2V62A

Structure of vaccinia-related kinase 2
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
316
structure length
309
Chain Sequence
FPEGKVLDDMEGNQWVLGKKILIYLAFPTNKPEKDARHVVKVEYQEGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE VRK2
publication title Structure of the Pseudokinase Vrk3 Reveals a Degraded Catalytic Site, a Highly Conserved Kinase Fold, and a Putative Regulatory Binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 309
sequence length 316
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2v62A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2v62A01
1OKVA 1XH7A 3KN6A 3KULA 3RI1A 3ORXA 4IACA 3OOGA 2EU9A 2CKQA 4FUYA 3VUGA 2ERZE 4CRSA 4M67A 2WGJA 5DT0A 4BZDA 2UZWE 4N4SA 3KXXA 3PP0A 4OTWA 5AP1A 4FT3A 2PUUA 3O2MA 4C3RA 2X2KA 4U42A 3W2PA 1URWA 2WNTA 2XS0A 1FQ1B 4YPDA 3Q9XA 3BYMA 2PVJA 4HGLA 3W18A 3OW3A 4IZ7A 4CCBA 5AIKA 1A06A 5AR2A 2CMWA 3R1QA 3QGWA 2WFYA 1Q3WA 3AD4A 4DEAA 3ZDUA 2CKEA 1OB3A 1YOJA 4ASDA 1SVHA 3EQCA 2B4SB 4GFOA 4JXFA 4MXAA 4D9UA 3RVGA 4F9WA 2R3MA 1VYWA 2R5TA 2XBAA 2XNOA 3C1XA 2IW8A 5TKDA 2E9NA 3AC5A 2VNYA 1GZ8A 2A27A 1QL6A 3KL8A 2QR7A 3ZONA 2YM6A 4BKYA 4TXCA 3GGFA 4LRJA 3O50A 5DRDA 1GZOA 2Z7RA 3EWHA 3ZUUA 2A2AA 3HAVA 1JSVA 4EK8A 5DT3A 4UEUA 5ANIA 2W1CA 5M56A 2C68A 1BUHA 2W5BA 3NS9A 3R7YA 3ORTA 3QTQA 3COKA 1QPCA 4IAYA 2PVFA 1J3HA 3UIUA 3LCSA 4O0YA 5J1WA 2R3LA 3TNIA 4DLIA 3PY3A 3A7FA 2CSNA 2QONA 4EJNA 1BI7A 3ZLWA 1PW2A 3ALOA 4YPSA 2KULA 3AD6A 5I5ZA 3CCNA 3ZLYA 1B39A 3MFUA 3CD8A 3V01A 4A9UA 4KBCA 3PSCA 4ZY4A 2B9JA 5AM7A 3UZTA 4EYMA 5E4HA 3MH2A 3U4WA 2OO8X 2R3KA 4E7WA 4FKLA 3NIZA 4QTAA 3MH0A 4KD1A 1XH9A 1YDRE 2P3GX 1STCE 4HVDA 4ZLZA 3RINA 5J7BA 5HNGA 5AAFA 4TRLA 2UW8A 3F66A 4XP2A 4E5BA 5IH5A 5KHWA 5M09A 2BIYA 3NGAA 1UV5A 3GQLA 2JAVA 4KBKA 5IQGA 2X81A 3KRLA 4RIXA 4ZTNA 5JKGA 1GAGA 4M97A 4YO4A 1U5RA 3FSKA 2YZLA 2XK8A 2UW7A 2P55A 3FDNA 4I6QA 3UQFA 3FMMA 2B54A 3LMHA 4F7JA 3HRBA 2B7AA 3EB0A 4FG7A 4XRLA 4YJNA 1YI3A 4CTBA 4LOOA 2W4OA 4IFCA 1PRYA 3WOWA 3PZEA 3BIZA 2V0DA 3R71A 2O8YA 3C5UA 4IANA 3UPZA 4I23A 3KQ7A 4R78A 2VWBA 4UWCA 3R9RA 2QCSA 3E88A 4LRMA 4FOCA 2JKKA 1WCCA 3KCKA 4X3FB 4RX8A 4WNOA 4RRVA 4ZTLA 2EVAA 3RWQA 1W83A 4BBEA 4RIYA 4XJ0A 4Y72A 2UW9A 3Q5ZA 3BZ3A 2HENA 4KWPA 3I4BA 3LFBA 2C6DA 5AUVA 1Y91A 3R1NA 2Z7LA 4XG3A 1WMKA 2HAKA 3G15A 3F5PA 4EH9A 2YAKA 3Q96A 5HO6A 4DEGA 3QZFA 3NAXA 2YDKA 3B2WA 3QWJA 4G6NA 5E1EA 5E7RA 1XH8A 2NPQA 4J8NA 4C59A 4BCJA 1U46A 3S1HA 4B8LA 3W8LA 2XKDA 1JBPE 2FSOX 5FUTA 5HIDA 3P9JA 5DMZA 4F7LA 2JDSA 3H4JA 3LCOA 2CCHA 2WMRA 4XLIA 4YU2A 5DA3A 3NVMB 4HPTE 3QRTA 4QQJA 4E4NA 2ZM1A 1W8CA 4II5A 5KBQA 1H1SA 2QR8A 2WMSA 3M2WA 3A8XA 1DS5A 2OZAA 5K5XA 1NVSA 3OMVA 2PMNX 3AGMA 3BYVA 5JH6A 4OBOA 4QMPA 5AP7A 4BC6A 4O7RA 5ETAA 1SVGA 1GZNA 5L8LA 2QHMA 5C27A 3OBGA 4GW8A 4W4YA 1XWSA 3V5QA 4XG8A 5HBHA 4BY9E 4XP0A 5ACKA 3IECA 2J50A 3KXZA 4FIHA 2WTKB 4UMPA 5KO1A 1H01A 3BLQA 4RZVA 3NAYA 1G3NA 2PL0A 1JVPP 4UALA 4IB0A 4U80A 5KMKA 4J98A 4JQEA 5KKRC 4CG9A 1KV1A 2UVZA 5DOSA 3FMKA 4O83A 3IW7A 4J8MA 4V04A 5LWNA 2ETKA 2W1GA 2A19B 2AUHA 3DB6A 3HX4A 5J9LA 1Q99A 2C6TA 2G2HA 1FMOE 5DIAA 5KZIA 4FL3A 3C4CA 3R02A 3DT1A 4NW5A 2VTQA 5EW9A 1H4LA 2QOOA 1KE7A 3HV3A 2WTWA 2R3PA 4D2VA 3RCJA 2VWUA 3D7TB 4PY1A 1AD5A 4KIOA 4AA0A 4BDIA 2YCRA 3GC9A 4OAUC 3JPVA 1U54B 2V62A 3EKKA 4GH2A 5DLSA 3MY1A 5FDXA 4JLCA 4ZZMA 3MFTA 3TCPA 4PTGA 2YACA 3PVGA 2JDVA 2B53A 3QHWA 3UVPA 4F70A 4FKPA 4X0MA 4UYNA 5DNRA 5BVWA 1BL6A 4ANOA 5F9EA 4O0WA 4U3YA 2R3NA 5FEEA 4GMYA 3H9RA 5I9YA 4N6YA 3HUCA 4EK5A 4ZJVA 1TQMA 5EI2A 4EH8A 3NLBA 4QQCA 3H0YA 5DN3A 1HCLA 2CGUA 2GTNA 3DDQA 2W9FB 3VW6A 4R7IA 4FKSA 4FTAA 1REJA 2XM9A 1UKIA 4V01A 3VUDA 4JDKA 4AXAA 3SW4A 3ZFYA 1BLXA 4BI1A 4CQGA 5GZ8A 4KABA 3FC1X 5J87A 5JGDA 5I9ZA 4NJDA 4Q9SA 3MYGA 4HCVA 3ULIA 5JGAA 2RKUA 2RG5A 1ZRZA 4TWCA 3ANRA 3VS2A 4HGTA 1OVEA 1DI9A 3KKVA 1Z5MA 4MEDA 4MXCA 2NNWB 2BIKB 4FG9A 2FH9A 2R3IA 3IGGA 4OTGA 4BCQA 4FEVA 1H8FA 4PV0A 3C13A 3FLWA 3NNWA 3E3BX 4RJ7A 1O6LA 2WU7A 2O3PA 4RWIA 4AT5A 4C02A 3U6JA 3VUTA 5AV4A 1UNGA 2VX0A 5L3AA 5M4CA 5CSPA 2QHNA 3R21A 4FSTA 4PPCA 2CGWA 3PP1A 4H39A 4NM3A 4UBAA 2YJRA 2E9VA 4PWNA 4YZMA 1RDQE 3U8WA 1CKIA 2R7IA 2W1EA 3LXLA 3VS5A 4C33A 4EORA 3RK7A 2X1NA 2BDJA 3VS7A 4BGGA 3UIXA 5LVNA 4QQTA 1OUKA 1QCFA 3LKMA 4FIIA 3IS5A 5EYCA 4CMUA 2H34A 1I09A 3BWFA 3RJCA 1JKKA 4QP4A 5LMKA 3KXNA 4G17A 3GXLA 3CKWA 3FV8A 4MHAA 4CFMA 4CVAA 2IVUA 5KMJA 3MPAA 4APCA 3GOPA 2BCJA 4JAJA 5DVRA 4HYIA 4IAFA 4FEUA 4R77A 4G2FA 5T68A 5D7VA 4TT7A 5AUWA 3CQUA 4DGNA 5AAEA 4S2ZA 4WUNA 5HCYA 3SVVA 1JAMA 2LGCA 5D1JA 4YJVA 3AXWA 3K2LA 2J7TA 1H07A 4MD7E 3Q32A 3LXNA 3OUNB 4KINA 2W5AA 4FV7A 3ZXZA 2BAQA 5ANDA 4BN1A 2UZBA 4I3ZA 2VWVA 1MQ4A 3E93A 3FL5A 4O0VA 4RLLA 2UW6A 4CMOA 3HMMA 4IAZA 3GC7A 2WQOA 4O21A 4P5QA 4DBNA 3S0OA 3DK7A 4YNOA 3W2OA 2F7EE 5BNJA 3ZM9A 2WMTA 4F9AA 5EW8A 4W8EA 3OY3A 4YSMA 3D5UA 3KCFA 4FV0A 5CEKA 1WBWA 4FTOA 5HTCA 2ZYBA 3FYKX 3FPQA 1IEPA 5FM3A 4FK3A 2JEDA 3DAJA 3FHIA 3LFNA 2OU7A 4D0XA 4NL0A 3EN6A 1RW8A 4QTBA 2BDWA 5FEDA 5LCJA 4ZTQA 3DBFA 2OJGA 2BZJA 1OKZA 4TYHB 3EYHA 4AT4A 5JN2A 4BDKA 4MTAA 3NDMA 3DLSA 4MVFA 5CVFA 4JL9A 2I1MA 4OAVB 4LL5A 5ANGA 3OCBA 5TOZA 3IW6A 5HO8A 4ZTHA 3PJ3A 3JYAA 3TTIA 2XNMA 4AX8A 2J0IA 5EG3A 4CT2A 2XIRA 3VULA 2G01A 2RSVA 3E8NA 3HMIA 5TT7A 3UE4A 3VNTA 4AW5A 2YM7A 3GCPA 1ZMVA 3DZOA 4PTCA 4FOBA 2HZNA 5AMNA 5AA9A 5B2MA 3Q04A 3R1YA 2X0GA 3QTRA 2C6IA 4NKAA 3DK6A 2QG5A 5J8IA 4OTRA 3QZHA 4I94A 4TPTA 5AR5A 4ID7A 3L8PA 4RC2A 4D2WA 4EZ3A 4CV9A 3KRWA 4A7CA 3CD3A 1LEWA 5EKOA 3AGLA 4PMPA 4E5AX 1DAYA 2R3RA 3THBA 4ERWA 3ZO1A 2C0IA 3PSBA 3VUHA 3EJ1A 2C6LA 5HIEA 3I6UA 4DBXA 3K3JA 3A61A 3A7GA 3LZBA 4CFUA 4FKWA 5HVJA 3BE2A 4O27B 5AV1A 2I7QA 4BIEA 4YSJA 5K4JA 3HV5A 1YOMA 2YCSA 4J96A 4OBPA 1ZAOA 4RWKA 5JGBA 5J5SA 4YBJA 4I5MA 3TNQB 3B2TA 4QP6A 5BVDA 3H3CA 5EQYA 4WIHA 3TNPC 4QP3A 5CSWA 2ZOQA 4W9WA 4DGMA 4U6RA 2OIDA 4MH7A 1K9AA 3P23A 5M4IA 3PPKA 1LUFA 3NYOA 2UZNA 3LXKA 5HVYA 3M42A 2QU5A 4EJ7A 4PF4A 3EN7A 4WG5A 3QQLA 5AM6A 2C6EA 3FMDA 4GCJA 2CPKE 4IVBA 3SRVA 4BFMA 1TQPA 2QLUA 4TL0A 5CU0A 4ANQA 5JK3A 4FUXA 3NUXA 2BPMA 1MRVA 2Z7QA 3P1AA 2GHGA 3R7VA 3VIDA 4CKIA 3LPBA 2ZB1A 3QUPA 4FT7A 5L2TA 3ERKA 3LCKA 2RFNA 4MD9E 4A4OA 4AN3A 1URCA 2ITQA 3F3VA 3OTUA 4I4EA 3VO3A 3PRIA 3U6IA 3MTLA 5IG1A 3U87A 3EL7A 1MRUA 3TG1A 4AZEA 4E3CA 1SNUA 4OTIA 4QMVA 3Q6UA 4OTHA 2HOGA 3QU0A 3VUMA 3QX2A 4WOVA 2PVYA 1GIIA 1BMKA 3WIGA 1YXUA 4C4IA 4MXYA 2UV2A 3DGKA 4NH1A 4BTJA 4XV1A 3WI6A 2JITA 5KBRA 3R7OA 4FK6A 4O0XA 3QD0A 3FMNA 2OFUA 3BPRA 4USFA 4I24A 5KMMA 3LJ2A 4K18A 2OIBA 2UZLA 4ACDA 4PMTA 1OITA 2HELA 1NA7A 3NYXA 3PRFA 4PDPA 4ZJIA 2Z60A 4R1VA 4FTLA 4RJ3A 5ETFA 4QP7A 4YC6A 3WE4A 1YXTA 3PYYA 4YTCA 5CI7A 5HHWA 3UG2A 3ALNA 1ZMWA 4RVKA 3I0OA 4CTCA 3O23A 3EFLA 1WAKA 3I60A 3O7LB 4OTFA 5AR8A 4WBBB 4KAOA 3QRJA 1SM2A 2C69A 2X6DA 4RJ5A 3GQIA 5LWMA 3DZQA 4RG0A 4HVGA 1H1QA 2Z8CA 3KXGA 4GG7A 4HYHA 1Q41A 4O1OA 3MVHA 4FV9A 4GIHA 5A4LA 3LLTA 1F3MC 3S95A 3P5KA 4DFYA 5HVKA 5JMSA 2YM8A 4C0TA 3WYXA 5EOLA 4H1JA 3R8MA 3II5A 4QO9A 2Y6OA 3W1FA 4BDGA 1TQIA 1AQ1A 2X9FA 4QNAA 3I0QA 4L01A 1ZY4A 4J97A 3I5ZA 3ZXTA 3DQWA 1E9HA 3KF7A 5TE0A 2WIPA 3FLNC 1M7NA 2DS1A 3UDBA 1UNLA 5AV3A 4YJOA 5BPYA 3C50A 4JG7A 5CY3A 2G9XA 3NNXA 4KBAA 3P4KA 2XK6A 2ITVA 2XKFA 3BHYA 2OKRA 4HYSA 4OGRA 4A9RA 3TKIA 3OWLA 4EHGA 1CMKE 2OFVA 3COMA 4FZAB 2IW9A 4OUCA 3LFSA 4YJPA 2CJMA 2OF2A 3IDPA 4EHEA 3KGAA 5C26A 3O51A 4D5HA 2JBPA 2X7GA 3QD3A 2I0EA 2O63A 4QMWA 3DBEA 5CAOA 3VAPA 2C47A 4KB8A 4AP7A 4PNKA 5M08A 4O91A 2WTDA 3ZTXA 2YEXA 1P4FA 4PNIA 3RPOA 3MESA 4M13A 4FYNA 4EH5A 2BILB 4TNDA 4I1ZA 3QZGA 3I7CA 4ZTMA 3D4QA 2PSQA 4M12A 3HUBA 3U9CA 2F2CB 5BQ0A 4UB7A 3SAYA 3V5TA 4B6LA 5M51A 3IO7A 2WOTA 2X4ZA 4FV3A 4TYIA 5HI2A 2V5QA 2ZMCA 5CU3A 2OIQA 3BLHA 2PZ5A 4CV8A 2ITWA 3D94A 3EMGA 5CEIA 2IVTA 3G6HA 1ZWSA 4HGEA 3HL7A 3OVVA 4FKQA 2C5XA 3EFKA 4ZSJA 2OJJA 2G2IA 4UX9A 3KVXA 1W0XC 3LQ5A 4YLJA 5HOAA 3TZ8A 3ZS5A 5IQFA 3PXFA 4QMTA 3N4TA 2JIIA 1M2RA 2F49A 3DFCB 2W99B 2XNNA 2R3HA 3Q4ZA 4ZY6A 3V5PA 3WZKA 4ANMA 4RIXB 3VJOA 5KE0A 4YHJA 4L43A 5FD2A 3C0IA 4IIRA 3WZJA 5FXQA 3R9DA 1R3CA 2H8HA 2R64A 2XJ2A 3GBZA 3MH1A 4EKKA 5JFSA 3OCGA 2YHVA 5AEPA 1QPJA 3NPCA 4IX4A 4QTEA 3W2SA 4C3PA 3EHAA 4XUFA 3UYSA 1FVTA 3T3UA 4TZRA 4FEXA 4I6HA 3FI4A 4DGGA 3R6XA 4GU6A 2JFMA 4GEOA 2WKMA 3OT3A 3ORZA 4JBOA 4RA5A 3E7VA 3UIMA 4BGHA 5E9EA 1OBDA 2V55A 2WB8A 4F08A 1ND4A 1IRKA 5CAVA 5L8JA 4FT5A 4G3CA 4O0TA 3QX4A 1PXJA 4V05A 2XUUA 4N6ZA 5CSVA 2RF9A 3Q9WA 3ID6C 3QQHA 1MRYA 4AGCA 5CXHA 3CEKA 5DI1A 3PXQA 1TVOA 5DR2A 3SG8A 2WEIA 4F4PA 3PXKA 4RJ8A 5CF8A 1SVEA 4MCVA 1ZY5A 5ETIA 4BF2A 3G9NA 4QT1A 2OK1A 2OGVA 3QWKA 3ZHPC 2WXVA 4JS8A 2GNGA 4I21A 5E8UA 1KUTA 2X39A 2QO2A 3ZUTA 3DS6A 2X2LA 2XIKA 3R2BA 4PP7A 5E92A 5BVKA 3RM6A 1Q8ZA 4XEYA 4D4YA 2VUWA 4LGGA 5IUHA 3UODA 1PKDA 1PF8A 4N57A 1H25A 4CSVA 3IDCA 4GT5A 4W4XA 2X6EA 1ZXEA 3FZ1A 5IUIA 2W4KA 4P90A 4IVAA 2CHLA 3V8SA 1R1WA 3GU7A 4USDA 4XX9A 2PUPA 4YLLA 5J79A 3PUPA 3E8DA 4FIJA 5D10A 5E8YA 2PPQA 2JKMA 3FEGA 5CAUA 4I0RA 2VTOA 4X2KA 3P08A 3BQCA 4ZTRA 1PJKA 3OCSA 4IWQA 4F6UA 3V5JA 3BHTA 2VV9A 3DXQA 3KEXA 3TTJA 4RC4A 4FBXA 4IHPA 4XS2A 3O0GA 3BGPA 3QTSA 4DAWA 2VTNA 5T3QA 3R63A 4M7IA 3G0EA 4NM7A 3DFAA 3GCQA 3JY0A 3QF9A 3KVWA 2CN8A 3QRKA 4X2JA 3SW7A 5AUZA 1OBGA 4ANLA 4FTUA 4MYGA 1GIJA 2YWVA 1LP4A 1XO2B 1ZMUA 3MY5A 4ZS0A 4DE4A 2HZ0A 4F1MA 4YO6A 2PE1A 3D7ZA 4MD8E 1OL7A 3OCTA 3AMAA 4UMUA 4FGRA 3IW8A 5HCZA 5C8KA 3HMOA 4M69A 3WYYA 2UZDA 3UOLA 2XJ0A 5J9YA 2HW6A 3D2IA 4QMUA 4NJ3A 4ACGA 1H1RA 3LOKA 4KIQA 3RWPA 4J52A 3TUBA 1KE9A 4YHFA 5HG7A 2PZRA 4QMYA 5K0XA 2FSTX 3ZUVA 3AD5A 1G5SA 4QP1A 4ALUA 1HOWA 1RQQA 3EQFA 2VO7A 5DG5A 4BB4A 4BTKA 5J1VA 5DRBA 1K2PA 4BDBA 2OG8A 4X6RA 3PWDA 2HWOA 2BALA 3ORPA 4XV3A 5E8XA 3MPMA 2BAJA 3RKBA 4DEEA 4E4LA 4E73A 4AUAA 2R0IA 2PZIA 5TF9A 3U6HA 3LLAA 1FINA 3LMGA 4QMMA 5DFPA 4D2TA 5A54A 5EK7A 2IW6A 5AWMA 1V0PA 2XH5A 3AC3A 1WBSA 3PG3A 5K5NA 3DOGA 4V0GA 3RAKA 3NUAA 1BI8A 1IR3A 4N70A 5CSHA 5AR3A 2XM8A 4EC9A 3CTQA 4X2FA 3FHRA 4IAKA 5H8BA 3HV4A 2V22A 4FNYA 5AA8A 1LR4A 4KA3A 4LMUA 4P4CA 1O6YA 4OTPA 4WG4A 3LFAA 3VN9A 4IZYA 1Q97A 2OZOA 3FZSA 2CGVA 2GMXA 4I4FA 4IC7A 4WRGA 3PA4A 5M06A 5L8KA 2J6MA 2XEZA 4ZS4A 3DLZA 2FB8A 1IASA 3DXNA 5DT4A 4EBWA 5CTPA 5A4EA 3ZBXA 3GB2A 2XF0A 3RAIA 4EOIA 2VWYA 1VEBA 2WEVA 3VBQA 2B0QA 1WVXA 2XNPA 2VN9A 4HNIA 4IDVA 4ASXA 4CFFA 4HGSA 3NRMA 2SRCA 4QD6A 5EH0A 2G15A 2ITXA 2CNUA 4WRSA 4YP8A 2P2IA 4OLIA 4ASEA 5AJQA 5C9CA 3CBLA 3DBDA 3QTXA 3VRZA 1PXOA 3C4XA 5EHYA 4FEWA 3ZLSA 5A9UA 4LRKA 3V6SA 4O7VA 3EOCA 5EW3A 4L7FA 3O8PA 5HEZA 4FZFB 2XYNA 4GG5A 3GFEA 2IPXA 5GJGA 5DWRA 4C62A 1H28A 2ZM4A 3FKOA 5AX3A 5CEMA 5BYLA 1I44A 3PWYA 1PXIA 4ZZNA 2OJIA 3C4WA 2JDRA 3C7QA 4CRLA 4AE6A 2ITTA 3MTFA 5J7HA 3MA6A 4FA2A 4KNBA 4DH5A 5IH4A 4Q9ZA 4DT8A 4BDEA 2W4JA 3AC1A 4BWPA 2H9VA 1Q8UA 3KB7A 1WBVA 4XP3A 5G1XA 3ANQA 3SQQA 3DDPA 3UVRA 4ASZA 4BCIA 1Q8WA 1GNGA 2Y7JA 4O7WA 4D2RA 4I20A 3SV0A 2HIWA 4QMNA 3FL4A 1J1BA 3TNWA 3POZA 2XP2A 1CKJA 2YLEA 1J7IA 2REIA 4NU1A 3ZSHA 5IA3A 3FI2A 4D28A 2UZVA 4F1OA 2W1ZA 4GL9A 3E64A 5FBNC 3MA3A 3R8ZA 3CSVA 2WMUA 4DFZE 3R7GA 4NIFB 3IW4A 3KMMA 1OZ1A 1OKWA 3QZIA 4PP9A 4AWIA 3FMEA 4F65A 5L6WL 5HKMA 1PHKA 5L6PA 3DQXA 3DJ6A 3ELJA 3V5WA 2VRXA 2ZDTA 3GC8A 3D5XA 4U81A 4WO5A 3COHA 2ZDUA 4QMQA 2W1IA 3ZO4A 3FMLA 4QP8A 3Q2MA 5I9WA 5IQEA 3HDNA 2ZJWA 3B8QA 5HD4A 3LW0A 1H1WA 1ZYLA 5EOBA 4ANBA 4DC2A 3DBQA 4FTIA 5D12A 1Y57A 2HCKA 2WAJA 4E4MA 4DINA 4D55A 4PTEA 3OXTA 4CKJA 4NM5A 4JX7A 2WELA 3QCYA 5CENA 3SG9A 4P5ZA 3WBLA 4OT6A 4UZHA 4X3FC 5CXZA 4WNPA 3PY0A 3QKLA 4IE9A 4NUSA 4C7TA 1ZYCA 5EQEA 4B4LA 4YZCA 4EH3A 5LVPA 2G1TA 3L8VA 3AC4A 1NVRA 4FNZA 4BZNA 3TI1A 3QUEA 4DG2E 5ANEA 3ZFMA 1JNKA 4BDDA 2WMWA 4J1RA 4O6LA 1R0PA 3UP7A 2CNVA 3SD0A 4RVMA 3HVCA 1KE8A 4ZIMA 3TACA 3VWAA 2J90A 2Q0BA 4RIWA 4PRJA 1U5QA 4AOJA 4E26A 1J7LA 4DCAA 4J7BA 5IA1A 1ERKA 4D2PA 2E9PA 2GTMA 5AP5A 3PSDA 3ULZA 4ITJA 4NFMA 3R8VA 2GHLA 3EN9A 4FIGA 4PL5A 1OECA 3GT8A 3E7OA 3OP5A 4KKEA 4NCTC 2BTRA 2JD5A 4TWOA 2F4JA 5CS6A 4USEA 2GNLA 2WQEA 2XA4A 3QKMA 4BCGA 3ZRMA 3KFAA 5AP0A 2BAKA 4K9YA 2C0OA 2PTKA 2GS6A 2XRWA 4U3ZA 5H8EA 1MQBA 4RGJA 5EM7A 3DJ7A 4YBKA 5DHJA 1CM8A 3K5VA 3R8PA 3QBNA 2W17A 3G2FA 3R01A 3DAEA 4FKUA 5JZJA 1WVYA 2BTSA 4MXOA 2C3JA 1LEZA 1ZYDA 4DFLA 2X7FA 3LCTA 1Q4LA 3ORIA 4GFMA 3L9PA 3OZ6A 4Z9LA 2PVNA 2FUMA 3G51A 4D9TA 3WF5A 3A7IA 5IA5A 4U97A 1Q24A 2WTKC 1UU8A 2VX3A 4BYIA 1CSNA 3VBWA 3U54A 1P14A 2BFXA 2GFSA 4ZMEA 3RGFA 3TDVA 3V04A 4D4SA 5GZ9A 5AUUA 2AYPA 4AA5A 4QYFA 4BDHA 3EKNA 4IC8A 5CI6A 4JDHA 3SRVB 4G5JA 3KMWA 2HK5A 4FC0A 4M0YA 3HRCA 4O7TA 3QA8A 3RNYA 4XV9A 5F4NA 3G6GA 3SC1A 4QMOA 4NWMA 3CP9A 3WZDA 4EEVA 3OF0A 3ZYAA 4AOTA 5GINE 2VO3A 4Y83A 4R5SA 2PUNA 3C0HA 3F5UA 4ZLYA 4L3PA 5AV0A 3VQHA 4HW7A 3CPBA 3MY0A 4W4WA 2B9FA 3OXIA 3IW5A 4XOYA 4E6AA 5HTIA 4BRXA 3ROYA 4OBQA 4EYJA 4BVUA 5CU4A 2YA9A 4RLKA 3D5WA 4GT4A 3EIDA 3F3ZA 3VBVA 5IMXA 2GSFA 2XIYA 1YKRA 4HVIA 4K11A 5CT7A 3QC4A 3UO6A 1IA9A 5IDPA 4JRNA 3PVWA 4D1SA 4LYNA 5LVLA 4BCPA 4L46A 3U55A 4WD5A 4K8AA 5IQHA 5IA0A 4EQMA 2WQNA 1QPDA 1XJDA 3BU6A 4CMTA 3BEGA 4X7QA 3F5GA 4FEQA 1ZARA 2ITYA 3NYVA 4F0GA 5KMOA 1B6CB 4IQ6A 4EZ5A 4YUQA 4FTTA 4Y95A 2Q0NA 3HZTA 5KX8A 4IWOA 3DBCA 3R00A 4ACCA 4FTCA 1JQHA 3UVQA 2HXQA 2KTYA 3BV2A 4FKGA 4IAIA 3COIA 4IM0A 4QYGA 4BTFA 1ATPE 1XH6A 4E5WA 4FMQA 2JFLA 3R7EA 5BVOA 3ZSGA 2BR1A 4GYIA 4FKJA 3MVMA 4ZXTA 4IW0A 2YIQA 5EYKA 3F6XA 4FZ7A 1Q61A 4L42A 2EB2A 3ORKA 3L1SA 2FVDA 3D15A 4LM5A 4LL0A 5BVFA 3BWJA 3V51A 2QD9A 3FLQA 5CF5A 4IAAA 2YIRA 4YZDA 2BFYA 3BGQA 5G6VA 5EI8A 3DB8A 5EHOA 4APPA 4YMJA 3NW7A 3H9OA 2P33A 4DA5A 3ATTA 3O17A 2CCIA 4X2NA 1GOLA 3MJ1A 3H30A 3LM0A 4ZAUA 3EQPA 3HYHA 2QURA 1YXVA 4MXZA 3LXPA 1WZYA 2VWZA 1SNXA 5CVGA 3T3VA 4YJSA 5IKWA 3F5XA 2QLQA 3ZRLA 5IISA 2QO9A 2OJFE 2VTIA 3MB7A 5EM6A 5AP6A 4EOMA 4YURA 3MDYA 4P7EA 3G0FA 3ZEPA 3FY0A 3VF9A 4EK3A 2C4GA 3OBJA 4JIAA 4U7ZA 3R8LA 3S4QA 4C2WA 2H6DA 2O65A 3Q53A 4LV8A 4F0FA 5FG8A 5ANOA 4ENXA 4PDOA 1YDSE 3LQ8A 3NSZA 2C6OA 3DAKA 2QOQA 3TM0A 3VC4A 3UQGA 1W7HA 3BLRA 3WZUA 1OM1A 5FBOA 5LMAA 5CLPA 3TZ9A 4DH7A 2P2HA 4GVAA 2E9OA 4ZP5A 4DT9A 5CU6A 4O22A 4FL1A 2C6MA 4J95A 4B9DA 4C8BA 4CFNA 3A60A 2XCHA 5JT2A 3TWJA 4NCTA 4JOAA 3VS0A 3F2RA 4ACMA 2W1FA 2F57A 4DG0E 4W9XA 3TUDA 4F0IA 4BKJA 4NT4A 1BYGA 4P2KA 4QMSA 4H3PA 2W9ZB 2BDFA 3RK9A 4C58A 5L4QA 3N4UA 3PLSA 5D11A 3Q9YA 3F7WA 2BRMA 4F99A 3F2AA 4FKTA 4I93A 3NUUA 3Q60A 4MF0A 3WE8A 3OWKA 3ORNA 4AZFA 2XVDA 4JQ7A 1JWHA 4NZWB 5AR4A 5AADA 3NNUA 5I0BA 2OBJA 5I3OA 2ZV9A 4ITIA 3LE6A 5F94A 4FL2A 4AU8A 3C0GA 3MFSA 3ODZX 4WHZA 4JG8A 3BQRA 3EQRA 4O96A 3QFVA 5M53A 1H00A 3EQDA 3E87A 4AT3A 3LJ1A 3FLSA 2XKCA 4FVRA 4HCUA 4YGAA 4O86A 4BR3A 4FSQA 1UU3A 2GQGA 2QG7A 3CKXA 1V0OA 2X2MA 4O2PA 5AX9A 4CXAA 3W2RA 2WPAA 1H08A 3CLYA 3KRXA 4LOQA 3DY7A 4F6WA 3R7IA 2W1DA 4U5JA 2ONLC 2VTHA 4TKSA 5E90A 4BWXA 4L45A 4YHTA 2VTSA 2W7XA 4C57A 1R0EA 4M3QA 4CZUA 3SOAA 3QLGA 4ANNA 5JQ8A 1B38A 3D5VA 1NXKA 3WARA 3FYJX 4C35A 3RHKA 2QOHA 3R7UA 5GIOE 4DEDA 1U54A 2O0UA 1VJYA 4WSQA 2RFDA 3ORMA 4RJ4A 3LM5A 4HCTA 4L00A 3W8QA 2J4ZA 2BRBA 3BYUA 3OWJA 5HQ0A 4R5YA 3NUSA 4F09A 5M4UA 1G8SA 1PMVA 3QTUA 5KMIA 1E1VA 1QMZA 3HP5A 5HLNA 5HLWA 4GS6A 3TUCA 4BCKA 3BHHA 2ITNA 4QPSA 5IQIA 4RIOA 4X6QC 1YI6A 1YW2A 3DTCA 4BL1A 1FBNA 4FT0A 2A4LA 1L3RE 3FQSA 4BTMA 3LFCA 3WF6A 2PMLX 2QODA 4OTQA 3LMIA 5B0XA 1V1KA 2J9MA 3V5LA 5FXRA 3JVRA 3F3WA 5CEPA 3I6WA 4NTTA 2XBJA 3PA5A 4S31A 4F7NA 3QYZA 2QC6A 1M14A 3AOXA 3R83A 2ZAZA 2GS7A 3ACKA 5AP3A 5H8GA 3A7JA 4X21A 5L2WA 2FSLX 5TR6A 3TT0A 4AE9A 2QKRA 5D9HA 5FTQA 3ZO2A 3UOKA 5LVOA 1SMHA 4JI9A 3SOCA 3RPSA 2VU3A 2CLQA 4EI4A 3S2PA 3K54A 4U9AA 1WVWA 3DJ5A 4IB3A 4J53A 5L6OA 3M1SA 3ZC6A 3FWQA 5IDNA 4WNMA 3ZM4A 3TN8A 3PLAE 4L7SA 4F1TA 1REKA 3PJ2A 2NO3A 3SA0A 4JQ8A 5ANJA 5BYYA 4GJ3A 4CYIA 1JKTA 1YXSA 3IKAA 4TYJA 5K9IA 3KULB 1APME 3ZMMA 2VD5A 4PQNA 5I4NA 1IAJA 3ETAA 4AZWA 4BCOA 4CYJA 1Q62A 3U51A 3L8SA 4FNWA 4QP2A 4IADA 5C03A 4CNHA 3UO5A 4B0GA 3FZPA 2RL5A 3MB6A 1YOLA 1KE6A 2IO6A 3QA0A 1T45A 2YN8A 3A7HA 3QD2B 4NK9A 4F7SA 3VUIA 3FI8A 5CYIA 3FMJA 3VF8A 3GCSA 4UY9A 3EZRA 3QHRA 4NKSA 1J91A 2OXDA 3QTIA 5TO8A 4WUAA 5FDPA 2R9SA 3MJ2A 2JKQA 5HE2A 1LPUA 4EOQA 4FKRA 4XG7A 4AW2A 4U45A 4V0GB 3BU5A 2UW4A 3HRFA 3OY1A 4G9CA 4IFGA 4LV5A 3CQEA 3TJDA 4I41A 3ZCLA 4ANSA 4QYEA 2OJ9A 3MSSA 4LI5A 4FICA 4UN0C 2JGZA 4YJUA 3CIKA 1PXKA 2ZV2A 3EFJA 4HVHA 2XB7A 1JLUE 3CY2A 2I0HA 3QQFA 1FPUA 1YHWA 1PYEA 4K77A 4G9RA 1PMNA 3ZU7A 3UNZA 4JRVA 3C9WA 1H26A 3DKOA 4YLKA 1YWNA 4AACA 4AZVA 3GP0A 3RBWA 3TV7A 2J0KA 4FG8A 3IGOA 3SDJA 2I40A 5LQFA 4ORKA 5HX8A 4DH8A 3FKLA 3ENMA 3WZEA 4AN2A 2OH4A 4EONA 5HU3A 3LFDA 4ZMFA 3UMXA 1M7QA 4MNEA 4IXPA 2YIXA 3MGYA 4QMZA 3BV3A 2PHKA 4FTKA 4G34A 4QTCA 2X4FA 4MKCA 3VW8A 2BHEA 3PIXA 4IJ9A 4GT3A 4IM2A 3KRJA 5E1SA 1KV2A 2PZPA 5FTGA 5C8NA 2A1AB 2PMOX 4G31A 3LAUA 4GU9A 5CQUA 2J5FA 3W33A 4MQ1A 3ZDIA 3S00A 4QPMA 4TYGA 2ONLA 2YDIA 4L44A 4DEIA 3MIAA 4UMQA 2G2FA 4AZSA 3DCVA 5AUYA 4BCHA 4FTMA 3G5DA 5M57A 2CDZA 2QO7A 1VR2A 5HIBA 2HYYA 4EOJA 5HCXA 2UZOA 3PXZA 4YC8A 3OROA 5HZNA 3GVUA 1PY5A 3VBXA 1PMUA 4QOXA 4Q5HA 2VWXA 3A99A 3ET7A 4EQUA 2Y4IB 4O84A 3IONA 2ETMA 3RM7A 3R0TA 4C2VA 4IZ5A 3UBDA 3IOKA 5B2KA 3NX8A 4NSTA 5AR7A 4AFEA 4OR5A 3HMNA 4XHKB 5CALA 5HE0A 3TKHA 5KUPA 4MK0A 4AGUA 5HBEA 3JY9A 4UMTA 2QU6A 4PL3A 1CKPA 4RIYB 4GK4A 2E9UA 5BX0A 3N51A 3ZBFA 2UW0A 4L67A 5E91A 1H1PA 1WFCA 2ZB0A 4PX6A 3KN5A 2PY3A 5EYMA 2WMVA 4KIKA 1UA2A 2OSCA 2UUEA 3EH9A 2XNBA 5L2IA 5JEBA 2JIVA 3KREA 2XIXA 2BROA 4S32A 2BKZA 5B2LA 3W32A 5CNNA 3R9NA 4EC8A 3UIBA 3OEZA 3PZHA 5M44A 2R7BA 3AT2A 4DLJA 2ERKA 5DGZA 2PVHA 3MBLA 3ZOSA 4I5PA 4FSZA 2J51A 2R3QA 3NWWA 4I92A 4W8DA 4BIBA 3V6RA 3C4EA 5A14A 3AMBA 4BDAA 5IEYA 2BKKA 4C4HA 5AFVA 5BUJA 4L53A 1KWPA 3UC4A 1S9JA 3KXMA 1IA8A 4EWQA 3ZEWA 3I81A 3KU2A 4HZSA 4TTHB 2JBOA 3MH3A 3FKNA 4M14A 1PXPA 5IQAA 2OZAB 4Q2AA 3FE3A 3MFRA 2C5VA 2QQ7A 5J5TA 3ROCA 4LGDA 4YTHA 1YVJA 4D1XA 2DWBA 1Q8YA 5HO7A 2IVSA 3O96A 4L9IA 5DR9A 4AS0A 4EWHA 1DM2A 5DPVA 5IA4A 4ZJJA 3PJ1A 4FGBA 2P4IA 3BHVA 3HEGA 4KRDA 4L3LA 2W06A 3VVHA 1OPLA 3DKCA 1XR1A 3D14A 3HV6A 4RT7A 5FXSA 5CAQA 1BL7A 3NUNA 1R78A 2WD1A 5GJDA 4RIWB 5FEQA 4A9YA 5HORA 3ODYX 4Y85A 1OL6A 4IEBA 1OIRA 4O7NA 4TW9A 3DV3A 2F7ZE 4XMOA 2WQBA 1W98A 2A0CX 3KK9A 2BRNA 2GPHA 4M8TA 3AMYA 4FTNA 4YC3A 4AGWA 4DFXE 4A9SA 2VWWA 5AIRA 3FUPA 3I5NA 4YJQA 3EFWA 3Q4TA 3ZRKA 1OKYA 3V3VA 1YWVA 3HKOA 4K1BA 2JKOA 2ZMDA 4IB5A 4O0RA 2B55A 4FVPA 5AUTA 3VS3A 1YXXA 1OL5A 3IK3A 3RZFA 4RX7A 3FBVA 3UOHA 3TDWA 1FVRA 5DYJA 1YRPA 3R30A 4BDJA 2YM4A 4BCMA 5A4QA 1V0BA 2HY81 4MAOA 3V8TA 2OICA 5D7AA 4D0WA 1O9UA 3D2KA 4XOZA 1JKLA 2GHMA 2VO0A 3EZVA 4R7HA 3G90X 2X7OA 3QTZA 3C5IA 3K3IA 4DCEA 3M11A 4BCNA 4EH6A 1ZZ2A 5LJJA 3Q52A 3TZMA 3SXFA 3PFQA 4A4XA 3R9HA 2GDOA 4FI1A 4Z3VA 2QOKA 4JVGA 3HP2A 4FSRA 2HW7A 1GY3A 4LG4A 1J1CA 2VGPA 4PMSA 3MW1A 4BKZA 3PY1A 4HNFA 4FZ6A 5JQ5A 1O6KA 2O5KA 3IG7A 3FQEA 1FGKA 1XQZA 3UZPA 3CQWA 2GNJA 3VQUA 4Y46A 2CKOA 4IX6A 2W1HA 3PPJA 4JNWA 5J95A 4ZLOA 4RSSA 4C36A 2DQ7X 1PXLA 3R28A 2R3GA 2X8DA 3B8RA 4L68A 3K5UA 1E1XA 4BIDA 2YABA 2IN6A 4M84A 2PVMA 4WBOA 1JPAA 4XRJA 5CWZA 4YTIA 4Z16A 5HX6A 2PE0A 2XK4A 3DA6A 4C37A 5F1ZA 4IWDA 4ZSGA 4FKIA 4NM0A 4I22A 3TZ7A 5FWKK 2OXXA 2R3FA 4CKRA 4H36A 4HPUE 4C3FA 5A6NA 3PE2A 3HECA 1GIHA 1Q5KA 4IX3A 4QPAA 4F64A 4DN5A 3H0ZA 2QOIA 5DH3A 3QALE 2BRGA 5CT0A 3E62A 5KNJA 3OT8A 5C8MA 2WQMA 4XYFA 3W2QA 1YQJA 2F9GA 1M2PA 3NUYA 4CLJA 1DAWA 3MV5A 5T6KA 2GQSA 3Q2JA 4RQVA 2QOCA 4MNFA 3PPZA 5ANKA 5K0KA 2QNJA 5I3RA 4GYGA 2XK7A 3FAAA 4FZDB 2BRHA 4JIKA 1ZOHA 4FT9A 5D41A 2W96B 5H9BA 3BHUA 4O7ZA 2CLXA 2PVKA 5BUEA 4S34A 5CEOA 3AC8A 4RJ6A 5EFQA 3U4UA 4UWYA 2C6KA 2OW3A 3OC1A 3BBWA 2FSMX 4A06A 3VBTA 5ITAA 1S9IA 3CC6A 4KKHA 2Z2WA 4QYHA 5HD7A 3IOPA 3ZZWA 4F6SA 4U40A 4D4VA 4RX5A 4K0YA 4DEHA 5GZAA 2C3KA 3OFMA 5I9UA 3FZOA 4UXQA 5ETCA 1Y6AA 4JX3A 1YHSA 4O1PA 3FMHA 1ZLTA 3UPXA 4CFVA 4L3JA 2JAMA 2ZV8A 1H0VA 4WKQA 3EQGA 2XIZA 1L8TA 2YCFA 5EDQA 5FQDC 3VBYA 5C4LA 1RE8A 4FSUA 5HU9A 1KOAA 2C3IB 3E8CA 5CQWA 3E5AA 2ACXA 4ZEGA 1K3AA 3FXXA 2C1AA 4RFYA 3FXZA 5EKNA 1XBBA 1ZOEA 2W05A 4GUBA 5A4CA 3BYSA 2BUJA 3FI3A 5LMKC 4PDYA 3CTHA 4DTKA 3P78A 4ZSAA 3GCVA 3C4ZA 5AV2A 3A4PA 4UXLA 5CVHA 2OI4X 3IQ7A 5EDPA 3GU5A 1FOTA 1OMWA 4D58A 3CY3A 3A8WA 4XBUA 4DGLC 4NW6A 2ITUA 4AOIA 4FSYA 4G1WA 4ZZOA 4MBJA 2HZIA 4M68A 3EN5A 2WHBA 2VTPA 3BRBA 3ZLXA 5KKRB 4Q5EA 4YJRA 3TJCA 3QAME 3U9NA 4CT1A 2J0JA 5IZFA 2YAAA 1YDTE 4KKGA 2XZSA 2JIUA 5C01A 4KRCA 5C4KA 4YR8A 5EDRA 3PXRA 1BX6A 1T46A 3JR1A 4IDTA 4E6DA 4RX9A 3IPHA 3VUKA 4ALVA 3TEIA 4EOLA 4I0TA 1JOWB 3QXOA 3RNIA 4H58A 1M2QA 4LQMA 4G16A 4E93A 1UVRA 2VTJA 5GIPE 3QLFA 4WNKA 3DTWA 3PXYA 2XYUA 2RFEA 4IH8A 4AGDA 4CGAA 3WILA 2W5HA 3H10A 2YERA 3NYNA 4FODA 4Y73A 2IWIA 3HGKA 3DKFA 3FY2A 3F88A 4E1ZA 4GSBA 3LFEA 2CNQA 4MF1A 2I0VA 4RPVA 5JFXA 4O81A 4R6VA 4IJPA 3VS1A 1EH4A 3R73A 1PXNA 4FV2A 5LMBA 1IAHA 2PUIA 4BDFA 4G3EA 3W16A 4DTBA 4R8QA 1ZYSA 2F2UA 2X9EA 1OUYA 4LFIA 3RZBA 4IVCA 3R22A 4PDSA 5KMNA 4BGQA 1JKSA 3I7BA 5CU2A 3NMUF 4ONAA 3GI3A 4F9BA 2WTCA 3DU8A 2ESMA 3BX5A 4YJTA 3UMWA 3F82A 4GIIA 4ENYA 4ZTSA 3DPKA 3QQGA 2GU8A 4K33A 2VX1A 3VS6A 2J0LA 1PKGA 1M52A 2UVXA 4ITHA 3NZ0A 4RC3A 2YFXA 4FKOA 3NR9A 3LFFA 4YZ9A 2QKWB 3A62A 2VTTA 1UWJA 1YWRA 2BZIB 2W0JA 5EYDA 5LVMA 5I9XA 4DFNA 3L9NA 4ZOGA 1MUOA 3G9LX 5HESA 1WBNA 5IF1A 4WSYA 4IBMA 4M66A 5GNKA 5FLFA 4Z7HA 4YTFA 4MWIA 3LQ3A 1R39A 3SXSA 1FVVA 2XNEA 3GENA 3ITZA 4PUZA 4E4XA 4AF3A 5EQPA 2XJ1A 3PJCA 2IJMA 2YISA 2C0TA 3CTJA 3QQUA 5HBJA 1GZKA 3N9XA 4G6OA 4K2RA 5JSMA 4R3RA 1VYZA 2PK9A 3OTVA 5CZHA 3VJNA 4NTSA 3OG7A 4PPBA 4U0IA 2ZVAA 5KMLA 3F61A 2XKEA 2R3JA 2VGOA 1UNHA 4ERKA 3QD4A 3NUPA 4FTJA 2CN5A 4JAIA 2EWAA 3IDBA 3GC0A 1KOBA 5DE2A 2BMCA 3Q4CA 4EHVA 3BU3A 3PG1A 4FVQA 2WTIA 4G3FA 4IMYA 4EOKA 4C38A 3HNGA 2YM3A 4O6EA 4FKVA 2C30A 5CX9A 4KUJA 1P4OA 3SKCA 3P7CA 3ENHA 3ZSIA 1FGIA 3L9LA 4L6QA 4Y8DA 5IEXA 5E8VA 4AN9A 2YIYA 4EBVA 2JLDA 5IQCA 4IZAA 3RAWA 2PE2A 5IQDA 3LFQA 3KMUA 4FTRA 3QCQA 4Z7GA 4A4LA 3EN4A 3UGCA 2GS2A 2J2IB 2Y8OA 4D1ZA 1Q3DA 5E8WA 1XBAA 3UG1A 2DUVA 2YWPA 4ALWA 5JFWA 1CTPE 4FYOA 3S3IA 1UU9A 4EKLA 4CD0A 4QNYA 4EL9A 4AQCA 2B9IA 2C5YA 1W84A 2QOBA 3Q9ZA 5HE1A 2XRUA 3OXZA 4R3PA 3AG9A 2YIWA 4U79A 4B8MA 1J7UA 2BVAA 4B99A 2GNIA 3QYWA 4CFWA 3UZRA 5IEVA 3PDTA 3ACJA 1NY3A 3F3TA 5FRIA 3NCGA 4WA9A 2YZAA 3GU6A 4Y5HA 3TIZA 3WIKA 2GNHA 3I79A 3QUDA 4N0SA 1XKKA 4XV2A 4EK4A 1H0WA 4CZYB 5FP6A 3C51A 2UW3A 1F5QA 1OGUA 2C3LA 2R0UA 2WOUA 2FYSA 2PMIA 2Z7SA 4L8MA 5K3YA 4EK6A 4H05A 4C34A 2IZSA 5JRSA 4HZRA 3JUHA 3CE3A 1CDKA 2RGPA 3BELA 4X3FA 3R2YA 2B1PA 1PXMA 1W82A 5A6OA 3O8TA 3F3UA 4W4VA 5BMMA 3QGYA 4IB1A 3BGZA 3TNHA 3UNKA 3QQKA 5E8SA 3E92A 4GK3A 4DH1A 1P5EA 3GEQA 3KY2A 2NRYA 3DKGA 1OIYA 3AT3A 4TWNA 4NIFA 5EI6A 5EHLA 3VHKA 4BICA 4CEGA 4C4FA 5E8TA 2ITPA 4Y5QA 4JR3A 2I0YA 4G5PA 4TWPA 4XNEA 1Y8GA 2XCKA 3RALA 1ZOGA 3NW6A 2PWLA 3DNEA 4JR7A 4O7SA 5GJFA 3QTWA 4LGHA 3FC2A 2CGXA 4J99A 2IZRA 4FV6A 3R9OA 2WIHA 1ZZLA 2H96A 3CR0A 4IX5A 4ZSEA 2XMYA 2VTAA 3JVSA 2YDJA 1UWHA 3HLLA 2V7OA 5HLPA 5M55A 5HG9A 5BMSA 3PVUA 3SHEA 2ITZA 3T9TA 3W10A 4MNEB 5IPJA 3QCSA 1SYKA 4FNXA 1PMEA 4I6FA 3HAMA 4GVJA 3UYTA 4FTQA 3LVPA 4H3BA 5HG8A 5CNOA 3UTOA 2IZUA 1AGWA 5IA2A 1Q8TA 5HGIA 3UC3A 4FV5A 2WZJA 4JBVA 5FP5A 2XK9A 2R3OA 3C4FA 4H1MA 5BVEA 5A4TA 5JRQA 3UNJA 3PTGA 5CAPA 3ATSA 2YITA 3PE1A 4UV0A 2EXCX 3RPYA 3UOJA 3OOMA 4A07A 1OL2A 4JJRA 5DBXA 5C1QB 3QRUA 1OIQA 1NVQA 3GOKA 4EH2A 2VTLA 3T8OA 4NYEA 3CJFA 4Z55A 4S30A 4AAAA 1QPEA 3SXRA 4QMXA 4F9YA 4DEBA 1PYXA 3DXPA 4YZNA 2ITOA 3EQIA 3GCUA 1HCKA 3MS9A 3P0MA 3Q5IA 5KCVA 4M0ZA 4RQKA 4MXXA 3BKBA 4F63A 4MQ2A 3DNDA 4RWLA 4KS8A 5BUIA 4DH3A 2IVVA 3D7TA 2YLFA 4C4JA 3RTPA 1OI9A 1OL1A 3G33A 2VTRA 2HXLA 1WBPA 4KSPA 4XG6A 3RPVA 2Q83A 4UYAA 4KIKB 5AP4A 2EUFB 3CJGA 3ZZEA 4C4EA 4LUDA 4RVTA 3GU4A 4EUTA 2YJSA 4PMMA 4BHNA 4RVLA 4GV1A 4C4GA 3FXWA 3FZRA 4TY1A 4B7TA 4D2SA 3PIYA 4BI2A 2PULA 4E20A 2XEYA 3REPA 3HDMA 4BWKA 3CPCA 4OW8A 3E8EA 3E63A 4FIEA 2QOLA 4LUEA 2EXMA 4KS7A 3RK5A 4JDJA 3OUKA 3EQHA 5EM5A 5HICA 3MWUA 5LARA 3VS4A 3ORLA 2RG6A 4ZY5A 3F69A 1OPKA 2YM5A 3BEAA 2Y4PA 3FQHA 3GNIB 5JZNA 3RP9A 1IG1A 2WMBA 3PJ8A 4FSWA 3CGFA 1H27A 3NIEA 1NW1A 4FE2A 3KC3A 4WT6A 3TV6A 5K4IA 4GKIA 4XH6A 3O8UA 4ZSLA 5LXMA 3RAHA 2RIOA 3QL8A 3TKUA 1NT2A 4HVSA 5LOHA 3WF8A 2C1BA 1OPJA 3Q6WA 3O71A 5FGKA 3FZTA 4MBLA 4U43A 5FM2A 2XK3A 4FV1A 4QP9A 4JDIA 2ETRA 3I1AA 3FJQE 2IG7A 4FV4A 3NNVA 3F9NA 4CLIA 3OW4A 5IQBA 5DEWA 5AAGA 1X8BA 3D83A 1XBCA 4QQ5A 4BHZA 1Y6BA 2FO0A 5KZ0A 3WF7A 4BCFA 4BZOA 4EOPA 4DTAA 4BBMA 3GU8A 4MX9A 5JFVA 2VO6A 3O7LD 2B52A 4MBIA 3CS9A 4MWHA 3LJ0A 4E6CA 1KE5A 2WTJA 3A2CA 4GRBA 4TYEA 4LMNA 3OD6X 4EH4A 4DYMA 3NVKI 3HA6A 5BYZA 5B7VA 2PZYA 4M69B 5IH6A 4BI0A 5LCKA 3QRIA 3F7ZA 2EB3A 5EM8A 1FMKA 5GHVA 3LCDA 1WBOA 2X8EA 3EL8A 3NW5A 3LHJA 2LAVA 3F2NA 3W55A 4FSMA 4O0UA 4DITA 3MI9A 4E6QA 4D5KA 3QKKA 2UW5A 4HOKA 3HMPA 1GJOA 5IU2A 3KA0A 3QXPA 4U44A 2Z02A 2C5OA 5HNBA 2WO6A 1OIUA 3TIYA 3OHTA 4EOOA 3SGCA 3PVBA 2WMXA 3QC9A 3P7BA 4GK2A 3LIJA 2Y0AA 3P79A 3PIZA 4YNEA 3R1SA 4FV8A 4K6ZA 3NCZA 1UU7A 4O7LA 2RFSA 3HA8A 3V8WA 4RA4A 3EQBA 4FR4A 4BDCA 4LOPA 1H24A 4RWJA 1YI4A 5AP2A 4S33A 5CF6A 1U4DA 2XNGA 4I5HA 5HTBA 4FIFA 4E8AA 4YZBA 2GFCA 2OXYA 4O82A 4L52A 3RHXA 4CQEA 3WF9A 2OH0E 4C61A 4XLVA 4R3CA 3D9VA 4U8ZA 3H9FA 3UJGA 3ZO3A 4I6BA 4RBLA 4XG2A 3D0EA 4H3QA 4TYHA 4EH7A 3BE9A 2UVYA 4XG4A 3ZFXA 4OT5A 2IZTA 4EUUA 1JSTA 3MVJA 3QQJA 4OTDA 4DG3E 4CCUA 4TNBA 2FA2A 4NFNA 4X3JA 4FSNA 1A48A 3Q4UA 4G3GA 5L2SA 4GJ2A 3Q3BA 4A9TA 3OEFX 2VAGA 4AW1A 3N4VA 2GCDA 2HWPA 2CKPA 1Z57A 4IWPA 4AA4A 3P7AA 5HE3A 1Z9XA 2ZV7A 3MN3A 1KSWA 2FGIA 5BVNA 3NEWA 1ZYJA 3VHEA 3P86A 5HG5A 1YHVA 5L2QA 1Y8YA 2J0MB 2O2UA 2HZ4A 3R04A 3PA3A 3RCDA 3RPRA 2JC6A 2NP8A 2OWBA 5A3XA 1XHAA 2R2PA 3GFWA 2PVLA 4QRCA 3BBTB 4CG8A 3L8XA 2BZHB 3KRRA 4O38A 2VNWA 4PL4A 5M4FA 3ZC5A 1A9UA 3JS2A 3TV4A 3TL8A 4ZK5A 4CZTA 2HY0A 5DR6A 2ZM3A 3T9IA 2JDTA 4F9CA 5A46A 2C5NA 4I0SA 1UKHA 2YCQA 3AC2A 4ARKA 3ZH8A 3CGOA 2QI8A 4FF8A 3R8UA 3VRYA 3AT4A 5M07A 1F0QA 4JBQA 2VZ6A 4TN6A 2WMQA 2I6LA 2VTMA 3EYGA 3OWPA 2X8IA 3POOA 2JDOA 4I5CA 4QMLA 4M15A 4UZDA 4GFGA 5F95A 4DFUA 3FSFA 1TKIA 2UZUE 2F7XE 2P0CA 3A4OX 5F20A 4KIPA 3UQCA 4O7YA 2EXEA 4R1YA 1VZOA 4JG6A 4UWBA 2O64A 4J71A 2DYLA 3FLYA 4RFZA 4R7BA 5E8ZA 4G3DA 3HV7A 4DFBA 3E3PA 5CEQA 3CXWA 3BYOA 5AUXA 4AG8A 4GKHA 4RMZA 2J5EA 4O2ZA 2Y4IC 2E2BA 5CSXA 1MP8A 2GNFA 5CZIA 4ACHA 5IMEA 4EQCA 5HNIX 4XCUA 2BZKB 2WTVA 4IM3A 4KSQA 3SLSA 1XH5A 2AC5A 1WBTA 2QOFA 5FTOA 4HYUA 5CF4A 4DF3A 2GQRA 4PPAA 4JBPA 1DI8A 1BKXA 1M17A 2WU6A 1G8AA 5CANA 3BI6A 1XH4A 1JSUA 3BCEA 4U41A 5H3QA 4X2GA 3JXWA 4RZWA 2OLCA 1RJBA 2V7AA 3TXOA 2QVSE 3MPTA 5IUGA 2AC3A 4EHZA 4DGOA 4RFMA 3OS3A 3W2CA 2Y9QA 2WMAA 3FPMA 4IVDA 4AZTA 2NRUA 4G6LA 4HJOA 3FLZA 1U59A 4QYYA 5J9ZA 4QTDA 5ICPA 4BBFA 2PYWA 2PVRA 3MVLA 1P2AA 2Y6MA 1SZMA 4WG3A 3SX9A 5ACBC 4O0SA 4XBRA 5KHXA 3KF4A 4FX3A 5I9VA 3QCXA 4CFXA 3MIYA 3DK3A 3UP2A 4GUEA 4UMRA 4D4RA 3GUBA 3KK8A 2UZEA 3AQVA 4XG9A 3RMFA 4AW0A 4EOSA 2UZTA 5H2UA 2B9HA 4DHFA 2BHHA 2R4BA 3UO4A 5CASA 4EZ7A 4NEUA 4BYJA 4AFJA 2PU8A 3L9MA 4JT3A 2VWIA 5DEYA 2OF4A 3KXHA
chains in the Genus database with same CATH superfamily
1OKVA 1XH7A 3KN6A 3KULA 3RI1A 3ORXA 4IACA 3OOGA 2EU9A 2CKQA 4FUYA 3VUGA 2ERZE 4CRSA 4M67A 2WGJA 5DT0A 4BZDA 2UZWE 4N4SA 3KXXA 3PP0A 4OTWA 5AP1A 4FT3A 2PUUA 3O2MA 4C3RA 2X2KA 4U42A 3W2PA 1URWA 2WNTA 1W2CA 1FQ1B 2XS0A 3Q9XA 3BYMA 2PVJA 4HGLA 4YPDA 3OW3A 4IZ7A 3W18A 5AIKA 4CCBA 1A06A 5AR2A 2CMWA 3R1QA 3QGWA 2WFYA 1Q3WA 3AD4A 4DEAA 3ZDUA 2CKEA 1OB3A 1YOJA 4ASDA 1SVHA 3EQCA 2B4SB 4GFOA 4JXFA 4MXAA 4D9UA 3RVGA 4F9WA 2R3MA 1VYWA 2R5TA 2XBAA 2XNOA 3C1XA 2IW8A 5TKDA 2E9NA 3AC5A 2VNYA 1GZ8A 2A27A 1QL6A 3KL8A 2QR7A 3ZONA 2YM6A 4BKYA 4TXCA 3GGFA 4LRJA 3O50A 5DRDA 1GZOA 2Z7RA 3EWHA 3ZUUA 2A2AA 3HAVA 1JSVA 4EK8A 4AXFA 5DT3A 4UEUA 5ANIA 2W1CA 5M56A 2C68A 1BUHA 2W5BA 3NS9A 3R7YA 4DHZA 3ORTA 3QTQA 3COKA 1QPCA 4IAYA 2PVFA 1J3HA 3UIUA 3LCSA 4O0YA 5J1WA 2R3LA 3TNIA 4DLIA 1VLRA 3PY3A 3A7FA 2CSNA 2QONA 4EJNA 1BI7A 3ZLWA 1PW2A 3ALOA 4YPSA 2KULA 3AD6A 5I5ZA 3CCNA 3ZLYA 1B39A 3MFUA 3CD8A 3V01A 4A9UA 4KBCA 3PSCA 4ZY4A 2B9JA 5AM7A 3UZTA 4EYMA 5E4HA 3MH2A 3U4WA 2OO8X 2R3KA 4E7WA 4FKLA 3NIZA 4QTAA 3MH0A 4KD1A 1XH9A 1YDRE 2P3GX 1STCE 4HVDA 4ZLZA 3RINA 5J7BA 5HNGA 5AAFA 4TRLA 2UW8A 3F66A 4XP2A 4E5BA 5IH5A 5KHWA 5M09A 2BIYA 3NGAA 1UV5A 3GQLA 2JAVA 4KBKA 5IQGA 2X81A 3KRLA 4RIXA 4ZTNA 5JKGA 1GAGA 4M97A 4YO4A 3P5JC 1U5RA 3FSKA 2YZLA 2XK8A 2UW7A 2P55A 3FDNA 4I6QA 3UQFA 3FMMA 2B54A 3LMHA 4F7JA 3HRBA 2B7AA 3EB0A 4FG7A 4XRLA 4YJNA 1YI3A 3AKKA 4CTBA 4LOOA 2W4OA 4IFCA 1PRYA 3WOWA 3PZEA 3BIZA 2V0DA 3R71A 2O8YA 3C5UA 4IANA 3UPZA 4I23A 3KQ7A 4R78A 2VWBA 4UWCA 3R9RA 2QCSA 3E88A 4LRMA 4FOCA 2JKKA 1WCCA 3KCKA 4X3FB 4RX8A 4WNOA 4RRVA 4ZTLA 2EVAA 3RWQA 1W83A 4BBEA 4RIYA 4XJ0A 4Y72A 1TZDA 2UW9A 3Q5ZA 3BZ3A 2HENA 4KWPA 3I4BA 3LFBA 2C6DA 5AUVA 1Y91A 3R1NA 2Z7LA 4XG3A 1WMKA 2HAKA 3G15A 3F5PA 4EH9A 2YAKA 3Q96A 5HO6A 4DEGA 3QZFA 3NAXA 2YDKA 3B2WA 3QWJA 4G6NA 5E1EA 5E7RA 1XH8A 2NPQA 4J8NA 4C59A 4BCJA 1U46A 3S1HA 4B8LA 3W8LA 2XKDA 1JBPE 2FSOX 5FUTA 5HIDA 3P9JA 5DMZA 4F7LA 2JDSA 3H4JA 3LCOA 2CCHA 2WMRA 4XLIA 4YU2A 5DA3A 3NVMB 4HPTE 3QRTA 4QQJA 4E4NA 2ZM1A 1W8CA 4II5A 5KBQA 1H1SA 2QR8A 2WMSA 3M2WA 3A8XA 1DS5A 2OZAA 5K5XA 1NVSA 3OMVA 2PMNX 3AGMA 3BYVA 5JH6A 4OBOA 4QMPA 5AP7A 4BC6A 4O7RA 5ETAA 1SVGA 1GZNA 4QDEA 5L8LA 2QHMA 5C27A 3OBGA 4GW8A 4W4YA 1XWSA 3V5QA 4XG8A 5HBHA 4BY9E 4XP0A 5ACKA 3IECA 2J50A 3KXZA 4FIHA 2WTKB 4UMPA 5KO1A 1H01A 3BLQA 4RZVA 3NAYA 1G3NA 2PL0A 1JVPP 4UALA 4IB0A 4U80A 5KMKA 4J98A 4JQEA 5KKRC 4CG9A 1KV1A 2UVZA 5DOSA 3FMKA 4O83A 3IW7A 4J8MA 4V04A 5LWNA 2ETKA 2W1GA 2A19B 2AUHA 3DB6A 3HX4A 5J9LA 1Q99A 2C6TA 2G2HA 1FMOE 5DIAA 5KZIA 4FL3A 3C4CA 3R02A 3DT1A 4NW5A 2VTQA 5EW9A 1H4LA 2QOOA 1KE7A 3HV3A 2WTWA 2R3PA 4D2VA 3RCJA 2VWUA 3D7TB 4PY1A 1AD5A 4F78A 4KIOA 4AA0A 4BDIA 2XARA 2YCRA 3GC9A 4OAUC 3JPVA 1U54B 2V62A 3EKKA 4GH2A 5DLSA 3MY1A 5FDXA 4JLCA 4ZZMA 3MFTA 3TCPA 4PTGA 2YACA 3PVGA 2JDVA 2B53A 3QHWA 3UVPA 4F70A 4FKPA 2XANA 4X0MA 4UYNA 5DNRA 5BVWA 1BL6A 4ANOA 5F9EA 4O0WA 4U3YA 2R3NA 5FEEA 4GMYA 3H9RA 5I9YA 4N6YA 3HUCA 4EK5A 4ZJVA 1TQMA 5EI2A 4EH8A 3NLBA 4QQCA 3H0YA 5DN3A 1HCLA 2CGUA 2GTNA 3DDQA 2W9FB 3VW6A 4R7IA 4FKSA 4FTAA 1REJA 2XM9A 1UKIA 4V01A 3VUDA 4JDKA 4AXAA 3SW4A 3ZFYA 1BLXA 4BI1A 4CQGA 5GZ8A 4KABA 3FC1X 5J87A 5JGDA 3W0SA 5I9ZA 4NJDA 4Q9SA 3MYGA 4HCVA 3ULIA 5JGAA 2RKUA 2RG5A 1ZRZA 4TWCA 3ANRA 3VS2A 4HGTA 1OVEA 1DI9A 3KKVA 1Z5MA 4MEDA 4MXCA 2NNWB 2BIKB 4FG9A 2FH9A 2R3IA 3IGGA 4OTGA 4BCQA 4FEVA 1H8FA 4PV0A 3C13A 3FLWA 3NNWA 3E3BX 4RJ7A 1O6LA 2WU7A 2O3PA 4RWIA 4AT5A 4C02A 3U6JA 3VUTA 5AV4A 1UNGA 2VX0A 5L3AA 5M4CA 5CSPA 2A98A 2QHNA 3R21A 4FSTA 4PPCA 2CGWA 3PP1A 4H39A 4NM3A 4UBAA 2YJRA 2E9VA 4PWNA 4YZMA 1RDQE 3U8WA 1CKIA 2R7IA 2W1EA 3LXLA 3VS5A 4C33A 4EORA 3RK7A 2X1NA 2BDJA 3VS7A 4BGGA 3UIXA 5LVNA 4QQTA 1OUKA 1QCFA 3LKMA 4FIIA 3IS5A 5EYCA 4CMUA 2H34A 1I09A 3BWFA 3RJCA 1JKKA 4QP4A 5LMKA 3KXNA 4G17A 3GXLA 3CKWA 3FV8A 4MHAA 4CFMA 4CVAA 2IVUA 5KMJA 3MPAA 4APCA 3GOPA 2BCJA 4JAJA 5DVRA 4HYIA 4IAFA 4FEUA 4R77A 4G2FA 5T68A 5D7VA 4TT7A 5AUWA 3CQUA 4DGNA 5AAEA 4S2ZA 4WUNA 5HCYA 3SVVA 1JAMA 2LGCA 5D1JA 4YJVA 3AXWA 3K2LA 2J7TA 1H07A 4MD7E 3Q32A 3LXNA 3OUNB 4KINA 2W5AA 4FV7A 3ZXZA 2BAQA 5ANDA 4BN1A 2UZBA 4I3ZA 2VWVA 1MQ4A 3E93A 3FL5A 4O0VA 4RLLA 2UW6A 4CMOA 3HMMA 4IAZA 3GC7A 2WQOA 4O21A 4P5QA 4DBNA 3S0OA 3DK7A 4YNOA 3W2OA 2F7EE 5BNJA 3ZM9A 2WMTA 4F9AA 5EW8A 4W8EA 3OY3A 4YSMA 3D5UA 3KCFA 4FV0A 5CEKA 1WBWA 4FTOA 5HTCA 2ZYBA 3FYKX 3FPQA 1IEPA 5FM3A 4FK3A 2JEDA 3DAJA 3FHIA 3LFNA 2OU7A 4D0XA 4NL0A 3EN6A 1RW8A 4QTBA 2BDWA 5FEDA 5LCJA 4ZTQA 3DBFA 2OJGA 3BL9A 2BZJA 1OKZA 4TYHB 3EYHA 4AT4A 5JN2A 4BDKA 4MTAA 3NDMA 3DLSA 4MVFA 5CVFA 4JL9A 2I1MA 4OAVB 4LL5A 5ANGA 3OCBA 5TOZA 3IW6A 5HO8A 4ZTHA 3PJ3A 3JYAA 3TTIA 2XNMA 4AX8A 2J0IA 5EG3A 3PFYA 4CT2A 2XIRA 3VULA 2G01A 2RSVA 3E8NA 3HMIA 5TT7A 3UE4A 3VNTA 4AW5A 2YM7A 3GCPA 1ZMVA 3DZOA 4PTCA 4FOBA 2HZNA 5AMNA 5AA9A 5B2MA 3Q04A 3R1YA 2X0GA 3QTRA 2C6IA 4NKAA 3DK6A 2QG5A 5J8IA 4OTRA 3QZHA 4I94A 4TPTA 5AR5A 4ID7A 3L8PA 4RC2A 4D2WA 4EZ3A 4CV9A 3KRWA 4A7CA 3CD3A 1LEWA 5EKOA 3AGLA 4PMPA 4E5AX 1DAYA 2R3RA 3THBA 4ERWA 3ZO1A 2C0IA 3PSBA 3VUHA 3EJ1A 2C6LA 5HIEA 3I6UA 4DBXA 3K3JA 3A61A 3A7GA 3LZBA 4CFUA 4FKWA 5HVJA 3BE2A 4O27B 5AV1A 2I7QA 4BIEA 4YSJA 5K4JA 3HV5A 1YOMA 2YCSA 4J96A 4OBPA 1ZAOA 4RWKA 5JGBA 5J5SA 4YBJA 4I5MA 3TNQB 3B2TA 4QP6A 5BVDA 3H3CA 5EQYA 4WIHA 3TNPC 4QP3A 5CSWA 2ZOQA 4W9WA 4DGMA 4U6RA 2OIDA 4MH7A 1K9AA 3P23A 5M4IA 3PPKA 1LUFA 3NYOA 2UZNA 3LXKA 5HVYA 3M42A 2QU5A 4EJ7A 4PF4A 3EN7A 4WG5A 3QQLA 5AM6A 2C6EA 3FMDA 4GCJA 2CPKE 4IVBA 3SRVA 4BFMA 1TQPA 2QLUA 4TL0A 5CU0A 4ANQA 5JK3A 4FUXA 3NUXA 2BPMA 1MRVA 2Z7QA 3P1AA 2GHGA 3R7VA 3VIDA 4CKIA 3LPBA 2ZB1A 3QUPA 4FT7A 5L2TA 3ERKA 3LCKA 2RFNA 4MD9E 4A4OA 4AN3A 1URCA 2ITQA 3F3VA 3OTUA 4I4EA 3VO3A 3PRIA 3U6IA 3MTLA 5IG1A 3U87A 3AKLA 3EL7A 1MRUA 3TG1A 4AZEA 4E3CA 1SNUA 4OTIA 4QMVA 3Q6UA 4OTHA 2HOGA 3QU0A 3VUMA 3QX2A 4WOVA 2PVYA 1GIIA 1BMKA 3WIGA 1YXUA 4C4IA 4MXYA 2UV2A 3DGKA 4NH1A 4BTJA 4XV1A 3WI6A 2JITA 5KBRA 3R7OA 4FK6A 4O0XA 3QD0A 3FMNA 2OFUA 3BPRA 4USFA 4I24A 5KMMA 3LJ2A 4K18A 2OIBA 2UZLA 4ACDA 1G8JA 4PMTA 1OITA 2HELA 1NA7A 3NYXA 3PRFA 4PDPA 4ZJIA 2Z60A 4R1VA 4FTLA 4RJ3A 5ETFA 4QP7A 4YC6A 3WE4A 1YXTA 3PYYA 4YTCA 3AKJA 5CI7A 5HHWA 3UG2A 3ALNA 1ZMWA 4RVKA 4O4FA 3I0OA 4CTCA 3O23A 3EFLA 1WAKA 3I60A 3O7LB 4OTFA 5AR8A 4WBBB 4KAOA 3QRJA 1SM2A 2C69A 1W2FA 2X6DA 3GQIA 4RJ5A 5LWMA 4BJJA 3DZQA 4RG0A 4HVGA 1H1QA 2Z8CA 3KXGA 4GG7A 4HYHA 1Q41A 4O1OA 3MVHA 4FV9A 4GIHA 5A4LA 3LLTA 1F3MC 3S95A 3P5KA 4DFYA 5HVKA 5JMSA 2YM8A 4O4DA 4C0TA 3WYXA 5EOLA 4H1JA 3R8MA 3II5A 4QO9A 2Y6OA 3W1FA 4BDGA 1TQIA 1AQ1A 2X9FA 4QNAA 3I0QA 3UDZA 4L01A 1ZY4A 4J97A 3I5ZA 3ZXTA 3DQWA 1E9HA 3KF7A 5TE0A 2WIPA 3FLNC 1M7NA 2DS1A 3UDBA 1UNLA 5AV3A 4YJOA 5BPYA 3C50A 4JG7A 5CY3A 2G9XA 3NNXA 4KBAA 3P4KA 2XK6A 2ITVA 2XKFA 3BHYA 2OKRA 4HYSA 4OGRA 4A9RA 3TKIA 3OWLA 4EHGA 1CMKE 2OFVA 3COMA 4FZAB 2IW9A 4OUCA 3LFSA 4YJPA 2CJMA 2OF2A 3IDPA 4EHEA 3KGAA 5C26A 3O51A 4D5HA 2JBPA 2X7GA 3QD3A 2I0EA 2O63A 4QMWA 3DBEA 5CAOA 3VAPA 2C47A 4KB8A 4AP7A 4PNKA 5M08A 4O91A 2WTDA 3ZTXA 2YEXA 1P4FA 4PNIA 3RPOA 3MESA 4M13A 4FYNA 4EH5A 2BILB 4TNDA 4I1ZA 3QZGA 3I7CA 4ZTMA 3D4QA 2PSQA 4M12A 3HUBA 3U9CA 2F2CB 5BQ0A 4UB7A 3SAYA 3V5TA 4B6LA 5M51A 3IO7A 2WOTA 2X4ZA 4FV3A 4TYIA 5HI2A 2V5QA 2ZMCA 5CU3A 2OIQA 3BLHA 2PZ5A 4CV8A 2ITWA 3D94A 3EMGA 5CEIA 4AXCA 2IVTA 3G6HA 1ZWSA 4HGEA 3HL7A 3OVVA 4FKQA 2C5XA 3EFKA 4ZSJA 2OJJA 2G2IA 4UX9A 3KVXA 1W0XC 3LQ5A 4YLJA 5HOAA 3TZ8A 3ZS5A 5IQFA 3PXFA 4QMTA 3N4TA 2JIIA 1M2RA 2F49A 3DFCB 2W99B 2XNNA 2R3HA 3Q4ZA 4ZY6A 3V5PA 3WZKA 4ANMA 4RIXB 3VJOA 5KE0A 4YHJA 4L43A 5FD2A 3C0IA 4IIRA 3WZJA 5FXQA 3R9DA 1R3CA 2H8HA 2R64A 2XJ2A 3GBZA 3MH1A 4EKKA 5JFSA 3OCGA 2YHVA 5AEPA 1QPJA 3NPCA 4IX4A 4QTEA 3W2SA 4C3PA 3EHAA 4XUFA 3UYSA 1FVTA 3T3UA 4TZRA 4FEXA 4I6HA 3FI4A 4DGGA 3R6XA 4GU6A 2JFMA 4GEOA 2WKMA 3OT3A 3ORZA 4JBOA 4RA5A 3E7VA 3UIMA 4BGHA 5E9EA 1OBDA 2V55A 2WB8A 4F08A 1ND4A 1IRKA 5CAVA 5L8JA 4FT5A 4G3CA 4O0TA 3QX4A 1PXJA 4V05A 2XUUA 4N6ZA 5CSVA 2RF9A 3Q9WA 3ID6C 3QQHA 1MRYA 4AGCA 5CXHA 3CEKA 5DI1A 3PXQA 1TVOA 5DR2A 3SG8A 2WEIA 4F4PA 3PXKA 4RJ8A 5CF8A 1SVEA 2X0OA 4MCVA 1ZY5A 5ETIA 4BF2A 3G9NA 4QT1A 2OK1A 2OGVA 3QWKA 3ZHPC 2WXVA 4JS8A 2GNGA 4I21A 5E8UA 1KUTA 2X39A 2QO2A 3ZUTA 3DS6A 2X2LA 2XIKA 3R2BA 4PP7A 5E92A 5BVKA 3RM6A 1Q8ZA 4XEYA 4FRFA 4D4YA 2VUWA 4LGGA 5IUHA 3UODA 1PKDA 1PF8A 4N57A 1H25A 4CSVA 3IDCA 4GT5A 4W4XA 2X6EA 1ZXEA 3FZ1A 5IUIA 2W4KA 4P90A 4IVAA 2CHLA 3UDSA 3V8SA 1R1WA 3GU7A 4USDA 4XX9A 2PUPA 4YLLA 5J79A 3PUPA 3E8DA 4FIJA 5D10A 5E8YA 2PPQA 2JKMA 3FEGA 5CAUA 4AQKA 4I0RA 2VTOA 4X2KA 3P08A 3BQCA 4ZTRA 1PJKA 3OCSA 4IWQA 4F6UA 3V5JA 3BHTA 2VV9A 3DXQA 3KEXA 3TTJA 4RC4A 4FBXA 4IHPA 4XS2A 3O0GA 3BGPA 3QTSA 4DAWA 2VTNA 5T3QA 3R63A 4M7IA 3G0EA 4NM7A 3DFAA 3GCQA 3JY0A 3QF9A 3KVWA 2CN8A 3QRKA 4X2JA 3SW7A 5AUZA 1OBGA 4ANLA 4FTUA 4MYGA 1GIJA 2YWVA 1LP4A 1XO2B 1ZMUA 3MY5A 4ZS0A 4DE4A 2HZ0A 4F1MA 4YO6A 2XAOA 2PE1A 3D7ZA 4MD8E 1OL7A 3OCTA 3AMAA 4UMUA 4FGRA 3IW8A 5HCZA 5C8KA 3HMOA 4M69A 3WYYA 2UZDA 3UOLA 2XJ0A 5J9YA 2HW6A 3D2IA 4QMUA 4NJ3A 4ACGA 1H1RA 3LOKA 4KIQA 3RWPA 4J52A 3TUBA 1KE9A 4YHFA 5HG7A 2PZRA 4QMYA 5K0XA 2FSTX 3ZUVA 3AD5A 1G5SA 4QP1A 4ALUA 1HOWA 1RQQA 3EQFA 2VO7A 5DG5A 4BB4A 4BTKA 5J1VA 5DRBA 1K2PA 4BDBA 2OG8A 4X6RA 3PWDA 2HWOA 2BALA 3ORPA 4XV3A 5E8XA 3MPMA 2BAJA 3RKBA 4DEEA 4E4LA 4E73A 4AUAA 2R0IA 2PZIA 5TF9A 3U6HA 3LLAA 1FINA 3LMGA 4QMMA 5DFPA 4D2TA 5A54A 5EK7A 2IW6A 5AWMA 1V0PA 2XH5A 3AC3A 1WBSA 3PG3A 5K5NA 3DOGA 4V0GA 3RAKA 3NUAA 1BI8A 1IR3A 4N70A 5CSHA 5AR3A 2XM8A 4EC9A 3CTQA 4X2FA 3FHRA 4IAKA 5H8BA 3HV4A 2V22A 4FNYA 5AA8A 1LR4A 4KA3A 4LMUA 4P4CA 1O6YA 4OTPA 4WG4A 3LFAA 3VN9A 4IZYA 1Q97A 2OZOA 3FZSA 2CGVA 2GMXA 4I4FA 4IC7A 4WRGA 3PA4A 5M06A 5L8KA 2J6MA 2XEZA 4ZS4A 3DLZA 3NFGB 2FB8A 1IASA 2X0QA 3DXNA 5DT4A 5CTPA 4EBWA 3ZBXA 5A4EA 3GB2A 2XF0A 3RAIA 4EOIA 2VWYA 1VEBA 2WEVA 3VBQA 2B0QA 1WVXA 2XNPA 2VN9A 4HNIA 4IDVA 4ASXA 4CFFA 4HGSA 3NRMA 2SRCA 4QD6A 5EH0A 2G15A 2ITXA 2CNUA 4WRSA 4YP8A 2P2IA 4OLIA 4ASEA 5AJQA 5C9CA 3CBLA 3DBDA 3QTXA 3VRZA 1PXOA 3C4XA 5EHYA 4FEWA 3ZLSA 5A9UA 4LRKA 3V6SA 4O7VA 3EOCA 5EW3A 4L7FA 3O8PA 5HEZA 4FZFB 2XYNA 4GG5A 3GFEA 2IPXA 5GJGA 5DWRA 4C62A 1H28A 2ZM4A 3FKOA 5AX3A 5CEMA 3BL7A 1I44A 5BYLA 3PWYA 1PXIA 4ZZNA 2OJIA 3C4WA 2JDRA 3C7QA 4CRLA 4AE6A 2ITTA 3MTFA 5J7HA 3MA6A 4FA2A 4KNBA 4DH5A 5IH4A 4Q9ZA 4DT8A 4BDEA 2W4JA 3AC1A 4BWPA 2H9VA 1Q8UA 3KB7A 1WBVA 4XP3A 5G1XA 3ANQA 3SQQA 3DDPA 3UVRA 4ASZA 4BCIA 1Q8WA 1GNGA 2Y7JA 4O7WA 4D2RA 4I20A 3SV0A 2HIWA 4QMNA 3FL4A 1J1BA 3TNWA 3POZA 2XP2A 1CKJA 2YLEA 1J7IA 2REIA 4NU1A 3ZSHA 5IA3A 3FI2A 4D28A 2UZVA 4F1OA 2W1ZA 4GL9A 3E64A 5FBNC 3MA3A 3R8ZA 3CSVA 2WMUA 4DFZE 3R7GA 4NIFB 3IW4A 3KMMA 1OZ1A 1OKWA 3QZIA 4O4EA 4PP9A 3FMEA 4AWIA 5L6WL 4F65A 5HKMA 1PHKA 5L6PA 3DQXA 3DJ6A 3ELJA 3V5WA 2VRXA 2ZDTA 3GC8A 3D5XA 4U81A 4WO5A 3COHA 2ZDUA 4QMQA 2W1IA 3ZO4A 3TMOA 3FMLA 4QP8A 3Q2MA 5I9WA 5IQEA 3HDNA 2ZJWA 3B8QA 5HD4A 3LW0A 1H1WA 1ZYLA 5EOBA 4ANBA 4DC2A 3DBQA 4FTIA 5D12A 1Y57A 2HCKA 2WAJA 4E4MA 4DINA 4D55A 4PTEA 3OXTA 4CKJA 4NM5A 4JX7A 2WELA 3QCYA 5CENA 3SG9A 4P5ZA 3WBLA 4DDIA 4OT6A 4UZHA 4X3FC 5CXZA 4WNPA 3PY0A 3QKLA 4IE9A 4NUSA 4C7TA 1ZYCA 5EQEA 4B4LA 4YZCA 4EH3A 5LVPA 2G1TA 3L8VA 3AC4A 1NVRA 4FNZA 4BZNA 3TI1A 3QUEA 4DG2E 5ANEA 3ZFMA 1JNKA 4BDDA 2WMWA 4J1RA 4O6LA 1R0PA 3UP7A 2CNVA 3SD0A 4RVMA 3HVCA 1KE8A 4ZIMA 3W0PA 3TACA 3VWAA 2J90A 2Q0BA 4RIWA 4PRJA 1U5QA 4AOJA 4E26A 1J7LA 4DCAA 4J7BA 5IA1A 1ERKA 4D2PA 2E9PA 2GTMA 5AP5A 3PSDA 3ULZA 4ITJA 4NFMA 3R8VA 2GHLA 3EN9A 4FIGA 4PL5A 1OECA 3GT8A 3E7OA 3OP5A 4KKEA 4NCTC 2BTRA 2JD5A 4TWOA 2F4JA 5CS6A 4USEA 2GNLA 2WQEA 2XA4A 3QKMA 4BCGA 3ZRMA 3KFAA 5AP0A 2BAKA 4K9YA 2C0OA 2PTKA 2GS6A 2XRWA 4U3ZA 5H8EA 1MQBA 4RGJA 5EM7A 3DJ7A 4YBKA 5DHJA 1CM8A 3K5VA 3R8PA 3QBNA 2W17A 3G2FA 3R01A 3DAEA 4FKUA 5JZJA 1WVYA 2BTSA 4MXOA 2C3JA 1LEZA 1ZYDA 4DFLA 2X7FA 3LCTA 1Q4LA 3ORIA 4GFMA 3L9PA 3OZ6A 4Z9LA 2PVNA 2FUMA 3G51A 4D9TA 3WF5A 3A7IA 5IA5A 4U97A 1Q24A 2WTKC 1UU8A 2VX3A 4BYIA 1CSNA 3VBWA 3U54A 1P14A 2BFXA 2GFSA 4ZMEA 3RGFA 3TDVA 3V04A 4D4SA 5GZ9A 5AUUA 2AYPA 4AA5A 4QYFA 4BDHA 3EKNA 4IC8A 5CI6A 4JDHA 3SRVB 4G5JA 3KMWA 2HK5A 4FC0A 4M0YA 3HRCA 4O7TA 3QA8A 3RNYA 4XV9A 5F4NA 3G6GA 3SC1A 4QMOA 4NWMA 3CP9A 3WZDA 4EEVA 3OF0A 3ZYAA 4AOTA 5GINE 2VO3A 4Y83A 4R5SA 2PUNA 3C0HA 3F5UA 4ZLYA 4L3PA 5AV0A 3VQHA 4HW7A 3CPBA 3MY0A 4W4WA 2B9FA 3OXIA 3IW5A 4XOYA 4E6AA 5HTIA 4BRXA 3ROYA 4OBQA 4EYJA 4BVUA 5CU4A 2YA9A 4RLKA 3D5WA 4GT4A 3EIDA 3F3ZA 3VBVA 5IMXA 2GSFA 2XIYA 1YKRA 4HVIA 4K11A 5CT7A 3QC4A 3UO6A 1IA9A 5IDPA 4JRNA 3PVWA 4D1SA 4LYNA 5LVLA 4BCPA 4L46A 3U55A 4WD5A 4K8AA 5IQHA 5IA0A 4EQMA 2WQNA 1QPDA 1XJDA 3BU6A 4CMTA 3BEGA 4X7QA 3F5GA 4FEQA 1ZARA 2ITYA 3NYVA 4F0GA 5KMOA 3W0MA 1B6CB 4IQ6A 4EZ5A 4YUQA 1ST0A 4FTTA 4Y95A 2Q0NA 3HZTA 5KX8A 4IWOA 3DBCA 1OGYA 3R00A 4ACCA 4FTCA 1JQHA 3UVQA 2HXQA 2KTYA 3BV2A 4FKGA 4IAIA 1TFFA 3COIA 4IM0A 4QYGA 4BTFA 1ATPE 1XH6A 4E5WA 4FMQA 2JFLA 3R7EA 5BVOA 3ZSGA 2BR1A 4GYIA 4FKJA 4BJJB 3MVMA 4ZXTA 4IW0A 2YIQA 5EYKA 3F6XA 4FZ7A 1Q61A 4L42A 2EB2A 3ORKA 3L1SA 2FVDA 3D15A 4LM5A 4LL0A 5BVFA 3BWJA 3V51A 2QD9A 3FLQA 5CF5A 4IAAA 2YIRA 4YZDA 2BFYA 3BGQA 4AXDA 5G6VA 5EI8A 3DB8A 5EHOA 4APPA 4YMJA 3NW7A 3H9OA 2P33A 4DA5A 3ATTA 3O17A 2CCIA 4X2NA 1GOLA 3MJ1A 3H30A 3LM0A 4ZAUA 3EQPA 3HYHA 2QURA 1YXVA 4MXZA 3LXPA 1WZYA 2VWZA 1SNXA 5CVGA 3T3VA 4YJSA 5IKWA 3F5XA 2QLQA 3ZRLA 5IISA 2QO9A 2OJFE 2VTIA 3MB7A 5EM6A 5AP6A 4EOMA 4YURA 3MDYA 4P7EA 3G0FA 3ZEPA 3FY0A 3VF9A 4EK3A 2C4GA 3OBJA 4JIAA 4U7ZA 3R8LA 3S4QA 4C2WA 2H6DA 2O65A 3Q53A 4LV8A 4F0FA 5FG8A 5ANOA 4ENXA 4PDOA 1YDSE 3LQ8A 3NSZA 2C6OA 3DAKA 2QOQA 3TM0A 3VC4A 3UQGA 1W7HA 3BLRA 3WZUA 1OM1A 5FBOA 5LMAA 5CLPA 3TZ9A 4DH7A <