3N4UA 3BBWA 4R7HA 4KIKB 3ZMMA 4QTEA 5CASA 3KU2A 4PL5A 3GEQA 3CBLA 5HE3A 4UV0A 4EOLA 3O96A 2PZRA 3V04A 3CD3A 4A4LA 1PMUA 1Q61A 4IX5A 4BWPA 2O2UA 3FLQA 4UWCA 2W1DA 5AUTA 4C2VA 3EQFA 1CDKA 1A9UA 4GK2A 3DT1A 5LVMA 5HD7A 2Q83A 4FEXA 4DFBA 4FTLA 4CLIA 2HAKA 5K0XA 4ZY5A 2R0UA 4A9TA 2Z7LA 4YZNA 5FP5A 5C03A 4HNFA 2GQGA 3GNIB 4F99A 4D5KA 5L2WA 2HZNA 4ENXA 3D2KA 3HGKA 3OEZA 2XJ0A 4F7SA 2VTAA 4HOKA 3ZO3A 3NGAA 3R1YA 1Y8YA 4EL9A 3A60A 4YJTA 3IS5A 1BL7A 4H3QA 3WZEA 4FV8A 5FGKA 3P7BA 2F9GA 4OUCA 4R5SA 2BTSA 3QUDA 4R3RA 4L45A 1PRYA 2IJMA 4AZWA 3RINA 3FQHA 2QOIA 4O0XA 4WNMA 5BQ0A 2HZIA 4XH6A 5EM5A 4CGAA 3C4XA 5IA3A 1DAYA 5EYMA 3NX8A 4BZNA 3KN6A 4FTAA 1G8SA 4Y83A 1K9AA 1V0PA 3VF9A 3C13A 2ZB1A 4G3GA 4IJ9A 3ATTA 5HESA 4RQVA 4RVKA 5KMMA 5K3YA 5DT0A 3BV3A 4RX9A 4M84A 3Q60A 4AFEA 5J1VA 2EVAA 4FSZA 2P2IA 2P2HA 4ARKA 2HYYA 4LGHA 2VUWA 4AFJA 4OBPA 5KUPA 5TE0A 1H0WA 3NYXA 3FUPA 4JG8A 4FIEA 2VTTA 1GY3A 4GFMA 4IC8A 3TN8A 4O81A 1JKKA 2C47A 4E6AA 4HPTE 4F7NA 2YWVA 3PZEA 2ZDUA 4LM5A 5HTBA 1PF8A 2WQBA 4FTCA 1WBWA 3MH1A 3F5PA 4JBQA 4PX6A 5DRBA 4AT4A 4QMNA 2WGJA 2XYNA 3ZBXA 4F1OA 1IA8A 4ZS4A 2DS1A 3DK6A 3D83A 4O83A 3CR0A 3L8PA 4W8EA 1M52A 3KF4A 5AAEA 1IA9A 1YVJA 1Y6BA 3DTCA 3NS9A 1BL6A 4PL4A 4XG6A 2ETKA 3LFCA 2IVUA 4X2NA 2GSFA 4UMRA 3EB0A 3FY2A 2CMWA 5AR3A 4NCTA 3A4OX 4L42A 4O21A 4XG9A 2JKOA 2OU7A 5ANJA 5AP2A 3KB7A 1H00A 2WU6A 3LLAA 4V0GB 3GFEA 2OIBA 2ESMA 3DA6A 4QMXA 3HUBA 3DXNA 4G6NA 5GJFA 3VULA 2CPKE 2J5FA 2VWYA 2YIRA 3KCFA 4Y5QA 1PW2A 5B0XA 4BZOA 4EUUA 3K2LA 2WEIA 5J95A 1U54B 3RVGA 3MB7A 5CU0A 1Q62A 2RFEA 4HYIA 3RM6A 2I40A 1OVEA 5CZHA 5D10A 4HZSA 1J1CA 4DN5A 2PMIA 4C62A 3KXXA 5HNIX 2HOGA 4FICA 1J7IA 4BL1A 3FHIA 5BX0A 2WQEA 3OTUA 1OL6A 1Q3DA 3G0EA 3OCBA 4RQKA 2RKUA 4X2FA 2X6DA 2GFCA 3O71A 2Z02A 1S9JA 4XYFA 3DXPA 1U4DA 2E9PA 4JDJA 3FMKA 5HO7A 3FQEA 3FPQA 3KXNA 4RX5A 4MXAA 1H1WA 3BHVA 3RP9A 3I60A 4ZTHA 4YTFA 4IZ5A 3PG1A 3PRFA 4X0MA 3TZ8A 3WF6A 2XUUA 3POZA 3Q9XA 3L8SA 3VS1A 2CN5A 4DF3A 2ACXA 5IDPA 3JXWA 3I7CA 3LM0A 3G6GA 3A99A 2HW7A 3QKKA 2X1NA 2JKMA 3RZFA 4NZWB 3SRVA 4KUJA 3LW0A 3QBNA 5CEPA 1IASA 1XH9A 5FDPA 4OTQA 1QPCA 2R3GA 3N9XA 5GNKA 4ZY6A 4ALWA 1PXMA 3ORTA 1XQZA 1UKHA 1Q99A 2J0LA 3NEWA 1YHSA 4JQ8A 3TNWA 3W2PA 4KIQA 5GHVA 4AZSA 2VTPA 5M4CA 5JQ8A 5CWZA 4ANMA 2JLDA 2C0TA 4NCTC 3OUKA 3MPAA 2ZV9A 5JQ5A 4L68A 4HYHA 4DGLC 2HELA 4QT1A 3W8LA 3VWAA 4IAKA 1UU7A 4NW5A 5T68A 2ZYBA 4E4LA 1NY3A 4YHFA 1IAJA 5E7RA 4S30A 4NH1A 3VBWA 4LRKA 4BWKA 1JPAA 5AA8A 3QHWA 4YP8A 1UWJA 3OOMA 2CCIA 5J1WA 3AGMA 2ERZE 3Q4UA 3R1SA 2IZRA 2CCHA 4WT6A 3PPJA 4UWYA 4CG8A 4EKKA 1GNGA 2PVFA 5M4IA 3E3PA 3W16A 5TT7A 5HE2A 1KE5A 4D1SA 2CGXA 4ENYA 4KBCA 3VW6A 3AT4A 3PWDA 4QMPA 5DEWA 5L2SA 2PWLA 3A4PA 4JOAA 4RIXA 2OJIA 3R71A 3UQGA 4MCVA 2J0KA 2BZIB 5GIOE 5E91A 3UGCA 2ZB0A 3TJCA 2XK9A 1YI6A 2XEYA 5AP4A 4YJVA 1R0EA 3BKBA 3TL8A 3ZC5A 2B9IA 4IFGA 1P4OA 2J51A 3QTUA 3ZUTA 4AT5A 1YXSA 1H1QA 4ITJA 4O1PA 5FXQA 1YWRA 3ZM9A 2UVXA 3ZZWA 1VJYA 4II5A 3SA0A 5E8XA 4HVIA 3FMDA 5A46A 5IDNA 5GINE 2ITVA 5JRQA 4LUDA 4AX8A 3VUMA 4BBMA 4F08A 1REJA 3BLQA 3WYXA 4Q9ZA 3HKOA 5CVHA 3GVUA 3W33A 2XK7A 3BYSA 1T45A 1J1BA 4R5YA 3L8VA 4YR8A 3CJGA 5KMKA 3RPSA 2VTMA 5BUIA 1JSTA 4NFNA 2YDJA 3ZEWA 2C1AA 3LQ3A 4EOKA 4MBLA 3V6RA 3O8TA 5BYYA 4J97A 4YZCA 5BVKA 2YAKA 4I93A 2RF9A 2W1IA 5FEDA 5EKNA 3MTLA 3LXLA 2BZJA 5AP0A 4A4XA 4YJRA 3BEAA 4XV9A 5ITAA 1UA2A 3DJ5A 2EXCX 3UBDA 2QO7A 3FLYA 3HP5A 4YNOA 4W8DA 3L9PA 2Y6OA 5L6WL 2QG7A 3F7ZA 4MD9E 3PP1A 5DGZA 5AFVA 5AV3A 2OJ9A 3SRVB 4Y46A 2OH0E 3KY2A 2YJRA 4I41A 3RPOA 5AMNA 4NK9A 2ITOA 2R64A 3AD5A 4JDKA 2R3OA 4WD5A 4AA4A 4B9DA 5HCZA 4U0IA 3VUHA 3Q9ZA 4ZTNA 4F4PA 4BKZA 1L8TA 4DEDA 2QOFA 4WHZA 2J0MB 2O8YA 3Q3BA 4IIRA 3BYMA 3F3ZA 3MVLA 3QCSA 4Z7HA 1U59A 4C34A 2ITZA 4U9AA 1GIHA 5E8ZA 2PULA 3PVUA 3PYYA 3Q5IA 3JVRA 3QRKA 1Q8UA 4ANLA 3U6IA 2DQ7X 4MXYA 3VVHA 3LFAA 2ZV2A 4EQMA 3ZH8A 4BN1A 2GHMA 2HWOA 3QALE 2HW6A 4BDEA 3WILA 4P4CA 2QOQA 2QHMA 3ROCA 3DQXA 3D94A 3FZ1A 3R22A 2UZNA 4L01A 4OTHA 3WF5A 2XKDA 2HCKA 4QMMA 1YOMA 2BR1A 1QPEA 2IG7A 1S9IA 3ORLA 4UALA 4YUQA 1W7HA 2NP8A 3B8RA 4QTCA 4DEIA 3I81A 5HO8A 2PZIA 2OKRA 4RC2A 4AZFA 3MSSA 4K0YA 4U41A 3E7OA 4GVAA 4D5HA 5KO1A 5L4QA 5FRIA 1NVQA 2C5NA 4XJ0A 3GP0A 2XCHA 4FOCA 4XBUA 4FSMA 1UU9A 2QOHA 4RIXB 4C0TA 3C4CA 4FV7A 4DH8A 4TW9A 3F3VA 5CAOA 3AC4A 3EH9A 1Z57A 2W5BA 1UVRA 2XK4A 3JYAA 4LL5A 4QNAA 5AIKA 1HCLA 2O0UA 2WTJA 3UQFA 2JC6A 3E88A 3MVJA 3FLZA 3QQHA 4IC7A 4PQNA 4QPAA 4GT4A 4YLLA 4NTTA 4IACA 3Q9YA 4C36A 4D2PA 2O63A 4USEA 4AACA 4IAAA 4EHZA 5HOAA 2CNUA 2C5VA 3WOWA 3DAEA 4RSSA 5LARA 2JGZA 4FKPA 3DDPA 5BUEA 2R3JA 4JLCA 3NVKI 2X7GA 3LVPA 5EM7A 4AW5A 3II5A 3V3VA 3ZLWA 4CTCA 4BVUA 4PTEA 4U45A 2PMOX 3KA0A 1PMNA 3R2BA 3H4JA 5IZFA 5HU3A 3O0GA 5AR4A 3CQUA 3GOKA 4WBOA 4FODA 3T3UA 3VS4A 4A07A 4WSYA 4CTBA 3FI2A 3GCUA 3RPYA 1YI3A 5AP3A 3TT0A 3UMXA 3IW8A 3DKCA 4DYMA 4ZTLA 4R7IA 4BI1A 2J4ZA 2BRGA 2J7TA 3W55A 4IAIA 5H2UA 3KRXA 4QQCA 2UW5A 4FIHA 2ZM4A 1G3NA 3FMMA 3HNGA 4MWIA 4B4LA 2YIYA 3UNKA 2HXQA 4GT5A 3PRIA 3TDWA 1SZMA 3CKXA 2XIRA 2QCSA 5JFVA 4DT9A 1VZOA 5HVKA 4IDTA 3PSDA 3QX4A 3D7TA 2OXDA 3F9NA 3JS2A 3LCTA 4XRJA 1OKWA 4NKAA 5KNJA 3SG9A 2X7OA 3LCSA 4GU9A 3PVBA 4K9YA 3RCJA 3DAKA 3MA3A 4IB1A 1YKRA 4CSVA 4HPUE 1KSWA 4L7FA 1ZWSA 4E6CA 1YOJA 4Z7GA 3RI1A 4EORA 5HU9A 4EH3A 1W98A 4LUEA 5AV2A 5J9LA 1AD5A 2YM7A 2XCKA 2ZM1A 4CCBA 2WMWA 3ZLSA 2CHLA 4DE4A 4IWDA 2UW8A 4E5BA 4YJUA 2CKPA 5EQEA 3OHTA 3NNVA 5IQHA 3SG8A 3LPBA 4OT6A 4IADA 4M66A 5B2MA 5EW9A 1GZKA 3O23A 5H8GA 3UMWA 5AUZA 4ASZA 3FI3A 1KWPA 2XK3A 2ZMDA 3TCPA 3IDBA 4E5AX 4W4WA 1V0BA 4X3FA 3GBZA 3IGGA 3R8VA 2H6DA 3COKA 3P08A 4KINA 4FTRA 3CGOA 1ZYJA 1PY5A 2XIKA 4ZZNA 2R7IA 2GQSA 4QTDA 4J95A 4WNKA 3E8CA 5HIDA 3U51A 4DGGA 5I9XA 2C6OA 1U46A 1H07A 4Y5HA 3BV2A 3ZLYA 4I6BA 3V5TA 2UW4A 4LFIA 3D5XA 3HRCA 1ZY4A 2JDVA 4YLJA 2PVHA 4DFNA 4BDFA 3GB2A 4EI4A 4ANQA 4O0YA 2GFSA 3LXPA 2JDOA 3Q6WA 3QUPA 4IDVA 3IO7A 3RALA 1SNXA 3OROA 2I7QA 4WA9A 3QAME 5BMMA 1XH4A 3DBFA 3PIXA 3F3WA 4XOZA 1Q8WA 4LQMA 2B1PA 3H0YA 4QMQA 4MVFA 2VRXA 4ZTQA 3E92A 4GKHA 4E3CA 3HV3A 5BVDA 1Y91A 4Q5EA 3GCPA 2CJMA 3UDBA 2XJ1A 5ETCA 3E62A 2UZUE 3KMUA 4UX9A 3ULZA 2WB8A 3BEGA 3QC9A 5HLPA 1ZYDA 3KN5A 2GNFA 2GS7A 4ZSGA 2VV9A 2YACA 3DBDA 5JSMA 2W5HA 5AP7A 3UPZA 4Z16A 3IKAA 5CYIA 5DR9A 4D0XA 1M7NA 1W84A 5AP6A 4MHAA 4DGMA 5BVOA 3JY0A 1PXIA 4YZ9A 2J50A 2XIZA 5CAPA 4EYJA 4C4FA 5KCVA 4FKVA 4BI0A 4U7ZA 2GNHA 4PV0A 4JAJA 2C0IA 3BGZA 3LAUA 4B0GA 4BWXA 3C9WA 5CLPA 2ITTA 3HMOA 3IOKA 5DLSA 1GZNA 2PU8A 3QQLA 4DH1A 3DS6A 2VAGA 4I20A 5HCYA 5IUIA 3BWFA 4IVCA 1XH5A 4X3FC 4OAUC 2PZYA 1CSNA 5CI7A 4BCMA 3NUAA 3D7TB 3FXXA 5AUYA 3I6WA 1KOBA 2PUUA 3ZU7A 4K77A 5HCXA 1FVTA 5JFXA 4FZ7A 4XP0A 3EN7A 2WMSA 2G9XA 4I3ZA 4MF0A 3BI6A 3BE9A 3OFMA 5AWMA 2VWXA 2IVSA 4E7WA 4H3PA 4BGHA 3CKWA 3EQIA 4ZAUA 2QOCA 4O86A 2W1CA 4E4MA 4O84A 3S95A 3LCDA 3BX5A 2OZOA 4KSQA 4CMUA 3QF9A 2B9HA 4G3DA 3ROYA 1OUYA 5I4NA 3CQEA 3GU6A 4RMZA 3E87A 3TZ7A 4AW0A 4RWLA 2OICA 3CTJA 4K1BA 4O0WA 3QGWA 2NRUA 1MQ4A 4X3FB 4MYGA 5GIPE 4GYIA 2XNOA 4RJ7A 4QPSA 5I5ZA 3IW4A 2VWWA 3LIJA 1RW8A 3QZHA 5EFQA 5D41A 5K5NA 4NT4A 5HNGA 2QU6A 3MA6A 2F7EE 4YJQA 2VTHA 3HMMA 2WNTA 4FKTA 3ZONA 2RG6A 2WZJA 2I0VA 2RGPA 3HEGA 3PXZA 4LYNA 4NM3A 4AGWA 3KMMA 3QD4A 5FXRA 5ETIA 1KOAA 2I0EA 3P9JA 4FEQA 4DEBA 3ENHA 3ZFMA 4L7SA 4FKQA 5F95A 1YI4A 4ACGA 3QYWA 3PXRA 1FGIA 4QMWA 3W18A 5JZJA 2NRYA 3MY1A 4KBKA 1ZOGA 1PYEA 2FA2A 1HCKA 4C02A 3BGQA 2R3PA 3PJCA 4B7TA 5ANEA 2OH4A 4BCJA 3IW7A 3KREA 3MH3A 3EIDA 3CSVA 4A9UA 4BKYA 4WOVA 3BYVA 5CXZA 1Y8GA 2V55A 2JEDA 3ZSIA 5KMLA 4YJPA 4MXXA 1SVGA 2W7XA 3NCZA 5IQGA 3TKHA 5E1SA 1O9UA 3D5VA 3RK9A 3F7WA 2P33A 3HV4A 3O8PA 3DFAA 3QFVA 1JLUE 3R2YA 3DKGA 5EOBA 4E4NA 3EN9A 4XV2A 4FK6A 3MY5A 3FV8A 1OL2A 4L00A 4C8BA 3QU0A 5C4LA 1YW2A 3BQRA 5HEZA 5HG8A 4XEYA 3KCKA 3QL8A 1H1RA 2OSCA 2X39A 2BDWA 2H96A 1SM2A 4NM0A 4N4SA 3E8EA 5EI8A 4DEAA 4Y72A 4ERKA 5M44A 4W4XA 4UEUA 2Q0NA 3VUGA 3AC3A 1X8BA 2X4ZA 4U44A 4EH9A 4G3FA 5AIRA 5HGIA 4M3QA 4RT7A 3DDQA 3QZIA 3LXKA 4TY1A 1OIQA 4UXLA 4QNYA 3FXWA 3LCOA 1OITA 4BIDA 4UZHA 1U5QA 4JDHA 5HTCA 5IG1A 4GYGA 1IEPA 3RCDA 4F9CA 2J90A 2GS2A 3PTGA 1OZ1A 2QOKA 2UZTA 3QHRA 3T9TA 3DFCB 4OTWA 4E20A 4Z3VA 3ATSA 3UYSA 3NYOA 3D9VA 1SVEA 4FTIA 1XHAA 4JQEA 4O0SA 3R8UA 4H05A 1FGKA 3EL8A 4RX8A 3UIUA 3H10A 3QD0A 4KS7A 5IQEA 3HA8A 4TNDA 4MXZA 2JKKA 2E9UA 2FSTX 2BCJA 4UY9A 3MH0A 5H9BA 2V7OA 3VHKA 4CRLA 2GMXA 2BMCA 4ZSJA 5AR7A 4BYJA 1P4FA 2V7AA 4GT3A 4PDSA 3R8ZA 3PP0A 4DINA 3MGYA 4IQ6A 3Q5ZA 4APPA 1RE8A 3A2CA 3OWKA 2E9OA 3PA3A 3HA6A 5TF9A 4BCFA 5ICPA 5IQFA 3NUSA 5JN2A 2PYWA 3MBLA 5AR5A 5LVPA 3R8LA 4PPCA 3SOCA 4B99A 1VYZA 2UZEA 3R9DA 3SQQA 3DLZA 3A8XA 2O3PA 3VHEA 5HI2A 3QRTA 4FR4A 5IF1A 1PKGA 2OO8X 2C6IA 2E9VA 4FG7A 4QP9A 2CKQA 5C8MA 4A9RA 4KNBA 4EOSA 3PXKA 4LV5A 4F09A 1XH6A 2RG5A 5HHWA 4RPVA 4FTUA 5L2IA 3LJ2A 2V22A 2QOOA 3PPZA 4FTNA 4TYJA 3NIZA 4LGDA 2YERA 5IQIA 4WG3A 2C30A 4YTCA 5E8UA 5FTOA 3GU5A 4PMTA 2VX1A 5DR2A 4ZZOA 4TRLA 3JR1A 1Q5KA 4EONA 1YRPA 3A7HA 2OJJA 3D15A 3CEKA 5EYCA 2IW8A 2ZMCA 3Q6UA 3OD6X 2A0CX 2WAJA 3NW7A 2PK9A 5DHJA 2BZKB 4LGGA 4C4GA 4ASDA 3MFUA 3NAYA 4KKGA 4NWMA 3ULIA 3ORMA 4W9WA 1OIYA 5FD2A 4YURA 5HE0A 5CT0A 3DBCA 3KEXA 3NWWA 2LGCA 4NTSA 4FT5A 2FB8A 4FUYA 3SXRA 5C8NA 4G17A 4FEWA 1QMZA 3E3BX 4RVMA 2IZTA 1XH8A 2W96B 3PUPA 4FVRA 2H9VA 4AE6A 2PTKA 3F69A 5BYZA 5HG9A 4DAWA 4K11A 3K54A 4FZ6A 4KA3A 4FKIA 3LKMA 4E1ZA 4W9XA 4Q2AA 2BAJA 5AR2A 3EZVA 4J8NA 4J99A 4UZDA 3VS6A 4MBJA 4F6UA 4HGEA 3VJNA 5M53A 2X9EA 4ZY4A 5K0KA 4UMTA 3NYVA 4PTGA 4FSUA 4GFGA 4BB4A 4EBVA 1ZARA 3QTIA 4FOBA 1OUKA 3CTHA 2OF4A 4CMTA 4UYAA 4D58A 1BUHA 1O6KA 2UZDA 4JVGA 3D2IA 4L6QA 4U42A 3OBGA 4XOYA 4AZTA 5B2LA 4EZ3A 4OR5A 2V0DA 1V1KA 4GU6A
chains in the Genus database with same CATH superfamily
2IW9A 3B8QA 5DBXA 5DOSA 4AXEA 2Z8CA 3P7AA 2QODA 5J7BA 3PG3A 2W4JA 5CQUA 2P0CA 3R7EA 4F6WA 3EJ1A 3O50A 3VAPA 4YU2A 4CYJA 3ZRKA 2ZV7A 4LMUA 4DEHA 1JOWB 3ZZEA 2EXMA 3OS3A 5DI1A 1OL5A 4CKIA 4FZAB 2XNEA 1QCFA 4BDBA 4YC6A 4FF8A 5EDQA 4D9TA 5LMKA 3BU6A 3F6XA 3NUYA 5J8IA 4G31A 4HCTA 4M13A 1P14A 1ZLTA 1SVHA 4AA0A 3OXZA 1M14A 3IPHA 3LOKA 4ZZMA 3QUEA 3SAYA 1FMOE 3NNWA 1WAKA 5F94A 3W32A 3WE4A 5FDXA 4DHIB 3SXFA 5D9HA 5K4IA 5JGDA 4G6LA 4FIGA 2UW6A 2PVNA 3Q52A 5E1EA 1GZOA 2YM3A 3UOHA 3HMIA 4E93A 4L3LA 4EK8A 4DHJA 4KKHA 2VTQA 4TYHA 2WO6A 2NYAA 2H8HA 5D11A 2X8DA 4DLIA 4D4YA 4BHNA 4O91A 2JIUA 2E2BA 2FGIA 3QTQA 4TPTA 1J3HA 3E93A 3HV5A 3GT8A 1H0VA 2C6DA 3IOPA 3ITZA 4IWQA 4ANOA 3K5UA 3QQFA 3E5AA 4MF1A 3ALOA 3W2SA 1JSVA 2ITPA 3C4WA 2PMLX 4JL9A 4WKQA 3C4ZA 3EFJA 4LOQA 4XS2A 5AA9A 2WXVA 2PE2A 3R7IA 4QTBA 1ZMUA 4RFMA 4I5HA 2OWBA 4NIFA 5AM7A 4O2PA 3RHKA 1B6CB 3VF8A 1PXPA 3H3CA 3TWJA 4BGGA 3ZDUA 5T6KA 3FSKA 1E9HA 2XK6A 4RJ8A 2JD5A 3L1SA 4AGUA 4YTIA 4RRVA 1Q8ZA 3BWJA 4RZVA 4ITIA 3PJ8A 4YZDA 3PA5A 4EHGA 4EH4A 4AP7A 4HNIA 1G8AA 5L8KA 1WVYA 2XNGA 1ST4A 4JQ7A 4CMOA 2F2CB 3R9OA 1I09A 1MRYA 2HY81 2QOLA 5EW8A 3SW7A 5HX6A 2XIYA 1YHWA 4O27B 3FPMA 4BTJA 3TG1A 5L3AA 4RZWA 3MB6A 3NCGA 3KRWA 2PZPA 3KRJA 4E73A 5DMZA 4RWKA 3T8OA 3TIYA 2QHNA 3TUBA 4FA2A 4NYEA 2WIHA 1JBPE 1OKZA 1RDQE 3R1QA 4N70A 4ZJJA 3HDMA 4FNXA 4GK4A 5LMKC 2VD5A 5BYLA 5CANA 4Z55A 5A4EA 5C1QB 3TMOA 5EG3A 1IRKA 1H1PA 1UU3A 3FY0A 2IWIA 5G1XA 2BRNA 2W1ZA 4RA4A 5IU2A 3W2QA 4JT3A 2WHBA 3U9CA 1Q8YA 5AEPA 5KZ0A 3GQLA 4AQCA 3KXZA 2PE0A 5A3XA 2PUNA 5I9WA 1NXKA 3UOLA 5IA5A 5IH4A 4FYNA 2ERKA 4I5MA 3V5WA 3R21A 1W82A 1IR3A 4XG8A 3WF8A 1IAHA 2WTDA 3FMLA 4TZRA 4OW8A 4BIBA 3PY1A 1OPLA 3LMHA 3DU8A 4YBKA 4YNEA 4BDCA 1OM1A 3BHTA 3OWPA 3QKLA 3VNTA 3EYGA 5B7VA 4P2KA 2VO7A 4RFZA 1W83A 3AMAA 1FINA 4RC3A 2PVYA 4R1YA 4AGCA 1R0PA 2QR7A 3VW8A 3NVMB 3KK9A 4CV8A 5DR6A 3ODYX 5FEEA 3FQSA 2Z7QA 4I4EA 5LVLA 4DGNA 4ZLYA 4PPAA 1XH7A 1A48A 3W0RA 3PVWA 3BQCA 4IEBA 3I4BA 2YISA 3ORIA 1Q24A 4ZTSA 4HJOA 5CF6A 4TYHB 2RIOA 3U6HA 3BYOA 3UYTA 4UXQA 3A61A 2BAKA 4XX9A 1OECA 2CN8A 1BI8A 2B9JA 3GU8A 3CJFA 4O0RA 4X2GA 5HNBA 3HRBA 4CV9A 3D0EA 4F9WA 3DXQA 3PUFC 2XAOA 3SHEA 4FTTA 2RFNA 1OGUA 5EM6A 2OFUA 5JK3A 4W4YA 4NM7A 1NT2A 2EU9A 2C0OA 1M2QA 3AQVA 3DCVA 4OLIA 5AV0A 3FZSA 5AAFA 1J7LA 3NFFB 2AUHA 2JFMA 2O5KA 4AUAA 5LCJA 4ID7A 4QYGA 2WTKB 1URWA 2C3KA 2PVJA 4NIFB 3FI4A 5CS6A 3VQHA 4AXAA 1APME 3LQ8A 4H1MA 1XWSA 2PUPA 5J7HA 4DBNA 2EWAA 2C5YA 2GPHA 3ZRLA 5BNJA 4NL0A 4O7LA 1GIIA 4WIHA 3PJ1A 4G5PA 4HGTA 4BCQA 3FZRA 3MDYA 3F61A 3B2WA 3FXZA 2SRCA 3NUUA 5EK7A 2P55A 2ZFYA 4IHPA 3GGFA 2CNVA 5IA1A 4QMYA 1OBGA 3R7GA 4AXCA 1FQ1B 2G2FA 3A62A 2BRHA 4GH2A 4TYGA 4FMQA 5E8WA 4ZIMA 3UP2A 2YIWA 4E6DA 4EJNA 4FIJA 2B54A 2GDOA 2VTJA 5LCKA 3R7UA 4BDAA 2CGVA 3DAJA 4IM3A 2CNQA 4Z9LA 1H24A 2VWUA 4O7SA 4YGAA 2WEVA 3FC2A 2F57A 3DGKA 4JR3A 4L43A 4DFYA 4C38A 2WOTA 3EL7A 3G90X 1NVRA 4KS8A 2R3KA 3TM0A 3EQBA 3DK7A 4B6LA 2PZ5A 4BTKA 1XKKA 3GXLA 3D5UA 5CF5A 2OI4X 2R3LA 2V62A 2A1AB 2YCSA 4G9CA 2XJ2A 5FM3A 5IKWA 3FKLA 4FVPA 2B0QA 4FSYA 3UG1A 4XCUA 4M69A 4BHZA 3HAVA 2ITUA 5JFSA 5KMNA 3HAMA 5ANKA 3JVSA 2WMAA 5CF8A 2GS6A 2RSVA 4U81A 4RFYA 4ACMA 3BU3A 3GC7A 3TKIA 5KKRC 1Q41A 1XJDA 1BX6A 4GIIA 3OT3A 4AW1A 3QA8A 2F4JA 4PPBA 2VO0A 4FTOA 5AUVA 5I3OA 1QL6A 3TV6A 4WUAA 4C7TA 4WNPA 2W99B 5AX9A 4S34A 3EFKA 1OIRA 4KKEA 3U4WA 1PXOA 3DK3A 2X0PA 3LMGA 4GJ2A 4OBOA 4FKGA 3AC1A 3HZTA 3I1AA 5DNRA 3VBYA 5HBJA 4JS8A 5DN3A 2Z2WA 4J7BA 1YWVA 3UIBA 4CLJA 3TNIA 3LMIA 1STCE 4BKJA 1KV2A 3GQIA 4RWJA 3SD0A 2W1EA 4D2RA 3IDCA 3UVPA 3QQUA 5DH3A 5CAUA 3VUKA 2PL0A 3SC1A 4QD6A 4RBLA 3OTVA 5CVFA 3LFBA 5TKDA 3G15A 5KKRB 2QO9A 4G5JA 3F82A 4O0VA 4FV0A 3F5GA 5DFPA 2FH9A 5HBEA 3UP7A 2QVSE 5IEVA 5F1ZA 2W9ZB 3FYKX 4I0TA 1FVRA 2GHGA 2QLQA 3KVWA 4BF2A 1MP8A 3ZLXA 3AT3A 4XHKB 2BZHB 4DTAA 1Q4LA 2B4SB 3UG2A 5M56A 2OG8A 5CNOA 5BVNA 4UMQA 3ZUUA 5KMIA 4Y95A 4GVJA 4JJRA 2GNGA 5CEMA 3ID6C 2AYPA 4GCJA 2QO2A 4FYOA 3QGYA 4EZ7A 5HORA 2X2KA 4I0SA 3W2OA 5DG5A 5EKOA 3UE4A 5AUUA 3BLRA 3ELJA 1PHKA 4H3BA 3C0GA 3AG9A 4HW7A 2CKOA 3A7FA 3V5JA 1VEBA 1DI9A 3UO5A 4LDTA 3HRFA 4PDOA 1CM8A 1F0QA 1DS5A 3OOGA 3KMWA 4I23A 2W17A 4WRGA 1DM2A 4MNFA 2R9SA 2GNIA 3DY7A 4HYSA 5CI6A 1OL1A 4QYEA 4DEGA 5M51A 3BHHA 4FL2A 4O4EA 1VR2A 3LE6A 5KBQA 2HXLA 3NUXA 3P86A 2VWIA 2REIA 4BDGA 3WF7A 1FVVA 3PPKA 4QQ5A 4O7ZA 1K3AA 2W5AA 4IX6A 3Q04A 3GC8A 2VO6A 3ODZX 3P79A 4QP8A 3L8XA 4BTMA 4MWHA 5GZAA 1YXXA 4CQGA 3NW6A 4O96A 1KE9A 3QRJA 4CVAA 2XZSA 2V5QA 4BCKA 3R9NA 1WFCA 3Q4CA 1H26A 4QP1A 4RJ6A 4EHEA 4IM0A 3ALNA 2O64A 3FL4A 4XG2A 5CSXA 4TWCA 5DE2A 5FTQA 3V6SA 4EH5A 2R2PA 1OBDA 1P5EA 2X4FA 4RLKA 4R78A 4RVTA 2XNMA 3AC2A 4MEDA 3ETAA 5CNNA 5B2KA 1ZZLA 1WBVA 4FRFA 3U4UA 3BPRA 4DFZE 2R7BA 2R3QA 3K3JA 1GJOA 4M69B 5LVOA 3ANRA 3R73A 4I5CA 4F6SA 3R7YA 4D28A 4ANNA 4V05A 4K2RA 3FEGA 2YAAA 1JKLA 3SGCA 4EH8A 4B8MA 3HLLA 3FYJX 4YO6A 4F7LA 1XBCA 4MD8E 5HX8A 3I5NA 1YXUA 2XM8A 3Q9WA 4EOQA 3SVVA 2QG5A 2PE1A 4FEUA 3GFWA 2PMNX 3N51A 3K5VA 3C7QA 3R28A 4F0IA 5JGBA 4FI1A 4EC9A 1VYWA 3IONA 1ZMVA 2IVVA 3H0ZA 3UVRA 4CFMA 1JAMA 4JG6A 3ACJA 3KK8A 5CX9A 4QPMA 4CZUA 5ANIA 3EQDA 2I0YA 2VNWA 5DPVA 2YITA 4O0UA 4M8TA 4FKRA 4KRDA 2QC6A 4QP6A 5E8YA 5CEIA 4IB0A 2UW3A 1ZZ2A 2BFXA 1GAGA 3QRIA 4K6ZA 1BMKA 4OGRA 2FSLX 4BC6A 2R3FA 4F70A 3R04A 2IZSA 3F5UA 3F3TA 4YC8A 4CCUA 2BHEA 3OVVA 4R3CA 4X2JA 2OW3A 4F9AA 2YDKA 5CVGA 1PMVA 2WTWA 2XBJA 2GTMA 3D5WA 2W4OA 4CZTA 4TL0A 4BY9E 3TTIA 4FGBA 3C1XA 1TQIA 2CGUA 3FMHA 3LXNA 3ORXA 3GCVA 4GEOA 2FSOX 4LV8A 4NJ3A 4FSTA 4CRSA 3CC6A 4QYHA 3U6JA 3FI8A 1B39A 5HQ0A 2W4KA 2ZAZA 4MAOA 3Q4TA 4CT2A 5KHXA 2C6MA 2ZVAA 4EK6A 3CY3A 4FC0A 4ANSA 5A4LA 5CT7A 3EFLA 3VS3A 3L9LA 3EQGA 4QMZA 4MQ2A 3I6UA 2J0IA 3ZCLA 4FV2A 4WO5A 3F2NA 2YHVA 3KVXA 4RLLA 5CXHA 3VBQA 4TYEA 4BDIA 4BDKA 3HMPA 5IA4A 2JAVA 2IEWA 3TEIA 4TTHB 4M97A 2QU5A 3U9NA 4PP7A 5FEQA 4IZ7A 4C4EA 1JKTA 1TQMA 3AMBA 3F5XA 2WMQA 4RA5A 4AQKA 2DUVA 3GCQA 4CFVA 3OF0A 4ONAA 5CSVA 4CFXA 2UUEA 4FV5A 4ZSAA 4N6ZA 4BCIA 3PIYA 4FK3A 3G51A 2YWPA 3OY3A 2X9FA 4IAZA 3AGLA 4FG8A 4I0RA 4OTPA 5CQWA 3TV7A 4PP9A 2G01A 1H28A 4QQTA 2UW0A 3EQPA 3NSZA 1MUOA 5F4NA 3TI1A 3TUCA 3BYUA 2WELA 3GCSA 3S4QA 5GJDA 3AOXA 4GL9A 4U80A 5CU2A 2HIWA 5FTGA 2JAMA 3BU5A 4C35A 4FV1A 2JBOA 4EWHA 4FSNA 4QYYA 4DEEA 3HDNA 4EH7A 4DTBA 4CQEA 2F2UA 2J0JA 2X8EA 3FKOA 4IANA 5CY3A 5EM8A 3OCGA 4D2SA 4D0WA 2B7AA 5LVNA 4U3YA 4CXAA 1OPKA 3PFQA 4C3PA 2ONLA 3IG7A 4KIPA 1OMWA 4RJ4A 3AD4A 4KRCA 3A7JA 2UZVA 1QPDA 3MS9A 4YBJA 3Q96A 3H30A 5E8VA 2UV2A 4C4HA 2ZDTA 4EKLA 4DCEA 4A4OA 2GNJA 4N0SA 4V01A 4GFOA 2QR8A 5LOHA 4O7TA 5CZIA 4LOOA 1TFFA 2BIYA 5L6OA 4GRBA 1WBPA 3CLYA 2UW7A 4MKCA 4WUNA 4EC8A 3MI9A 5LWMA 4CD0A 4YTHA 2NPQA 3A7GA 5CENA 3VRYA 3JUHA 4FE2A 1LEZA 4TN6A 4BCNA 3KRLA 3ZEPA 1BKXA 3LFSA 4IWOA 4MNEA 4QMLA 3VS2A 2GTNA 2BROA 3L9MA 4WBBB 3DJ7A 5AX3A 1V0OA 3P0MA 5E4HA 5A14A 4MQ1A 2UZBA 2VTOA 3MJ1A 4QMOA 5KE0A 4AAAA 4EOMA 3Q2JA 5HIBA 3HMNA 4GG5A 4JIAA 4JR7A 3MH2A 4C4IA 3DTWA 1R3CA 3P1AA 4BDDA 3WZUA 3ZXZA 3CTQA 2YCRA 2NNWB 1G8KA 4XUFA 3UQCA 4O4FA 5HLNA 4YSMA 2W9FB 3U8WA 3PXFA 5DA3A 4H58A 2XEZA 1U5RA 3C4EA 3ZFXA 3UJGA 2OZAA 2QONA 2QURA 2PVLA 2C5OA 4LI5A 3E64A 3ZUVA 5LMBA 3MPTA 3R02A 4IX4A 3Q32A 5C8KA 1XBAA 3SX9A 4C3RA 3R30A 4ZK5A 3ORKA 4IXPA 1RJBA 3KC3A 3IW6A 4D4RA 3W1FA 1LP4A 2WMXA 3Q2MA 2C4GA 1ERKA 3RK5A 3OWJA 3G6HA 4M0YA 4PNIA 4RWIA 1KE8A 4BIEA 2ONLC 4NFMA 1ATPE 1O6LA 3SOAA 4JBOA 4ZMEA 3ZC6A 1REKA 4BI2A 1PXNA 3VQUA 3LFFA 3SW4A 5J87A 5GJGA 4AOIA 4AZEA 3UVQA 5L8JA 4EWQA 3EQCA 1TKIA 3DZQA 3QWJA 4CKRA 2ETRA 2ZOQA 2PUIA 4KAOA 3HV6A 1WZYA 3FAAA 4AE9A 3MTFA 3ZHPC 2WU7A 2E9NA 3EOCA 1ZMWA 5IH6A 5KBRA 3WI6A 3M2WA 4RG0A 3UNZA 2PVKA 3CPBA 3G9LX 3IK3A 4GG7A 2R3NA 4IX3A 1H08A 5D7VA 4O6LA 5C01A 3ZFYA 3UNJA 5HG5A 2C6LA 4QDEA 3R0TA 5L8LA 1M17A 3DKFA 3PJ2A 3EZRA 3UO6A 4P7EA 2HK5A 3TJDA 3FKNA 4FZFB 1UNHA 4CFWA 3O7LD 3T9IA 1UU8A 2F49A 4U8ZA 4WG5A 4L44A 4J52A 4IBMA 3THBA 2JBPA 1VLRA 3NNXA 3DZOA 4G6OA 4EBWA 4AGDA 1FBNA 1RQQA 4PDPA 5DWRA 3FC1X 5IMXA 3RKBA 4HVSA 4GSBA 3D7ZA 2A27A 2XKFA 3OC1A 3AXWA 3QCXA 3KGAA 5FLFA 3V5QA 4NSTA 4RJ5A 2I1MA 3DPKA 1WBSA 5EI2A 3MVHA 4UYNA 2UZWE 4BTFA 5IQCA 3O7LB 3DLSA 4J53A 3S0OA 3MFRA 3NAXA 3UZRA 3GENA 2IPXA 3OT8A 4M7IA 2UW9A 3S3IA 3TV4A 5I9YA 1A06A 4ZOGA 3WIKA 3OG7A 4MK0A 3ORPA 4UWBA 1YWNA 3U87A 3DNEA 3VONA 3BZ3A 3MV5A 3VRZA 3BLAA 3UIMA 4MNEB 5C9CA 2XIXA 4BR3A 4QRCA 4NW6A 2X8IA 1MRVA 2EUFB 2CDZA 3M42A 3C50A 3FSFA 5FP6A 4J1RA 2A4LA 4BCGA 3RPRA 4AT3A 4C61A 5DEYA 4GK3A 3EN5A 1OKYA 4C37A 4G3CA 4PRJA 3DOGA 3HV7A 3OCSA 4QP2A 1Q8TA 2Y8OA 4YJSA 3UOJA 2ITQA 4C33A 4UMPA 5JFWA 2XALA 3PY0A 5LMAA 1NA7A 3W0NA 4N57A 2Y4IC 5FUTA 3RZBA 2JKQA 4I6HA 3KXHA 2YN8A 5E9EA 5BPYA 3V8SA 2OZAB 3DKOA 4DG3E 2BVAA 2UZOA 2VX3A 3C51A 3QTZA 4FV6A 4E4XA 4EH2A 3EKKA 4YPSA 3FWQA 2QOBA 5TO8A 4NJDA 3ZSHA 1P2AA 4DHFA 1WVWA 4OTGA 4CKJA 3BELA 4K8AA 4LL0A 2QD9A 4M15A 4R7BA 4FT9A 3AMYA 4OTDA 3OZ6A 3QRUA 4O38A 4NM5A 4AW2A 2C5XA 3W0QA 2R3RA 2ITNA 1G5SA 2XP2A 2Y7JA 1YXTA 3PXYA 3QCYA 2B53A 5KX8A 3OXTA 4HZRA 3SKCA 2YM6A 3SXSA 4TNBA 4EOPA 4ZP5A 5DYJA 5CEOA 3PY3A 3RBWA 3MN3A 5M06A 3H9OA 1FMKA 3Q53A 2YLFA 1EH4A 3FMEA 1IG1A 2HZ0A 3HYHA 2Y4IB 4HGSA 2CGWA 1GZ8A 3PSBA 4KBAA 4XG3A 5FG8A 5A9UA 3UC4A 1J7UA 3OWLA 3LLTA 4TYIA 4ACDA 4AXFA 4OTRA 3UTOA 2VTSA 2JDSA 2C3JA 4YHTA 1H01A 2WTIA 4C2WA 4U43A 3TKUA 2YEXA 3QQKA 4P5ZA 4IB3A 4QMVA 5ACKA 3R7OA 4BCPA 2XH5A 3FZOA 3PE1A 2BRBA 4LG4A 2JIIA 4APCA 3OCTA 2WPAA 4JBVA 3PVGA 4V04A 3T3VA 3BRBA 3QA0A 3R63A 2ITWA 4L3JA 4M14A 4AN9A 3WZKA 2XKEA 3ZBFA 2IZUA 3FZPA 3ZSGA 3OMVA 4FSRA 3MIYA 5C4KA 3NZ0A 4O1OA 3P5KA 3QTWA 4QMUA 2VU3A 5HD4A 4BBFA 4DH3A 4FV3A 4QMTA 3VN9A 4I6FA 4J98A 4F64A 4UN0C 3GC0A 4FL3A 5KZIA 5A6NA 5T3QA 1F5QA 3WZDA 2J2IB 4GUEA 1F3MC 4XBRA 2VTLA 4FKSA 2OJFE 4KIOA 3C5UA 5ANOA 2VO3A 4HCUA 3RAHA 3CGFA 3COMA 5ETAA 4YMJA 4ZTMA 1Q97A 4AAYA 3IECA 1ND4A 3QTXA 1YQJA 4JI9A 4LV7A 1JSUA 3BGPA 3I0QA 1MRUA 3MYGA 3W2CA 3HECA 3MWUA 4HVGA 5KMOA 1LR4A 2OLCA 2UZLA 4XG4A 4BBEA 3ENMA 1ZY5A 2GCDA 3NUPA 3LJ1A 2B55A 2YIQA 3V01A 2H34A 4I1ZA 3VBXA 2XS0A 3FE3A 4D1XA 1AQ1A 4BRXA 4NUSA 4NKSA 3QZFA 4MD7E 4IAYA 2C6EA 1L3RE 1UWHA 3MVMA 3EQRA 3QKMA 4R8QA 4QP3A 5E92A 5AAGA 2ITXA 1CKJA 3CD8A 4S33A 4BGQA 4F9BA 4IWPA 1JQHA 2BPMA 4AWIA 4EK5A 3P23A 2X6EA 5E8TA 3FMJA 5FWKK 4MTAA 4FKOA 4FNWA 4FV4A 4R1VA 3QD2B 5EH0A 4O4DA 5GZ9A 3RAWA 3ZM4A 2WMTA 2CSNA 3QXPA 1DI8A 4J8MA 4D4VA 5M55A 4GMYA 4XV1A 2YIXA 2VWZA 3REPA 4D2TA 2YCFA 3EN4A 3QX2A 4M0ZA 3C0HA 3TXOA 3MJ2A 4L9IA 4AA5A 4EOJA 4UMUA 2XAMA 3PLSA 5L2TA 1XR1A 4F0GA 2RFSA 3N4VA 3JPVA 1QPJA 4RIYA 2WKMA 2FSMX 4M68A 3KQ7A 5A6OA 4KWPA 5AADA 3ZTXA 4HGLA 4X6RA 4IVBA 5ANGA 4Y73A 3W10A 2R4BA 2VGOA 3E8NA 3GC9A 3I0OA 3VUTA 2RFDA 3CP9A 4H36A 3QZGA 2JITA 4QYFA 2JDRA 4Y85A 2EXEA 5HTIA 3EMGA 5J79A 5C26A 3NPCA 2YABA 4IW0A 1ZYCA 2CKEA 3F66A 3P78A 5M09A 4K33A 1PMEA 3FLNC 5CU3A 2ZM3A 2OIDA 3EYHA 5EOLA 4AZVA 4DH5A 2C6TA 2W0JA 3TZMA 1BYGA 2ZV8A 3NUNA 5H8EA 4U97A 3IDPA 3MFTA 2KULA 3IGOA 5JEBA 2BUJA 4CG9A 4ACHA 4A9SA 4F65A 2Y9QA 3QCQA 4DG0E 2J5EA 2WTKC 4DTKA 3NNUA 3F2RA 5AUWA 1KV1A 4S31A 1YDSE 3VBTA 4IZYA 1XMMA 3CIKA 4B8LA 3MW1A 3M1SA 3I79A 3VC4A 5EQPA 3QC4A 2WD1A 5A4CA 4XV3A 2Y0AA 3A7IA 5IUGA 5IQBA 3V51A 1M7QA 4O7WA 4E6QA 2F7ZE 3G2FA 2QNJA 4XLIA 3B2TA 3E8DA 3OUNB 4FNZA 4U6RA 3VIDA 3M11A 4O6EA 2YZLA 3V8TA 2DYLA 2OF2A 4PL3A 5HVYA 5IA2A 4ASEA 4D1ZA 3BIZA 4RC4A 2WTCA 5J5TA 4G3EA 4J96A 4ZJIA 4WRSA 5BVEA 1BLXA 4F9YA 2P4IA 4FUXA 4AOTA 4ACCA 3WYYA 4UBAA 3G5DA 3G9NA 3O51A 4HYUA 2X0GA 4L3PA 3OY1A 4FKJA 2PVRA 4GKIA 5D7AA 4X7QA 4M12A 3P4KA 1YHVA 3F88A 3RNYA 2R3IA 1G8JA 5AV4A 4QTAA 4DFXE 3R8MA 3HVCA 3I5ZA 1LUFA 3CQWA 3ZO4A 4RX7A 2X7FA 2WIPA 2ZJWA 3CPCA 5J5SA 1UV5A 2WTVA 3EKNA 4U79A 4EZ5A 1R1WA 4XLVA 4MH7A 4LRMA 2HENA 4QP4A 4ZSEA 1FPUA 3ZO2A 3ERKA 2X2MA 3SDJA 3BL9A 4JRNA 3FLSA 4P5QA 4IZAA 3NMUF 4O7RA 4DT8A 4FKWA 4OTFA 5JMSA 4LOPA 3D14A 3R83A 3C5IA 4YJNA 3R9HA 3UPXA 3GU4A 5A4TA 4IVAA 5FM2A 1OL7A 5M4UA 1YDRE 5HICA 3DBQA 4PF4A 2KTYA 3VJOA 1NW1A 1Z5MA 4FT0A 4IVDA 4O0TA 4YPDA 3VO3A 4AG8A 3AKJA 5ETFA 4HVHA 5D12A 4BZDA 1Y6AA 4RGJA 1XMLA 2HWPA 5C27A 1DAWA 2EB2A 2G2HA 1W2DA 2IN6A 2VX0A 3COHA 4RJ3A 5CAQA 3S1HA 4OBQA 3SV0A 2IVTA 5BMSA 3BHUA 4RIYB 1BI7A 4GS6A 3RPVA 4DITA 2YLEA 4N6YA 2AC5A 3LM5A 4X3JA 4TWOA 3W8QA 1H4LA 1TQPA 2VTIA 3A8WA 3ZS5A 1SYKA 3C4FA 2OBJA 2UVZA 4FZDB 4DGOA 3CE3A 4ORKA 1GOLA 3FDNA 3DV3A 4R3PA 4XMOA 3AD6A 2PSQA 3UDSA 4IMYA 2YM4A 5F20A 4E5WA 2BFYA 5CTPA 2IW6A 1MQBA 2WMVA 5EHLA 3EN6A 5AV1A 1OI9A 2Z7SA 2RL5A 3ML1A 4O2ZA 5LXMA 2ITYA 2OGVA 4ERWA 5IH5A 3DJ6A 4DC2A 4O82A 4EK3A 3OXIA 1O6YA 4HVDA 4ZTRA 2Q0BA 3TNPC 3WIGA 4ZLOA 5I0BA 4ITHA 3RM7A 1OPJA 4U5JA 4L53A 4NU1A 4FGRA 3WE8A 3GUBA 3KF7A 1JVPP 5EI6A 1LPUA 2YJSA 2BDJA 4U40A 4YHJA 4EQCA 5K4JA 1UKIA 3QD3A 2VZ6A 2Z7RA 1ZYLA 3S00A 4W4VA 5EDPA 3R9RA 4FTJA 4I6QA 2A2AA 5AJQA 3RAKA 3UZTA 2PPQA 4A9YA 4ZLZA 2A98A 4FSWA 4F1MA 3IW5A 4DLJA 5CU4A 1ZRZA 5DVRA 2IO6A 1XO2B 2OIQA 3O2MA 3RJCA 5CEQA 3VBVA 4C3FA 3BL7A 3RWPA 2GNLA 4E26A 4BICA 2XVDA 1JWHA 2XRWA 5HVJA 1CTPE 5DT4A 5CSWA 3R8PA 5IA0A 3ZOSA 4BYIA 3LFQA 4F63A 1WMKA 2BILB 3AC5A 4XP2A 5GZ8A 4IJPA 4X2KA 1YXVA 3CXWA 4DG2E 4MXCA 5HIEA 2W1HA 4JAIA 4X6QC 3ORZA 4MX9A 4TXCA 5I9ZA 4L67A 4ASXA 3TNQB 5IMEA 4DFUA 4FEVA 2B52A 2VWBA 3NYNA 2B9FA 5L2QA 3LFDA 4FVQA 5AUXA 3O5AA 3W0PA 3NRMA 5HG7A 4FIIA 1I44A 2JIVA 2R0IA 4AF3A 2WMRA 2VWVA 3U55A 1WBTA 1W0XC 4KSPA 2I6LA 5ANDA 1HOWA 4AS0A 1OB3A 3VS7A 5CEKA 4G2FA 4EUTA 3GU7A 2QLUA 4EYMA 1JNKA 1KE7A 4JMQA 4F7JA 2X81A 4D9UA 2VTNA 3NIEA 4A06A 5DRDA 4PTCA 3WF9A 3WARA 4EOIA 5J9ZA 2QKRA 4FL1A 3U54A 4FTKA 4YJOA 2PVMA 4ZMFA 4KABA 4YSJA 4X21A 2BIKB 2BKZA 4C59A 4HCVA 2C3LA 4JRVA 1KUTA 5CF4A 4FX3A 1PJKA 4ZJVA 3FZTA 2GU8A 2Z60A 4RIWA 3PLAE 1CKI