3E92A

Crystal structure of p38 kinase in complex with a biaryl amide inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
350
structure length
348
Chain Sequence
b'QERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDELKILDFGLAHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Kinase array design, back to front: Biaryl amides
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 348
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e92A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e92A01
5JKGA 4GT3A 4JLCA 3I1AA 1YI3A 4QMSA 3KULB 3TT0A 3NEWA 4QP4A 3PPJA 3A7HA 4BI0A 5E91A 2QR8A 2B7AA 1QMZA 4EJ7A 2ITZA 3CY2A 3PXZA 2CLXA 4PMSA 3DB8A 3DS6A 4GJ3A 3C9WA 4V04A 4HVSA 4EOMA 4MD9E 3FXZA 1M14A 2XVDA 3F66A 4GYGA 2WHBA 1H26A 3LFNA 3QD4A 4TRLA 3RM7A 3VS4A 4JVGA 2WU7A 3MSSA 5HBJA 3FMDA 4CFVA 1WVWA 3R1YA 1UNHA 4CFFA 3LFQA 1QPDA 3R1SA 4R5SA 3O51A 4KUJA 1IAHA 4GVJA 2UZNA 4ASXA 2CSNA 2SRCA 4FV0A 4O7NA 4ZTSA 3C50A 4QD6A 2C6MA 2BROA 3NVMB 3COHA 3EN7A 5HX6A 4O0SA 3CS9A 4EHEA 1EH4A 4APPA 4EH6A 4QMUA 3NPCA 3AT2A 3MIAA 3OD6X 5EQEA 2VTOA 5CAUA 5L8KA 2YIRA 3CBLA 2JDSA 3CTQA 1YXVA 4QMPA 4PPCA 4AF3A 4G2FA 4ZTMA 3NWWA 4C4GA 3W2PA 4CV8A 2BFYA 4UV0A 3W8LA 3DU8A 2R3QA 4LRMA 5CYIA 2XB7A 5D11A 3DFCB 2JIUA 4IADA 2ITTA 4F6SA 2EB2A 3GNIB 3OWLA 4JI9A 4YZDA 3F5GA 5FEEA 4IW0A 3Q9YA 4QTAA 4DLJA 4A9RA 1R3CA 2ERZE 3GC9A 1ZLTA 2BDJA 1Q3WA 3L8XA 2BR1A 3PJ8A 3ELJA 4IBMA 2Q0BA 3H9OA 4QPSA 4FOBA 4I5MA 3HP2A 5HO8A 3H9RA 3R9OA 3NGAA 2YM8A 1XBBA 3AMBA 2UZWE 3DKGA 3N9XA 4DH7A 4AW5A 3JS2A 3RJCA 4MKCA 3QC9A 1DAYA 2XUUA 3RPSA 3O96A 4HYSA 1SVGA 1H07A 2BTRA 5B0XA 3DQXA 3RPYA 4YGAA 5LQFA 4PX6A 1M17A 1H0VA 3MVLA 3E62A 1LP4A 4C8BA 2XNPA 4AN9A 4BDJA 1Y91A 4B8LA 3R8PA 2G2HA 1UV5A 1ZZLA 2ITXA 3ALNA 4H1JA 5ANDA 4F6WA 3O2MA 4CNHA 4M8TA 2R3JA 2UW8A 4QMWA 4FTQA 4OTIA 3GP0A 4L43A 3K5UA 5EHLA 2IVSA 3AD4A 3D5VA 5BYYA 5KMLA 4FKSA 3WYYA 5JGAA 2J6MA 4CZUA 4NYEA 3FZ1A 4CFNA 2OLCA 2PE0A 3IGGA 4KIQA 3UMWA 3F2AA 1AQ1A 1WBSA 4LOQA 1CM8A 1K2PA 3Q96A 1TQPA 4I5HA 4NM7A 2OI4X 4R7HA 3KREA 4O7TA 3QTSA 5C4LA 3DKOA 4NZWB 2EXCX 4MQ1A 4PMMA 3EQRA 3BQRA 3NZ0A 3OW3A 2YDIA 5CLPA 2PK9A 3NYVA 4AAAA 1OVEA 2NRYA 3FL4A 4CFUA 5KUPA 4X2FA 3C4CA 2X2LA 4YLJA 2UZDA 3L9PA 1QL6A 2CKEA 4L42A 4YTHA 3R7UA 2X8IA 3EWHA 4RLLA 4ZAUA 2UW0A 4FIFA 4MX9A 4FSYA 4FIIA 4F7NA 2B4SB 5EM5A 3SDJA 4QPMA 3DZQA 3UIMA 3UPXA 2QOOA 4AXAA 2GNHA 3KMMA 5E1SA 4ZJJA 3QCQA 4RMZA 5IQGA 3RPOA 3VF8A 4TTHB 4JR3A 3PA4A 4EH9A 4F99A 4YJTA 3UYTA 4L7SA 3A4PA 5L3AA 3OWJA 5LWMA 3ORNA 2C6EA 4FYOA 3UQCA 4M12A 4I0SA 4I0RA 3ACJA 3UP7A 3MIYA 4CZYB 4DF3A 4XOYA 3ORPA 4FYNA 1YRPA 5EYKA 2PYWA 4CFMA 2F2UA 2XIYA 4X21A 1NVQA 2HW6A 1DS5A 4RA5A 4U45A 4MWIA 3GB2A 2HK5A 3PVGA 1GZKA 3OCBA 4TZRA 4JAJA 3GC8A 4X3FC 5DHJA 4BKJA 4YJRA 3M42A 3SW7A 3UQGA 1A06A 4OBQA 3FZOA 4EOKA 5FRIA 5B2MA 4IZYA 4YJVA 4C02A 5JT2A 3VN9A 2BAJA 5KBRA 3H10A 1UA2A 3E7VA 4FT3A 4TNDA 4C3PA 4LYNA 3JR1A 3AC8A 3BIZA 4C3FA 4F9YA 5BQ0A 4C62A 3TNIA 3N51A 3V6SA 4F4PA 4ACHA 3QQJA 5C8KA 2X6DA 3P7BA 3HNGA 4OGRA 4YC3A 4YZNA 3RP9A 3V8TA 4AWIA 5IA4A 4MXXA 3ZBFA 4R5YA 4XG3A 1H4LA 2QOFA 3E5AA 3RTPA 2C1AA 1FMKA 5H8EA 2GQSA 4EHVA 3DFAA 4C3RA 1UWJA 4GMYA 3JY9A 5DRBA 2E9VA 5KMMA 2UZVA 4XV1A 2C5VA 2R7BA 1O6KA 1AD5A 3KEXA 3KK9A 5DI1A 4XUFA 2PMNX 3IO7A 4I93A 5CT7A 4B99A 2XH5A 5IISA 5AJQA 4U79A 1B39A 4M66A 3EFWA 3BWFA 4CFXA 5KX8A 4RC2A 4DG3E 2WTCA 2FSLX 4YHTA 4CFWA 2RG5A 3LOKA 1ZOGA 4TYHA 1PKDA 4QMTA 4D55A 2FH9A 3CJGA 4X3FA 2W4OA 3ZLXA 4XH6A 3TEIA 2GTMA 2C3LA 1SM2A 4F0GA 2Z02A 3F5UA 4B8MA 3PWYA 4RQKA 4YBJA 5DT4A 5DT3A 5AV1A 4TYIA 3IK3A 1LEWA 3QL8A 4BIEA 2W1IA 2PUNA 4ZTRA 4TL0A 5BVFA 1FOTA 2HZ4A 2XIZA 3HZTA 3K2LA 4L53A 4RT7A 2QOQA 4U81A 1PXJA 1XH8A 4YC8A 2OGVA 4YU2A 4Z16A 1E1XA 4QTDA 4D4SA 4G17A 4ACGA 4ASEA 4DGNA 4I5CA 2HENA 3BGQA 3C13A 4FIHA 1YXTA 4GK2A 5AV0A 2IW9A 5CEPA 2JDOA 4FC0A 2F4JA 1JAMA 1VZOA 2WMTA 4R3PA 3RPRA 2EB3A 4ZZOA 5JH6A 1M52A 3FE3A 5DWRA 5IQEA 3GU4A 1ZYCA 3LLTA 4II5A 3EHAA 2W0JA 3FYJX 4J95A 5ITAA 2W5HA 2VTRA 4GT5A 3V5JA 4A06A 4ZY5A 4L3JA 2WKMA 4XNEA 5EM6A 5KMIA 4BFMA 4HCUA 5JZNA 5HNIX 4PNIA 4PPAA 3MN3A 5LCJA 2OW3A 2ITPA 4WNPA 3PY0A 4ITJA 4CRSA 2DWBA 5HU3A 2FA2A 2QO7A 4RGJA 2FSOX 3DBDA 3MJ1A 4HCVA 4QYYA 4RC3A 4LG4A 4ACDA 2A0CX 2C5NA 1JLUE 4ENYA 5FBOA 2GHGA 2VNWA 3FEGA 5FEDA 4BTMA 5DNRA 5AWMA 5H3QA 4RFYA 3IOKA 4RWKA 5KNJA 4D0XA 2QQ7A 4IANA 3QLFA 3D0EA 3F69A 5LMBA 2YCRA 4EOSA 3G6HA 3OHTA 5C1QB 2BIYA 3QD2B 3TUBA 4FBXA 5AUYA 4FUXA 2BRNA 5EYCA 5AV4A 2VTTA 2BKKA 4IAAA 2PMLX 4WG5A 3WZJA 5JK3A 3FUPA 4JDHA 3BX5A 3OVVA 4J97A 4G6LA 3L9NA 3V5LA 3WF6A 5D12A 5E90A 3DNEA 3QGYA 4NFMA 3SKCA 4DEIA 4FKRA 4RWJA 3KF7A 3VO3A 3LJ2A 4RJ5A 4IQ6A 3CD3A 3KU2A 4FSRA 4DBNA 4RJ3A 5J1VA 4S31A 4Z9LA 3ZXZA 4PV0A 4AN2A 2WTDA 2OG8A 3PJ3A 4L00A 4E4XA 2PULA 4ACCA 2OU7A 2P3GX 5HTCA 4QP6A 2VWBA 5AUUA 2VV9A 2W1DA 1Z57A 4MNEB 3F5PA 2IZTA 3E7OA 3OZ6A 3AQVA 2ETKA 1WCCA 3ZLSA 4MCVA 3D2KA 2OXXA 3SHEA 4USEA 4YSMA 2B55A 5HG9A 4BYJA 4EOJA 3ALOA 4IB5A 5IA3A 4UZDA 2YIYA 1BKXA 1UKIA 3DB6A 1S9IA 2Y8OA 3BKBA 3DZOA 4ANMA 3QQFA 4E73A 3ZSGA 2XM9A 2HZIA 2XKFA 4W9XA 3DLZA 3V5QA 5HE2A 4FNYA 4BBEA 4J71A 4FUYA 5AP6A 3SOCA 4ANLA 2EXEA 4RIWB 3BEAA 4XBUA 4F0FA 4FZ6A 4F64A 4PQNA 2C30A 2UVXA 4M97A 5HIBA 5LARA 4JIKA 4LM5A 5CEIA 3ZO3A 4BDGA 3MTFA 3CTJA 5KMNA 1YXXA 4OAUC 3PA5A 4CKRA 2ONLA 2YZAA 1PXPA 4J8MA 4OAVB 4YMJA 2BZIB 4WUAA 1JKKA 1K9AA 3ZSHA 4CTCA 1BI7A 4GH2A 3R1QA 3PSBA 4FG7A 3G0FA 4FKUA 4BHZA 3MPAA 4BGGA 2VUWA 2XKEA 4KRDA 3ZLYA 4RX7A 4FNXA 3NUYA 2QKWB 2WPAA 3DJ6A 5IQHA 1OBDA 3B2WA 3NDMA 3FZSA 5EG3A 3FHIA 3RK7A 2GHLA 2YITA 3P23A 4EQCA 2BZJA 3LXLA 1KUTA 2JFMA 2OFUA 3LCDA 4PMTA 2O3PA 3D14A 3FLSA 4RFMA 3ZXTA 2R3HA 5E92A 3WF7A 4R78A 2YM5A 5IKWA 2Z7QA 3D5UA 2XBJA 4IB0A 1Q8ZA 3QA0A 3DCVA 5TOZA 2B9FA 3E8EA 4G6NA 1ZMUA 4Z7HA 4AT5A 2W1GA 2YWPA 5EM7A 5C01A 4AE6A 4FTRA 4ZSJA 4YP8A 3AD6A 3MB6A 5BNJA 1CKJA 3MTLA 4V05A 5E9EA 4CLJA 3QCYA 2PZRA 3DDPA 4FSWA 1MRUA 2KTYA 3I5ZA 4QP8A 4JDJA 2X2MA 3P7AA 4UYAA 3NUXA 2ZAZA 2YHVA 2XK8A 4Y5QA 5AADA 3L8PA 3EMGA 5AP0A 3QTUA 2ITOA 5E8SA 1Q8WA 3A2CA 4D28A 4F9WA 2QLUA 1WFCA 4UALA 4IWOA 4EEVA 4PP7A 3FXXA 2VWVA 3Q5ZA 4K0YA 5GIPE 3HMPA 1Z5MA 3JUHA 2VNYA 2XBAA 3UO4A 2Z8CA 5AM6A 4AP7A 3IDBA 4I4EA 3CCNA 4ZP5A 3ET7A 4OR5A 2V5QA 3MY5A 2C5XA 4FODA 5L2TA 3POZA 4IC8A 4H05A 4KIOA 3OOMA 4AUAA 4DC2A 4OTPA 4DH5A 4UBAA 3W2CA 3VAPA 4DE4A 1UNGA 3OXIA 4GU9A 4ANNA 4DH3A 5BVEA 3REPA 4RX5A 5B2LA 4KS8A 5DPVA 2F49A 3HV3A 1PXNA 4C4JA 4QP7A 3RCJA 3FKLA 3KFAA 4RRVA 5F4NA 3WARA 4DFLA 3IOPA 3SGCA 3H3CA 3QU0A 4FV1A 3HECA 3D7TB 4K2RA 2GU8A 5DIAA 3RNYA 3JPVA 4R8QA 5LVLA 3ZM4A 1VR2A 4EC8A 4GG5A 3W2RA 3E93A 2JAMA 5A4CA 4O21A 5A9UA 5D41A 4JS8A 3K5VA 4W4WA 2CGVA 3THBA 3DAEA 3QCSA 1CMKE 2YIXA 4XCUA 2VO3A 4BRXA 4GU6A 4BGQA 4LRKA 3DAKA 3PE2A 4WSYA 4IVAA 3U55A 2X4FA 4RPVA 3T3UA 2ZDUA 4FT0A 4E5BA 1KE8A 5IPJA 4Z3VA 4L52A 5E8TA 5GINE 2P33A 1YOMA 4ZS4A 4QMXA 4EK8A 4JXFA 3ROYA 4BB4A 3DTWA 2GS6A 4AOJA 2X7GA 2WQNA 4F1MA 4AOIA 1KE5A 2IW6A 2RIOA 4NUSA 2VN9A 2WFYA 1M2PA 5IQBA 2RGPA 4K11A 5FTGA 4CTBA 4E6QA 2BUJA 5CU3A 4JX7A 4CG9A 3ZFXA 2C3JA 4HOKA 2I6LA 4QTCA 5IA5A 4ANQA 4DFBA 4YUQA 4F9BA 3P79A 3CE3A 4GJ2A 1I44A 3WZDA 1WVXA 4HGEA 4MXOA 5KO1A 4DEEA 2C47A 2BZKB 3IW5A 4O0YA 1Y6BA 1H8FA 4L3PA 4FSMA 4XG7A 3SC1A 4C4IA 4TN6A 4NIFB 5GJGA 4AU8A 4DHFA 4YSJA 5F95A 1JPAA 2WTKC 3K3JA 3FQHA 5JZJA 2J5FA 1FINA 3EZVA 2CCIA 2R3OA 5BMMA 5IA2A 5DOSA 5FLFA 3LJ0A 1U46A 3F61A 3FPQA 5EHYA 5HVJA 2V22A 4GT4A 5I3OA 5AAFA 2YDJA 3BYOA 3PFQA 4XJ0A 4U5JA 3ZBXA 3VS2A 4D1XA 1FBNA 1PW2A 2RL5A 1WMKA 2CDZA 3UC4A 3FL5A 4YJSA 1XBCA 1RJBA 3GCPA 3O23A 4JBPA 2CNQA 4YPDA 4I94A 4KINA 4BDKA 4PDYA 5KHWA 3DTCA 5J5SA 3BHHA 3EFJA 5KE0A 5FQDC 3VS1A 3T9IA 2ITUA 2I0HA 3KA0A 3ORLA 4XBRA 1Y8GA 2J51A 5EFQA 3ZOSA 5IH4A 4GKHA 4J99A 3GEQA 1ZMWA 3TZ9A 3RAWA 3ZEPA 3DGKA 4Y95A 5F94A 5JN2A 4CKJA 3QFVA 2UVYA 4DCEA 3HMIA 4RIXB 3FJQE 1JSUA 2ZDTA 3OTUA 1CTPE 2WU6A 3PIXA 4M7IA 5FTQA 3FXWA 3E92A 2WTVA 4Y72A 5DR9A 3G33A 5JGDA 3FHRA 4G5PA 3NR9A 4NW6A 3LMGA 1Q8YA 2JDRA 4FTKA 5HE0A 4EORA 5AP2A 3KF4A 3UE4A 1LPUA 2OIDA 4F1TA 4Q5EA 1TVOA 3GT8A 2BILB 4QRCA 3ATTA 1H0WA 3R00A 4B7TA 4LRJA 5HD4A 5I9YA 3EIDA 3LW0A 4Q2AA 5CENA 5F20A 5CEKA 3F3VA 4CMTA 4DGMA 2H9VA 2O8YA 1OL7A 3A61A 3TJDA 2J0KA 3LE6A 3VIDA 1CKIA 3R30A 4LGDA 5IQAA 4I6BA 1V0PA 3QTQA 5I9UA 3R2YA 4F9AA 3N4UA 4LV5A 3FQEA 5HVKA 2HAKA 4BWXA 3Q2JA 3W2SA 3L8SA 4GL9A 4MNFA 3W8QA 3PSDA 3H0ZA 5CAQA 1GIJA 2HCKA 3KULA 2R3RA 2PZIA 2Z7RA 3KRWA 3QKMA 4FNWA 1PXMA 5L8JA 3ZMMA 5IEYA 3VS5A 5T6KA 5D7VA 1XJDA 2Z2WA 3NRMA 4FL2A 4LFIA 1NVRA 5HE3A 5HCXA 4FTAA 3K3IA 3EN4A 3CSVA 5M44A 2O5KA 2R4BA 4IJPA 2VTNA 4GG7A 4AACA 4W9WA 4ACMA 4CYIA 3RAIA 3GC7A 4PPBA 4DG2E 4K8AA 3ZM9A 3EQFA 3D2IA 5IG1A 3MVHA 5KMOA 3MI9A 3ZH8A 5HCYA 5AUWA 3DQWA 5EM8A 3BBTB 4IC7A 2JLDA 3FI8A 3FLQA 3QBNA 4WNMA 4X2GA 2C6LA 3W18A 5HG8A 4FVRA 3QF9A 3Q53A 3ZSIA 5FEQA 1XKKA 4F7JA 4NT4A 3LIJA 3TZMA 3A7JA 3G0EA 4OUCA 5AEPA 2CNVA 4IX4A 2XK7A 4NWMA 3C0HA 3BHYA 4RFZA 5J95A 2WEVA 3Q9ZA 4XEYA 1KE9A 2OH0E 3Q4CA 4QYHA 3JY0A 4U8ZA 2VTMA 2CGXA 4M68A 3DDQA 5E7RA 3QWJA 3P1AA 3UIUA 3MV5A 4EK6A 2W7XA 4S32A 3KRRA 3OBJA 4QYGA 4BTFA 2G1TA 2OXDA 5IUGA 2V62A 4QYEA 4ZLZA 4YTCA 2QC6A 4M0ZA 3HV5A 5D10A 1IA9A 2BAKA 3P7CA 5EQYA 1W83A 2WTIA 3OWKA 2YEXA 4RWLA 3KN6A 3ORIA 2XKCA 2PL0A 4H3QA 4ANOA 2F2CB 5KHXA 1J1BA 2CN5A 3R9HA 3A62A 4U41A 4QMVA 3O7LB 2WEIA 2CPKE 2IN6A 4CGAA 3D9VA 4OTQA 1YDRE 3G5DA 3S2PA 4MHAA 4FT7A 4G3EA 4QP2A 5AR2A 4B0GA 4NU1A 1Q41A 3TZ7A 5IQIA 5LMAA 3VWAA 4XG9A 3JXWA 1BMKA 3WF9A 3D15A 4JR7A 5CAOA 1B6CB 4FZ7A 3H9FA 3ZCLA 4U80A 2W9ZB 4CKIA 1SZMA 4EBVA 5CF8A 3Q52A 4NKAA 3SLSA 3R2BA 5M07A 3PXRA 2VGOA 3EJ1A 4J8NA 4QMOA 3VRYA 4QPAA 5J7HA 4U44A 5IUIA 4GSBA 4WD5A 5TO8A 4DA5A 2G2IA 2PVNA 4ZZNA 3M1SA 3MVJA 2W99B 3UYSA 4FOCA 4LV8A 5BUEA 5K0XA 3IDPA 3GU6A 2WOUA 3MY0A 3V8WA 3RCDA 3P08A 4IDTA 2J2IB 5J9LA 5ANGA 1KOBA 2GFSA 5CTPA 4O7RA 2QNJA 2RFSA 5ANJA 5CVGA 3LAUA 5BVKA 4BBFA 5IMXA 4G3CA 2XF0A 4MBJA 3CLYA 4DGLC 3QZHA 4FEWA 1O6LA 3TCPA 2BRBA 2QG5A 2R3FA 4CSVA 1J7UA 2Q83A 2WMWA 5M55A 4GK3A 4DEHA 3H0YA 2R3PA 4XV9A 5KKRB 2HELA 5CI7A 5M4CA 5EOLA 3PJ1A 4YJQA 3AOXA 3HA8A 4UX9A 3E64A 4IAKA 4D1ZA 4FVPA 4WG4A 2ZJWA 4K33A 2F7ZE 4EH5A 5BYLA 1GOLA 1OPKA 4BICA 3FMMA 5EW8A 3RHKA 4FVQA 4RX8A 4X2KA 1BUHA 3FLWA 4DBXA 5ETAA 2HYYA 5C27A 4JG8A 3R7GA 3D83A 3VJNA 4IX3A 3RGFA 3QQUA 4NCTC 5EOBA 2ITWA 2X1NA 3S0OA 4ZMFA 4K18A 1CDKA 3OXZA 4C4HA 3M2WA 2X4ZA 4EHGA 1Y57A 2ZV2A 4LUEA 2RF9A 4CD0A 5JFWA 5D9HA 4F1OA 4C38A 4C2WA 5I9WA 3F6XA 3UO5A 2ITVA 3MW1A 3R04A 3WZUA 3SQQA 2GS7A 4FTOA 1U5RA 1Q8TA 3FMNA 4X2NA 1U54B 3NYNA 2X39A 4FKJA 3EYHA 5E4HA 2QU5A 4L01A 2C6DA 2BDWA 2QD9A 1PKGA 5AR3A 3FLYA 5AV2A 3BHVA 5IDNA 5HVYA 2C5OA 3NAYA 5CU6A 4L44A 4MVFA 4MBIA 5JFVA 4QO9A 4R3CA 3ZEWA 5J79A 3S1HA 2J0JA 2YCSA 4AQCA 4P5ZA 2VAGA 1Q62A 3BGZA 1UU3A 4H3BA 3UC3A 4EK4A 1KOAA 3JVSA 4I21A 3OTVA 4O7SA 3E63A 4QQ5A 3DT1A 4G6OA 1CSNA 3ENMA 4BC6A 3BE2A 1UU7A 3OG7A 3PE1A 4S33A 4HYIA 5M53A 2CLQA 4S30A 4BCNA 3ID6C 3P86A 2IVTA 3C4WA 5ANIA 3LXKA 3VJOA 5CEMA 1ZY5A 4MF0A 4FK3A 2JITA 2XM8A 2P2HA 4U3YA 3ZC5A 5CWZA 3W10A 3AMAA 3AC4A 4NCTA 2OJIA 4KBAA 3I81A 2XEZA 4PDSA 3FSFA 4EH8A 4TYJA 3LLAA 3UNZA 4E4NA 4UZHA 4HPTE 3SA0A 3T8OA 4QTBA 3E87A 1VEBA 4AW1A 3KXGA 4I24A 4EK5A 4U42A 3RHXA 3QTWA 3UODA 3E3PA 1FVRA 2QOBA 3FC2A 1H25A 4ZSEA 4YZ9A 4BI1A 4E26A 2VTAA 1M2QA 2NPQA 4D5HA 1YKRA 4UWBA 5AMNA 4O0VA 2OZOA 2QODA 3BGPA 5ANKA 4ALWA 3II5A 2QU6A 4YO4A 3UZRA 3MPMA 2W1CA 2RKUA 3FZRA 2CN8A 5H8BA 2C0TA 2W1EA 4L67A 4AZWA 4IHPA 1WBNA 4RA4A 4U9AA 2PVJA 4FSZA 4Q5HA 4DTKA 3GCQA 2WMUA 5A6OA 5C4KA 3C0GA 4RSSA 4D2WA 1OIYA 1Q4LA 2W1FA 3ORKA 3QKLA 4XX9A 3R7OA 1OITA 2G2FA 4BCPA 1J3HA 4E7WA 5CSPA 4BKYA 2UV2A 3FZPA 2JD5A 4MXYA 2CNUA 2VX0A 3AXWA 4M3QA 4EKLA 2XK4A 3I0QA 4G3GA 4PDOA 3MPTA 2JGZA 4YR8A 2H34A 2IWIA 4PNKA 4FG8A 4IAZA 4WKQA 2BDFA 1HCLA 1Q5KA 3ZZWA 4E6DA 1IEPA 4FG9A 3POOA 4FTJA 1M7NA 2GCDA 4O0XA 5HOAA 4CCUA 2I0EA 3HL7A 2VWYA 3IW7A 1NW1A 3HA6A 4DT9A 4J52A 3UPZA 3NCZA 4PL5A 2BKZA 3U9NA 3CKXA 1Q24A 4QYFA 4WNKA 3C51A 4EH3A 3V5WA 5CVHA 5K9IA 4FSTA 2HXQA 1KSWA 1YXUA 1NY3A 2FB8A 4YHJA 3UVQA 4CT1A 3EKNA 4F63A 4FEVA 2FSTX 3QXOA 2WMQA 2B52A 5IMEA 4JQ7A 1OIRA 2J50A 4LQMA 5HU9A 3BE9A 3LQ5A 5EDPA 4F7LA 3CIKA 4P4CA 3MH3A 4NFNA 4M0YA 1G3NA 2PY3A 5AX9A 3GFEA 3VHKA 3HLLA 2JKQA 4I22A 1YI6A 3L1SA 3R21A 4AGWA 2XS0A 2VTLA 2JKMA 1OKWA 5KMJA 1GIIA 4G9CA 4FZFB 5GHVA 2WXVA 2OF2A 3QHWA 1UKHA 4EH4A 5IA0A 4TWCA 2VTSA 3LCTA 3PXQA 5GZ8A 2I7QA 3GFWA 4EOIA 3H4JA 3VS7A 4ZY6A 2W05A 2WQBA 3RK9A 1WVYA 4RQVA 3U6IA 3CTHA 2YACA 5I5ZA 1STCE 4EQMA 4R77A 4BCIA 2E9UA 2GS2A 5BMSA 2AC5A 3I7CA 5CASA 2YLEA 2HY81 3BPRA 5K4IA 4NK9A 4MNEA 5EW9A 2WQMA 3HEGA 3ODZX 3U51A 4W4XA 3AD5A 4WIHA 3BWJA 4XP3A 2V0DA 3NNWA 3UDBA 4MYGA 4UMPA 3Q9XA 3LJ1A 4DFUA 3LZBA 3OT8A 4EBWA 5FBNC 5HIDA 4FIEA 3SXFA 4BDFA 4IB1A 4O27B 1XH5A 5AA8A 4D9TA 1G8AA 4BDDA 3TZ8A 2WIPA 2UZEA 2IZSA 4FIGA 3VQHA 4RIWA 4A4XA 3HAMA 2XNEA 1YOJA 1YHVA 4OBOA 1WBWA 5KZIA 3HVCA 4EL9A 4XYFA 4FMQA 3O17A 2HW7A 4TYHB 4V01A 4JNWA 3O7LD 5C26A 4L7FA 3IPHA 5AUVA 2Q0NA 1IR3A 5J9YA 3A7IA 5DLSA 2ACXA 1OPJA 4XP0A 2QR7A 4KRCA 1JKSA 5M4FA 2WB8A 5A4QA 5AM7A 3SV0A 4RIOA 3UIXA 4D58A 5CSXA 5K4JA 5CXHA 1JSVA 5CU0A 3QQHA 2R3IA 1DM2A 2X7FA 5I4NA 4JAIA 2UW3A 2YJRA 2H6DA 2HXLA 3B2TA 4KIKB 5EK7A 5AX3A 3SAYA 1BL7A 2OJ9A 3VUDA 1MQ4A 4KKEA 4DEBA 3BLQA 3QUDA 4FV9A 3G90X 4QQTA 4R3RA 4C61A 2IJMA 5J7BA 3G9LX 3PJCA 3VW8A 3OXTA 4LL5A 4EOLA 5BVNA 5AR7A 2R3GA 5F9EA 4RJ7A 1ZYSA 3HRBA 4QMMA 2OZAB 5J87A 5L2IA 2YCQA 3QQKA 1OB3A 3RPVA 3TV7A 3LVPA 5M4UA 2UZTA 5DGZA 5HESA 1GNGA 4FEQA 4X3JA 5FTOA 3I6UA 4DEGA 1OL6A 2B9HA 4IJ9A 4O22A 2QONA 4FKIA 2GFCA 4JDIA 4YTIA 3ZLWA 2BRHA 1Q3DA 3KXZA 3OCGA 4B6LA 1WBOA 3QQGA 4E6AA 1XH9A 4JDKA 4NKSA 4JG6A 4HVIA 5LVNA 3CPBA 3PLAE 4IH8A 4PUZA 5T68A 1TKIA 3KXHA 2V7AA 5IEXA 5BYZA 2C6IA 3KXMA 3Q6UA 2BPMA 4J1RA 1ZMVA 3LQ8A 1AGWA 3V51A 4OT5A 4HVDA 5CAPA 4E5AX 4R7BA 3DBEA 3ACKA 3GCSA 3MGYA 2PVYA 1JOWB 3MBLA 3KMWA 1VYWA 4JT3A 5CZHA 2W5AA 2F7XE 3O8UA 3A7FA 3MJ2A 4L8MA 4LOPA 4ITIA 4RVKA 5ANEA 4DYMA 1ZOEA 4AFJA 3HKOA 4G3FA 3EL8A 4KWPA 3G15A 3VS3A 4P5QA 4FTUA 2P55A 2VWXA 4C37A 1P14A 5K0KA 5A4LA 3QTZA 1OECA 5GJFA 4EONA 3DBCA 3QX4A 3PUPA 5DG5A 5A46A 4KB8A 5M57A 4JBOA 2C68A 4KSPA 2ZVAA 3TM0A 2YDKA 3C0IA 4FX3A 2YLFA 2Y6MA 3ZO2A 1XR1A 2J0LA 2C6OA 3FKNA 4IM3A 2YM3A 3TDWA 4QMZA 3R83A 4NH1A 2YIWA 2VGPA 3NW6A 2PE1A 1IA8A 4FTIA 4OTWA 3SRVB 3ZTXA 5EQPA 4NSTA 3D7TA 4DH1A 5AUXA 5FGKA 1YXSA 2O64A 1QPEA 2FO0A 2NO3A 5HX8A 4U7ZA 1ZXEA 3AGLA 1OI9A 3HRFA 3I4BA 4GIHA 3WZKA 1FGKA 3QLGA 3R01A 4L3LA 3TKUA 2UVZA 5HEZA 1PMUA 5AUTA 3PY3A 5JFSA 5JQ8A 2WQOA 1Y6AA 1UVRA 2BVAA 4O0RA 3SOAA 4FICA 1LEZA 4JQ8A 4C59A 2IZUA 2VTJA 3PLSA 4IXPA 2HWOA 5M4IA 4IAIA 3NLBA 4HGSA 2XJ2A 4JG7A 3K54A 3LM5A 5IEVA 3NUPA 4DAWA 4TWPA 2C5YA 1P2AA 4H1MA 4BIBA 3BHTA 4CYJA 4H58A 4U6RA 1HCKA 2B1PA 1S9JA 5FP5A 3GCVA 4ASZA 3U6JA 3L8VA 2HOGA 3C4EA 3EH9A 5CF4A 1F0QA 1GZ8A 1MP8A 4YZMA 5BVDA 3RNIA 4DT8A 2UZUE 3GGFA 3DXPA 1JNKA 5JGBA 2GQRA 5IDPA 5F1ZA 3ITZA 3SD0A 3PP0A 5LOHA 1H1RA 4G5JA 2VWWA 4W8DA 4WRGA 5C9CA 3VF9A 3U8WA 5KMKA 4JRVA 3CD8A 1MUOA 4IEBA 3ODYX 1OUKA 4AW0A 4D4RA 4S2ZA 4ZTLA 1SVHA 2YERA 4ZZMA 1REJA 2PUIA 3GQLA 4NIFA 4DFYA 3G6GA 4JX3A 1H00A 4ZMEA 4YC6A 4IWDA 3FI4A 5EI8A 4A4OA 3NIEA 3UMXA 2JBOA 3PYYA 1PXOA 3EQGA 3E88A 3P5KA 3FMEA 3IS5A 2H96A 3DA6A 2AYPA 3OS3A 5CI6A 3WF5A 3UVRA 4CRLA 5AR8A 3BBWA 4AZTA 4M69B 2JC6A 4RIYB 4YNEA 5BUJA 3S4QA 5AP7A 4C4EA 3TV6A 1ATPE 1X8BA 2R5TA 5GIOE 4O7VA 4RJ6A 3PXYA 2WMSA 3R8LA 4WHZA 2FYSA 3TI1A 4AZVA 3V5TA 1E9HA 4FSQA 4XG4A 5HBHA 4P7EA 5TF9A 3ZUUA 5AFVA 3LMHA 5CSVA 2PZYA 3OUKA 3WZEA 1PXLA 3R28A 3EQDA 4IM0A 4WT6A 4QMLA 4RIXA 1UWHA 3ZRLA 5JRSA 3CJFA 3GENA 2PMIA 5ANOA 2YWVA 4AT3A 4O86A 4BCFA 3W32A 4IM2A 4JJRA 4AE9A 1YWNA 2A19B 2OWBA 3IECA 4FV3A 1ND4A 4H36A 3GC0A 1PXIA 2I1MA 1OL1A 3H30A 3VBVA 4FKVA 4IAYA 1JWHA 3AG9A 4BCOA 5EHOA 5HLNA 3W1FA 1OUYA 2PVKA 3LFBA 4UYNA 5HLPA 4O0TA 5FWKK 4TNBA 5I9XA 1W82A 2R0IA 1YWRA 2W5BA 3HRCA 3HP5A 5CEQA 2GTNA 5K3YA 4G3DA 4H3PA 1T46A 3OC1A 3WYXA 4BCGA 3LPBA 3ULIA 2XRWA 4G9RA 1PHKA 4BCHA 3TKHA 2PSQA 2BAQA 2DUVA 4MXAA 4F7SA 3I6WA 4AX8A 4WUNA 4C58A 1CKPA 3PZEA 2REIA 2BTSA 1SNUA 4ALUA 4I1ZA 3U87A 1YWVA 3NX8A 4AGUA 5L2SA 4Y73A 4XS2A 4NTTA 4O91A 2C69A 3LXNA 4RLKA 4V0GB 2EVAA 1JKTA 5LVPA 1WBTA 3R7EA 1P4OA 4ALVA 3OROA 3O8PA 2GNLA 2YCFA 2ZMDA 5IH6A 4EC9A 3DY7A 4BF2A 2QCSA 3DXNA 4M14A 4ERKA 4RC4A 5AR4A 5LJJA 5HNBA 5DEWA 4YZCA 4BGHA 4JRNA 2GNGA 2JIVA 2R3MA 3COMA 3CGFA 2QO9A 4IFGA 2Z7LA 5GJDA 5L6PA 2Y9QA 4J53A 4QOXA 3SW4A 2GNJA 2VO7A 2OIQA 2O2UA 3P4KA 4A07A 5CY3A 1V0BA 3ZS5A 4OT6A 4ZY4A 1ERKA 3UOKA 4OTDA 3ZFYA 3VVHA 3A60A 4B9DA 3O50A 3NS9A 4DITA 4I4FA 3ORTA 5JQ5A 4N6ZA 3R02A 5CU2A 2YABA 5C8NA 1H1WA 2PVHA 4O1OA 3OCTA 3VS6A 5LMKC 1YHSA 4C7TA 4OTHA 3DNDA 4FV7A 3LQ3A 4E93A 4UB7A 4FV8A 3KXNA 3TV4A 2A27A 1R78A 1LR4A 1ZOHA 4D9UA 2OK1A 5CANA 4HYHA 3S3IA 3A8XA 2W1ZA 3EQHA 3GU8A 4D2SA 4F70A 2O65A 2WOTA 4I6QA 1REKA 4FZDB 5DT0A 3QC4A 4HCTA 3ZO4A 5I9VA 2X9EA 3TL8A 4AA0A 2HZ0A 3KRLA 3OW4A 5HIEA 3TNPC 5J8IA 3KRJA 2OJGA 4LMNA 1DAWA 3I5NA 5LXMA 4I3ZA 4N6YA 2OF4A 3A7GA 2Z60A 1A9UA 4BCQA 1H01A 3D94A 5EDRA 3WIGA 2ERKA 4ZLYA 4MK0A 5L6OA 2PHKA 2YA9A 4APCA 2XZSA 3I60A 3VBWA 4JL9A 4F09A 2E9NA 4HPUE 2IPXA 2BMCA 5L4QA 5FUTA 5JMSA 1PMEA 2RFDA 5KKRC 2B9IA 2VRXA 3QD3A 4EWHA 3RWQA 2VTIA 3MWUA 3EN5A 3QZGA 4IDVA 4XG2A 4Y83A 3OY3A 3V3VA 4BDBA 4CT2A 4EYJA 5HO7A 4U40A 3DPKA 3NVKI 5CVFA 3ENHA 4ZTHA 4YJOA 1ZRZA 3QQLA 3OP5A 4L46A 5CZIA 4WSQA 4A9TA 4CZTA 3MFRA 3U4UA 3FY2A 5CNNA 4DFNA 3RAHA 2XK3A 2YN8A 5HO6A 3SXRA 5FXRA 3C1XA 3R22A 3NUUA 1OMWA 4MF1A 4YO6A 4CQGA 4DG0E 4FZAB 4RWIA 4O7WA 3GCUA 4FL1A 4S34A 3CP9A 4FKTA 5CT0A 3CPCA 4X6QC 1R1WA 5L2QA 3RINA 4NL0A 2GSFA 4C0TA 4ZSLA 1Q99A 2LGCA 3AGMA 3UJGA 4P90A 3TTJA 4GFGA 5CSWA 5IQCA 2QO2A 2ZV7A 4MD8E 4ZK5A 4IZAA 3QUPA 2ZYBA 2I0VA 3WIKA 2NRUA 3LFAA 4M15A 3MH0A 3CKWA 3NUAA 4QP3A 5AA9A 3CQEA 2YAKA 5A14A 2JDTA 3PG3A 3WE8A 3PSCA 4PL3A 3PIYA 4ID7A 3BYSA 3L9LA 4HVHA 5HNGA 3UQFA 3CXWA 4BIDA 4DFZE 5IUHA 1Z9XA 4UEUA 3F7ZA 3C4FA 3FV8A 4F9CA 4CEGA 4U43A 4FSNA 5CQUA 4UMRA 2GQGA 3N4VA 3RK5A 2DS1A 5DBXA 4DEDA 4LMUA 3HV7A 1VJYA 2X9FA 3E8DA 2ZM1A 4ZJIA 1QPCA 5CXZA 3IW8A 3TIYA 4FE2A 2C6KA 2O63A 3ANQA 4LI5A 4LUDA 5IH5A 5JRQA 1URCA 1NT2A 4BI2A 3C5IA 3LFCA 3Q3BA 3GOPA 2PVMA 1URWA 2R3LA 3HUBA 2VZ6A 5JFXA 5M51A 3VS0A 4WO5A 2W17A 5HTBA 2RSVA 3TN8A 3PIZA 2ESMA 2B9JA 5E8WA 4YBKA 4NJ3A 3ZDIA 3HMMA 1U5QA 2R3KA 4FTCA 5IF1A 1W7HA 3QZFA 4QMYA 1PJKA 3MESA 3PVUA 3COKA 3ZFMA 4EH7A 1F5QA 2X81A 4GUBA 3QRKA 3LCKA 1APME 2GNIA 2XKDA 3BELA 1W98A 1ZZ2A 3EB0A 1YDTE 3EFKA 5AP5A 5HI2A 3QRIA 3R8MA 2OBJA 1WBPA 4FGRA 3TJCA 3OWPA 2R9SA 4YZBA 3BYMA 3LHJA 3RZFA 1U54A 5HORA 1YI4A 5M09A 4ASDA 2VU3A 4PDPA 2OO8X 4F0IA 3EZRA 4KA3A 4PY1A 3A4OX 3E8NA 3RM6A 2VTHA 3VRZA 5FP6A 1FGIA 3QTIA 3EN6A 3IGOA 3RAKA 4EZ7A 3U9CA 5K5XA 1KV1A 4OTFA 3A99A 5IA1A 1BI8A 2Y4IB 4UXQA 3DKFA 5E8YA 3R73A 4R6VA 3R1NA 1Y8YA 3BV3A 1PXKA 1IAJA 2OICA 3V6RA 2ZM4A 2QKRA 2CGWA 1ZARA 3AC1A 3NAXA 2WMRA 3N4TA 1FVTA 3NYOA 4ITHA 3NSZA 3IG7A 2DYLA 4C4FA 2CGUA 2G15A 1OIQA 4XG6A 3KGAA 4UMTA 1JKLA 5CS6A 3S95A 1ZAOA 5DRDA 5AP1A 4CMOA 1XWSA 2X0GA 2DQ7X 4U0IA 2WZJA 4C36A 5AAEA 2XNGA 4N4SA 3E3BX 2PPQA 1OBGA 3F2NA 4AA4A 3QTRA 4OW8A 2IVUA 2QHMA 2BRGA 3QZIA 1PY5A 2R7IA 4QNYA 2XP2A 2VTQA 4QQJA 3AT3A 1OIUA 4OLIA 4RVLA 4FTLA 5EI6A 5AAGA 1YOLA 1YQJA 4PF4A 5BPYA 5CF5A 2PZPA 3PY1A 4X0MA 3AMYA 3SX9A 4E3CA 5HZNA 2IZRA 1J1CA 4O6EA 4IMYA 3TACA 2B54A 5M06A 2X7OA 3MA6A 2JBPA 2WAJA 2RFNA 2ZM3A 1RE8A 3EKKA 3Q2MA 3QWKA 4EWQA 4Z55A 1QPJA 3R7YA 4LGGA 1MQBA 1A48A 3OOGA 3EQCA 3R0TA 2J0IA 1ZY4A 2GMXA 2C3KA 2YM4A 4BDIA 3NYXA 3OCSA 5KBQA 1GAGA 4HGTA 5DH3A 2PVRA 4FV6A 1PYXA 3W16A 3KXXA 4XP2A 2JEDA 3UTOA 3V04A 3VBQA 3PWDA 3PJ2A 4KS7A 3G2FA 4YJUA 1H27A 3QGWA 3UGCA 1UU8A 4YLLA 1XH4A 3O8TA 4D2VA 5ACKA 3CGOA 5HG7A 3WE4A 3ZZEA 3DLSA 3UOLA 3F2RA 4GW8A 2PVLA 3NNXA 4WBOA 1OZ1A 4W4VA 3CQUA 5HE1A 2F7EE 3I7BA 4TXCA 1DI8A 2XIRA 4PTEA 5DN3A 3QRJA 4D2TA 5FDPA 1H1SA 2YM6A 3OBGA 5H8GA 3KRXA 2XJ1A 4Y85A 4G34A 2XCKA 4XG8A 4ZLOA 2R0UA 4ANBA 4GUEA 4GKIA 3DJ5A 3BI6A 4IZ5A 4Y46A 1MRVA 2YM7A 4TWOA 5E8UA 2XIKA 3PZHA 1KV2A 4AOTA 2UZOA 1V0OA 4WG3A 4FKPA 5AIKA 3O0GA 3R7IA 4IAFA 3ROCA 3RZBA 3VUKA 5I3RA 2PMOX 3C7QA 3KB7A 4PWNA 4W4YA 5M08A 3R71A 2VX1A 2RFEA 3I0OA 3BU3A 2Y4PA 3NCGA 3PXKA 2BHHA 1Q8UA 2QOIA 2XNBA 3F9NA 4GIIA 5L8LA 2CKOA 1HOWA 5JEBA 2NP8A 5ETFA 4I23A 3EL7A 1M2RA 2IG7A 4GS6A 4IE9A 3KN5A 3LFEA 5J5TA 4TT7A 2VWUA 1KE7A 3W33A 4AGDA 4O7LA 1R0EA 4EQUA 3SG9A 1H24A 4KAOA 2AUHA 4FKWA 3DK7A 2C6TA 2X8DA 3Q9WA 1H1QA 4WOVA 3DAJA 3MS9A 3MY1A 1IASA 2JIIA 3R8UA 5G1XA 2RG6A 2OFVA 2F57A 1JQHA 1NA7A 2BZHB 1PYEA 2UW9A 5CQWA 3F5XA 4WBBB 4YJPA 4EH2A 3U54A 4IVBA 4X2JA 3GU7A 2VTPA 2XIXA 4BBMA 2C0OA 4ENXA 3QXPA 3FLZA 3MH1A 3C4ZA 1OPLA 5EDQA 3ZUVA 4BCKA 1P4FA 3U4WA 3RVGA 4KSQA 1B38A 2X8EA 4KNBA 2PUPA 3M11A 5FDXA 3DBFA 2WD1A 5L6WL 1WAKA 4XV2A 2C1BA 2XYNA 1G8SA 4FK6A 3VULA 4EK3A 4H39A 3QALE 5L2WA 1OL2A 1OKZA 3GQIA 4FSUA 1BX6A 1PF8A 4L68A 2W9FB 3WF8A 3FDNA 1LUFA 4XOZA 4XV3A 3ZONA 1IRKA 5EI2A 4BZDA 4D2RA 4F6UA 1OKYA 3W2QA 2V7OA 4A4LA 4DGOA 2XRUA 3F3WA 3OFMA 4UN0C 3HX4A 5AP4A 5A3XA 4EUUA 5DMZA 5FG8A 5HKMA 4Z7GA 2QURA 5HICA 2BALA 4BTKA 4P2KA 3QA8A 4EYMA 2ITYA 4KBCA 4EJNA 2WQEA 2WNTA 1L3RE 4PP9A 4YHFA 2QHNA 2XK9A 3UNKA 1J7LA 3WOWA 2QOCA 3PXFA 2J7TA 4UY9A 2IVVA 3VBYA 3P9JA 5GNKA 4KIKA 2ZV9A 4MXCA 3QHRA 3VUMA 5FM2A 3DJ7A 3ATSA 3AC2A 4FI1A 2YJSA 5AP3A 2UZLA 3D7ZA 1G5SA 2BCJA 2IO6A 4YLKA 4ZTNA 3UZTA 2UW7A 3DXQA 4WNOA 4HZRA 3S00A 4O2ZA 4GV1A 4L45A 4IWQA 5GZ9A 3DKCA 3COIA 4FTTA 5AIRA 4MH7A 4C34A 2OZAA 5EH0A 4CXAA 3NMUF 4FNZA 3R63A 4O2PA 4RVTA 1ZYDA 3TWJA 3VQUA 4D4YA 1JVPP 5EW3A 3B8RA 3OMVA 2VWIA 4ONAA 4EOOA 1GY3A 4DINA 2XJ0A 1W8CA 2PVFA 3BCEA 3Q4TA 1M7QA 2O0UA 3KKVA 4N57A 2YIQA 4TW9A 5AR5A 2ETMA 4PTCA 3UG2A 4QMNA 2R2PA 4BHNA 4IVCA 4PMPA 3MFTA 2CKQA 1H1PA 4G1WA 5CF6A 4GEOA 4AZEA 1O9UA 2BHEA 3QX2A 4UMQA 4EI4A 3WI6A 4QP9A 2C4GA 2V55A 4MTAA 3UG1A 3CR0A 4O1PA 2FUMA 3EFLA 4BDCA 5FXSA 2P4IA 4RJ8A 5LVMA 4X3FB 3IW6A 3ORMA 2YZLA 4HNFA 3RALA 2CHLA 3GBZA 3CQWA 5CSHA 4NEUA 4E6CA 3KCFA 5G6VA 4AG8A 4DEAA 2PWLA 4CLIA 3TKIA 3G9NA 2R3NA 2ZOQA 4ZIMA 2ZMCA 3BYVA 4ZXTA 2AC3A 2EXMA 4DLIA 2P2IA 3FMLA 4HGLA 4FF8A 2IW8A 2J90A 3G51A 2EUFB 1SMHA 4U3ZA 4AN3A 4I20A 5IQDA 3EQPA 3DBQA 5HQ0A 5HGIA 2ONLC 3B8QA 4LL0A 4TY1A 3TUCA 4MXZA 4E1ZA 4G31A 5EKOA 4O0UA 2VD5A 1OM1A 4CMUA 3VUGA 3HYHA 4IWPA 3PDTA 3FYKX 2QLQA 3MFSA 3IQ7A 4IB3A 3SRVA 3KK8A 4AFEA 1K3AA 2G01A 2Z7SA 1RQQA 1U4DA 4EZ3A 1O6YA 4LOOA 1PRYA 5DEYA 1RW8A 1ZWSA 3BHUA 3ZRKA 3VUTA 4BDHA 3D4QA 4DH8A 3TG1A 4CQEA 3VBXA 5BUIA 2GNFA 3CC6A 3L9MA 3R6XA 4ZTQA 3ZC6A 1GZOA 5IZFA 3KL8A 2CKPA 2W1HA 4LGHA 4FL3A 4DFXE 4HW7A 2F9GA 1E1VA 2XCHA 3ZDUA 3TUDA 1NVSA 2QOLA 3F82A 4CV9A 5BX0A 3DV3A 3ORZA 4WRSA 4I6HA 4BN1A 1R39A 4F65A 4O6LA 1KWPA 4FTNA 4HZSA 3P0MA 1WBVA 1JSTA 4JIAA 5HBEA 4EKKA 3GUBA 3RI1A 1UNLA 3UIBA 3ZUTA 4MBLA 4O96A 3EQIA 3GVUA 3IKAA 3EOCA 4E20A 3DOGA 3HMOA 5LVOA 3V8SA 4K1BA 5FM3A 3NW5A 4BCMA 2H8HA 4M67A 3KC3A 2W4JA 3V01A 2ITQA 4J7BA 4X7QA 4BYIA 4MEDA 4USFA 1KE6A 4WA9A 3VNTA 5I0BA 4C35A 5DR6A 1GIHA 4PL4A 1VYZA 4FKGA 4FV2A 3FMJA 5J1WA 5D1JA 1GJOA 4QMQA 4HVGA 4IACA 3FAAA 3QKKA 1FQ1B 4C57A 4DCAA 3IW4A 2HZNA 4R1YA 4I5PA 1R0PA 4O0WA 4FT9A 4QT1A 5C8MA 2OXYA 3VHEA 3BLRA 4OBPA 4A7CA 1J91A 3KMUA 5M56A 4M69A 5AUZA 4YTFA 4F08A 3GXLA 4ANSA 4RIYA 3FSKA 5GZAA 3MVMA 4FR4A 3GI3A 2XNNA 2WMVA 1OKVA 2WMAA 4BCJA 5K5NA 2PTKA 4C2VA 5FXQA 2X2KA 4A9SA 4ARKA 1OGUA 2YFXA 3PG1A 1P5EA 5HCZA 2OJJA 5ICPA 2FGIA 2XYUA 2HWPA 3CY3A 1SYKA 3D5WA 5E8ZA 4GK4A 3BRBA 2ITNA 3TNWA 1SNXA 3NW7A 3UNJA 5ETIA 5CALA 5DR2A 3TNHA 3VC4A 3R9RA 3VW6A 4CG8A 2BRMA 3OEFX 4JBVA 3ANRA 2J9MA 1XO2B 3A8WA 3BV2A 1YW2A 3C5UA 3OEZA 3VBTA 3ZHPC 2XEYA 4RG0A 2QOHA 3Q60A 4JBQA 4D2PA 2E9PA 5A6NA 4CVAA 2XK6A 4NJDA 2OKRA 2EWAA 2E9OA 3MYGA 4U97A 3PPZA 4Y5HA 4R7IA 3KCKA 3UVPA 3FC1X 5TKDA 3ERKA 2YISA 3WILA 1BL6A 4HJOA 5E1EA 4E8AA 3I79A 4GFOA 2J0MB 3FY0A 5CEOA 1OL5A 4XRLA 1BYGA 2C3IB 4JOAA 4RVMA 4RZVA 3PP1A 3RKBA 3AT4A 4D1SA 1U59A 3HV4A 4M13A 2GPHA 4AZFA 4O7ZA 3KVWA 4EUTA 3MA3A 3Q4UA 4GFMA 1RDQE 2P0CA 5KCVA 4IIRA 1MRYA 2QG7A 2HIWA 2XMYA 2CMWA 2KULA 4FT5A 3Q5IA 4N70A 4QTEA 1TQMA 4AZSA 3PRIA 1QCFA 3ZU7A 3UZPA 4NW5A 1ZYJA 5A4TA 1XH7A 5D7AA 4BVUA 4W8EA 4FEUA 2FSMX 2JDVA 2I40A 3MDYA 3QYZA 5TE0A 3QAME 1W84A 1XQZA 3QRTA 4PTGA 3FI2A 4C33A 4B4LA 2OSCA 3PVBA 2NNWB 1UU9A 4YJNA 5A54A 2WGJA 4OTGA 3HGKA 4V0GA 5HD7A 3RBWA 2Y7JA 4K6ZA 4AGCA 5ETCA 4D4VA 2R64A 1Q97A 3W55A 3BQCA 4DN5A 3GOKA 3F88A 2I0YA 2A4LA 3BZ3A 2YAAA 2A1AB 3IDCA 3KVXA 4CCBA 3UBDA 4ZSGA 1H08A 2EU9A 3BU5A 2Y0AA 3FLNC 2A2AA 5IU2A 4DTAA 2J4ZA 4KBKA 1FMOE 4R1VA 4NTSA 4M84A 4KIPA 3C4XA 2BFXA 4USDA 3LMIA 4XLVA 2W4KA 4IX5A 4ZEGA 1V1KA 3MB7A 4ERWA 3QRUA 4FKQA 3ULZA 4FKOA 4BDEA 5IQFA 5CAVA 3TXOA 4BZOA 5I9ZA 4YNOA 4I0TA 4RZWA 1PMVA 2G9XA 3DK3A 3DK6A 4FV5A 3EQBA 5DYJA 4A9YA 1DI9A 3TNQB 3KY2A 3MH2A 4J98A 5BVWA 5CX9A 2HY0A 3UP2A 3FI3A 4XLIA 5BVOA 4AA5A 3PVWA 2WMBA 3OY1A 4ORKA 5CNOA 2OJFE 4E4LA 4PRJA 1FVVA 3TDVA 2XNOA 1FPUA 3T9TA 5HLWA 4BKZA 4L9IA 5HHWA 3RWPA 1W0XC 4JQEA 4UWYA 5EYDA 3BLHA 4FKLA 3PA3A 5E8VA 4ZSAA 4GCJA 3FBVA 3FPMA 4Y8DA 3QUEA 5CU4A 3NIZA 2WIHA 2W96B 4BY9E 2VWZA 1WZYA 1XBAA 3FMHA 3UOHA 3QCXA 3HMNA 2ZV8A 1ZYLA 2WELA 4BR3A 5LCKA 2QVSE 4MAOA 4D0WA 5A4EA 5TR6A 2VX3A 5H9BA 2QOKA 3LM0A 1H28A 3LKMA 3V5PA 4FV4A 4BZNA 3QYWA 5ACBC 2WMXA 4X6RA 3VUIA 4O81A 3SG8A 4TYEA 2ZB1A 4MQ2A 5LWNA 2Y6OA 3PPKA 4TPTA 3IONA 3HAVA 2LAVA 3Q04A 4HYUA 4K9YA 3U6HA 1J7IA 4K77A 3F3ZA 4E4MA 2OH4A 4IFCA 3P78A 3VUHA 4TWNA 2ZB0A 1IG1A 3WBLA 4UXLA 1XHAA 3E8CA 4FGBA 3PTGA 4FEXA 4O82A 2X6EA 1TQIA 4KKGA 1BLXA 4D5KA 4NM0A 4DTBA 4EOQA 2XNMA 4MWHA 4ZOGA 5DFPA 2JKOA 3T3VA 2PUUA 3R9NA 4KD1A 5KZ0A 4KABA 3LFSA 2C0IA 3PRFA 4GVAA 3R8ZA 4BDAA 2OIBA 3SXSA 2JFLA 4I6FA 4Q9SA 4FTMA 2CJMA 2UUEA 1PMNA 2UW4A 2J5EA 3Q4ZA 4ZS0A 5HTIA 4FA2A 3FWQA 4IX6A 2GDOA 3O71A 2WO6A 2VO6A 3LCSA 4AS0A 4EHZA 2PU8A 1SVEA 4KKHA 5FD2A 4G16A 4TYGA 4E5WA 5JSMA 3KQ7A 4DGGA 3HUCA 4BTJA 3Q32A 5B2KA 4QP1A 3Q6WA 3ZRMA 3RMFA 4UMUA 3LCOA 3OT3A 4QQCA 1F3MC 1NXKA 2CCHA 3F3TA 3R8VA 1L8TA 5J9ZA 4NM3A 4RX9A 3QTXA 3NUNA 3OUNB 4AW2A 2JAVA 2XA4A 2Y4IC 4OTRA 2FVDA 2UW6A 4IZ7A 5AV3A 4A9UA 2B0QA 4RBLA 2B53A 4O84A 3TTIA 4UWCA 4J96A 3ORXA 3TIZA 4XHKB 3ZYAA 3JVRA 1JBPE 2GHMA 3AC3A 3BYUA 3NNUA 2E2BA 2BIKB 3F7WA 3FQSA 5E8XA 3BU6A 3GU5A 3EYGA 4N0SA 2JKKA 2WTWA 3SVVA 3AC5A 4O83A 5DA3A 5EKNA 5LMKA 4GRBA 4O38A 3W2OA 2UW5A 3LFDA 3JYAA 4EZ5A 1YHWA 2W06A 3UO6A 5DVRA 3EN9A 4I41A 1I09A 4O7YA 4GYIA 3FMKA 3UOJA 3HDMA 3HDNA 3QD0A 3FKOA 3HV6A 4I92A 5DE2A 2PE2A 2UZBA 1XH6A 4MD7E 1GZNA 3ZO1A 5B7VA 4XRJA 1YDSE 5H2UA 4ZJVA 2PZ5A 3F3UA 4IVDA 4L6QA 2WTKB 4XMOA 5TT7A 2WTJA 3MFUA 3D5XA 3FZTA 3LFFA 3LXPA 4BWPA 3NUSA 5C03A 4RJ4A 5EYMA 4YPSA 1T45A 2QI8A 1Q61A 3NNVA 4FIJA 4EOPA 4HNIA 4TKSA 5HG5A 2VO0A 4AT4A 3CEKA 4NM5A 3R9DA 2ETRA 4BWKA 1YVJA 4Q9ZA 4QNAA 3ETAA 3R7VA 5T3QA 4BL1A 4YURA 3OF0A 3BEGA
chains in the Genus database with same CATH superfamily
5JKGA 4GT3A 4JLCA 3I1AA 1YI3A 4QMSA 3KULB 3TT0A 3NEWA 4QP4A 3PPJA 3A7HA 4BI0A 5E91A 2QR8A 2B7AA 1QMZA 4EJ7A 2ITZA 3CY2A 3PXZA 2CLXA 4PMSA 3DB8A 3DS6A 4GJ3A 3C9WA 4V04A 4HVSA 4EOMA 4MD9E 3FXZA 1M14A 2XVDA 3F66A 4GYGA 2WHBA 1H26A 3LFNA 3QD4A 4TRLA 3RM7A 3VS4A 4JVGA 2WU7A 3MSSA 5HBJA 3FMDA 4CFVA 1WVWA 3R1YA 1UNHA 4CFFA 3LFQA 1QPDA 3R1SA 4R5SA 3O51A 4KUJA 1IAHA 4GVJA 2UZNA 4ASXA 2CSNA 2SRCA 4FV0A 4O7NA 4ZTSA 3C50A 4QD6A 2C6MA 2BROA 3NVMB 3COHA 3EN7A 5HX6A 4O0SA 3CS9A 4EHEA 1EH4A 4APPA 4EH6A 4QMUA 3NPCA 3AT2A 3MIAA 3OD6X 5EQEA 2VTOA 5CAUA 5L8KA 2YIRA 3CBLA 2JDSA 3CTQA 1YXVA 4QMPA 4PPCA 4AF3A 4G2FA 1ST0A 4ZTMA 3NWWA 4C4GA 3W2PA 4CV8A 2BFYA 4UV0A 3W8LA 3DU8A 2R3QA 4LRMA 5CYIA 2XB7A 5D11A 3DFCB 2JIUA 4IADA 2ITTA 4F6SA 2EB2A 3GNIB 3OWLA 4JI9A 4YZDA 3F5GA 5FEEA 4IW0A 3Q9YA 4QTAA 4DLJA 4A9RA 1R3CA 2ERZE 3GC9A 1ZLTA 2BDJA 1Q3WA 3L8XA 2BR1A 3PJ8A 3ELJA 4IBMA 2Q0BA 3H9OA 4QPSA 4FOBA 4I5MA 3HP2A 5HO8A 3H9RA 3R9OA 3NGAA 2YM8A 1XBBA 3AMBA 2UZWE 3DKGA 3N9XA 4DH7A 4AW5A 3JS2A 3RJCA 4MKCA 3QC9A 1DAYA 2XUUA 3RPSA 3O96A 4HYSA 1SVGA 1H07A 2BTRA 5B0XA 3DQXA 3RPYA 4YGAA 5LQFA 4PX6A 1M17A 1H0VA 3MVLA 3E62A 1LP4A 4C8BA 2XNPA 4AN9A 4BDJA 1Y91A 4B8LA 3R8PA 2G2HA 1UV5A 1ZZLA 2ITXA 3ALNA 4H1JA 5ANDA 4F6WA 3O2MA 4CNHA 4M8TA 2R3JA 2UW8A 4QMWA 4FTQA 4OTIA 3GP0A 4L43A 3K5UA 5EHLA 2IVSA 3AD4A 3D5VA 5BYYA 5KMLA 4FKSA 3WYYA 5JGAA 2J6MA 4CZUA 4NYEA 3FZ1A 4CFNA 2OLCA 2PE0A 3IGGA 4KIQA 3UMWA 3F2AA 1AQ1A 1WBSA 4LOQA 1CM8A 1K2PA 3Q96A 1TQPA 4I5HA 4NM7A 2OI4X 4R7HA 3KREA 4O7TA 3QTSA 5C4LA 3DKOA 4NZWB 2EXCX 4MQ1A 4PMMA 3EQRA 3BQRA 3NZ0A 3OW3A 2YDIA 5CLPA 2PK9A 3NYVA 4AAAA 1OVEA 2NRYA 3FL4A 4CFUA 5KUPA 4X2FA 3C4CA 2X2LA 4YLJA 2UZDA 3L9PA 1QL6A 2CKEA 4L42A 4YTHA 3R7UA 2X8IA 3EWHA 4RLLA 4ZAUA 1TZDA 2UW0A 4FIFA 4MX9A 4FSYA 4FIIA 4F7NA 2B4SB 5EM5A 3SDJA 4QPMA 3DZQA 3UIMA 3UPXA 2QOOA 4AXAA 2GNHA 3KMMA 5E1SA 4ZJJA 3QCQA 4RMZA 5IQGA 3RPOA 4DHJA 3VF8A 4TTHB 4JR3A 3PA4A 4EH9A 4F99A 4YJTA 3UYTA 4L7SA 3A4PA 5L3AA 3OWJA 5LWMA 3ORNA 2C6EA 4FYOA 3UQCA 4M12A 4I0SA 4I0RA 3ACJA 3UP7A 3MIYA 4CZYB 4DF3A 4XOYA 3ORPA 4FYNA 1YRPA 5EYKA 2PYWA 4CFMA 2F2UA 2XIYA 4X21A 1NVQA 2HW6A 1DS5A 4RA5A 4U45A 4MWIA 3GB2A 2HK5A 3PVGA 1GZKA 3OCBA 4TZRA 4JAJA 3GC8A 4X3FC 5DHJA 4BKJA 4YJRA 3M42A 3SW7A 3UDZA 3UQGA 1A06A 4OBQA 3FZOA 4EOKA 5FRIA 5B2MA 4IZYA 4YJVA 4C02A 5JT2A 3VN9A 2BAJA 5KBRA 3H10A 1UA2A 3E7VA 4FT3A 4TNDA 4C3PA 4LYNA 3JR1A 3AC8A 3BIZA 4C3FA 4F9YA 5BQ0A 4C62A 3TNIA 3N51A 3V6SA 4F4PA 4ACHA 3QQJA 5C8KA 2X6DA 3P7BA 3HNGA 4OGRA 4YC3A 4YZNA 3RP9A 3V8TA 4AWIA 5IA4A 4MXXA 3ZBFA 4R5YA 4XG3A 1H4LA 2QOFA 3E5AA 3RTPA 4DHIB 2C1AA 1FMKA 5H8EA 2GQSA 4EHVA 3DFAA 4C3RA 1UWJA 4GMYA 3JY9A 5DRBA 2E9VA 5KMMA 3BL9A 2UZVA 4XV1A 2C5VA 2R7BA 1O6KA 1AD5A 3KEXA 3KK9A 5DI1A 4XUFA 2PMNX 3IO7A 4I93A 5CT7A 4B99A 2XH5A 5IISA 5AJQA 4U79A 1B39A 4M66A 3EFWA 3BWFA 4CFXA 5KX8A 4RC2A 4DG3E 2WTCA 2FSLX 4YHTA 4CFWA 2RG5A 3LOKA 1ZOGA 4TYHA 1PKDA 4QMTA 4D55A 2FH9A 3CJGA 4X3FA 2W4OA 3ZLXA 4XH6A 3TEIA 2GTMA 2C3LA 1SM2A 4F0GA 2Z02A 3F5UA 4B8MA 3PWYA 4RQKA 4YBJA 5DT4A 5DT3A 5AV1A 4TYIA 3IK3A 1LEWA 3QL8A 4BIEA 2W1IA 2PUNA 4ZTRA 4TL0A 5BVFA 1FOTA 2HZ4A 2XIZA 3HZTA 3K2LA 4L53A 4RT7A 2QOQA 4U81A 1PXJA 1XH8A 4YC8A 2OGVA 4YU2A 4Z16A 1E1XA 4QTDA 4D4SA 4G17A 4ACGA 4ASEA 4DGNA 4I5CA 2HENA 3BGQA 3C13A 4FIHA 1YXTA 4GK2A 5AV0A 2IW9A 5CEPA 1G8KA 2JDOA 4FC0A 2F4JA 1JAMA 1VZOA 2WMTA 4R3PA 3RPRA 2EB3A 4ZZOA 5JH6A 1M52A 3FE3A 5DWRA 5IQEA 3GU4A 1ZYCA 3LLTA 4II5A 3EHAA 2W0JA 3FYJX 4J95A 5ITAA 2W5HA 2VTRA 4GT5A 3V5JA 4A06A 4ZY5A 4L3JA 2WKMA 4XNEA 5EM6A 5KMIA 4BFMA 4HCUA 5JZNA 5HNIX 4PNIA 4PPAA 3MN3A 5LCJA 2OW3A 2ITPA 4WNPA 3PY0A 4ITJA 4CRSA 2DWBA 5HU3A 2FA2A 2QO7A 4RGJA 2FSOX 3DBDA 3MJ1A 4HCVA 4QYYA 4RC3A 4LG4A 4ACDA 2A0CX 2C5NA 1JLUE 4ENYA 5FBOA 2GHGA 2VNWA 3FEGA 5FEDA 4BTMA 4BJJA 5DNRA 5AWMA 5H3QA 4RFYA 3IOKA 4RWKA 5KNJA 4D0XA 2QQ7A 4IANA 3QLFA 3D0EA 3F69A 5LMBA 2YCRA 4EOSA 3G6HA 3OHTA 5C1QB 2BIYA 3QD2B 4AAYA 3TUBA 4FBXA 5AUYA 4FUXA 2BRNA 5EYCA 5AV4A 2VTTA 2BKKA 4IAAA 2PMLX 4WG5A 3WZJA 5JK3A 3FUPA 4JDHA 3BX5A 3OVVA 4J97A 4G6LA 3L9NA 3V5LA 3WF6A 5D12A 5E90A 3DNEA 3QGYA 4NFMA 3SKCA 4DEIA 4FKRA 4RWJA 3KF7A 3VO3A 3LJ2A 4RJ5A 4IQ6A 3CD3A 3KU2A 4FSRA 4DBNA 4RJ3A 5J1VA 4S31A 4Z9LA 3ZXZA 4PV0A 4AN2A 2WTDA 2OG8A 3PJ3A 4L00A 4E4XA 2PULA 4ACCA 2OU7A 2P3GX 5HTCA 4QP6A 2VWBA 5AUUA 2VV9A 2W1DA 1Z57A 4MNEB 3F5PA 2IZTA 3E7OA 3OZ6A 3AQVA 2ETKA 1WCCA 3ZLSA 4MCVA 3D2KA 2OXXA 3SHEA 4USEA 4YSMA 2B55A 5HG9A 4BYJA 4EOJA 3ALOA 4IB5A 5IA3A 4UZDA 2YIYA 1BKXA 1UKIA 3DB6A 1S9IA 2Y8OA 3BKBA 3DZOA 4ANMA 3QQFA 2A98A 4E73A 3ZSGA 2XM9A 2HZIA 2XKFA 4W9XA 3DLZA 3V5QA 5HE2A 4FNYA 4BBEA 4J71A 4FUYA 5AP6A 3SOCA 4ANLA 2EXEA 4RIWB 3BEAA 4XBUA 4F0FA 4FZ6A 4F64A 4PQNA 2C30A 2UVXA 4M97A 5HIBA 5LARA 4JIKA 4LM5A 5CEIA 3ZO3A 4BDGA 3MTFA 3CTJA 5KMNA 1YXXA 4OAUC 3PA5A 4CKRA 4AXDA 2ONLA 2YZAA 1PXPA 4J8MA 4OAVB 4YMJA 2BZIB 4WUAA 1JKKA 1K9AA 3ZSHA 4CTCA 1BI7A 3AKLA 4GH2A 3R1QA 3PSBA 4FG7A 3G0FA 4FKUA 4BHZA 3MPAA 4BGGA 2VUWA 2XKEA 4KRDA 3ZLYA 4RX7A 4FNXA 3NUYA 2QKWB 2WPAA 3DJ6A 5IQHA 1OBDA 3B2WA 3NDMA 3FZSA 5EG3A 3FHIA 3RK7A 2GHLA 2YITA 3P23A 4EQCA 2BZJA 3LXLA 1KUTA 2JFMA 2OFUA 3LCDA 4PMTA 2O3PA 3D14A 3FLSA 4RFMA 3ZXTA 2R3HA 5E92A 3WF7A 4R78A 2YM5A 5IKWA 2Z7QA 3D5UA 2XBJA 4IB0A 1Q8ZA 3QA0A 3DCVA 5TOZA 2B9FA 3E8EA 4G6NA 1ZMUA 4Z7HA 4AT5A 2W1GA 2YWPA 5EM7A 5C01A 4AE6A 4FTRA 4ZSJA 4YP8A 3AD6A 3MB6A 3W0RA 5BNJA 1CKJA 3MTLA 4V05A 5E9EA 4CLJA 3QCYA 2PZRA 3DDPA 4FSWA 1MRUA 2KTYA 3I5ZA 4QP8A 4JDJA 2X2MA 3P7AA 4UYAA 3NUXA 2ZAZA 2YHVA 2XK8A 4Y5QA 5AADA 3PUFC 3L8PA 3EMGA 5AP0A 3QTUA 2ITOA 5E8SA 1Q8WA 3A2CA 4D28A 4F9WA 2QLUA 1WFCA 4UALA 4IWOA 4EEVA 4PP7A 3FXXA 2VWVA 3Q5ZA 4K0YA 5GIPE 3HMPA 1Z5MA 3JUHA 2VNYA 2XBAA 3UO4A 2Z8CA 5AM6A 4AP7A 3IDBA 4I4EA 3CCNA 4ZP5A 3ET7A 4OR5A 2V5QA 3MY5A 2C5XA 4FODA 5L2TA 3POZA 4IC8A 4H05A 4KIOA 3OOMA 4AUAA 4DC2A 4OTPA 4DH5A 4UBAA 3W2CA 3VAPA 4DE4A 1UNGA 3OXIA 4GU9A 4ANNA 4DH3A 5BVEA 3REPA 4RX5A 5B2LA 4KS8A 5DPVA 2F49A 3HV3A 1PXNA 4C4JA 4QP7A 3RCJA 3FKLA 3KFAA 4RRVA 5F4NA 3WARA 4DFLA 3IOPA 3SGCA 3H3CA 3QU0A 4FV1A 3HECA 3D7TB 4K2RA 2GU8A 5DIAA 3RNYA 3JPVA 4R8QA 5LVLA 3ZM4A 1VR2A 4EC8A 4GG5A 3W2RA 3E93A 2JAMA 5A4CA 4O21A 5A9UA 5D41A 4JS8A 3K5VA 4W4WA 2CGVA 3THBA 3DAEA 3QCSA 1CMKE 2YIXA 4XCUA 2VO3A 4BRXA 4GU6A 4BGQA 4LRKA 3DAKA 3PE2A 4WSYA 3TYKA 4IVAA 3U55A 2X4FA 4RPVA 3T3UA 2ZDUA 4FT0A 4E5BA 1KE8A 5IPJA 4Z3VA 4L52A 5E8TA 5GINE 2P33A 1YOMA 4ZS4A 4QMXA 4EK8A 4JXFA 3ROYA 4BB4A 3DTWA 2GS6A 4AOJA 2X7GA 2WQNA 4F1MA 4AOIA 1KE5A 2IW6A 2RIOA 4NUSA 2VN9A 2WFYA 1M2PA 5IQBA 2RGPA 4K11A 5FTGA 4CTBA 4E6QA 1VLRA 2BUJA 5CU3A 4JX7A 4CG9A 3ZFXA 2C3JA 4HOKA 2I6LA 4QTCA 5IA5A 4ANQA 4DFBA 4YUQA 4F9BA 3P79A 3CE3A 4GJ2A 1I44A 3WZDA 1WVXA 4HGEA 4MXOA 5KO1A 4DEEA 2C47A 2BZKB 3IW5A 4O0YA 1Y6BA 1H8FA 4L3PA 4FSMA 4XG7A 3SC1A 4C4IA 4TN6A 4NIFB 5GJGA 4AU8A 4DHFA 4YSJA 5F95A 1JPAA 2WTKC 3K3JA 3FQHA 5JZJA 2J5FA 1FINA 3EZVA 2CCIA 2R3OA 5BMMA 5IA2A 5DOSA 5FLFA 3LJ0A 1U46A 3F61A 3FPQA 5EHYA 5HVJA 2V22A 4GT4A 5I3OA 5AAFA 2YDJA 3BYOA 3PFQA 4XJ0A 4U5JA 3ZBXA 3VS2A 4D1XA 1FBNA 1PW2A 2RL5A 1WMKA 2CDZA 3UC4A 3FL5A 4YJSA 1XBCA 1RJBA 3GCPA 3O23A 4JBPA 2CNQA 4YPDA 4I94A 4KINA 4BDKA 4PDYA 5KHWA 3DTCA 5J5SA 3BHHA 3EFJA 5KE0A 5FQDC 3VS1A 3T9IA 2ITUA 2I0HA 3KA0A 2X0PA 3ORLA 4XBRA 1Y8GA 2J51A 5EFQA 3ZOSA 5IH4A 4GKHA 4J99A 3GEQA 1ZMWA 3TZ9A 3RAWA 3ZEPA 3DGKA 4Y95A 5F94A 5JN2A 4CKJA 3QFVA 2UVYA 4DCEA 3HMIA 4RIXB 3FJQE 1JSUA 2ZDTA 3OTUA 1CTPE 2WU6A 3PIXA 4M7IA 5FTQA 3FXWA 3E92A 2WTVA 4Y72A 5DR9A 3G33A 5JGDA 3FHRA 3ML1A 4G5PA 3NR9A 4NW6A 3LMGA 1Q8YA 2JDRA 4FTKA 5HE0A 4EORA 5AP2A 3KF4A 3UE4A 1LPUA 2OIDA 4F1TA 4Q5EA 1TVOA 3GT8A 2BILB 4QRCA 3ATTA 1H0WA 3R00A 4B7TA 4LRJA 5HD4A 5I9YA 3EIDA 3LW0A 4Q2AA 5CENA 5F20A 5CEKA 3F3VA 4CMTA 4DGMA 2H9VA 2O8YA 1OL7A 3A61A 3TJDA 2J0KA 3LE6A 3VIDA 1CKIA 3R30A 4LGDA 2NYAA 5IQAA 4I6BA 1V0PA 3QTQA 5I9UA 3R2YA 4F9AA 3N4UA 4LV5A 3FQEA 5HVKA 2HAKA 4BWXA 3Q2JA 3W2SA 3L8SA 4GL9A 4MNFA 3W8QA 5BV3A 3PSDA 3H0ZA 5CAQA 1GIJA 2HCKA 3KULA 2R3RA 2PZIA 2Z7RA 3KRWA 3QKMA 4FNWA 1PXMA 5L8JA 3ZMMA 5IEYA 3VS5A 5T6KA 5D7VA 1XJDA 2Z2WA 3NRMA 4FL2A 4LFIA 1NVRA 5HE3A 5HCXA 4FTAA 3K3IA 3EN4A 3CSVA 5M44A 2O5KA 2R4BA 4IJPA 2VTNA 4GG7A 4AACA 4W9WA 4ACMA 4CYIA 3RAIA 3GC7A 4PPBA 4DG2E 4K8AA 3ZM9A 3EQFA 3D2IA 5IG1A 3MVHA 5KMOA 3MI9A 3ZH8A 5HCYA 5AUWA 3DQWA 5EM8A 3BBTB 4IC7A 2JLDA 3FI8A 3FLQA 3QBNA 4WNMA 4X2GA 2C6LA 3W18A 5HG8A 4FVRA 3QF9A 3Q53A 3ZSIA 5FEQA 1XKKA 4F7JA 4NT4A 3LIJA 3TZMA 3A7JA 3G0EA 4OUCA 5AEPA 2CNVA 4IX4A 2XK7A 4NWMA 3C0HA 3BHYA 2XAOA 4RFZA 5J95A 2WEVA 3Q9ZA 4XEYA 1KE9A 2OH0E 3Q4CA 4QYHA 3JY0A 4U8ZA 2VTMA 2CGXA 4M68A 3DDQA 5E7RA 3QWJA 3P1AA 3UIUA 3MV5A 4EK6A 2W7XA 4S32A 3KRRA 3OBJA 4QYGA 4BTFA 2G1TA 2OXDA 5IUGA 2V62A 4QYEA 4ZLZA 4YTCA 2QC6A 4M0ZA 3HV5A 5D10A 1IA9A 2BAKA 3P7CA 3NFGB 1W83A 2WTIA 3OWKA 2YEXA 4RWLA 5EQYA 3KN6A 3ORIA 2XKCA 2PL0A 4H3QA 4ANOA 2F2CB 5KHXA 1J1BA 2CN5A 3R9HA 3A62A 4U41A 4QMVA 3O7LB 2WEIA 2CPKE 2IN6A 4CGAA 3D9VA 4OTQA 1YDRE 3G5DA 3S2PA 4MHAA 4FT7A 4G3EA 4QP2A 5AR2A 4B0GA 4NU1A 1Q41A 3TZ7A 5IQIA 5LMAA 3VWAA 4XG9A 3JXWA 1BMKA 3WF9A 3D15A 4JR7A 5CAOA 1B6CB 4FZ7A 3H9FA 3ZCLA 4U80A 2W9ZB 4CKIA 1SZMA 4EBVA 5CF8A 3Q52A 4NKAA 3SLSA 3R2BA 5M07A 3PXRA 2VGOA 3EJ1A 4J8NA 4QMOA 1W2DA 4QPAA 3VRYA 5J7HA 4U44A 5IUIA 4GSBA 4WD5A 5TO8A 4DA5A 2G2IA 2PVNA 4ZZNA 3M1SA 3MVJA 2W99B 3UYSA 4FOCA 4LV8A 5BUEA 5K0XA 3IDPA 3GU6A 2WOUA 3MY0A 3V8WA 3RCDA 3P08A 4IDTA 2J2IB 5J9LA 5ANGA 1KOBA 2GFSA 5CTPA 4O7RA 2QNJA 2RFSA 5ANJA 5CVGA 3LAUA 5BVKA 4BBFA 3KIOC 5IMXA 4DHZA 4G3CA 2XF0A 4MBJA 3CLYA 4DGLC 3QZHA 4FEWA 1O6LA 3TCPA 2BRBA 2QG5A 2R3FA 4CSVA 1J7UA 2Q83A 2WMWA 5M55A 4GK3A 4DEHA 3H0YA 2R3PA 4XV9A 3W0MA 5KKRB 2HELA 5CI7A 5M4CA 5EOLA 3PJ1A 4YJQA 3AOXA 3HA8A 4UX9A 3E64A 4IAKA 4D1ZA 4FVPA 4WG4A 2ZJWA 4K33A 2F7ZE 4EH5A 5BYLA 1GOLA 1OPKA 4BICA 3FMMA 5EW8A 3RHKA 4FVQA 4RX8A 4X2KA 1BUHA 3FLWA 4DBXA 5ETAA 2HYYA 5C27A 2X0OA 4JG8A 3R7GA 3D83A 3VJNA 4IX3A 3RGFA 3QQUA 4NCTC 5EOBA 2ITWA 2X1NA 3S0OA 4ZMFA 4K18A 3PFYA 1CDKA 3OXZA 4C4HA 3M2WA 2X4ZA 4EHGA 1Y57A 2ZV2A 4LUEA 2RF9A 4CD0A 5JFWA 5D9HA 4F1OA 4C38A 4C2WA 5I9WA 3F6XA 3UO5A 2ITVA 3MW1A 3R04A 3WZUA 3SQQA 2GS7A 4FTOA 1U5RA 1Q8TA 3FMNA 4X2NA 1U54B 3NYNA 2X39A 4FKJA 3EYHA 5E4HA 2QU5A 4L01A 2C6DA 2BDWA 2QD9A 1PKGA 5AR3A 3FLYA 5AV2A 3BHVA 5IDNA 5HVYA 2C5OA 3NAYA 5CU6A 4L44A 4MVFA 4MBIA 5JFVA 4QO9A 4R3CA 3ZEWA 5J79A 3S1HA 2J0JA 2YCSA 4AQCA 4P5ZA 2VAGA 1Q62A 1OGYA 3BGZA 1UU3A 4H3BA 3UC3A 4EK4A 1KOAA 3JVSA 4I21A 3OTVA 4O7SA 3E63A 4QQ5A 3DT1A 4G6OA 1CSNA 3ENMA 4BC6A 3BE2A 1UU7A 3OG7A 3PE1A 4S33A 4HYIA 5M53A 2CLQA 4S30A 4BCNA 3ID6C 3P86A 2IVTA 3C4WA 5ANIA 3LXKA 3VJOA 5CEMA 1ZY5A 4MF0A 4FK3A 2JITA 2XM8A 2P2HA 4U3YA 3ZC5A 5CWZA 3W10A 3AMAA 4LDTA 3AC4A 4NCTA 2OJIA 4KBAA 3I81A 2XEZA 4PDSA 3FSFA 4EH8A 4TYJA 3LLAA 3UNZA 4E4NA 4UZHA 4HPTE 3SA0A 3T8OA 4QTBA 3E87A 1VEBA 4AW1A 3KXGA 4I24A 4EK5A 4U42A 3RHXA 3QTWA 3UODA 3E3PA 1FVRA 2QOBA 3FC2A 1H25A 4ZSEA 4YZ9A 4BI1A 4E26A 2VTAA 1M2QA 2NPQA 4D5HA 1YKRA 4UWBA 5AMNA 4O0VA 2OZOA 2QODA 3BGPA 5ANKA 4ALWA 3II5A 2QU6A 4YO4A 3UZRA 3MPMA 2W1CA 2RKUA 3FZRA 2CN8A 5H8BA 2C0TA 2W1EA 4L67A 4AZWA 4QEBA 4IHPA 1WBNA 4RA4A 4U9AA 2PVJA 4FSZA 4Q5HA 4DTKA 3GCQA 2WMUA 5A6OA 5C4KA 3C0GA 4RSSA 4D2WA 1OIYA 1Q4LA 2W1FA 3ORKA 3QKLA 4XX9A 3R7OA 1OITA 2G2FA 4BCPA 1J3HA 4E7WA 5CSPA 4BKYA 2UV2A 3FZPA 2JD5A 4MXYA 2CNUA 2VX0A 3AXWA 4M3QA 4EKLA 2XK4A 3I0QA 4G3GA 4PDOA 3MPTA 2JGZA 4YR8A 2H34A 2IWIA 4PNKA 4FG8A 4IAZA 4WKQA 2BDFA 1HCLA 1Q5KA 3ZZWA 4E6DA 1IEPA 3UDTA 4FG9A 3POOA 4FTJA 1M7NA 2GCDA 4O0XA 5HOAA 4CCUA 4FJVA 2I0EA 3HL7A 2VWYA 3IW7A 1NW1A 3HA6A 4DT9A 4J52A 3UPZA 3NCZA 4PL5A 2BKZA 3U9NA 3CKXA 1Q24A 4QYFA 4WNKA 3C51A 4EH3A 3V5WA 5CVHA 5K9IA 4FSTA 2HXQA 1KSWA 1YXUA 1NY3A 2FB8A 4YHJA 3UVQA 4CT1A 3EKNA 4F63A 4FEVA 2FSTX 3QXOA 2WMQA 2B52A 5IMEA 4JQ7A 1OIRA 2J50A 4LQMA 5HU9A 3BE9A 3LQ5A 5EDPA 4F7LA 3CIKA 4P4CA 3MH3A 4NFNA 4M0YA 1G3NA 2PY3A 5AX9A 3GFEA 3VHKA 3HLLA 2JKQA 4I22A 1YI6A 3L1SA 3R21A 4AGWA 2XS0A 2VTLA 2JKMA 1OKWA 5KMJA 1GIIA 4G9CA 4FZFB 5GHVA 2WXVA 2OF2A 3QHWA 1UKHA 4EH4A 5IA0A 4TWCA 2VTSA 3LCTA 3PXQA 5GZ8A 2I7QA 3GFWA 4EOIA 3H4JA 3VS7A 2ZFYA 4ZY6A 2W05A 2WQBA 3RK9A 1WVYA 4RQVA 3U6IA 3CTHA 2YACA 5I5ZA 1STCE 4EQMA 4R77A 4BCIA 2E9UA 2GS2A 5BMSA 2AC5A 3W0PA 3I7CA 5CASA 2YLEA 2HY81 3BPRA 5K4IA 4NK9A 4MNEA 5EW9A 2WQMA 3HEGA 3ODZX 3U51A 4W4XA 3AD5A 4WIHA 3BWJA 4XP3A 2V0DA 3NNWA 3UDBA 1TFFA 4MYGA 4UMPA 3Q9XA 4QDVA 3LJ1A 4DFUA 3LZBA 3OT8A 4EBWA 5FBNC 5HIDA 4FIEA 3SXFA 4BDFA 4IB1A 4O27B 1XH5A 5AA8A 4D9TA 1G8AA 4BDDA 3TZ8A 2WIPA 2UZEA 2IZSA 4FIGA 3VQHA 4RIWA 4A4XA 3HAMA 2XNEA 1YOJA 1YHVA 4OBOA 1WBWA 5KZIA 3HVCA 4EL9A 4XYFA 4FMQA 3O17A 2HW7A 4TYHB 4V01A 4JNWA 3O7LD 5C26A 4L7FA 3IPHA 5AUVA 2Q0NA 1IR3A 5J9YA 3A7IA 5DLSA 2ACXA 1OPJA 4XP0A 2QR7A 4KRCA 1JKSA 5M4FA 2WB8A 5A4QA 5AM7A 3SV0A 4RIOA 3UIXA 4D58A 5CSXA 5K4JA 5CXHA 1JSVA 5CU0A 3QQHA 2R3IA 1DM2A 2X7FA 5I4NA 4JAIA 2UW3A 2YJRA 2H6DA 2HXLA 3B2TA 4KIKB 5EK7A 5AX3A 3SAYA 1BL7A 2OJ9A 3VUDA 1MQ4A 4KKEA 4DEBA 3BLQA 3QUDA 4FV9A 3G90X 4QQTA 4R3RA 4C61A 2IJMA 5J7BA 3G9LX 3PJCA 3VW8A 3OXTA 4LL5A 4EOLA 5BVNA 5AR7A 2R3GA 5F9EA 4RJ7A 1ZYSA 3HRBA 4QMMA 2OZAB 5J87A 5L2IA 2YCQA 3QQKA 1OB3A 3RPVA 3TV7A 3LVPA 5M4UA 2UZTA 5DGZA 5HESA 1GNGA 4FEQA 4X3JA 5FTOA 3I6UA 4DEGA 1OL6A 2B9HA 4IJ9A 4O22A 2QONA 4FKIA 2GFCA 4JDIA 4YTIA 3ZLWA 2BRHA 1Q3DA 3KXZA 3OCGA 4B6LA 1WBOA 3QQGA 4E6AA 1XH9A 4JDKA 4NKSA 4JG6A 4HVIA 5LVNA 3CPBA 3PLAE 4IH8A 4PUZA 5T68A 1TKIA 3KXHA 2V7AA 5IEXA 4FRFA 5BYZA 2C6IA 3KXMA 3Q6UA 2BPMA 4J1RA 1ZMVA 3LQ8A 1AGWA 3V51A 4OT5A 4HVDA 5CAPA 4E5AX 4R7BA 3DBEA 3ACKA 3GCSA 3MGYA 2PVYA 1JOWB 3MBLA 3KMWA 1VYWA 4JT3A 5CZHA 2W5AA 2F7XE 3O8UA 3A7FA 3MJ2A 4L8MA </