2V62A

Structure of vaccinia-related kinase 2
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
316
structure length
309
Chain Sequence
FPEGKVLDDMEGNQWVLGKKILIYLAFPTNKPEKDARHVVKVEYQEGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE VRK2
publication title Structure of the Pseudokinase Vrk3 Reveals a Degraded Catalytic Site, a Highly Conserved Kinase Fold, and a Putative Regulatory Binding Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 309
sequence length 316
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2v62A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2v62A01
4XOZA 4C4GA 5ICPA 2UVYA 3U9NA 3ET7A 1ERKA 2O63A 4LFIA 4FTNA 4PL3A 4YZDA 3OXTA 4M68A 3UTOA 3ZHPC 4C38A 2VWIA 3FC2A 4O91A 4EOMA 3O2MA 3VN9A 4O86A 3VS7A 2BFXA 3AOXA 3GGFA 5AV1A 2BTSA 2BRHA 4IQ6A 3O7LD 2YDKA 5DH3A 3AXWA 3ITZA 5M4FA 2VWZA 3Q4TA 3MJ2A 5FM3A 5HD7A 5LVNA 2XK9A 4ZSGA 4A9UA 1M52A 2VO0A 4KBCA 4BGGA 5C8NA 2WAJA 5E8WA 4R7HA 4H1JA 3C5UA 4FMQA 4TW9A 3LFAA 1P4OA 3R02A 5J9YA 3LM5A 4BDHA 4J98A 4BTMA 5H8BA 3C4CA 1WBNA 5DRDA 3RCDA 1H01A 5CVHA 3CKWA 1PMUA 5HLPA 2WMWA 3P7AA 2B55A 1REJA 2JIVA 4YZBA 2Z7LA 1BMKA 4UMRA 4C62A 3SV0A 3FHRA 4F6SA 3BYVA 4Y73A 4M67A 2WTDA 1BYGA 3VBTA 2X9EA 2X8IA 1J7UA 4I5HA 1FBNA 2QCSA 1H24A 4O0TA 4YU2A 5AR2A 2ZMDA 1XWSA 2R0UA 4A4OA 2ZV7A 3VBQA 2VWBA 3GCVA 3NNXA 2QOFA 2XH5A 2YACA 4MD8E 5I9YA 1IASA 3GB2A 3N4VA 3TUDA 5AM6A 3UZTA 3LCOA 3R8LA 3ROCA 5A4LA 3MVMA 3UO5A 3LLAA 5HEZA 3UO4A 3LXPA 4O22A 3ZONA 3EIDA 5H9BA 4MF1A 3IECA 1PXPA 2XUUA 2A2AA 2PVNA 3P79A 4MNFA 3AD4A 5IA2A 1Q8WA 3MW1A 2GNFA 3F88A 3O8PA 5KMKA 4HW7A 4MXXA 4O2ZA 5E8UA 4FTMA 4QMNA 2BALA 4IC7A 5DPVA 3FJQE 3HX4A 1YDRE 2EXCX 4H3PA 5BVFA 3CY3A 3MJ1A 4AE6A 5LWNA 5LVLA 2IZRA 3UOLA 3DKFA 3WZEA 2QO7A 3EWHA 4E7WA 4PP7A 2OO8X 4GCJA 2QO2A 4RVKA 5AAFA 4D0XA 4NKSA 4EOJA 5A4CA 3GCUA 2YAAA 4FT0A 5KMNA 3C4EA 3UOJA 1ND4A 5H3QA 4F08A 4D1ZA 1I09A 4G6LA 5ETCA 4ZTHA 3EFLA 4CCBA 2OBJA 4I5CA 5IQFA 3KKVA 3E8EA 3TN8A 4FYOA 3P23A 5AA9A 4PDYA 4LM5A 5J87A 4ENYA 3CGFA 4FKLA 4YSJA 2HZIA 2VTIA 4EC9A 5HBJA 4D55A 2Z7QA 2A0CX 2YABA 3KRRA 4CZUA 4EQCA 3DBQA 3ZM9A 1OL7A 1XBBA 3VW6A 4M69A 4G16A 2XMYA 4ZY4A 3NR9A 1KE8A 3KEXA 3DZQA 3G0EA 4IB3A 2ITYA 1TQMA 3A61A 3EL7A 2WMSA 4NSTA 4RJ6A 3CLYA 3DV3A 3G9LX 4IM2A 3TJDA 5AX3A 3ZUTA 2QVSE 4B4LA 5KO1A 3MFTA 1JSTA 3EFWA 2B54A 1JKLA 4KIOA 2J7TA 3GU8A 4FIEA 2XB7A 4TYHB 1YOMA 3DNDA 4MXOA 4LRKA 4HYUA 5HE1A 3LKMA 2B9HA 3F3ZA 3DAJA 4PNIA 4ANMA 3U6IA 3F5PA 5HHWA 4FT5A 3QKLA 1YXUA 3FPQA 1WBOA 3OHTA 4HGLA 2VGPA 4BBMA 4EH9A 5TO8A 5JFXA 4AAAA 4K0YA 2F7XE 4FZ7A 3UG1A 4MBIA 4XCUA 4FIGA 4BYIA 1R3CA 4EKLA 4HJOA 2XS0A 1OPLA 4FUXA 3R9NA 3GNIB 3LMIA 3EQFA 4FK6A 4PWNA 3UPXA 4EJNA 1Q5KA 1OECA 2YN8A 4EWQA 5EI6A 2WFYA 2BAQA 3KVWA 4Y72A 1YWVA 3ZLSA 4C02A 3ORTA 4XV1A 5B2LA 3FQEA 4GV1A 2HOGA 4QP4A 1H0WA 4V04A 3G15A 3KQ7A 3QTUA 1O6YA 4PPAA 2H6DA 4QNYA 4XX9A 1X8BA 3FLSA 3G9NA 3MTFA 5KZIA 3Q9XA 4L53A 1FVVA 2QKRA 4NJDA 5JFSA 5JN2A 5TT7A 4EEVA 2FGIA 5AX9A 3D4QA 4MEDA 1E9HA 4BC6A 4XP0A 4FTAA 3VIDA 3DJ7A 3VJOA 4UMPA 4F64A 3JY0A 3CCNA 5A6NA 2V62A 4X3JA 2QOQA 5M51A 1JBPE 2YHVA 2VTHA 3D7ZA 2CCHA 4N57A 4U5JA 2XIZA 3FKNA 4I6QA 5FLFA 4WG4A 4BWKA 5HLWA 5HQ0A 2WB8A 4QMUA 2XEZA 2XF0A 3R9DA 2A1AB 3ORKA 3PJCA 1XKKA 3D83A 4U3YA 5DT0A 2UV2A 3II5A 4LRMA 5HO8A 3LQ3A 4F4PA 3LFFA 3S4QA 3EQHA 2GQRA 4EH6A 5M55A 4YBKA 2JKOA 2BDJA 3T9IA 4PMMA 2VX0A 1XH7A 3REPA 4GG7A 3CIKA 5HCXA 3V04A 1WBPA 3DKOA 4LUDA 4EOKA 3R6XA 1ZWSA 3UVQA 2W06A 3FLQA 3QHRA 4C34A 3HAMA 4O7NA 2JDSA 2PVLA 3PIZA 3CY2A 3VO3A 3NMUF 2P3GX 2VTRA 3PJ1A 1JKSA 1DAWA 2WNTA 5JGDA 3RK7A 4AXAA 4S34A 4YTFA 2HAKA 3Q2JA 1OIUA 3NUPA 4G3FA 3HRCA 2C1AA 1M2RA 2JKKA 3A60A 4JL9A 3UC4A 3CR0A 4DG2E 1NY3A 3DLSA 2GDOA 3ZSIA 4YZCA 3ZO1A 4R7IA 5DEWA 3NNVA 2C6LA 3R30A 4XLIA 4C2WA 4D28A 3ZXTA 3CD8A 3QC4A 3RK9A 3RHKA 4EL9A 1OBGA 4X2GA 4RVMA 4D4YA 5FBNC 2X81A 2J51A 3ZEWA 1OUYA 4FEVA 4C58A 5CXHA 4CRSA 2YJSA 3LFBA 4PDSA 4U0IA 5IDNA 4O7SA 4WUAA 5DNRA 3KMMA 5DEYA 4RIOA 4F7LA 4YC8A 4GG5A 5CEIA 4H05A 5AAGA 4Y46A 4QQCA 4S30A 3DJ5A 4DEIA 2Z7SA 3EN6A 3Q2MA 4IZYA 5HBHA 3PRFA 2EWAA 4R1YA 5EYKA 5T3QA 4BDDA 1GZOA 3C1XA 2UZDA 2X2LA 4FV1A 2YEXA 4J71A 3HMPA 4YTHA 4ZY6A 5LMKC 4RJ5A 4C3FA 2XEYA 3CKXA 4GK3A 4FSQA 4FI1A 2QHMA 4CYIA 3E3PA 3MIAA 3FMJA 3OWJA 3AC4A 3FI4A 3Q4ZA 4MBLA 3PPZA 1FGKA 3BHHA 3E64A 4IZAA 4LOPA 4XYFA 2Z7RA 3H9OA 2E2BA 2YLEA 3DXNA 2CGUA 2FVDA 3ZOSA 2GHMA 4E4LA 1J7LA 5C4LA 4JRVA 5JZJA 2CN5A 2YITA 5KBQA 4IZ5A 1PJKA 2HW6A 2VN9A 5AM7A 5AP1A 5J1WA 1ZYDA 1SM2A 4M13A 1URWA 3NVKI 4AZTA 2YCRA 3U51A 5IU2A 4ASZA 4GVAA 5KZ0A 3UVRA 4NL0A 3D2IA 3VC4A 3QTQA 1PXKA 4ZP5A 1WBWA 5F95A 3ZS5A 3T3VA 5AUTA 4TT7A 4BCMA 2XNPA 1PXMA 2HZ0A 2SRCA 1J1BA 3TXOA 4CG9A 2C5OA 4NWMA 4NZWB 1U59A 4TNBA 4Y95A 4ANBA 2CMWA 4YJQA 3IONA 4W4WA 3AMAA 1UVRA 5C03A 4ZJJA 1J3HA 2PVKA 3R1SA 4O0WA 3ZU7A 3OXZA 2R7IA 4B7TA 5IQCA 4AUAA 2WTKC 3QHWA 4LGGA 3U6HA 5G6VA 2HXLA 3DGKA 2A4LA 2P55A 3A7FA 4DEAA 2XM9A 4CFFA 3KRXA 4GK4A 4GT5A 4O38A 2IPXA 1P4FA 3TIYA 4JDHA 4AGWA 1MQ4A 3CPBA 3EHAA 1I44A 3TV4A 3QWKA 1Y6AA 2GNLA 3NW5A 5DR2A 3VS4A 2QHNA 3CC6A 2WELA 4G9CA 4EOIA 5LVMA 4O1PA 5L2IA 4O7TA 4RA5A 2JBOA 2VTJA 2XA4A 4V0GB 4G9RA 5ANEA 3PFQA 5CEKA 1XJDA 4KS7A 4DFUA 2ESMA 4J95A 4OTHA 4KSPA 4C57A 2BTRA 3I1AA 4H36A 4YJPA 4XNEA 2XKFA 4HGEA 3HP5A 3KMUA 2QU6A 3ZBFA 3D5VA 3ZC6A 2BRBA 3DAKA 3FYKX 4BCPA 3QQUA 4CEGA 2CLQA 3GVUA 5KMJA 3DB6A 4YTCA 3QUPA 3RJCA 3VQUA 2QODA 3LAUA 4WUNA 3ZZEA 3V8SA 3FZTA 4FTIA 2WQOA 1OBDA 4OTRA 1M7QA 3R7VA 2JDOA 4P5ZA 3UMXA 4C4EA 3ID6C 5M4CA 4MCVA 3TV7A 4ANLA 4UMTA 4L52A 1UU7A 4H1MA 4IM0A 3VBXA 1DI8A 3ODYX 4RJ4A 2WEIA 2OH0E 3E5AA 5FDPA 1NVSA 4R3CA 1AGWA 3BU5A 4PL5A 4RWKA 2YWPA 3FV8A 4QMQA 1YDTE 1H00A 5E7RA 5IA5A 2C5YA 3O7LB 4NCTC 4DTBA 5C27A 3QRTA 1JVPP 2YDIA 3IOKA 5T6KA 3HA8A 3C9WA 4JIKA 4IVCA 3LW0A 4F7NA 3NX8A 4FV5A 2YIQA 4Z7GA 2ITNA 4CXAA 5E92A 4F65A 5EM7A 3OOGA 1GOLA 1S9IA 4Z55A 5AR4A 5HCZA 3DBCA 3ODZX 5KMIA 4NM7A 5HVKA 4ZLYA 2O5KA 3JYAA 3HUBA 4I4FA 5CI6A 3R21A 4B9DA 2B52A 4D2TA 3Q04A 3VUTA 1OUKA 3R9HA 3ZZWA 4N6YA 4ASXA 3QTSA 5IQHA 3QLGA 4FV8A 5JMSA 3G33A 3I5ZA 4FTTA 5IMXA 4E4XA 3C0IA 4IE9A 4RLLA 2ZM1A 2FSTX 2IZUA 4FSYA 3HMNA 2PZ5A 2XIRA 2AYPA 3NAYA 4JDJA 3GU7A 2RFSA 5IQAA 4OR5A 5L4QA 4DT8A 4FNYA 2AC3A 4FKWA 4RJ8A 3EJ1A 5I9ZA 4YJOA 3D5XA 2Z60A 4DN5A 3PTGA 4KKGA 2OGVA 5C01A 4D4SA 3UP2A 2WGJA 5FEEA 1WAKA 3GBZA 5FD2A 4IWDA 3UIXA 3UOHA 2F9GA 2GSFA 4M84A 4PTEA 3HV6A 5K3YA 4C3RA 3HV7A 4IADA 5CTPA 3TKHA 2HYYA 2WIHA 3ZXZA 4CLJA 5DG5A 2XK4A 3KCKA 4A9YA 1BX6A 3B8RA 4DAWA 4KBKA 4R7BA 4YO4A 5DT3A 4ID7A 4YC6A 4IZ7A 3ORNA 4DEBA 2BRGA 4PQNA 5KMOA 2RF9A 1LP4A 2VUWA 5CEMA 1H1PA 1FQ1B 3EQGA 4I0TA 2BKKA 2QD9A 4I20A 3Q5IA 4F6UA 4Q2AA 2HIWA 3BLHA 3MVJA 1YXVA 2OG8A 2PUUA 3VUHA 3LJ2A 5K0XA 4FNXA 4E6QA 3DLZA 5HX6A 2OICA 4JDIA 3MIYA 3GC7A 1ZAOA 3FZOA 5DVRA 5JGBA 5LJJA 2W4KA 5GZAA 3B8QA 3OWKA 4G6NA 1LUFA 4JIAA 4EOOA 4M15A 5EG3A 1OITA 1UNLA 2HWPA 3H30A 4FTCA 4GJ2A 5GJFA 3Q6UA 3ORZA 4C33A 4L9IA 3KRLA 5BUIA 1OL2A 4EH8A 4WRSA 1APME 4R6VA 4U80A 5J79A 4CQGA 1ZZLA 4BTJA 4AOIA 3COIA 4S33A 3RPOA 3K5UA 4FG9A 1GNGA 5DRBA 2WXVA 3A8WA 4J96A 5AR8A 4Y85A 2HW7A 1KE6A 5AUXA 1XH8A 1YXSA 4C4JA 4YURA 2X39A 2UVXA 3RAWA 3SC1A 2QOKA 3BWJA 3KN5A 4DE4A 5EQPA 2G2HA 1BKXA 4HZRA 3FBVA 3NSZA 2ZJWA 3VWAA 2C6IA 2WOUA 3C0HA 3HLLA 3MPAA 2IJMA 2IZSA 3E7VA 4I3ZA 4KABA 4WNPA 3DK7A 4NK9A 3EH9A 4EH2A 4ERWA 2JDTA 2FA2A 4GH2A 4RC4A 1XBAA 3GC0A 5CU4A 5IDPA 2W99B 1H08A 2QOBA 3R83A 2B4SB 4I23A 5IH6A 2JKMA 2VWVA 3HMOA 2XKCA 2CHLA 4M0YA 4BKYA 4BDBA 4U8ZA 3NIZA 5D12A 4ASEA 3MPMA 4YJTA 3PWYA 1UU8A 3R1NA 2KULA 4RX7A 2VWWA 4V0GA 4JX7A 2O64A 2UW8A 4EK5A 3MS9A 4FSTA 3H9RA 4LMNA 1U5QA 1V0PA 2C69A 3IG7A 4Z3VA 4XG3A 4CKIA 3ZUVA 3KXNA 5AMNA 1QPDA 4L46A 3F2RA 4ALVA 4G3GA 3DDPA 3PJ8A 4U40A 4G31A 4L8MA 3C13A 4FR4A 3UYSA 4RLKA 3QQLA 3QRJA 5E8ZA 3E87A 4QP8A 3RKBA 2ZVAA 2Y4IC 2Y7JA 3FMNA 4XG9A 5HG9A 4ZZMA 3RZBA 5BQ0A 3QGWA 4EH3A 1ATPE 3PLAE 4C4HA 4GFOA 4ZEGA 4IX4A 3MY0A 3TWJA 1IA8A 3ZDIA 4AT3A 4HNFA 3BYUA 4ALWA 3I5NA 2X4ZA 3MH1A 4FV2A 3MFUA 4IWPA 4IC8A 4Z7HA 4QMSA 2W0JA 4MAOA 4QQ5A 3I81A 5D1JA 1H8FA 4JAIA 4DFBA 3K54A 4QMPA 2WMUA 4RRVA 2UW4A 4ZAUA 3EL8A 2RG5A 5DT4A 3PA4A 4E6AA 4GU9A 3MVLA 3P9JA 2VX3A 2Y6OA 3DBFA 4PTGA 4YO6A 5AP0A 2W1ZA 4P5QA 4CV8A 5A54A 4MQ2A 4F63A 4FEUA 5AUZA 3PJ3A 3LM0A 3ATSA 2VWYA 3P1AA 4I0SA 3M11A 1A9UA 4EH7A 4DFXE 3VUGA 3A7JA 4W4YA 3VBVA 1QL6A 3DPKA 1GJOA 2ZV2A 3QD2B 4FTKA 4JXFA 4XV9A 1XH4A 4JX3A 5AV3A 3TL8A 3FSKA 4I92A 3H9FA 2ITWA 4WNOA 4XP2A 1OL6A 2Z8CA 3ANRA 4U79A 2PUPA 1Q62A 5EM8A 5HICA 1YWRA 3C4FA 3LE6A 4FA2A 2R2PA 4C7TA 5CNOA 4B8MA 3IO7A 4FZ6A 5EKOA 3LQ5A 5B0XA 3SXFA 3SXSA 4LV8A 4W9WA 4U44A 3KREA 3DB8A 1UNHA 3ETAA 2WTJA 4XRLA 4AZFA 5BVNA 4RG0A 3VS6A 3QQJA 4ZSEA 3P78A 1WBVA 3PP1A 4GMYA 4QYGA 3SG8A 3QCQA 1M7NA 4RJ3A 3PWDA 3UOKA 3SW7A 3TUBA 3UQGA 4XV2A 4G2FA 5IA1A 2PVRA 4F70A 5ANOA 4UXQA 2IVVA 3RNIA 2UZVA 3KFAA 3GXLA 3OY3A 3P4KA 3WF7A 4CTCA 5BVOA 2Q83A 4O7ZA 3PXZA 3TKUA 3R9RA 2C0TA 4YZNA 4TYIA 2R64A 4UB7A 3EFKA 3HMIA 4Y5QA 1O9UA 1VEBA 3EKNA 3FLZA 5H8GA 3TNIA 1LEZA 4C37A 3E3BX 1YVJA 3PZEA 2W05A 3UMWA 1P5EA 1BLXA 3ACKA 3PVBA 4TPTA 1PYEA 5E8XA 4JDKA 4B99A 2OXDA 4EOQA 4XOYA 5JQ8A 3LCTA 5FUTA 4FNWA 3M1SA 1H07A 4EH4A 3OG7A 4MKCA 3RPSA 4AZWA 4C0TA 2W1IA 3WZKA 1YRPA 3VS1A 4EQUA 5HLNA 4UBAA 3U8WA 3ZO2A 4APPA 2FSOX 3CTHA 4XMOA 2R3RA 2J6MA 5A4QA 2QI8A 1Q24A 2IZTA 5GNKA 3PSCA 1OKZA 4USFA 2HENA 4AW0A 2OIDA 2PVJA 2WU7A 4GYGA 3NYNA 3HEGA 4FT9A 3RI1A 5L2SA 4QP6A 2NP8A 2VTOA 2Y4PA 3EYHA 3F69A 4LOOA 3W2RA 4RC2A 2LAVA 2OJGA 3HUCA 3UE4A 5CEOA 1OIQA 2JLDA 3R7UA 3S00A 3CP9A 3PE2A 2QNJA 4IXPA 4L01A 2NNWB 1VYWA 2WTKB 4O21A 5HI2A 3AT2A 2XCHA 1UA2A 2PPQA 5CSWA 2BMCA 4GUEA 1H1SA 1GY3A 3PUPA 1J91A 2O65A 4MXZA 4NT4A 4OLIA 3BGQA 4WHZA 1IAHA 5EQEA 4DC2A 5C8MA 3A7HA 3N4UA 2X0GA 5HOAA 3R0TA 1SZMA 3QYZA 4MXYA 4H3QA 4FG7A 3L8SA 1WVYA 3DKGA 2XK7A 1J7IA 3IOPA 4TYEA 3CQUA 3W10A 3POOA 5K5NA 2C3IB 1OPKA 4ZSAA 1DI9A 3OZ6A 4JVGA 3IW4A 2XK8A 2C6EA 4C4IA 4DGOA 1H1WA 3PXRA 3D5UA 1O6KA 3TIZA 4BCOA 3R8VA 3RM7A 3TZ8A 4YJRA 3OWLA 3PY1A 3DQXA 4IX5A 4LMUA 1R39A 3FLWA 3DY7A 2PMOX 3D5WA 3E8CA 3SDJA 3DK3A 3F3WA 4D9TA 1H25A 2R5TA 3V5TA 4CMUA 3I7CA 3U9CA 1M2PA 5L6WL 2F4JA 5HO6A 5BMSA 1KOAA 3DTCA 1U54B 4LI5A 4XLVA 2YIXA 4I94A 4BIBA 4WG3A 2W5AA 1YI4A 4F1MA 4IJPA 4MX9A 2HZNA 3SX9A 3AC3A 3OVVA 3GOKA 4YLLA 2E9UA 2F49A 1BL7A 4FEQA 4OTWA 3RZFA 5FRIA 4JBQA 3ZTXA 4I6HA 1DAYA 1JOWB 1QPJA 2F7EE 5HVYA 1KOBA 4RFMA 4IACA 2HWOA 4U7ZA 2EUFB 4FV9A 3QQKA 3P0MA 4I5MA 5BMMA 3AT3A 3R73A 1GIHA 3JUHA 3QYWA 4I21A 2CJMA 2YDJA 3FL5A 3QF9A 5CQWA 2FSLX 4E4NA 5AA8A 3FMLA 1QPCA 2XK3A 1KE5A 2ZV8A 4A9RA 5AUUA 5BYLA 3QXPA 2WMQA 3WYXA 1H4LA 2CNVA 3Q60A 2JDVA 1ZARA 4PUZA 3UZPA 4AWIA 4AOTA 1Q41A 2E9VA 1H27A 4JS8A 4QNAA 3VF9A 3TZ7A 3EMGA 5IH4A 3PY3A 4O84A 2B9IA 2OWBA 1CKJA 3R63A 4K2RA 2I0EA 2YZAA 4QYEA 3RPVA 2W17A 4QYHA 1ZY5A 4AQCA 4FTOA 3P86A 3RAIA 5JKGA 5IUIA 2Y6MA 4EOPA 4HGTA 1HOWA 3FWQA 4FX3A 4NU1A 2BZKB 4FODA 3KF7A 3COMA 3TZMA 2PE0A 5IEVA 3V6SA 3PYYA 5C4KA 4AFEA 4S31A 2ERZE 3ENMA 1VR2A 4UXLA 5K5XA 3MWUA 5HIBA 5A4TA 3H3CA 4TNDA 5CU3A 4AGCA 3CJGA 5AADA 3A4OX 2R3KA 1CTPE 5I9WA 3BX5A 3HRFA 3EQBA 2J0MB 3PVUA 4L6QA 4A4LA 1ZOHA 4OAUC 2PULA 2QR8A 2J0IA 2QC6A 3SW4A 2XBAA 3VRZA 5EQYA 2W5HA 4QTBA 5BUJA 4WSQA 5LXMA 1WZYA 4OUCA 3MSSA 2UZBA 4YNEA 2R3IA 4XBRA 4BF2A 3I6WA 5JFVA 2XIKA 4IMYA 1W0XC 4GKHA 5B7VA 2OH4A 2YCFA 3PVWA 3I0OA 1XHAA 5LMKA 4L7SA 2BHEA 5KHWA 2WPAA 5FTQA 4HVDA 4Q9ZA 3E7OA 3L9LA 4MXAA 2EB3A 3MYGA 3ZFMA 2BILB 4EZ5A 5I9XA 3KGAA 3G0FA 4DF3A 2I0HA 4U6RA 5IEXA 2O2UA 5ANDA 4CSVA 2JGZA 4FV0A 4EBWA 4I6FA 3PIXA 4FNZA 2VTNA 4FL3A 4M8TA 4WNKA 4ORKA 1H26A 3FPMA 3LCKA 5EW9A 2W1EA 2GNJA 2O3PA 2YM4A 4PF4A 3KB7A 2QO9A 5E8SA 5F20A 3FE3A 3ZFYA 4FTQA 2I6LA 4BIDA 5H2UA 4BI1A 4CG8A 5HKMA 5GJGA 2C30A 1B6CB 1ZXEA 4BL1A 1RE8A 4UZHA 5JSMA 4G1WA 4L43A 1JSUA 4DGNA 2IG7A 3NW7A 4X2FA 4A4XA 3BCEA 2XVDA 4EK8A 2ZM4A 3N4TA 1QPEA 5EM5A 3FC1X 4DLJA 4MD7E 4BDAA 2BRMA 2Z2WA 4ACCA 3TM0A 4ZY5A 3AC2A 2CDZA 1QCFA 3F5XA 2WMRA 5IZFA 4Z16A 2OI4X 4ZOGA 4YZMA 2VGOA 4DH8A 4AGDA 4BWPA 2R9SA 2RFNA 3W2QA 4K33A 5DR9A 1HCLA 1YI6A 2DUVA 3QZFA 3ULIA 1NT2A 2BHHA 3RK5A 5T68A 4FV7A 1ZMWA 2XK6A 3EKKA 3CTQA 3R01A 5FTGA 1SVGA 3WIGA 3NRMA 1G8SA 4EORA 2OFUA 2AC5A 2H96A 1V0BA 2NO3A 4RQKA 4JNWA 3PXQA 5H8EA 2CSNA 3IKAA 2JBPA 3MV5A 4KRDA 3LCSA 5IA3A 1OL5A 4OTPA 5J9ZA 3SG9A 4O0XA 5EDRA 1OI9A 4CT1A 3QCXA 4IDVA 4K77A 2R3OA 2CKEA 4RMZA 5IG1A 2ZV9A 3EOCA 4BGQA 2QQ7A 3ZM4A 2CPKE 2EXMA 3FZPA 3PA5A 2UZOA 3QTZA 3COHA 3WF5A 4A7CA 4PV0A 3SGCA 1OVEA 4RPVA 4UYAA 2JAMA 4TXCA 4FZAB 4BZNA 1K3AA 2VWXA 5L8JA 2Y4IB 4X21A 4XEYA 1XR1A 3KMWA 4G5PA 3VHKA 4HVSA 1OPJA 4IDTA 4J7BA 2ITVA 3BHVA 4I22A 4EHVA 3O17A 4JQEA 5FEDA 1U54A 3V5PA 1YQJA 4DLIA 3QA8A 4QQJA 5L6PA 4XRJA 1W8CA 5E1EA 4JBOA 2G01A 3CPCA 3NZ0A 4E8AA 4EUUA 2WTIA 3QC9A 1IRKA 3GCSA 1H1QA 1KV2A 3GU5A 1PXJA 3L8XA 4K18A 4E4MA 4MNEB 4CTBA 3FYJX 4EK4A 3Q6WA 4IM3A 2R4BA 5JGAA 4IHPA 4NCTA 3CD3A 4QT1A 3RPYA 1JLUE 3WARA 4FKPA 5CAVA 4IAYA 1ZOEA 5EM6A 4YBJA 4ANSA 4EUTA 4BBEA 2ZM3A 1H1RA 1W7HA 4WG5A 5KUPA 4PMPA 3MN3A 2PVMA 4BN1A 2B1PA 4M14A 5IPJA 5CVGA 3RINA 3VQHA 2OK1A 4EKKA 1F0QA 2P4IA 2RSVA 3DNEA 3HZTA 3JVRA 5I0BA 2J5FA 2X8DA 3LQ8A 3KULB 4TWNA 4ZJIA 3A7GA 2HZ4A 4IFCA 3OBJA 3SVVA 3R71A 3PLSA 2DYLA 5HIEA 4USEA 3KXHA 3SXRA 4LUEA 2VO3A 3LFCA 5JRSA 3NCZA 4AW2A 2Z02A 2R3HA 5IKWA 4NJ3A 3UZRA 4YJUA 5FEQA 4TKSA 3B2WA 3VUMA 3JY9A 4IBMA 4O7LA 1ZOGA 4KA3A 5AR5A 4BDIA 3OC1A 2W1DA 1RJBA 5FXRA 3RAHA 4G34A 5AUYA 4BCIA 2R3QA 5M09A 2C3JA 2GHGA 2J90A 5HTIA 3DXQA 4IX3A 4TWOA 4NM3A 5ACBC 5TE0A 3BV2A 3NYXA 5DFPA 5M44A 4CFXA 4RX5A 1T45A 3KF4A 4JG6A 4H58A 3T3UA 3LXLA 4F9AA 4WKQA 4JR7A 3BZ3A 5E8YA 2V55A 2WEVA 3LZBA 3ZCLA 5AP5A 1EH4A 5BYZA 2HXQA 4MVFA 3D15A 2OZOA 4OW8A 3MB7A 2VTPA 3UC3A 5AV4A 3R00A 4XHKB 4BB4A 5HG7A 4I5PA 3NUSA 4A07A 4RZWA 5M4UA 5HU9A 1URCA 2JKQA 1JSVA 4YGAA 2VTMA 4X2KA 3PDTA 1BI7A 3FI8A 4J8NA 1KV1A 5BNJA 4RA4A 3OTVA 2GQSA 3DJ6A 5D41A 2XJ0A 2R3LA 3DBEA 3RGFA 5J5SA 3EYGA 3FUPA 2YM5A 3OW4A 4OBQA 3W33A 2WMBA 2GCDA 4OTFA 3SRVB 5KBRA 4G3EA 2WQEA 2B53A 5JZNA 3MPTA 3IDCA 3F7WA 2Q0NA 2PE2A 2YCSA 3LLTA 3E8DA 3EN4A 3A8XA 4DEHA 5F9EA 4E1ZA 1YWNA 4ACMA 2QOLA 2R3FA 1WFCA 3THBA 3QUDA 2X4FA 4N70A 4BICA 4TWPA 4BCGA 4BR3A 2C1BA 2F2CB 2W1HA 1TKIA 1U4DA 2JFLA 2UW7A 4JG8A 5EW3A 3NUAA 2C6KA 2VAGA 5EK7A 3OD6X 4PTCA 4DG0E 3IGOA 5DWRA 3UJGA 4DA5A 2CNQA 3HMMA 3CE3A 4FKJA 3I7BA 4FTRA 4ZTNA 4GYIA 3WE8A 2W1FA 3MY5A 4KS8A 3IDBA 4E5BA 3CTJA 5A46A 3ANQA 3C5IA 2VTSA 1CDKA 2C0IA 4R3PA 3CBLA 3FLNC 1GZKA 2JIUA 4ASDA 3PVGA 4D2PA 4CVAA 3G5DA 4KWPA 5EI8A 5LMBA 4QMZA 3IPHA 3A4PA 3GC8A 3TTJA 5BPYA 3FSFA 3POZA 4GVJA 1BUHA 4EQMA 3QTIA 3HV5A 2XCKA 4XP3A 1U46A 5CAUA 1V1KA 3AD6A 5IMEA 3KK9A 2WHBA 4PY1A 2X6EA 3MFSA 4GL9A 4B8LA 2IW8A 4D58A 2KTYA 4KAOA 4HVHA 5AEPA 4AA4A 5FDXA 3NUYA 4X2NA 3VS5A 1Q4LA 2ZAZA 4DH7A 5JH6A 1YOJA 5L2TA 3KY2A 3I79A 5LCKA 4KUJA 1NA7A 5AV2A 2WU6A 4F7JA 3NVMB 3LFQA 1E1VA 2UW3A 3KRWA 4MK0A 2UUEA 3ORLA 3QUEA 2XZSA 1OKWA 2GS2A 2WTVA 2OXXA 3QRKA 2HK5A 3SQQA 3ZSGA 4D2WA 2ITZA 4JBVA 4KIQA 4UWBA 5E91A 2XNOA 2ERKA 5HBEA 2QG5A 4QMYA 3VJNA 5I5ZA 4MNEA 4UMUA 4BHNA 5CZHA 3BRBA 5J7BA 2PMLX 1DS5A 4RIXB 4IW0A 3QKKA 3QZGA 5B2KA 4XV3A 1JKKA 1SNUA 4O7YA 3HVCA 4L42A 4XJ0A 3MH0A 4GRBA 4JAJA 4JI9A 3R7EA 3P7CA 4FUYA 2CN8A 4Q9SA 5CT0A 4CRLA 3NCGA 4IAAA 4WRGA 2ETMA 4Q5HA 3ZUUA 2IVTA 3TNHA 1JPAA 2W96B 3FKLA 3AGMA 2BCJA 1R78A 3ORIA 5HTCA 2VV9A 3KULA 4KIPA 1Q8TA 1RQQA 4TRLA 2PVHA 2FO0A 3NAXA 2J0LA 2OFVA 4O0VA 4LG4A 4XG4A 4QMMA 3PE1A 2C5NA 4PDOA 4P2KA 4ANOA 5KKRC 3FDNA 4UWYA 4C36A 2A19B 2J50A 1V0OA 2PZRA 2YM8A 3IQ7A 4D0WA 4DFNA 4RWJA 4FGBA 3ZFXA 4E20A 4FK3A 3D0EA 1GIJA 1PHKA 3IGGA 4C8BA 4O0RA 5HE0A 4X6RA 3W2CA 1MRVA 4GFGA 4CMOA 1J1CA 4Z9LA 3QA0A 4DEGA 1GIIA 3BQRA 1JWHA 3R8UA 3BLQA 3HP2A 4JBPA 3U87A 1Q8YA 4NFNA 4FIFA 3EN9A 1MRYA 3TDWA 4F0FA 1Q99A 1YDSE 5IA0A 5CSXA 2X7OA 5K4IA 4B0GA 3QX4A 3OWPA 4DFLA 2V7OA 4L3JA 1REKA 2XP2A 3GFWA 4GIIA 4YJVA 3BYOA 3TTIA 4PRJA 4BDEA 5EKNA 4DH3A 4KRCA 3OUKA 3R2YA 2B9FA 4O1OA 1IAJA 3C50A 3F82A 4RGJA 3QBNA 4BCQA 4GEOA 5J5TA 4EJ7A 1PMVA 4CZYB 3ZRLA 2C6MA 3IW7A 3AMBA 1IA9A 1O6LA 4OTGA 2YISA 4J8MA 5L2QA 3UP7A 2YIRA 3O0GA 4JT3A 3IDPA 3D7TB 1ZYSA 4MBJA 5HX8A 3E8NA 3TKIA 5HORA 5EHOA 4AF3A 3KCFA 4CCUA 3HNGA 4MWIA 4WOVA 4N4SA 5IUHA 2OJJA 4TYJA 3NPCA 4H39A 4KD1A 4ACHA 5AUWA 5BVWA 4KBAA 2PMIA 3W8LA 3QTXA 4I4EA 4JQ8A 4RBLA 3OY1A 4W4XA 4QP9A 5E8VA 2QOCA 3GFEA 2VO7A 2R0IA 4YHTA 4IAIA 4GU6A 3MDYA 4FSNA 3UVPA 2WMXA 3V6RA 4BTKA 4U81A 2C5XA 2EU9A 4HCVA 4N0SA 1PMNA 4EH5A 5FGKA 5EDPA 3ORPA 5FM2A 5JT2A 4FG8A 3GU4A 4YJSA 4IB1A 4CYJA 5JK3A 5DIAA 2UZLA 3C51A 2P2IA 4O0SA 5DLSA 3H0YA 1PF8A 3SRVA 4OTQA 2HELA 2OZAB 2Y9QA 3AC1A 4ITHA 3ZO3A 3RWQA 5DMZA 3OROA 4D4RA 3HKOA 3QD3A 4YLKA 3OS3A 5CY3A 5ETAA 4NUSA 4D1XA 3CXWA 3RBWA 5CSPA 4DEEA 4WIHA 5CS6A 3VHEA 1S9JA 4XUFA 4AZEA 2W4JA 3BE9A 1OL1A 4P4CA 4YSMA 3VS3A 3K3JA 4D5KA 1JAMA 2R7BA 4D9UA 2W5BA 2IN6A 2GU8A 3S1HA 5A4EA 3QRUA 1PXNA 4BBFA 4AW5A 5GZ8A 1L8TA 3DFCB 1IEPA 3VF8A 1SVHA 4AA0A 5AAEA 1XQZA 5CALA 2QKWB 4BDKA 3FZ1A 5M07A 1JQHA 4TYGA 2QOOA 2RG6A 2RKUA 3QTRA 1TVOA 2PYWA 4G17A 1F3MC 2X7FA 3M2WA 2VX1A 1B39A 3EQDA 3O96A 5HESA 3WBLA 5I9VA 2QR7A 4KB8A 4O96A 5D7VA 3VW8A 5AIKA 4NM0A 4O2PA 4S32A 3VBYA 4HNIA 4LOQA 3TI1A 3ZEPA 4WD5A 2UZTA 4BDCA 4E6DA 1KE7A 1PXLA 3WI6A 4DHFA 2QONA 4NFMA 1WBSA 3E63A 4U45A 4F6WA 2PMNX 4EHGA 4DTAA 3F6XA 4EK6A 4FE2A 3R7IA 2OJIA 4I6BA 2GHLA 2XIXA 3C4XA 3W8QA 3F5UA 1L3RE 4RSSA 3O51A 4GUBA 1GZ8A 4YC3A 5HNGA 3OOMA 2O8YA 5L2WA 2B0QA 4TZRA 3UG2A 3W1FA 4HCUA 4EHEA 3DFAA 4BKJA 4XG6A 4RFZA 2XJ2A 4ZIMA 3GT8A 3RM6A 3W2PA 1AQ1A 3Q53A 2E9OA 2YA9A 3BKBA 3D94A 3FQHA 3QALE 3SOCA 5J1VA 2FUMA 3K2LA 2VTLA 3PPKA 3U6JA 5LCJA 5AP3A 5C9CA 4FKIA 4AX8A 4CFMA 3RNYA 3A2CA 3QCYA 2W4OA 4E26A 2CGXA 3LFDA 4AN9A 4RQVA 3LHJA 3HAVA 3TEIA 4UN0C 4CFNA 5KHXA 1ZY4A 1UU9A 3P5KA 4FVRA 3HYHA 4PNKA 5CXZA 4YR8A 4D2RA 3CQWA 4IIRA 1G5SA 3HL7A 3MFRA 4RIXA 4M66A 5AFVA 4HCTA 4LYNA 4MYGA 4D2VA 4MHAA 4BZDA 3QRIA 5DI1A 4AZSA 3N9XA 3U55A 1PY5A 4YHJA 5CVFA 5EYCA 4L67A 3NGAA 2J2IB 2REIA 3TG1A 3PXKA 2QG7A 3ENHA 3NYVA 3UNKA 3SLSA 3QGYA 4R77A 5ETIA 4EYJA 2BZIB 2VZ6A 2UZWE 3UQFA 2VU3A 4FT7A 4ZTMA 2WMTA 3FXZA 4XG2A 5DE2A 2WTWA 4ZTLA 3OW3A 5CAQA 4U42A 1HCKA 1LEWA 4QMLA 3BPRA 1WBTA 2QURA 2FB8A 1T46A 3PY0A 4I0RA 3W18A 4UEUA 3ZLXA 3LFNA 3DTWA 2I7QA 5FG8A 3BGZA 2C6TA 3QX2A 4JRNA 5C1QB 4QPSA 5KE0A 5IQIA 1NXKA 4FV3A 2UZNA 4BCFA 2YZLA 3AGLA 3WZDA 3DS6A 4ZZOA 2PZIA 4IWQA 4WBOA 4X0MA 3T9TA 5CSHA 4R78A 4O0YA 3DAEA 4BDFA 2X7GA 2UZEA 2XRUA 3S2PA 2PTKA 2PZPA 4HVGA 2VD5A 3CEKA 3GEQA 3V5LA 2HY81 2YCQA 1IR3A 3EZRA 2E9NA 1KSWA 5DA3A 1BI8A 3SOAA 3F3TA 4QP7A 4L68A 4YTIA 5LARA 1FGIA 2XJ1A 3KXGA 4O0UA 5F4NA 5CANA 5L3AA 2J0KA 3UPZA 2X9FA 3I0QA 3PSBA 4DCAA 4MF0A 1BL6A 2ITOA 5J95A 4X3FB 3D7TA 5EHYA 3IW5A 3G90X 3P7BA 5K4JA 4R5YA 4BCKA 4C4FA 3F9NA 4RFYA 3FQSA 1Z9XA 2VNYA 4WSYA 5HU3A 4C2VA 4NM5A 2PZYA 3BHYA 3S0OA 2ZYBA 2B7AA 4U41A 3QL8A 4NW6A 1YI3A 3W55A 1OZ1A 4BRXA 5D10A 2J0JA 1KE9A 4AS0A 2VTTA 2GNIA 2QOIA 5IQBA 3TNWA 3D9VA 4BI0A 4D4VA 2HCKA 4DFYA 1CKIA 1DM2A 5HD4A 3QKMA 2NRYA 3UODA 2VNWA 4P7EA 5BVKA 5J9LA 2GTNA 2W1CA 4ITJA 4ZS0A 3VUDA 3R1YA 5FXSA 4JJRA 4J52A 5AP7A 3MTLA 1TQIA 4D2SA 4DCEA 1RDQE 2F57A 1P14A 2PVFA 4PL4A 4W8EA 2OZAA 3R2BA 1YOLA 4X6QC 3FAAA 5DR6A 3RTPA 2VTQA 3U54A 4RZVA 4PPBA 3NLBA 4LL5A 3KRJA 1Y8GA 1R1WA 3UQCA 4S2ZA 3BGPA 4RVTA 2G2IA 2CCIA 2DWBA 4AN2A 5FQDC 4GKIA 1SNXA 1MQBA 3Q32A 3SAYA 4BTFA 2G15A 4IAKA 3WE4A 5L8KA 5JFWA 5TF9A 5M4IA 4J1RA 1NW1A 3ALOA 4EWHA 1XBCA 3TNPC 4ZMEA 4I93A 4TWCA 4F9CA 4BKZA 3AD5A 3MB6A 1UWJA 3PJ2A 2YIWA 4IFGA 4MD9E 3IW6A 3B2TA 2G9XA 2QLUA 3V3VA 3OMVA 3ZBXA 4AA5A 4FSWA 3DZOA 4LL0A 1FOTA 3R8ZA 4O6EA 4FKGA 1YHVA 5CU2A 1PRYA 2NRUA 4J53A 1ZRZA 2EVAA 3UIMA 4XH6A 4FIJA 4EC8A 4U43A 2WO6A 3UDBA 4DYMA 3FMEA 4BFMA 1Q3DA 2RFEA 4ALUA 4ANNA 2WZJA 2E9PA 2F2UA 4FIIA 2EB2A 1OB3A 4ZSJA 4EZ7A 3QXOA 4ZK5A 4FTJA 3KXZA 3KXMA 4QTEA 5HTBA 2ONLC 4OT5A 2ZB1A 4RJ7A 3WOWA 3DQWA 3FHIA 4OBPA 3AQVA 5M53A 3RPRA 5LOHA 5D7AA 5M06A 2BDWA 3ZSHA 3KVXA 2XRWA 2UW6A 3H0ZA 5BUEA 1Z5MA 3EFJA 3VVHA 2PUNA 3AG9A 4F9YA 2PU8A 5D9HA 2UZUE 5AV0A 4ZXTA 1OMWA 2CGVA 3QFVA 5BX0A 2EXEA 3OT8A 3JVSA 3BEGA 4BGHA 3BHUA 3PPJA 4X7QA 4ITIA 4QTAA 2BUJA 2X6DA 2YM6A 4Y8DA 4BWXA 2V5QA 5HNIX 4U3ZA 5M56A 3ZDUA 3RVGA 3EQCA 4FV4A 5E8TA 3FXWA 1Q8UA 3DT1A 4AP7A 3TT0A 3VULA 4FC0A 2XNGA 4MWHA 5FTOA 3MA6A 4IJ9A 2WMAA 1CM8A 1QMZA 2GNGA 2X2KA 4MH7A 5KNJA 3AMYA 5IH5A 2OSCA 4NIFB 5JQ5A 3Q4UA 2YERA 4B6LA 3GQLA 2H34A 4UALA 4NTSA 3UO6A 3LFSA 3R8PA 2ZMCA 2XNNA 5KKRB 5CX9A 1WVWA 5ANJA 1XO2B 2IVSA 2V0DA 4QPAA 3IW8A 4FSMA 4RIWB 4I24A 2ACXA 4RC3A 1FMOE 2ITXA 4TL0A 1Z57A 3PIYA 4CFUA 4KKEA 4QYFA 2C5VA 4FZDB 4FYNA 4TTHB 4WA9A 4DINA 4F7SA 5GINE 5CYIA 2C3LA 5DHJA 3RMFA 5L8LA 3QD0A 4KINA 4C35A 2ZDUA 4C59A 3EN5A 3QCSA 4GT4A 4AW1A 5F1ZA 4EI4A 4EYMA 3FMMA 5C26A 4QQTA 3UNZA 2YM3A 4BVUA 3CQEA 3ZMMA 3W2SA 1IG1A 4KSQA 2XM8A 4IEBA 5AJQA 4FEWA 5CAPA 3LPBA 3TUCA 1KWPA 2XNMA 2WQMA 3ZLYA 3TDVA 3HECA 2ZOQA 3WF6A 4AU8A 1U5RA 3ALNA 4ZS4A 1NVQA 2JC6A 2I0VA 4V01A 3U4WA 2IVUA 3OF0A 4W8DA 5E90A 2BZJA 5HZNA 1W84A 2R3NA 4F09A 1OKVA 2GS7A 5EOBA 3NUXA 4X3FA 5CU6A 3BLRA 5CI7A 3D14A 1ZZ2A 3G6GA 2BIYA 2C0OA 3LXNA 3L9PA 3EQPA 4IX6A 2B9JA 1UU3A 5AR3A 3BU6A 5K0KA 5FWKK 2VO6A 5A3XA 2G2FA 4OTDA 4O7WA 5AP4A 1MUOA 3HV4A 4HYSA 4IVAA 4XBUA 3DU8A 1W98A 3OP5A 4UMQA 3V01A 3L8PA 5EH0A 2OF2A 5CWZA 3ZRMA 3QAME 4FEXA 2ITUA 3OEFX 1Q3WA 3GC9A 4U9AA 4EK3A 4IWOA 4DGLC 2GQGA 3TACA 3VS2A 5BVDA 2DQ7X 4F0GA 4CD0A 3SD0A 4GT3A 2VWUA 3NEWA 4HYHA 4HZSA 1Q97A 3ULZA 2PUIA 3LMHA 2R3PA 1G3NA 2W1GA 3EZVA 2C47A 4CFWA 4D5HA 4E3CA 4LRJA 5ANIA 3FEGA 3ERKA 3KA0A 4D1SA 4A9TA 3FLYA 4FOBA 4APCA 5BYYA 3GQIA 3HV3A 5FXQA 3R7YA 4RIYB 4WNMA 1M17A 3GU6A 3FY2A 3OFMA 4DITA 3HRBA 3ROYA 3OCSA 4E5WA 3OTUA 2GMXA 2WTCA 3PA3A 1Q61A 4FVQA 2W9FB 4Y83A 5G1XA 2BPMA 2FH9A 3CSVA 5EW8A 3MA3A 4FSRA 2BZHB 2UW5A 5GHVA 2HY0A 3U4UA 4BYJA 4F9BA 5LVOA 1VYZA 3SHEA 4FKTA 4G3CA 3BBTB 4L3LA 4ANQA 4BCJA 2ZDTA 4L7FA 3Q9YA 4CT2A 4F9WA 2GFCA 3ELJA 3EN7A 3QTWA 3M42A 4UYNA 2G1TA 3MY1A 3PG1A 5CENA 3GCQA 4YPDA 2Q0BA 3FMHA 1H0VA 1A48A 3BQCA 3CGOA 3G2FA 5IQDA 4AE9A 5CF5A 5FBOA 4J99A 4O83A 2BAJA 2R3JA 3BBWA 4ZSLA 4FF8A 3V5QA 3UIBA 3MI9A 2W9ZB 3UBDA 3OUNB 3PRIA 3QZIA 4ONAA 4AN3A 1PMEA 4FKQA 4I41A 2YAKA 3V8TA 5M57A 4GS6A 4R1VA 2JIIA 3BYMA 3LJ0A 4OBOA 5HGIA 5HE3A 2XNBA 2Y8OA 2QU5A 4PPCA 1KUTA 4AG8A 5AUVA 2X1NA 1OIRA 3FI3A 4GIHA 4L3PA 2XBJA 2OW3A 4FKSA 4H3BA 4RX9A 4XG7A 4CGAA 1SYKA 1ZMVA 5I3OA 5CEPA 3A62A 3VRYA 3R9OA 4QMXA 4YHFA 4G5JA 3LCDA 5JEBA 2P33A 1W82A 4BIEA 3SKCA 3AC5A 1Y91A 5FP6A 4NYEA 3I60A 3L9NA 4M7IA 5CQUA 3TV6A 2OXYA 3QQGA 3QD4A 5AIRA 2WMVA 3C4WA 3COKA 3MESA 3ATTA 1ZYLA 4CKJA 3LIJA 4MTAA 4P90A 4X3FC 5GJDA 4DFZE 4O82A 4PMSA 4GK2A 2RL5A 3SA0A 2FYSA 4IVDA 2BVAA 3E62A 5CSVA 2WKMA 2F7ZE 4AOJA 4ZJVA 1VZOA 1MRUA 2ETRA 3FXXA 3O8UA 4TYHA 5CNNA 3VS0A 3GOPA 3MH2A 4KNBA 4YZ9A 3WF9A 1OM1A 1CMKE 2BIKB 4FKOA 4NIFA 2VRXA 4YUQA 3JXWA 5EYMA 3VNTA 4FV6A 5GIPE 3N51A 3PSDA 3RWPA 4CMTA 3G6HA 1Y57A 5KCVA 4RIWA 3ORXA 3ORMA 3S3IA 1XH5A 2OLCA 4IAFA 3WF8A 1XH9A 3EQIA 3NUUA 2PY3A 4E93A 3MVHA 4QD6A 4QTCA 5TOZA 5AR7A 3DK6A 3S95A 2I0YA 1YW2A 1PKGA 5ITAA 4LGDA 4QPMA 3L8VA 4RVLA 4CV9A 1ZLTA 4PP9A 1SMHA 3F3VA 1LPUA 4DGGA 4L00A 4O7RA 3O23A 3FZSA 3GCPA 3R7GA 3WYYA 3TCPA 3R28A 2YJRA 5CEQA 1M14A 3HA6A 3V5WA 4HVIA 4NEUA 2CKPA 4CZTA 4LGHA 4RWLA 2R3MA 3I6UA 3RCJA 2JITA 3NYOA 4YPSA 3TNQB 4O7VA 1STCE 5AWMA 4FTUA 5HE2A 5IF1A 4ACGA 2VTAA 3D2KA 4USDA 4K8AA 5I3RA 1WMKA 4IB0A 3NS9A 4N6ZA 4QMWA 4BCHA 3QZHA 4V05A 2YLFA 3R7OA 5E9EA 4FOCA 4GSBA 5CT7A 2BR1A 5IEYA 2WIPA 2JFMA 4QP1A 4KIKB 5B2MA 1PXOA 4BDGA 3BEAA 3NNWA 4EOLA 3PXFA 2UW9A 2BDFA 4EBVA 5DGZA 4FSZA 5A6OA 2JAVA 3NUNA 3G51A 5DOSA 2H8HA 3V8WA 2C68A 2LGCA 4L45A 2Y0AA 1ZYCA 4ZTSA 2OKRA 5EHLA 2UW0A 3H4JA 3MH3A 3OEZA 1FPUA 4OT6A 5HNBA 4AACA 4OAVB 3KU2A 5LQFA 3DXPA 2XKDA 3EB0A 3L9MA 4I1ZA 3V51A 1NVRA 1OGUA 2X8EA 3FMKA 2WD1A 2XNEA 4FKUA 2RFDA 2BFYA 3DDQA 3WZJA 4Y5HA 3E92A 3DBDA 4E5AX 2GFSA 3O8TA 3O71A 3UYTA 4E73A 2A27A 2GS6A 4AT5A 1MP8A 4OTIA 4RIYA 2C3KA 1JKTA 2I40A 2WQNA 1R0EA 1H28A 2PVYA 1WCCA 3DA6A 4PDPA 4PX6A 5ANKA 5HG5A 3NW6A 1PXIA 1E1XA 2PL0A 3UIUA 1ZMUA 4LQMA 3ZH8A 2OJ9A 5IISA 2CGWA 4ZTRA 5CF4A 3H10A 5E4HA 3FL4A 1A06A 2V7AA 4DEDA 3PP0A 5E1SA 5AP2A 5D11A 3CS9A 3DOGA 5TR6A 3T8OA 4ERKA 1JNKA 3BIZA 3PXYA 2RGPA 3O50A 3W32A 4DG3E 4BHZA 1G8AA 2YWVA 1GAGA 4NTTA 4ZLZA 4FL1A 5HG8A 5A9UA 3L1SA 3OCTA 5DBXA 4G3DA 3TZ9A 3IS5A 3QLFA 5LWMA 4O6LA 4BDJA 1F5QA 3NIEA 4DGMA 3JS2A 2GTMA 5J7HA 1PW2A 5HVJA 4KKHA 2R3GA 4NH1A 4YNOA 1YXTA 5CF6A 2C4GA 4A9SA 4BI2A 4DBXA 3F7ZA 3VUKA 3A99A 2WOTA 4QYYA 4AT4A 1FINA 5TKDA 4CFVA 3F66A 4ARKA 3UNJA 1AD5A 3C0GA 2CKOA 3MBLA 4FSUA 2BROA 5ANGA 5EOLA 3BV3A 4UZDA 2IW6A 4ACDA 3Q5ZA 5K9IA 3IK3A 5KX8A 4QMOA 4TY1A 2YM7A 4II5A 4A06A 4F99A 1FVTA 4BZOA 3GI3A 3HDMA 4DT9A 3LOKA 1YHWA 2H9VA 2V22A 4FTLA 4CNHA 2ITTA 4K1BA 3Q96A 3W2OA 3R22A 2PE1A 3Q9ZA 4M3QA 5DYJA 1ZYJA 3R1QA 4K6ZA 2CNUA 2CLXA 4FKRA 3ACJA 3GP0A 4TN6A 4F1OA 1M2QA 4IH8A 2OIBA 3BI6A 2C6OA 1TQPA 5I9UA 4R3RA 1UKHA 4ZZNA 2W7XA 1UKIA 3KC3A 2BKZA 1RW8A 4JOAA 4YMJA 2XIYA 4W9XA 4AFJA 2C6DA 3KN6A 5KMLA 3OXIA 4K9YA 1K2PA 4DH5A 4RWIA 4FZFB 5JRQA 4K11A 2ITQA 4HOKA 2ZB0A 3FI2A 2PWLA 2FSMX 3R04A 1R0PA 3Q3BA 3ZC5A 4DH1A 4J97A 1FMKA 3BE2A 3KK8A 3LMGA 4NW5A 3FZRA 3F61A 3JPVA 4CQEA 4EOSA 5IA4A 2OF4A 1OKYA 4FIHA 4C3PA 5IUGA 3E93A 4HPUE 4JLCA 2PSQA 2NPQA 3BHTA 4GJ3A 3NWWA 3VUIA 3K5VA 2RIOA 4FT3A 5M08A 3BYSA 1P2AA 4MQ1A 4DBNA 4W4VA 1UWHA 2P0CA 4X2JA 4R5SA 3F2AA 4OGRA 5CASA 3QQFA 1PYXA 3LJ1A 2IWIA 3KXXA 4AGUA 4EHZA 3QU0A 5A14A 4QOXA 3VBWA 3AT4A 2J5EA 4QTDA 3EQRA 3TJCA 3LFEA 4L44A 2WQBA 3FKOA 3KL8A 5F94A 3DKCA 3RALA 2ITPA 5C8KA 4EZ3A 4FVPA 5GIOE 3WILA 2GPHA 3K3IA 4RX8A 4QRCA 5ETFA 3RP9A 5EFQA 5EYDA 4WT6A 4HGSA 4HYIA 4IVBA 3QWJA 3ZRKA 4M97A 5CLPA 5CZIA 4ZLOA 5J8IA 2XYUA 3LXKA 5LMAA 5I4NA 4O81A 3F2NA 5ACKA 5HIDA 4QMTA 4KIKA 3V5JA 3P08A 4M0ZA 4FL2A 4F1TA 4QP2A 4FGRA 1CSNA 4YJNA 4Q5EA 5IQGA 1GZNA 3MGYA 1WVXA 1XH6A 3Q52A 2IW9A 3OCGA 3AC8A 2O0UA 3CJFA 3DCVA 5EI2A 5FP5A 2UVZA 4UWCA 2J9MA 2P2HA 2OJFE 3R8MA 4O27B 3JR1A 2BRNA 1SVEA 2QOHA 3ZLWA 2OU7A 3HGKA 1VJYA 4IANA 2BAKA 3GUBA 3FY0A 4HPTE 1Q8ZA 1LR4A 1Y6BA 2JDRA 4M69B 4U97A 1OIYA 5HO7A 2QLQA 4CLIA 1PKDA 3OBGA 3BWFA 1YKRA 3C7QA 4QP3A 2XKEA 2AUHA 5HCYA 5AP6A 5DN3A 4ZTQA 4BCNA 4YP8A 5KMMA 1Y8YA 2X2MA 4GFMA 4PMTA 2J4ZA 4IB5A 3OCBA 4C61A 4EONA 2ETKA 4MXCA 4CKRA 4LV5A 2PHKA 2YFXA 4QO9A 3ZO4A 1YXXA 5EDQA 2OIQA 5L6OA 1FVRA 3F5GA 4JR3A 4FICA 1B38A 1CKPA 4WO5A 4ENXA 2JD5A 3A7IA 3NNUA 3RHXA 4RT7A 3VAPA 4R8QA 3QQHA 5LVPA 2I1MA 3PZHA 1W83A 3C4ZA 4ZMFA 2JEDA 4F0IA 2YIYA 4G6OA 4FKVA 4GW8A 4XG8A 4E6CA 4QMVA 3FMDA 3PG3A 3UGCA 4BY9E 4M12A 2ONLA 5GZ9A 4UX9A 5CAOA 3Q4CA 3I4BA 4UV0A 2XYNA 5IQEA 4JG7A 3E88A 3W16A 5BVEA 3WIKA 2DS1A 4YLJA 4UY9A 3HDNA 4WBBB 4XS2A 3Q9WA 3BELA 5CU0A 1K9AA 2PK9A 2IO6A 4JQ7A 4NKAA 3WZUA 2CKQA 4IAZA 4FBXA 3LVPA 1UV5A 2GNHA 3OT3A 3RAKA 1UNGA 3F3UA 3ZYAA 5CF8A 3NDMA 4AZVA 1YHSA 3BU3A 4DTKA 3GENA
chains in the Genus database with same CATH superfamily
4XOZA 4C4GA 5ICPA 2UVYA 3U9NA 3ET7A 1ERKA 2O63A 4LFIA 4FTNA 4PL3A 4YZDA 3OXTA 4M68A 3UTOA 3ZHPC 4C38A 2VWIA 3FC2A 4O91A 4EOMA 3O2MA 3VN9A 4O86A 3VS7A 2BFXA 3AOXA 3GGFA 5AV1A 2BTSA 2BRHA 4IQ6A 3O7LD 2YDKA 5DH3A 3AXWA 3ITZA 5M4FA 2VWZA 3Q4TA 3MJ2A 5FM3A 5HD7A 5LVNA 2XK9A 4ZSGA 4A9UA 1M52A 2VO0A 4KBCA 4BGGA 4MUQA 5C8NA 4DDIA 2WAJA 5E8WA 4R7HA 4H1JA 3C5UA 4FMQA 4TW9A 3LFAA 1P4OA 3R02A 5J9YA 3LM5A 4BDHA 4J98A 4BTMA 1XMMA 1OGYA 5H8BA 3C4CA 1WBNA 5DRDA 3RCDA 3W0QA 1H01A 5CVHA 3CKWA 1PMUA 5HLPA 3ML1A 2WMWA 3P7AA 1XMLA 2B55A 1REJA 2JIVA 4YZBA 2Z7LA 1BMKA 4UMRA 4C62A 4F78A 3SV0A 3FHRA 4F6SA 3BYVA 4Y73A 4M67A 2WTDA 1BYGA 3VBTA 2X9EA 2X8IA 1J7UA 4I5HA 1FBNA 2QCSA 1H24A 4O0TA 4YU2A 5AR2A 2ZMDA 1XWSA 2R0UA 4A4OA 2ZV7A 3VBQA 2VWBA 3GCVA 3NNXA 2QOFA 2XH5A 2YACA 4MD8E 5I9YA 1IASA 3GB2A 3N4VA 3TUDA 5AM6A 3UZTA 3LCOA 3R8LA 3ROCA 5A4LA 3MVMA 3UO5A 3LLAA 5HEZA 3UO4A 3LXPA 4O22A 3ZONA 3EIDA 5H9BA 4MF1A 3IECA 1PXPA 2XUUA 2A2AA 2PVNA 3P79A 4MNFA 3AD4A 5IA2A 1Q8WA 3MW1A 2GNFA 3F88A 3O8PA 5KMKA 4HW7A 4MXXA 4O2ZA 5E8UA 4FTMA 4QMNA 2BALA 4IC7A 5DPVA 3FJQE 3HX4A 4AXCA 1YDRE 2EXCX 4H3PA 5BVFA 3CY3A 3MJ1A 4AE6A 5LWNA 5LVLA 2IZRA 3UOLA 3DKFA 3WZEA 2QO7A 3EWHA 4E7WA 4PP7A 2OO8X 4GCJA 2QO2A 4RVKA 5AAFA 4D0XA 4NKSA 4EOJA 5A4CA 3GCUA 2YAAA 4FT0A 5KMNA 3C4EA 3UOJA 1ND4A 5H3QA 4F08A 4D1ZA 1I09A 4G6LA 5ETCA 4ZTHA 3EFLA 4CCBA 2OBJA 4I5CA 5IQFA 3KKVA 3E8EA 3TN8A 4FYOA 3P23A 5AA9A 4PDYA 4LM5A 5J87A 4ENYA 3KIOC 3CGFA 4FKLA 4YSJA 2HZIA 2VTIA 4EC9A 5HBJA 3W0OA 4D55A 2Z7QA 2A0CX 2YABA 3KRRA 4CZUA 4EQCA 3DBQA 3ZM9A 1OL7A 1XBBA 3VW6A 4M69A 4G16A 2XMYA 4ZY4A 3NR9A 1KE8A 3KEXA 3DZQA 3G0EA 4IB3A 2ITYA 1TQMA 3A61A 3EL7A 2WMSA 4NSTA 4RJ6A 3CLYA 3DV3A 3G9LX 4IM2A 3TJDA 5AX3A 3ZUTA 2QVSE 4B4LA 5KO1A 3MFTA 1JSTA 3EFWA 2B54A 1JKLA 4KIOA 2J7TA 3GU8A 4FIEA 2XB7A 4TYHB 1YOMA 3DNDA 4MXOA 4LRKA 4HYUA 5HE1A 3LKMA 2B9HA 3F3ZA 3DAJA 4PNIA 4ANMA 3U6IA 3F5PA 5HHWA 4FT5A 3QKLA 1YXUA 3FPQA 1WBOA 3OHTA 4HGLA 2VGPA 4BBMA 4EH9A 5TO8A 5JFXA 4AAAA 4K0YA 2F7XE 4FZ7A 3UG1A 2X0OA 4MBIA 4XCUA 4FIGA 4BYIA 1R3CA 4EKLA 4HJOA 2XS0A 1OPLA 4FUXA 3R9NA 3GNIB 3LMIA 3EQFA 4FK6A 4PWNA 3UPXA 4EJNA 1Q5KA 1OECA 2YN8A 4EWQA 5EI6A 2WFYA 2BAQA 3KVWA 1W2CA 1YWVA 4Y72A 3ZLSA 3ORTA 4XV1A 4C02A 3FQEA 5B2LA 4GV1A 2HOGA 4QP4A 1H0WA 4V04A 3G15A 3KQ7A 3QTUA 2AEGA 1O6YA 4PPAA 2H6DA 4QNYA 4XX9A 1X8BA 3FLSA 3G9NA 3MTFA 5KZIA 3Q9XA 4L53A 1FVVA 2QKRA 4NJDA 5JFSA 5JN2A 5TT7A 4EEVA 2FGIA 5AX9A 3D4QA 4MEDA 1E9HA 4BC6A 4XP0A 4FTAA 3VIDA 3DJ7A 3VJOA 4UMPA 4F64A 3JY0A 3CCNA 5A6NA 2V62A 4X3JA 2QOQA 5M51A 1JBPE 2YHVA 2VTHA 3D7ZA 2CCHA 4N57A 4U5JA 2XIZA 3FKNA 4I6QA 5FLFA 4WG4A 4BWKA 5HLWA 5HQ0A 2WB8A 4QMUA 2XEZA 2XF0A 3R9DA 2A1AB 3ORKA 3PJCA 1XKKA 3D83A 4U3YA 5DT0A 2UV2A 3II5A 4LRMA 5HO8A 3LQ3A 4F4PA 3LFFA 3S4QA 3EQHA 2GQRA 4EH6A 5M55A 4YBKA 2JKOA 2BDJA 3T9IA 4PMMA 2VX0A 1XH7A 3REPA 4GG7A 3CIKA 5HCXA 3V04A 1WBPA 3DKOA 4LUDA 4EOKA 3R6XA 1ZWSA 3UVQA 2W06A 3FLQA 3QHRA 4C34A 3HAMA 4O7NA 2JDSA 2PVLA 3PIZA 3CY2A 3VO3A 3NMUF 2P3GX 2VTRA 3PJ1A 1JKSA 1DAWA 2WNTA 5JGDA 3RK7A 4AXAA 4S34A 4YTFA 2HAKA 3Q2JA 1OIUA 3NUPA 4G3FA 3HRCA 2C1AA 1M2RA 2JKKA 3A60A 4JL9A 3UC4A 3CR0A 4DG2E 1NY3A 3DLSA 2GDOA 3ZSIA 4YZCA 3ZO1A 4R7IA 5DEWA 3NNVA 2C6LA 3R30A 4XLIA 4C2WA 4D28A 3ZXTA 3CD8A 3QC4A 3RK9A 3RHKA 4EL9A 1OBGA 4X2GA 4RVMA 4D4YA 5FBNC 2X81A 2J51A 3ZEWA 1OUYA 4FEVA 4C58A 5CXHA 4CRSA 2YJSA 3LFBA 2XANA 4PDSA 4U0IA 5IDNA 4O7SA 4WUAA 5DNRA 3KMMA 5DEYA 4RIOA 4F7LA 4YC8A 4GG5A 5CEIA 4H05A 5AAGA 4Y46A 4QQCA 4S30A 3DJ5A 4DEIA 2Z7SA 3EN6A 3Q2MA 4IZYA 5HBHA 3PRFA 2EWAA 4R1YA 5EYKA 5T3QA 4BDDA 1GZOA 3C1XA 2UZDA 2X2LA 4FV1A 2YEXA 4J71A 3HMPA 4YTHA 4ZY6A 5LMKC 4RJ5A 4C3FA 2XEYA 3CKXA 4GK3A 4FSQA 4FI1A 2QHMA 4CYIA 3E3PA 3MIAA 3FMJA 3OWJA 3AC4A 3FI4A 3Q4ZA 4MBLA 3PPZA 1FGKA 3BHHA 3E64A 4IZAA 4LOPA 4XYFA 2Z7RA 3H9OA 1G8KA 2E2BA 2YLEA 3DXNA 2CGUA 2FVDA 3ZOSA 2GHMA 4E4LA 1J7LA 5C4LA 4JRVA 5JZJA 2CN5A 2YITA 5KBQA 4IZ5A 1PJKA 2HW6A 2VN9A 5AM7A 5AP1A 5J1WA 1ZYDA 1SM2A 4M13A 1URWA 4O4BB 4AZTA 3NVKI 2YCRA 3U51A 5IU2A 4ASZA 4GVAA 5KZ0A 3UVRA 4NL0A 3D2IA 3VC4A 3QTQA 1PXKA 3W0MA 4ZP5A 1WBWA 5F95A 3ZS5A 3T3VA 5AUTA 4TT7A 4BCMA 2XNPA 1PXMA 2HZ0A 2SRCA 1J1BA 3TXOA 4CG9A 2C5OA 4NWMA 4NZWB 1U59A 4TNBA 4Y95A 4ANBA 2CMWA 4YJQA 3IONA 4W4WA 3AMAA 1UVRA 5C03A 1VLRA 4ZJJA 1J3HA 2PVKA 3R1SA 4O0WA 3ZU7A 3OXZA 2R7IA 4B7TA 5IQCA 4AUAA 2WTKC 3QHWA 4LGGA 3U6HA 5G6VA 2HXLA 3DGKA 2A4LA 2P55A 3A7FA 4DEAA 2XM9A 4AXDA 4CFFA 3KRXA 4GK4A 4GT5A 4O38A 2IPXA 1P4FA 3TIYA 4JDHA 4AGWA 1MQ4A 3CPBA 3EHAA 1I44A 3TV4A 3QWKA 1Y6AA 2GNLA 3NW5A 5DR2A 3VS4A 2QHNA 3CC6A 2WELA 4G9CA 4EOIA 5LVMA 4O1PA 5L2IA 4O7TA 4RA5A 2JBOA 2VTJA 2XA4A 4O4DA 4G9RA 4V0GB 3PFQA 5ANEA 1XJDA 4KS7A 5CEKA 4DFUA 2ESMA 4J95A 4OTHA 4KSPA 4C57A 2BTRA 3I1AA 4H36A 4YJPA 4XNEA 2XKFA 4HGEA 3HP5A 3KMUA 2QU6A 3ZBFA 3D5VA 3ZC6A 2BRBA 3DAKA 3FYKX 4BCPA 3QQUA 4CEGA 2CLQA 3GVUA 5KMJA 3DB6A 4YTCA 3QUPA 3RJCA 3VQUA 2QODA 3LAUA 4WUNA 3ZZEA 3V8SA 3FZTA 4FTIA 2WQOA 1OBDA 4OTRA 1M7QA 3R7VA 2JDOA 4P5ZA 3UMXA 4C4EA 3ID6C 5M4CA 4MCVA 3TV7A 4ANLA 4UMTA 3AKKA 4L52A 1UU7A 4H1MA 4IM0A 3VBXA 1DI8A 3ODYX 4RJ4A 2WEIA 2OH0E 3E5AA 5FDPA 1NVSA 4R3CA 1AGWA 3BU5A 4PL5A 4RWKA 2YWPA 3FV8A 4QMQA 1YDTE 1H00A 5E7RA 5IA5A 2C5YA 3O7LB 4NCTC 4DTBA 5C27A 3QRTA 1JVPP 2YDIA 3IOKA 5T6KA 3HA8A 3C9WA 4JIKA 4IVCA 3LW0A 4F7NA 3NX8A 4FV5A 2YIQA 4Z7GA 2ITNA 4CXAA 5E92A 4F65A 5EM7A 3OOGA 1GOLA 1S9IA 4Z55A 5AR4A 5HCZA 3DBCA 3ODZX 5KMIA 4NM7A 5HVKA 3W0NA 4ZLYA 2O5KA 3JYAA 3HUBA 4I4FA 5CI6A 3R21A 4B9DA 2B52A 4D2TA 3Q04A 3VUTA 1OUKA 3R9HA 3ZZWA 3BL9A 4N6YA 4ASXA 3QTSA 5IQHA 3QLGA 4FV8A 5JMSA 3G33A 3I5ZA 4FTTA 5IMXA 4E4XA 3C0IA 4IE9A 4RLLA 2ZM1A 2FSTX 2IZUA 4FSYA 3HMNA 2PZ5A 2XIRA 2AYPA 3NAYA 4JDJA 3GU7A 2RFSA 5IQAA 4OR5A 5L4QA 4DT8A 4FNYA 2AC3A 4FKWA 4RJ8A 3EJ1A 5I9ZA 4YJOA 3D5XA 2Z60A 4DN5A 3PTGA 4KKGA 2OGVA 5C01A 4D4SA 3UP2A 2WGJA 5FEEA 1WAKA 3GBZA 5FD2A 4IWDA 3UIXA 3UOHA 2F9GA 2GSFA 4M84A 4PTEA 3HV6A 5K3YA 4C3RA 3HV7A 4IADA 5CTPA 3TKHA 2HYYA 2WIHA 3ZXZA 4CLJA 5DG5A 2XK4A 3KCKA 4A9YA 1BX6A 3B8RA 4DAWA 4KBKA 4R7BA 4YO4A 5DT3A 4ID7A 4YC6A 4IZ7A 3ORNA 4DEBA 2BRGA 4PQNA 5KMOA 2RF9A 1LP4A 2VUWA 5CEMA 1H1PA 1FQ1B 3EQGA 4I0TA 2BKKA 2QD9A 4I20A 3Q5IA 4F6UA 4Q2AA 2HIWA 3BLHA 3MVJA 1YXVA 2OG8A 2PUUA 3VUHA 3LJ2A 5K0XA 4FNXA 4E6QA 3NFFB 3DLZA 5HX6A 2OICA 4JDIA 3MIYA 3GC7A 1ZAOA 3FZOA 5DVRA 5JGBA 5LJJA 2W4KA 5GZAA 3B8QA 3OWKA 4G6NA 1LUFA 4JIAA 4EOOA 4M15A 5EG3A 1OITA 1UNLA 2HWPA 3H30A 4FTCA 4GJ2A 5GJFA 3Q6UA 3ORZA 4C33A 4L9IA 3KRLA 5BUIA 1OL2A 4EH8A 4WRSA 1APME 4R6VA 4U80A 5J79A 4DDGA 4CQGA 1ZZLA 4BTJA 4AOIA 3COIA 4S33A 1TZDA 3RPOA 3K5UA 4FG9A 1GNGA 5DRBA 2WXVA 3A8WA 4J96A 5AR8A 4Y85A 2HW7A 1KE6A 5AUXA 1XH8A 1YXSA 4C4JA 4YURA 2X39A 2UVXA 3RAWA 3SC1A 2QOKA 3BWJA 3KN5A 4DE4A 5EQPA 2G2HA 1BKXA 4HZRA 3FBVA 3NSZA 2ZJWA 3VWAA 2C6IA 2WOUA 3C0HA 3HLLA 3MPAA 2IJMA 2IZSA 3E7VA 4I3ZA 4KABA 4WNPA 3DK7A 4NK9A 3EH9A 4EH2A 4ERWA 2JDTA 2FA2A 4GH2A 4RC4A 1XBAA 3GC0A 5CU4A 5IDPA 2W99B 1H08A 2QOBA 3R83A 2B4SB 4I23A 5IH6A 2JKMA 2VWVA 3HMOA 2XKCA 2CHLA 4M0YA 4BKYA 4BDBA 4U8ZA 3NIZA 5D12A 4ASEA 3MPMA 4YJTA 3PWYA 1UU8A 3R1NA 2KULA 4RX7A 2VWWA 4V0GA 4JX7A 2O64A 2UW8A 4EK5A 3MS9A 4FSTA 3H9RA 4LMNA 1U5QA 1V0PA 2C69A 3IG7A 4Z3VA 4XG3A 4CKIA 3ZUVA 3KXNA 5AMNA 1QPDA 4L46A 3F2RA 4ALVA 4G3GA 3DDPA 3PJ8A 4U40A 4G31A 4L8MA 3C13A 4FR4A 3UYSA 4RLKA 3QQLA 3QRJA 5E8ZA 3E87A 4QP8A 3RKBA 2ZVAA 2Y4IC 2Y7JA 3FMNA 4XG9A 5HG9A 4ZZMA 3RZBA 5BQ0A 3QGWA 4EH3A 1ATPE 3PLAE 4C4HA 4GFOA 4ZEGA 4IX4A 3MY0A 3TWJA 1IA8A 3ZDIA 4AT3A 4HNFA 3BYUA 4ALWA 3I5NA 2X4ZA 3MH1A 4FV2A 3MFUA 4IWPA 4IC8A 4Z7HA 4QMSA 2W0JA 4MAOA 4QQ5A 3I81A 5D1JA 1H8FA 4JAIA 4DFBA 3K54A 4QMPA 2WMUA 4RRVA 2UW4A 4ZAUA 3EL8A 2RG5A 5DT4A 3PA4A 4E6AA 4GU9A 3MVLA 3P9JA 2VX3A 2Y6OA 3DBFA 4PTGA 4YO6A 5AP0A 2W1ZA 4P5QA 4CV8A 5A54A 4MQ2A 4F63A 4FEUA 5AUZA 3PJ3A 3LM0A 3ATSA 2VWYA 3P1AA 4I0SA 3M11A 1A9UA 4EH7A 4DFXE 3VUGA 3A7JA 4W4YA 3VBVA 1QL6A 3DPKA 1GJOA 2ZV2A 3QD2B 4FTKA 4JXFA 4XV9A 1XH4A 4JX3A 5AV3A 3TL8A 3FSKA 4I92A 3H9FA 2ITWA 4WNOA 4XP2A 1OL6A 2Z8CA 3ANRA 4U79A 2PUPA 1Q62A 5EM8A 5HICA 1YWRA 3C4FA 3LE6A 4O4CA 4FA2A 2R2PA 4C7TA 5CNOA 4B8MA 3IO7A 4FZ6A 5EKOA 3LQ5A 5B0XA 4DHZA 3SXFA 3SXSA 4LV8A 4W9WA 4U44A 3KREA 3DB8A 1UNHA 3ETAA 2WTJA 4XRLA 4AZFA 5BVNA 4RG0A 3VS6A 3QQJA 4ZSEA 3P78A 1WBVA 3PP1A 4GMYA 4QYGA 3SG8A 3QCQA 1M7NA 4RJ3A 3PWDA 3UOKA 3SW7A 3TUBA 3UQGA 4XV2A 4G2FA 5IA1A 2PVRA 4F70A 5ANOA 4UXQA 2IVVA 3RNIA 2UZVA 3KFAA 3GXLA 3OY3A 3P4KA 3WF7A 4CTCA 5BVOA 2Q83A 4O7ZA 3PXZA 3TKUA 3R9RA 3UDTA 2C0TA 4YZNA 4TYIA 2R64A 4UB7A 3EFKA 3HMIA 4Y5QA 1O9UA 1VEBA 3EKNA 3FLZA 5H8GA 3TNIA 1LEZA 4C37A 3E3BX 1YVJA 3PZEA 2W05A 3UMWA 1P5EA 1BLXA 3ACKA 3PVBA 4TPTA 1PYEA 5E8XA 4JDKA 4B99A 2OXDA 4EOQA 4XOYA 5JQ8A 3LCTA 5FUTA 4FNWA 3M1SA 1H07A 4EH4A 3OG7A 4MKCA 3RPSA 4AZWA 4C0TA 2W1IA 3WZKA 1YRPA 3VS1A 4EQUA 5HLNA 4UBAA 3U8WA 3ZO2A 4APPA 2FSOX 3CTHA 4XMOA 2R3RA 2J6MA 5A4QA 2QI8A 1Q24A 2IZTA 5GNKA 3PSCA 1OKZA 4USFA 2HENA 4AW0A 2OIDA 2PVJA 2WU7A 4GYGA 3NYNA 3HEGA 4FT9A 3RI1A 5L2SA 4QP6A 2NP8A 2VTOA 2Y4PA 3EYHA 3F69A 4LOOA 3W2RA 4RC2A 2LAVA 2OJGA 3HUCA 3UE4A 5CEOA 1OIQA 2JLDA 3R7UA 3S00A 3CP9A 3PE2A 2QNJA 4IXPA 4L01A 2NNWB 1VYWA 2WTKB 4O21A 5HI2A 3AT2A 2XCHA 1UA2A 2PPQA 5CSWA 2BMCA 4GUEA 1H1SA 1GY3A 3PUPA 1J91A 2O65A 4MXZA 4NT4A 4OLIA 3BGQA 4WHZA 1IAHA 5EQEA 4DC2A 5C8MA 3A7HA 3N4UA 2X0GA 5HOAA 3R0TA 1SZMA 3QYZA 4MXYA 4H3QA 3TMOA 4FG7A 3L8SA 1WVYA 3UDZA 3DKGA 2XK7A 1J7IA 3IOPA 4TYEA 3CQUA 3W10A 3POOA 5K5NA 2C3IB 1OPKA 4ZSAA 4QDVA 1DI9A 3OZ6A 4JVGA 3IW4A 2XK8A 2C6EA 4C4IA 4DGOA 1H1WA 3PXRA 3D5UA 1O6KA 3TIZA 4BCOA 3R8VA 3RM7A 3TZ8A 4YJRA 3OWLA 3PY1A 3DQXA 4IX5A 4LMUA 1R39A 3FLWA 3DY7A 2PMOX 3D5WA 3E8CA 3SDJA 3DK3A 3F3WA 4D9TA 1H25A 2R5TA 3V5TA 4CMUA 3I7CA 3U9CA 1M2PA 5L6WL 2F4JA 5HO6A 5BMSA 1KOAA 3DTCA 1U54B 4LI5A 4XLVA 2YIXA 4I94A 4BIBA 4WG3A 2W5AA 1YI4A 4F1MA 4IJPA 4MX9A 2HZNA 3SX9A 3AC3A 3OVVA 3GOKA 4YLLA 2E9UA 2F49A 1BL7A 4FEQA 4OTWA 3RZFA 5FRIA 4JBQA 3ZTXA 4I6HA 1DAYA 1JOWB 1QPJA 2F7EE 5HVYA 1KOBA 4RFMA 4IACA 2HWOA 4U7ZA 2EUFB 4FV9A 3QQKA 3P0MA 4I5MA 5BMMA 3AT3A 3BLAA 3R73A 1GIHA 3JUHA 3QYWA 4I21A 2CJMA 2YDJA 3FL5A 3QF9A 5CQWA 2FSLX 4E4NA 5AA8A 3FMLA 1QPCA 2XK3A 1KE5A 2ZV8A 4A9RA 5AUUA 5BYLA 3QXPA 2WMQA 3WYXA 1H4LA 2CNVA 3Q60A 2JDVA 1ZARA 4PUZA 3UZPA 4AWIA 1G8JA 4AOTA 1Q41A 2E9VA 1H27A 4JS8A 4QNAA 3VF9A 3TZ7A 3EMGA 5IH4A 3PY3A 4O84A 2B9IA 2OWBA 1CKJA 3R63A 4K2RA 2I0EA 2YZAA 4QYEA 3RPVA 2W17A 4O4EA 4QYHA 1ZY5A 4AQCA 4FTOA 3P86A 3RAIA 5JKGA 5IUIA 2Y6MA 4EOPA 4HGTA 1HOWA 3FWQA 4FX3A 4NU1A 2BZKB 4FODA 3KF7A 3COMA 3TZMA 2PE0A 5IEVA 3V6SA 3PYYA 5C4KA 4AFEA 4S31A 2ERZE 3ENMA 1VR2A 4UXLA 5K5XA 3MWUA 5HIBA 5A4TA 3H3CA 4TNDA 5CU3A 4AGCA 3CJGA 5AADA 3A4OX 2R3KA 1CTPE 5I9WA 3BX5A 3HRFA 3EQBA 2J0MB 3PVUA 4L6QA 4A4LA 1ZOHA 4OAUC 2PULA 2QR8A 2J0IA 2QC6A 3SW4A 2XBAA 3VRZA 5EQYA 2W5HA 4QTBA 5BUJA 4WSQA 5LXMA 1WZYA 4OUCA 3MSSA 2UZBA 4YNEA 2R3IA 4XBRA 4BF2A 3I6WA 3VONA 5JFVA 2XIKA 4IMYA 1W0XC 4GKHA 5B7VA 2OH4A 2YCFA 3PVWA 3I0OA 1XHAA 5LMKA 4L7SA 2BHEA 5KHWA 2WPAA 5FTQA 4HVDA 4Q9ZA 3E7OA 3L9LA 4MXAA 2EB3A 3MYGA 3ZFMA 2BILB 4EZ5A 5I9XA 3KGAA 3G0FA 4DF3A 2I0HA 4U6RA 5IEXA 2O2UA 5ANDA 4CSVA 2JGZA 4FV0A 4EBWA 4I6FA 3PIXA 4FNZA 2VTNA 4FL3A 4M8TA 4WNKA 4ORKA 1H26A 3FPMA 3LCKA 5EW9A 2W1EA 2GNJA 2O3PA 2YM4A 4PF4A 3KB7A 2QO9A 5E8SA 5F20A 3FE3A 3ZFYA 4FTQA 4AQKA 2I6LA 4BIDA 5H2UA 4BI1A 4CG8A 5HKMA 5GJGA 2C30A 1B6CB 1ZXEA 1W2FA 1RE8A 4UZHA 4BL1A 4G1WA 4L43A 1JSUA 4DGNA 5JSMA 2IG7A 3NW7A 4X2FA 4A4XA 3BCEA 2XVDA 4EK8A 2ZM4A 3N4TA 1QPEA 5EM5A 3FC1X 4DLJA 4MD7E 4BDAA 2BRMA 2Z2WA 4ACCA 3TM0A 4ZY5A 3AC2A 2CDZA 1QCFA 3F5XA 2WMRA 5IZFA 3PUFC 4Z16A 2OI4X 4ZOGA 4YZMA 2VGOA 4DH8A 4AGDA 4BWPA 2R9SA 2RFNA 3W2QA 4K33A 5DR9A 1HCLA 1YI6A 2DUVA 3QZFA 3ULIA 1NT2A 2BHHA 3RK5A 5T68A 4FV7A 1ZMWA 2XK6A 3EKKA 3CTQA 3R01A 5FTGA 1SVGA 3WIGA 3NRMA 1G8SA 4EORA 2OFUA 2AC5A 2H96A 1V0BA 2NO3A 4RQKA 4JNWA 3PXQA 5H8EA 4LV7A 2CSNA 3IKAA 2JBPA 3MV5A 4KRDA 3LCSA 5IA3A 1OL5A 4OTPA 5J9ZA 3SG9A 4O0XA 5EDRA 1OI9A 4CT1A 3QCXA 4IDVA 4K77A 2R3OA 2CKEA 4RMZA 5IG1A 2ZV9A 3EOCA 4BGQA 2QQ7A 3ZM4A 2CPKE 2EXMA 3FZPA 3PA5A 2UZOA 3QTZA 3COHA 3WF5A 4A7CA 4PV0A 3SGCA 1OVEA 4RPVA 4UYAA 2JAMA 4TXCA 4FZAB 4BZNA 1K3AA 2VWXA 5L8JA 2Y4IB 4X21A 4XEYA 1XR1A 3KMWA 4G5PA 3VHKA 4HVSA 1OPJA 4IDTA 4J7BA 2ITVA 3BHVA 4I22A 4EHVA 3O17A 4JQEA 5FEDA 1U54A 3V5PA 1YQJA 4DLIA 3QA8A 4QQJA 5L6PA 4XRJA 1W8CA 5E1EA 4JBOA 2G01A 3CPCA 3NZ0A 4E8AA 4EUUA 2WTIA 3QC9A 1IRKA 3GCSA 1H1QA 1KV2A 3GU5A 1PXJA 3L8XA 4K18A 4E4MA 4MNEB 4CTBA 3FYJX 4EK4A 3Q6WA 4IM3A 2R4BA 5JGAA 4IHPA 4NCTA 3CD3A 4QT1A 3RPYA 1JLUE 3WARA 2XARA 4FKPA 5CAVA 4IAYA 1ZOEA 5EM6A 4YBJA 4ANSA 4EUTA 4BBEA 2ZM3A 1H1RA 1W7HA 4WG5A 5KUPA 4PMPA 4AXFA 3MN3A 2PVMA 4BN1A 2B1PA 4M14A 5IPJA 5CVGA 3RINA 3VQHA 2OK1A 4EKKA 1F0QA 2P4IA 2RSVA 3DNEA 3HZTA 3JVRA 5I0BA 2J5FA 2X8DA 3LQ8A 3KULB 4TWNA 4ZJIA 3A7GA 2HZ4A 4IFCA 3OBJA 3SVVA 3R71A 3PLSA 2DYLA 5HIEA 4USEA 3KXHA 3SXRA 4LUEA 2VO3A 3LFCA 5JRSA 3NCZA 4AW2A 2Z02A 2R3HA 5IKWA 4NJ3A 3UZRA 4YJUA 5FEQA 4TKSA 3B2WA 3VUMA 3JY9A 4IBMA 4O7LA 1ZOGA 4KA3A 5AR5A 4BDIA 3OC1A 2W1DA 1RJBA 5FXRA 3RAHA 4G34A 5AUYA 4BCIA 2R3QA 5M09A 2C3JA 2GHGA 2J90A 5HTIA 3DXQA 4IX3A 4TWOA 4NM3A 5ACBC 5TE0A 3BV2A 3NYXA 5DFPA 5M44A 4CFXA 4RX5A 1T45A 3KF4A 4JG6A 4H58A 3T3UA 3LXLA 4F9AA 4WKQA 4JR7A 3BZ3A 5E8YA 2V55A 2WEVA 3LZBA 3ZCLA 5AP5A 1EH4A 5BYZA 2HXQA 4MVFA 3D15A 2OZOA 4OW8A 3MB7A 2VTPA 3UC3A 5AV4A 3R00A 4XHKB 4BB4A 5HG7A 4I5PA 3NUSA 4A07A 4RZWA 5M4UA 5HU9A 1URCA 2JKQA 1JSVA 4YGAA 2VTMA 4X2KA 3PDTA 1BI7A 3FI8A 4J8NA 1KV1A 5BNJA 4RA4A 3OTVA 2GQSA 3DJ6A 5D41A 2XJ0A 2R3LA 3DBEA 3RGFA 5J5SA 3EYGA 3FUPA 2YM5A 3OW4A 4OBQA 3W33A 4AXEA 2WMBA