3FUPA

Crystal structures of jak1 and jak2 inhibitor complexes
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
284
Chain Sequence
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDQMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Dissecting specificity in the Janus kinases: the structures of JAK-specific inhibitors complexed to the JAK1 and JAK2 protein tyrosine kinase domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 284
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fupA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fupA01
2HENA 4FK3A 3NYVA 3R2YA 4FV5A 3V5TA 3OT8A 1M2QA 4WA9A 2WQOA 3LCOA 4OBQA 5AAFA 3UP7A 2RSVA 2X2KA 4C34A 3LXLA 1WBSA 3Q04A 4Y5HA 4X21A 3TNIA 4I5HA 4YZDA 5HGIA 2PYWA 4HZRA 2WTIA 1RE8A 2PSQA 3E64A 4G17A 5HNIX 4DFYA 1H1PA 5HO8A 2B9HA 2Y4IB 3HV6A 3GB2A 3UVQA 1Q41A 3ITZA 3HLLA 1KOBA 3F3UA 3OUNB 3MFUA 5GJFA 3FI4A 4I5PA 1YDTE 4YZCA 3CTQA 4CZUA 4HGSA 4ZSEA 1ZWSA 1S9IA 5HTIA 2C6KA 4EJ7A 1XBBA 4FTNA 3WARA 2YWVA 2B9IA 3TUCA 3ZCLA 5D7AA 3ZLYA 5HLNA 5DN3A 1PW2A 3QRTA 3LJ0A 4G5PA 4YJOA 3K5VA 3TKIA 5AV4A 2YIWA 3D5XA 1AGWA 2B9JA 3MY0A 4G6OA 2AYPA 4YC6A 2YAKA 3LM5A 3RK9A 2CKOA 3NVKI 3E7VA 2ZM3A 3D7TB 2HZNA 2UUEA 2XVDA 3QA0A 2VWWA 4AZFA 3RCJA 3RI1A 2YEXA 4S31A 1WCCA 3KMWA 3OT3A 4KRCA 4YC3A 5L2SA 3DFAA 3PTGA 1OKYA 2WXVA 3KA0A 3REPA 1PXIA 3FY0A 5HLPA 4BDHA 1XH4A 4L6QA 4I5CA 1U59A 4XP3A 2X2LA 5BNJA 4EQUA 3S4QA 3TKHA 3ULIA 3U6IA 4AW0A 3WF8A 3E62A 4AA0A 3OOMA 1ND4A 1FGKA 2RL5A 4QMOA 1VR2A 4PDOA 5I9UA 3M42A 5JFWA 3FL4A 5T3QA 2XJ0A 3I79A 4F65A 5JKGA 4AE9A 2VAGA 4TPTA 1RJBA 4D1XA 5A14A 3EQIA 3V5PA 2WMVA 1BL6A 4OTQA 3OBGA 3R8UA 3F5UA 1OKVA 2O5KA 4ENXA 5GIPE 1J7UA 4D58A 3SKCA 2YDIA 4FYOA 4MWIA 3FQEA 4GU6A 4N4SA 2YIRA 3AXWA 2OFUA 5LARA 3VF9A 3NW5A 4AZTA 5FM2A 4ASEA 2WQEA 5CASA 4O7NA 1PXKA 3C0IA 3C0HA 4EWHA 4AQCA 4EZ5A 4U40A 4V04A 2E9NA 1G8AA 3N4VA 1JNKA 1X8BA 1H07A 2WMRA 4DEGA 2E9PA 5T68A 5KO1A 3OCTA 4G3FA 5AP2A 1XBAA 3LFQA 3LFDA 3CQUA 3VBXA 4F7SA 4HGEA 1V0PA 4RIXB 4CVAA 3R04A 3F3WA 3VJNA 5DBXA 3BYSA 4H1JA 3VBTA 5M06A 4ZTSA 2ERZE 3BELA 3EN5A 4YZNA 4PV0A 5CI6A 3ROYA 4BYIA 3HMNA 3QQKA 2Y7JA 4UBAA 4CMUA 5DH3A 5J95A 3PIYA 3F3VA 3MPMA 2KTYA 3MIYA 3FZ1A 4YJNA 4FV3A 5DPVA 4NIFB 3LFCA 3P23A 1OPJA 4MVFA 3F61A 2JIVA 2EXEA 5FG8A 3S0OA 2DYLA 2WTDA 4FSNA 5G1XA 4JQEA 2JIUA 4YO6A 4F1OA 4F9AA 5JFVA 3U54A 2XKFA 3F6XA 3U87A 3GQIA 5DRBA 4M68A 1H24A 1TQPA 3BYMA 3E3BX 3GCUA 3KXXA 3UOKA 1VEBA 4FV7A 3LFNA 4FKSA 4QMTA 2H6DA 3UODA 3VUTA 4Y8DA 4DITA 2V55A 2YDJA 4CZTA 2W5BA 1IA9A 4DF3A 2C1BA 4E20A 5ANEA 4ANBA 2OIQA 5AV3A 3TL8A 5TF9A 4AA4A 4DH1A 3BE2A 3HL7A 4I4FA 4JDKA 3DY7A 3CXWA 4HJOA 5DR6A 5HE3A 3IGOA 5I5ZA 5EK7A 1CKJA 3NSZA 3ALNA 4IVDA 1UWJA 4LMNA 4ZLYA 5M4UA 4JRNA 4QTDA 4L53A 4D2SA 3E8DA 5AM7A 4RC3A 3DU8A 5GZ8A 5L6PA 2XF0A 3A61A 5KZ0A 4XP0A 4L67A 3I1AA 1Z57A 3RPYA 4RJ8A 2R0IA 4R5YA 1W0XC 3TIYA 4DFLA 1P4FA 2CMWA 1Q24A 2XIRA 1B38A 3NRMA 3EN7A 2OJFE 3PSCA 2JDSA 1OIYA 3K2LA 4O0TA 3ZLSA 3R73A 4OR5A 2W1HA 1OGUA 3F88A 3MJ1A 3ORMA 3JVSA 4U44A 4USEA 3R8PA 2YABA 5HICA 5HG9A 1Z9XA 3SG8A 3QD0A 5E8SA 2C5YA 5AUTA 4UYNA 4UMPA 5EG3A 3D0EA 3FQSA 4BCKA 2ZB1A 2C6OA 5DVRA 5E1EA 3TTJA 4C4EA 5TR6A 3V01A 3DXQA 3QYWA 2X2MA 2E9OA 4ANSA 4D1ZA 2GQRA 4MCVA 4G1WA 4C8BA 2UW7A 5JSMA 5HG5A 3GVUA 4U5JA 4K2RA 4XG8A 4UYAA 5HTBA 2ESMA 2DQ7X 4UMUA 3UC4A 4IEBA 2BFYA 3BWFA 2YITA 3LXPA 3DKFA 4PMSA 3AC1A 4IH8A 4EOQA 4EYJA 3VBWA 3H9FA 4YTFA 4W9WA 1W98A 3PG1A 2W7XA 1NY3A 4GUBA 4Y95A 3TDWA 1OPLA 2WZJA 3VRYA 1J91A 5C27A 5CEQA 3HAVA 5DOSA 5HZNA 4FVQA 2ZVAA 3IECA 4F1MA 1OL7A 2XRUA 3HV5A 3OF0A 3PY1A 1URWA 2BZHB 3AT3A 1WBWA 2ERKA 3DZQA 3NEWA 5J8IA 4WG4A 5FM3A 1P2AA 3DLZA 3GCVA 4AP7A 2ZV2A 2ETMA 4PL4A 3FJQE 3PXFA 2GFSA 4N6YA 4PPAA 2HZ0A 2W9ZB 5EM5A 3BYVA 4EKLA 4U3YA 4G5JA 4O86A 5BVOA 3W33A 4CRSA 4J95A 4FE2A 4GRBA 4UB7A 4EOPA 2VNWA 2W1IA 3O0GA 2JDTA 3MPAA 1JLUE 3D7ZA 3OW3A 1QPDA 4O21A 4BL1A 2UZVA 3TNWA 2WAJA 3IOKA 1UU7A 2XB7A 3F3TA 3QTZA 5K4JA 4BFMA 2O8YA 3O23A 4O7TA 5DE2A 5JFXA 1OL6A 4BDEA 4DBXA 2R3RA 2VTJA 4D4YA 5B2LA 2C6EA 3BGZA 2XS0A 5FTQA 2FGIA 1Q5KA 1PHKA 4XG3A 4TYHB 3W32A 3KXNA 2WEIA 4MNEA 4PWNA 4ACDA 4BZDA 3BHVA 4TTHB 5L2WA 3DKOA 1PMNA 4TW9A 1H4LA 2IZRA 5A9UA 5L2TA 1XQZA 2C6DA 4RJ7A 4WNOA 4IB5A 3COIA 4D2VA 4AN3A 4QMLA 3VUHA 4C58A 4DGNA 4O7WA 4AW1A 3DPKA 4IIRA 4W8DA 3GU8A 3I5NA 4D0XA 1E1XA 4EOSA 5E8ZA 3Q53A 5BVDA 4P7EA 3MH1A 3H0YA 1ZYJA 4HVHA 2X7OA 2YM6A 3MVJA 3VN9A 4MBJA 4MX9A 4NFNA 3E8CA 1YQJA 5BPYA 4MEDA 5JMSA 1U46A 3FI2A 3FKOA 4YUQA 5E92A 4QMVA 2Z7QA 2ITOA 4RMZA 2XKEA 5IA5A 4QP4A 3Q4ZA 2WNTA 1YVJA 5HE0A 4NTTA 2PHKA 4BDGA 1RDQE 4O38A 2R64A 4Z16A 5CF5A 4FVRA 2O64A 3WF5A 3CGOA 4B99A 2WQBA 4ID7A 3P5KA 4O0UA 4YTCA 2QHNA 2FO0A 5CEMA 2IVVA 2BR1A 3A7GA 4XRJA 2JEDA 3R28A 4MBIA 4Q9ZA 3SG9A 3KRXA 3C0GA 4BKYA 3DDPA 5EM6A 3VAPA 3PSDA 3TV7A 3VS4A 4MBLA 3JUHA 4FZ7A 5D7VA 2PE0A 3JVRA 1AQ1A 3QF9A 5B2MA 1PYEA 3QXOA 4LRMA 2CCIA 4MTAA 2J9MA 3KRJA 4D55A 3WYXA 3MY1A 2VWXA 2VTHA 3E8EA 4UWCA 5CNNA 2XK9A 2GPHA 3VUMA 2VWVA 4V05A 3HECA 2QG5A 1ZLTA 2W0JA 1Y6BA 5EH0A 3TDVA 3QZIA 1TKIA 5C4KA 4QP7A 4HCVA 1YWRA 5C9CA 4IWQA 2VZ6A 2IO6A 3EFJA 2R0UA 3HDMA 1FOTA 1WBOA 2HYYA 4BVUA 3KK9A 4DT8A 4G3EA 3GT8A 4BF2A 1WZYA 1QPCA 2BRGA 4JR3A 4RZVA 4BDJA 5IQGA 1G5SA 4FSQA 2QOQA 4OTHA 4YJUA 3UJGA 3FPQA 1UV5A 4P5ZA 1TQIA 4FTKA 4XG6A 4X3FC 5AUZA 4RX9A 3FI3A 4I6FA 4QYGA 4E6QA 4HNIA 1JVPP 3SVVA 3HAMA 1GZOA 3NUAA 5BYLA 4FYNA 2BRBA 3HMMA 2YJSA 4YJRA 5IDNA 2QCSA 3UTOA 2CKQA 2JDRA 3PA5A 5F9EA 3MPTA 2Y8OA 4LMUA 3WF6A 4RFZA 2VD5A 3UYTA 3FLWA 5IA0A 4E73A 4FTUA 3UNJA 4WNMA 2IZUA 5B2KA 5HORA 3AOXA 3QRUA 4H3QA 3RMFA 4JXFA 2C1AA 2C30A 4ZJJA 4QMZA 4XEYA 2XBAA 3QXPA 2PL0A 5EHLA 3ROCA 4Y83A 1DI8A 2QO9A 2OZAB 3QC9A 4FV1A 4PRJA 4QNAA 3TV4A 3ZHPC 4CV8A 4CKIA 5BVKA 4AS0A 3PRIA 4DLJA 4LOQA 4MYGA 5CYIA 4JX3A 1OKWA 2OIBA 3KC3A 3PWDA 4TNBA 2W1CA 4YJPA 3OXZA 3DBDA 2PULA 4FZ6A 2QOIA 5AR4A 3L8VA 4FI1A 2R3IA 3PXQA 3QCSA 1IRKA 4HYUA 5LVOA 2YCRA 1IAHA 2R3LA 3P7BA 4C3PA 4OTRA 4O0WA 1JKSA 4AN9A 3PY3A 1JOWB 3L8XA 3HUCA 4YZBA 4EK8A 3GFEA 2J2IB 3R83A 4MD9E 3QFVA 4U9AA 2Y6OA 1BKXA 5C26A 2IW8A 2VGOA 2OXDA 1F3MC 4OLIA 1OKZA 3BI6A 3VUIA 4FC0A 4I22A 4USDA 4RWJA 2OGVA 3O17A 5ANJA 2G2IA 1SNXA 4MQ2A 3QCYA 4AZSA 5IF1A 3KEXA 4AA5A 5J9ZA 4N6ZA 4J96A 3H30A 5M07A 4ORKA 4KKHA 2J90A 3ORKA 2BIKB 5IH4A 2C5VA 4NEUA 2QC6A 5AUXA 3OS3A 4ZSGA 3IW6A 3MGYA 3SW7A 2WMUA 3HNGA 1FVTA 4GIIA 3DB6A 4MQ1A 4XP2A 3PVWA 5HTCA 3LLTA 2HAKA 5I9XA 2WFYA 4O22A 1QPJA 4O7SA 2QOLA 3PXKA 3AC2A 3MIAA 4NWMA 5IUIA 2YLEA 4I6HA 3G51A 4LRJA 1PMEA 3TJCA 1WMKA 2OF2A 2QR8A 4BGQA 4E4NA 5F4NA 2H96A 3L9NA 4RRVA 2GSFA 2VTMA 5FP5A 4EH9A 4O96A 4EJNA 4F7JA 2X7GA 3DAKA 4OT5A 4EHVA 1VJYA 3ZU7A 4PDSA 4XG9A 1OIRA 4H3PA 3OEZA 1DAYA 4ZTRA 4GFGA 3LVPA 3N9XA 3U55A 3PYYA 3W10A 3U9NA 2UW8A 4CMOA 4FKGA 3E88A 4PMTA 1UKHA 2E9VA 2W96B 4EOIA 2CKPA 3ZZWA 4J52A 1OL2A 2PVJA 2XCHA 1KWPA 2GS6A 3PXZA 4D4RA 4MKCA 1Q99A 4JAIA 4KAOA 4BCMA 2JBPA 3FXZA 5ITAA 3DXPA 1YI4A 4FTTA 5IZFA 2OH0E 4F1TA 4F9BA 4IX3A 2CNVA 1M2PA 4BHZA 3UQCA 4ITIA 3ZXTA 3OC1A 5EQEA 4BKJA 2P2IA 4AZEA 5HU3A 3V5JA 4FT5A 4HYHA 4TXCA 5GZAA 2OJGA 5DR2A 3SRVB 4JLCA 2XM8A 2WKMA 3IONA 1QCFA 4RVKA 3OUKA 1PYXA 1Q3WA 1Y6AA 3C4WA 3KMMA 4O0XA 1NVRA 2QD9A 3R71A 4FOBA 4JJRA 4PL5A 4EQMA 4HGLA 4GUEA 3TI1A 4DE4A 1ZY4A 3TV6A 3LMGA 2ITWA 4EORA 3E87A 4NW6A 3QHRA 4E4LA 5JEBA 3QX2A 3R7YA 2R3JA 3D2IA 3QQJA 4MXOA 4KIQA 2O2UA 4X3FB 4LGDA 4M14A 2LGCA 3L9LA 5KKRB 3CGFA 5EKNA 2QU5A 3KULB 2I1MA 3FBVA 3VS7A 4XMOA 4ERWA 5DFPA 4WBBB 3R8MA 2XIKA 4KBKA 5IPJA 1STCE 2WMAA 5DG5A 1GIJA 2ITTA 3D4QA 3NW7A 2RGPA 3ODYX 4FTJA 5E8UA 3RPSA 4YNOA 3C4CA 4TKSA 4Y72A 4CFVA 4X2JA 3GFWA 3MWUA 4RT7A 3OY3A 3FLNC 4ZTHA 1REKA 4ZTLA 2W1ZA 4YC8A 2BTSA 5A54A 2J5FA 5H3QA 2G15A 4M97A 4D5HA 3GEQA 5HI2A 5FEQA 3VVHA 4FV0A 2HK5A 3VUDA 2I0VA 2IWIA 4FIHA 3FL5A 4BHNA 1YDRE 4QPMA 3D5WA 5L6WL 5HESA 4RVMA 5K0KA 3ATSA 5EI6A 4E1ZA 5E8YA 2WHBA 4YTIA 1ERKA 1PXNA 2C69A 3I7BA 5IQFA 4BWKA 4M67A 3QKLA 2I0EA 4YBJA 4P2KA 3MW1A 3VW6A 3C5IA 2NRYA 4R7IA 3ALOA 3A60A 4H39A 4WKQA 3RPVA 4YJSA 2HW6A 2WMTA 3GU4A 2ZB0A 2QOHA 3BLHA 3VS1A 4C4JA 3EQGA 1JWHA 4QP3A 4PTCA 2X9FA 4EUUA 5K4IA 5JRQA 4KA3A 1DS5A 3PG3A 2WQNA 5JGDA 4IACA 3KXGA 3ZDUA 4EK3A 3I6WA 3FZPA 2FA2A 4O81A 1SMHA 2DS1A 4R7HA 3WIGA 5CAPA 3II5A 4FKPA 3UVPA 1A9UA 5K3YA 4WO5A 2Y4PA 3AC3A 5CU4A 4EOLA 5DI1A 5IH6A 5JQ8A 5K0XA 2PWLA 3ZO4A 3SGCA 2QNJA 3EQHA 4RA4A 1Y8GA 4GG7A 3AC4A 5I9YA 3R7VA 4UV0A 4FV8A 5AUVA 4FEUA 3W2QA 4R77A 2XYUA 4UWYA 3MESA 3TT0A 5CU0A 2CN5A 2I0HA 2QOFA 3CP9A 4Y46A 2XIXA 4XV2A 4F7LA 3VC4A 4WSYA 2IW6A 3I81A 4DFNA 4XV3A 4JVGA 1I09A 3QCXA 5DGZA 5EDPA 4IBMA 1P5EA 3QAME 3RHXA 4A4LA 1JBPE 4DGOA 1PKDA 2R7BA 3GU6A 3LCSA 3Q4TA 3NYOA 2ACXA 3K3JA 5CF6A 4OTGA 5IQBA 3QD2B 5F20A 4HGTA 3TKUA 3MI9A 4YO4A 4RC4A 3VJOA 4XOZA 2B52A 2VX3A 3FYJX 1CKPA 4QOXA 2PE2A 3WILA 3D9VA 4DH8A 4IWPA 4CKRA 1FINA 5DR9A 5M44A 5I9ZA 5D9HA 5AJQA 5AUYA 3OMVA 2W99B 3ORTA 3QLFA 1SVGA 2J7TA 1F5QA 3V04A 1YWVA 3A8WA 4AG8A 3R1QA 4ZIMA 5JQ5A 5LVLA 2XUUA 4IDTA 4P5QA 5E4HA 1GY3A 4DBNA 4FMQA 3U4WA 2VTRA 4G3GA 3LFAA 3FMEA 1WBNA 5HQ0A 4I23A 5IA1A 3TG1A 1CKIA 3D2KA 5ANIA 1G3NA 2C6IA 2CGXA 4W4YA 1H1WA 3NUUA 2C68A 4LG4A 3P1AA 5HX8A 4DGMA 1PXMA 3K54A 1O6LA 3Q9WA 2C0OA 2Z8CA 1UA2A 4CLJA 5CU3A 4JG6A 4NL0A 2BRHA 4BICA 3OFMA 3NS9A 3DJ5A 2KULA 4L43A 3W2OA 4O0RA 2OW3A 2XRWA 4C3RA 1O6KA 1OUKA 3AD5A 3S00A 4LYNA 4FZFB 1FGIA 1SNUA 2UZTA 3O50A 4OBOA 1I44A 4BDCA 4YHJA 4D9UA 3UOLA 2BDJA 4BYJA 3EHAA 3MJ2A 4NM0A 3VUGA 2JAMA 2R3MA 5F1ZA 2F7EE 4CCBA 3UIBA 4LRKA 4IXPA 2GMXA 4OW8A 5KMMA 3GC8A 4K11A 3SQQA 1DI9A 2XNPA 4I21A 4K9YA 4R3CA 2IG7A 4BTKA 5CX9A 3ORIA 3Q2MA 4C3FA 5LWNA 4RVTA 5F95A 4F63A 3DCVA 2GS2A 4HPUE 4APPA 4IAAA 4BI2A 3Q9ZA 4FSYA 2GTNA 2XKCA 2QONA 2YZAA 3WZJA 2X8IA 1CMKE 5EM7A 3UZRA 3DLSA 2UZWE 4IANA 2RFNA 3MY5A 3R1SA 1F0QA 4D2TA 3FKNA 4J53A 1UNLA 3S2PA 3QTRA 1R39A 4M3QA 4FNZA 4RQVA 4IB3A 3WZEA 3U6JA 3M1SA 3FZTA 5CTPA 2ZV8A 2BKKA 3ZM4A 3EQCA 4PTGA 3LIJA 4QO9A 2VTSA 5J1VA 4QMQA 2BAKA 2ETRA 1JQHA 2PMIA 4F0FA 3Q5IA 4RX8A 3TJDA 3OXIA 4C37A 5GZ9A 4N57A 4IADA 3FLZA 5H9BA 4QP8A 4O83A 3UPZA 4BI1A 2LAVA 2OU7A 4TRLA 3C1XA 3DOGA 5AV2A 5E8TA 2XK3A 2VGPA 4D1SA 4FVPA 3DBFA 2CNUA 2VO0A 4ZY5A 4PDYA 5AP3A 3UO6A 3PA3A 4FTIA 4GVJA 3O71A 4EC9A 3IGGA 3LM0A 5HE2A 4EC8A 2B4SB 5JZJA 4JDJA 3FMNA 2PVMA 4E3CA 3FZRA 2G2HA 2JD5A 4PX6A 4BWXA 4HVSA 3PRFA 4O6EA 4F0GA 5CAOA 4F6WA 2OJ9A 1ATPE 3E5AA 2XEZA 3HGKA 3PY0A 4APCA 4AU8A 1H1SA 2Y9QA 4O0YA 4ZTQA 4BIDA 2OO8X 2YAAA 4M13A 3T3UA 2BUJA 5KMLA 3QQUA 4XJ0A 3R9HA 3UOHA 5CXZA 4I0SA 5IEXA 4OBPA 1JAMA 2X8DA 4Q9SA 4PTEA 2J51A 2YJRA 5J9LA 3QGWA 4FKJA 2VWYA 4Y85A 4QPSA 4AZWA 3CPCA 4D0WA 4M8TA 2XK4A 1ZMVA 4LUEA 4ANNA 4L8MA 4MXZA 4JRVA 3EL7A 2PPQA 5GJGA 2WB8A 5AWMA 4DYMA 2YM4A 3BV2A 5AMNA 5FXQA 4IM0A 1ZOHA 4X2GA 5HCZA 1V0BA 1Q8WA 4I93A 3KU2A 2WOTA 3EFWA 4EBVA 3FWQA 4NU1A 3DJ6A 4ACHA 2Y6MA 5CQWA 3G33A 4GK2A 4ZY4A 4QYYA 2NPQA 4B0GA 3LMHA 1JSVA 3TEIA 2W1EA 4FICA 4DHFA 5J1WA 3QZGA 2R3GA 2VN9A 2OIDA 4KWPA 3QL8A 2IVTA 3ORPA 4JBVA 3C51A 3O8PA 4MNEB 3QRIA 4XUFA 4HVGA 5E1SA 2BALA 5AR3A 4BCIA 5HD4A 1HCLA 3TXOA 3HA6A 5JT2A 2F4JA 4A9RA 3JR1A 4IM3A 3VS2A 4ERKA 4R6VA 2PVKA 2BHEA 5JRSA 3V6RA 3R9NA 3MVHA 1XH7A 4WBOA 2PMOX 4WOVA 3W18A 5DWRA 2OKRA 3LZBA 2F7ZE 3OVVA 3P7AA 5FXSA 4U97A 2AUHA 3UG1A 2ZM1A 1DAWA 3MVLA 5KCVA 3EKNA 4TYIA 3V5LA 3WF7A 4I41A 3OTUA 4KNBA 3SAYA 3FLYA 4FTRA 2GTMA 4BWPA 4S2ZA 4TWOA 5J5SA 3LHJA 1Q61A 2UVXA 3QQFA 3DBEA 3I0OA 4O7LA 1LUFA 4LFIA 4PY1A 4TWNA 3R9DA 2OJJA 2X4FA 5EW9A 1IASA 4ZK5A 2JKKA 3AC5A 3P86A 3QLGA 5FP6A 3NAYA 2C3KA 3DV3A 5IA4A 4I0RA 3UZPA 5DT0A 4NKAA 4IWOA 4QQTA 4U43A 1U4DA 3T9IA 4D2RA 2YIYA 3KF4A 3QWKA 4L68A 3Q3BA 4KBAA 3QUEA 4AN2A 4DEEA 1CM8A 3D5UA 4C35A 4JNWA 3OWLA 4K8AA 2ITZA 2BKZA 4LOOA 2Z7RA 1J1BA 4USFA 4GU9A 3KN5A 3PZEA 2JDOA 5HNGA 1W84A 4K33A 3PDTA 3C4XA 2W1GA 3H9RA 4L01A 4FBXA 4PNIA 3A99A 5LMAA 5DEYA 4CQGA 2C6LA 2UZOA 3Q6WA 3SLSA 1BX6A 2ITPA 4DEDA 4TT7A 3GCPA 5IQCA 4XBRA 4NM5A 1VYZA 3F2AA 5GIOE 4L3PA 4O27B 3V8TA 5CEPA 3Q60A 1E9HA 4CGAA 2CHLA 4QRCA 5CVHA 3P0MA 4RIOA 1YHWA 3WBLA 3R1NA 3G90X 2PUIA 4DG0E 2CN8A 2OF4A 3BHYA 5HIBA 2PUPA 2UW0A 4A7CA 4E8AA 3WE4A 3S1HA 4IQ6A 4B6LA 5EHOA 4RJ3A 3EMGA 2P4IA 3OP5A 5JFSA 2G01A 2R3KA 4LI5A 3EYGA 4OTIA 2UW6A 4TYGA 3SX9A 3BU5A 4CT2A 3OEFX 4F70A 2XNOA 5GNKA 3IOPA 4YJTA 4AZVA 4D4SA 4IM2A 2UZLA 2W4OA 3E63A 3A2CA 2VWZA 3V5QA 5C8KA 3KREA 5FUTA 5LOHA 3GGFA 1LEWA 2P3GX 5L2QA 3SHEA 3W16A 3LLAA 3SV0A 1BYGA 1XKKA 2B53A 3TN8A 3FSKA 3R6XA 3PSBA 4UWBA 4YHFA 5I3OA 5TT7A 4JG7A 3PIXA 5IMXA 5FLFA 5L4QA 4U7ZA 3H0ZA 4DT9A 4YLJA 4F7NA 3ZRMA 4I6BA 4HPTE 1NVQA 3GOPA 3RPOA 4WHZA 4NUSA 3UYSA 3Q4UA 2DWBA 4IC7A 4J97A 4NM7A 3VS5A 2Z2WA 2O63A 3ZSIA 3BEAA 1XJDA 4DAWA 4RJ6A 3QTUA 5HO7A 1B39A 3PVUA 4QTCA 3R9OA 1XBCA 1PF8A 2PY3A 5HLWA 4Z7HA 3POZA 5FWKK 5M55A 3BWJA 4ALWA 1T45A 4JI9A 1JSUA 4RFMA 3U8WA 2CLQA 1ZZ2A 2EU9A 4J1RA 4FEVA 4K77A 2C0IA 1OBDA 4PP9A 4YJVA 3V5WA 3AQVA 3FXWA 5HKMA 1SVEA 4CCUA 2VO7A 4U41A 2W9FB 1WFCA 3DTWA 5DYJA 4YURA 2PZPA 3OROA 1JSTA 4KS7A 3TACA 3C50A 5KMIA 3CKXA 4IFGA 4QYHA 4ASDA 5J9YA 3UQFA 5EQYA 2W06A 4RA5A 2WTKC 3ID6C 3F3ZA 4ZS4A 4ITHA 1MUOA 2YCSA 4G16A 4NKSA 3LCTA 2FVDA 5LMKA 2HIWA 3PE2A 3RAWA 3TWJA 4ZSLA 1ZOGA 2A0CX 3A7JA 4IZAA 3TNHA 3KMUA 3AGLA 4G31A 4BKZA 3VS3A 3DNEA 3OD6X 3DFCB 4FNXA 4FSRA 4RIYA 4OAVB 5CWZA 2XM9A 4P4CA 4NYEA 3CS9A 1R1WA 1J1CA 2PVNA 3ZRKA 5C1QB 3UP2A 4FL2A 5M4IA 5AFVA 1PJKA 4RVLA 4MHAA 4ALUA 5A4QA 5E7RA 4U81A 1QL6A 2OSCA 4AT4A 5HOAA 4C2VA 2G2FA 2CPKE 5BYZA 4O84A 5KZIA 3P9JA 4FZDB 3UOJA 3LPBA 3R00A 4FKLA 3TNQB 5KUPA 4YMJA 4QP9A 4IDVA 3D94A 3SOCA 4DC2A 4WUNA 5A3XA 4AAAA 1PXOA 2W5HA 5BUEA 4CKJA 4D9TA 5IUHA 1Y8YA 4IFCA 5IH5A 2R3QA 5LMBA 4AX8A 4UMRA 5K5NA 5K9IA 3EN6A 3CJGA 3RCDA 5J79A 1OVEA 1U54B 3KGAA 3KXMA 4WUAA 3I60A 4DEBA 3OHTA 3BZ3A 5L3AA 3MS9A 2Q0BA 3DBQA 3GC7A 4XS2A 3OCBA 3EN4A 3VW8A 4L44A 4XG7A 2PVRA 2BFXA 4TYJA 2RF9A 3FMLA 3V51A 1PXJA 4EBWA 3HA8A 3UZTA 5FBNC 4ENYA 2W4KA 5BYYA 1O6YA 2JBOA 3BU6A 3HRFA 3R7GA 5D11A 5KKRC 3VRZA 4D2WA 4DTKA 1YOMA 3JY0A 5HCXA 3LOKA 2G9XA 2OJIA 2NRUA 4E4MA 3HDNA 3EQDA 4JBQA 4L9IA 2PUUA 3COHA 4FG8A 2P0CA 4GYIA 2UVYA 5KMKA 4FK6A 4ZSAA 3D15A 3Q4CA 1REJA 4QQJA 4QTAA 4TYEA 2VWBA 4ZEGA 3MTLA 3VO3A 2QR7A 3BGQA 5KNJA 1UVRA 5IU2A 2OBJA 5TO8A 5IQEA 4R1YA 1M14A 5IQDA 3LXKA 4IB1A 4W9XA 5I4NA 3PPZA 4LGHA 3RWQA 4E93A 4JDIA 2X9EA 1XH5A 5CF4A 4YHTA 5IDPA 3DKGA 3ZDIA 2J0IA 1Y91A 4PP7A 1KE7A 4O2PA 2EWAA 3ZFYA 4FG9A 1OIUA 4K6ZA 2R5TA 5KBQA 4ZMFA 4A9TA 2BIYA 2P55A 3P08A 3ZUVA 3R7UA 4MD8E 1WVYA 4M66A 4UZHA 3FC2A 2B55A 5CVGA 5ANGA 5AR2A 4ZY6A 4CYIA 2GCDA 3ZS5A 5IA3A 4GS6A 1V1KA 3F9NA 4NFMA 3CQWA 5KE0A 3DT1A 2R3FA 3IKAA 2XJ2A 4G3CA 1UU3A 2WMXA 3CY3A 5LWMA 2PZ5A 4HYSA 4RPVA 1AD5A 1ZARA 2BZJA 4J98A 1GOLA 2F57A 3V8SA 5DMZA 1BL7A 3LJ1A 4FT9A 3FXXA 4DEIA 5TE0A 4O91A 2UW3A 3UQGA 4I1ZA 4OGRA 4M7IA 5BQ0A 4EI4A 5LXMA 3LJ2A 4IE9A 2WTCA 4B8LA 4UN0C 5FDXA 4V0GA 3PZHA 4BB4A 4IZ5A 2V62A 4Y5QA 2XCKA 3K3IA 3VS6A 4FTLA 3UO4A 4TNDA 1YWNA 3FZSA 2HOGA 5E90A 4L3JA 5LCJA 5BMSA 3ZFXA 1U5RA 4IX4A 5AIKA 3AT2A 3NR9A 4RWKA 4KIPA 3HP5A 4PQNA 4UXLA 5HCYA 3NCZA 4AGUA 4CFWA 4FTAA 5CSXA 4U8ZA 3E8NA 2WTKB 2RG5A 2YCFA 1PKGA 2C3JA 3G2FA 3F2RA 2G1TA 4EHGA 5KBRA 1ZYSA 3D14A 2UZEA 2YERA 2QKWB 4FNWA 4PF4A 4EH6A 3EL8A 3KK8A 4G2FA 1A06A 1ZAOA 2XK6A 4UALA 4YZ9A 4A4OA 1M2RA 1M7NA 4L42A 1Q4LA 3F69A 3HZTA 3L1SA 4ANMA 4KSPA 4CSVA 4AF3A 3RALA 1UU9A 2SRCA 3MA3A 4YBKA 4QQ5A 4WT6A 3MBLA 3PA4A 4BDKA 5JN2A 4KKGA 3QRKA 1M52A 3AMAA 4K18A 2XP2A 3BRBA 1J7IA 2W5AA 3OBJA 3PUPA 2CLXA 1U54A 2PE1A 5EDRA 4AE6A 4DEAA 2P33A 5AUWA 1T46A 1ZZLA 5DLSA 4FGRA 4I24A 3WF9A 4DGLC 3BGPA 3EQFA 4OTDA 3RAHA 2XNGA 3MFTA 4I94A 3JPVA 2C0TA 5DA3A 3KCKA 3ZUUA 4ARKA 5AA9A 3KRWA 5D41A 4ZLZA 4M15A 3HV4A 3NGAA 2YM5A 3G15A 3OY1A 3TNPC 5DT4A 3QD3A 1Y57A 3ANRA 2ZDTA 3EQPA 3M2WA 4IAZA 2VTNA 4FIGA 4W4XA 2Z60A 3H4JA 4DH5A 2WTVA 4XH6A 5KHWA 4GKIA 1YI3A 4JIKA 2NO3A 3GOKA 4XV9A 2UW4A 4KKEA 2YIQA 4GV1A 3RNYA 2CCHA 4FL3A 4HZSA 2PVLA 5I0BA 3ZLXA 3AT4A 3H9OA 3BU3A 3UE4A 4ACCA 4BTMA 3RPRA 2HWPA 2X4ZA 1P4OA 1ZYDA 4ZSJA 2X81A 4PPBA 4JBOA 4IMYA 5L8LA 4I3ZA 4EH5A 5AEPA 3CEKA 1FMOE 4AGDA 4A9UA 3LMIA 4RLLA 3ULZA 3BV3A 2PMLX 3F66A 4EH2A 4WRGA 3RINA 2JFMA 3CD3A 4X0MA 5IEVA 3HKOA 4E5AX 3K5UA 3G9LX 5EYMA 2ITQA 2YFXA 3G9NA 3BQCA 1OB3A 4QTEA 3BBTB 3Q9YA 3RP9A 5I9WA 4PPCA 3WIKA 4BBMA 2E2BA 4FZAB 5JH6A 2HXLA 1IG1A 1GIIA 2DUVA 2HELA 4BIBA 2REIA 3RJCA 4YU2A 3O7LB 4H58A 5L8JA 3L8SA 3JY9A 4WD5A 3TUBA 2ZJWA 4IAYA 3N4TA 2YISA 4CFFA 4QQCA 2A2AA 4AW2A 2FSMX 2C5XA 2NP8A 3GC9A 3QQGA 2IZTA 5ETAA 3RKBA 3ORXA 3I0QA 4C7TA 4FTMA 5F94A 3EH9A 3ODZX 4A06A 2HZIA 4QTBA 5FEDA 4E7WA 5H8BA 3FMDA 2VTPA 3R7OA 4FKWA 4B4LA 4PMMA 3COKA 3I5ZA 3QTXA 3P4KA 4XRLA 4ACGA 4EHZA 2RFSA 3MH2A 4JQ7A 2XK7A 3LCDA 1KE6A 4FF8A 4F9CA 5J87A 3U4UA 3D5VA 3G0FA 4JS8A 2GHGA 3QZHA 4EEVA 4A9SA 4DH7A 3OTVA 3QBNA 1OIQA 3GU5A 4R8QA 2WIPA 4GFMA 4ANLA 3VBYA 1W83A 4GJ2A 3U51A 1DM2A 2W05A 3NNWA 1FVVA 4EOOA 5BMMA 3R01A 2ONLA 1CTPE 4GMYA 5T6KA 3R7EA 2BHHA 4U79A 5AM6A 3FE3A 1JKLA 1XH6A 4KS8A 3OWPA 5AA8A 3KXHA 4O0VA 3GP0A 2C47A 4FL1A 4MF1A 3UIXA 3TCPA 3G6HA 2JDVA 2CGUA 4S32A 1MRVA 5HEZA 2J50A 5FTGA 3UIMA 2WO6A 2VTAA 4O82A 4C4HA 3FI8A 5LQFA 4NK9A 5HIDA 2QU6A 3FZOA 1KE5A 3TUDA 3NVMB 4IVAA 3LFFA 3EB0A 4QMSA 2RG6A 4Z9LA 1KSWA 2PMNX 4KIKA 2IW9A 1OBGA 4GYGA 2PZIA 4MD7E 4RBLA 4AOTA 4ZJIA 2QVSE 4KIOA 3OG7A 2UZNA 3NNVA 4NM3A 4BCGA 2C5OA 2OG8A 1YHVA 2JLDA 4ASXA 4EONA 1GJOA 2XEYA 1OM1A 2QURA 3HV7A 1FBNA 3CKWA 1ZOEA 3JYAA 2UZUE 2ZMDA 5EW3A 4TZRA 2V7AA 4L7SA 3SXSA 4NZWB 4BDFA 4FT3A 2QG7A 3DTCA 3ELJA 1H0WA 4E6AA 1RW8A 3KCFA 1G8SA 4DCEA 4BCNA 3D83A 1APME 3OXTA 2R4BA 4CNHA 4DG3E 4M84A 4EZ7A 3NX8A 5CQUA 4E5BA 4GCJA 3SOAA 4X6RA 2X6EA 1YXUA 2A4LA 2HXQA 1FQ1B 2HY0A 3QA8A 4RFYA 4YSMA 3DAJA 5EYDA 5M56A 3LXNA 3BBWA 4LOPA 5FDPA 4L52A 5C4LA 2XA4A 3W2SA 3SC1A 4X6QC 3UBDA 1WVXA 5GHVA 3RM7A 4A9YA 4N70A 4AOIA 3WE8A 4W8EA 4D2PA 1VZOA 3QU0A 5IEYA 5CALA 4AACA 4BCQA 4M0YA 1UU8A 2WQMA 2XIZA 4O7VA 3WOWA 5AAGA 3DQWA 2CKEA 1FVRA 3HYHA 4GT5A 2AC3A 3RTPA 3SDJA 3Q6UA 3CE3A 3NZ0A 4GW8A 4G9RA 4HCUA 2XNNA 4L00A 5BVWA 5IG1A 3ZSHA 2JC6A 1WAKA 4R5SA 4EKKA 3T9TA 5LMKC 5FRIA 4EH8A 4HYIA 2EVAA 4MNFA 2XZSA 5EOLA 3P7CA 3MFSA 3ZRLA 3QKMA 3NYXA 4B8MA 3ETAA 1JKTA 4G3DA 3TZ9A 2C6TA 3QQLA 4CV9A 4FT7A 4EUTA 4Q5EA 3TZ8A 5ACKA 3ATTA 1L3RE 4EOMA 3KKVA 2I40A 3NNXA 2O3PA 3EZVA 4LL5A 4OT6A 4FEXA 2HW7A 1GIHA 2JKQA 2F2CB 3W2PA 4K0YA 3ZOSA 2XKDA 4H3BA 5HU9A 4DG2E 4XLVA 5HVKA 4X2KA 1FMKA 2VNYA 1KUTA 5DHJA 5KMOA 3BE9A 4MWHA 3RM6A 4M69A 2GHLA 2X7FA 3IW8A 1OI9A 4ZP5A 2J0JA 2ZDUA 4FIEA 4KUJA 2ITUA 4CEGA 5E8XA 3GENA 3M11A 4GT4A 4YNEA 2WELA 4O2ZA 1OL1A 5FXRA 5GINE 2J5EA 2W4JA 3G0EA 5DIAA 4BCPA 3MVMA 4TY1A 3VBQA 4C4GA 4JIAA 5IUGA 5IA2A 4IHPA 4DA5A 3IQ7A 4ITJA 5HX6A 4FKOA 3UG2A 4RWLA 5LVPA 2QHMA 3ZO3A 4Q2AA 2J6MA 3BYOA 5IMEA 3QTQA 4HW7A 2BDFA 3RWPA 3LAUA 4B7TA 3BYUA 5CSVA 3U9CA 3WZDA 5E8VA 4CFMA 5HIEA 5HG7A 3ORNA 4FIFA 3NMUF 4KABA 3W2CA 2UZDA 3FY2A 4L7FA 4QMMA 2VWUA 4D4VA 4WRSA 1XO2B 3O7LD 4AWIA 5M57A 1W82A 4XYFA 3IDCA 3LFBA 3MH0A 3CLYA 5LVMA 3RGFA 3R7IA 3ZEWA 3UVRA 5AAEA 4DEHA 4FKUA 4QMWA 5FTOA 3PJ3A 1WBTA 3UIUA 4S30A 3VF8A 4ZZOA 3CTHA 3KB7A 2XMYA 5E91A 2QO7A 4QYFA 3QD4A 5HD7A 4J8MA 4DFXE 1BLXA 3DK3A 5J5TA 4ZZMA 1HCKA 2WEVA 1V0OA 2C6MA 4NT4A 4F99A 3KXZA 2WU6A 3RBWA 1VYWA 2BMCA 4CFXA 4X7QA 5EYKA 5CEOA 2H34A 3N51A 3UGCA 4AUAA 4AGWA 4AW5A 4ASZA 3THBA 5ANKA 3QRJA 4H05A 3UNZA 2V22A 4XOYA 4O7RA 2R3HA 4L46A 2BCJA 2ZYBA 5C8MA 2XNMA 4LV8A 2JAVA 3AMBA 3IO7A 4FKQA 2F49A 3Q5ZA 4V01A 5L2IA 1ZY5A 3DJ7A 3ZM9A 5ACBC 1H8FA 3FHIA 5M09A 3E7OA 3E93A 4WG3A 2VWIA 3TTIA 4EL9A 4ANQA 3FEGA 4IZYA 5A4TA 4CG8A 3F5PA 3Q9XA 4M12A 2H8HA 3LE6A 2EUFB 4UMQA 1XWSA 2R3NA 4IW0A 4C2WA 1YDSE 4BDDA 5BUJA 3QZFA 4U42A 4FT0A 4JAJA 2GNIA 5H2UA 4N0SA 3OW4A 4Z55A 3T8OA 3W8LA 1OECA 4ONAA 1ZXEA 3NIEA 3PXRA 4IC8A 1JKKA 1W7HA 2CDZA 4AFEA 3ZO2A 3MSSA 3P78A 5ETCA 4FA2A 5IISA 3FV8A 2QKRA 5CT7A 5AR7A 3VWAA 4EYMA 2GDOA 1U5QA 2BDWA 4GKHA 2C3LA 3JXWA 2C5NA 1K9AA 2JIIA 4HOKA 4XHKB 4QD6A 2XIYA 2PK9A 2GNGA 4C38A 2HCKA 3CD8A 4BBEA 2X1NA 4EK6A 4F9YA 1H27A 2X6DA 4RJ5A 2HZ4A 3FUPA 4QMUA 4Z7GA 2BAQA 2OH4A 1ZYCA 3CR0A 2VTQA 3QUDA 4C02A 5BUIA 2OICA 2OK1A 4C4IA 4BDIA 3GQLA 2RFEA 2I7QA 4W4WA 1ZMUA 2P2HA 4TWPA 5CLPA 5M51A 5TKDA 2YM7A 4EK4A 2WTWA 1M7QA 3ACJA 1MRYA 4U3ZA 2WU7A 3DDQA 3IPHA 5HVYA 1OITA 4S34A 4WNPA 4NCTA 4RIYB 2GNFA 3OWJA 3R21A 2YZLA 2ITYA 3BPRA 4YP8A 3L8PA 4YLLA 5H8EA 3ZO1A 4U0IA 1SVHA 3LQ5A 2A19B 3QGYA 5EI2A 1L8TA 2WIHA 2OWBA 5EFQA 4HVIA 1NXKA 2QLUA 5HO6A 4G6LA 4FIJA 3MDYA 3NNUA 2OLCA 3AMYA 4PDPA 5AADA 1Q62A 2UZBA 4FTCA 1PRYA 2QQ7A 3C4ZA 4CTCA 2QI8A 4I0TA 1H28A 2I6LA 2VU3A 3B2WA 3W8QA 2BRMA 5CI7A 4I6QA 4LUDA 4EH3A 4RLKA 4H36A 5CEIA 4ZTNA 5C01A 4P90A 2XK8A 3GBZA 1TQMA 3LFEA 3QHWA 1YXXA 4JL9A 4KB8A 4NH1A 1NA7A 3UNKA 3D7TA 3NDMA 3TZ7A 2JKMA 3AC8A 2IPXA 2GU8A 4CD0A 2IVUA 5CT0A 2VV9A 3QX4A 5EHYA 3S3IA 3T3VA 3UO5A 3DNDA 5A4LA 1Q97A 2B54A 3UDBA 4Q5HA 3ZONA 3RNIA 3Q96A 3R30A 5EOBA 4FSZA 4R3PA 5CY3A 4BDBA 1LR4A 1A48A 5CSWA 2PVHA 4QMNA 4C59A 4FV4A 3TIZA 3HMPA 5ANOA 1YW2A 1B6CB 3F5GA 4QT1A 3HRCA 2OXYA 5ICPA 3W2RA 4FV2A 4UEUA 2BROA 1GNGA 4GSBA 5AV0A 4EK5A 3ERKA 2GNHA 3DS6A 1Z5MA 3BKBA 5M08A 3RZFA 4CYJA 4I5MA 1Q8TA 4YJQA 3O2MA 3QYZA 2O65A 2ZOQA 1Q3DA 2BILB 4GK4A 2CSNA 4O7YA 3B8QA 3DA6A 3IDPA 5EYCA 2RIOA 4MXAA 4YGAA 3W55A 4QP1A 1OPKA 3MB6A 4J99A 3OCGA 5AP1A 3R8ZA 3KQ7A 4GT3A 5IQAA 2ITNA 1UNHA 4X3JA 3MTFA 5AX9A 1MP8A 3HRBA 4A4XA 2F9GA 3EFKA 4CMTA 4RIXA 4XV1A 2GHMA 3ZBXA 2FYSA 3H10A 2UVZA 4OUCA 3PJCA 2B9FA 4KSQA 2IJMA 4YSJA 3V8WA 4AGCA 4MH7A 3BX5A 2WD1A 5AP7A 2UW9A 3HV3A 2WMWA 3O96A 5L6OA 4DFBA 2GFCA 3DK6A 4II5A 4IAFA 3E3PA 3WZKA 1FPUA 2QOBA 4NIFA 4DINA 4G34A 3BHHA 3LW0A 1GAGA 3NCGA 3PP0A 3S95A 1YXSA 4BY9E 3TM0A 2ZV7A 4Y73A 3O51A 3PPJA 4BR3A 3GI3A 2CGWA 3CSVA 2I0YA 3VULA 3SA0A 5CF8A 4F6UA 2VTLA 3CJFA 4FEQA 4JBPA 3QQHA 4KD1A 4IJ9A 4V0GB 3A7HA 4D5KA 1GZKA 3KVWA 3HEGA 2J0LA 3FMMA 3FSFA 2WMSA 4BN1A 3RAIA 2ONLC 2BZKB 2FB8A 4FSUA 3TZMA 1KE8A 1Q8UA 4BZOA 4DCAA 4RC2A 3C4EA 4GL9A 5AIRA 2R3OA 4FKIA 5FD2A 3RK5A 3CPBA 1PMUA 5AV1A 3C13A 3KFAA 4O7ZA 4ANOA 2UV2A 5FGKA 4OAUC 1ZYLA 3ACKA 4GEOA 3NIZA 1XH8A 3LCKA 3PWYA 2WTJA 4FUYA 3RVGA 5A6NA 4J71A 4GIHA 4LGGA 3UMXA 3MA6A 2BVAA 2VO6A 4J7BA 2JKOA 3EFLA 3PJ2A 3F2NA 3DGKA 4NSTA 5BX0A 3BHUA 2H9VA 3ORLA 1H1RA 1SM2A 4AT5A 5JGAA 2YDKA 3GXLA 4F08A 2CJMA 1Q8YA 4BGHA 4LM5A 5A4EA 2YM3A 2GQSA 3MH3A 3EIDA 3QCQA 4C4FA 4UY9A 1MRUA 5EW8A 4B9DA 1BI7A 1YHSA 4RIWB 4IVBA 1YOLA 5HBJA 1R78A 1H01A 2XJ1A 2VX0A 4RJ4A 3R8VA 5IQIA 2UW5A 4BDAA 5KMJA 3EYHA 3V6SA 3CQEA 3DKCA 4FKRA 4O1OA 3ZC5A 4G6NA 3ZSGA 4Z3VA 3BIZA 4EHEA 4XNEA 1E1VA 5CS6A 1R0PA 3VQHA 4BTFA 2XH5A 3SXRA 4FIIA 3QC4A 2OFVA 4WG5A 3VHEA 4D28A 1K3AA 3OZ6A 4U6RA 1BI8A 1GZNA 2QO2A 3PVGA 3FAAA 5C03A 4TN6A 4HNFA 5D12A 4BIEA 3ANQA 3PFQA 3PJ1A 5DNRA 2BTRA 4BI0A 5KMNA 1KV1A 2F7XE 4I20A 2WMBA 1KOAA 1WBVA 3FKLA 3IS5A 3CY2A 2QODA 3MYGA 4QMYA 3NUPA 5CANA 5LVNA 4XG2A 4X2FA 5I3RA 4PL3A 5EKOA 2Q0NA 1WBPA 3V3VA 1CSNA 3R2BA 5A6OA 4RGJA 4IJPA 4GK3A 4C36A 4IAIA 4XG4A 4R7BA 2Z7LA 1Q8ZA 4O0SA 4ACMA 5CU6A 4X2NA 3CC6A 2XNEA 2FSOX 4FEWA 2R7IA 2ETKA 3FLQA 4CFNA 4E6DA 2EXCX 5EM8A 2ZM4A 3ZUTA 2Q83A 4IB0A 4AT3A 1IA8A 2ZMCA 3B2TA 4YR8A 4FX3A 3NLBA 5D1JA 5C8NA 1YI6A 4FODA 4LL0A 3KRRA 4M0ZA 3EQRA 3NW6A 1ZRZA 4FGBA 5B7VA 1GZ8A 5AP5A 3IW5A 4JR7A 4R78A 5DRDA 3L9MA 3HX4A 1MQ4A 3F7ZA 3AD4A 3NUSA 4RQKA 4YZMA 3ZEPA 4BCJA 3LQ3A 5D10A 4QMXA 4GFOA 3VHKA 3CTJA 3MFRA 4TYHA 3ET7A 2V5QA 3Q2JA 4ZAUA 5A46A 5I9VA 3EN9A 1XH9A 4PUZA 1SZMA 5ETIA 1PXPA 3R02A 4YLKA 3OOGA 4EOJA 2PU8A 2GS7A 3SXFA 2NNWB 3NUYA 3RZBA 5JGBA 2BRNA 4C62A 4QNYA 1PXLA 3FC1X 3I4BA 4TL0A 5CAUA 5G6VA 4AFJA 3FQHA 4QPAA 2IZSA 4L45A 3BHTA 3N4UA 4FUXA 2AC5A 3KVXA 1URCA 2ZAZA 4BC6A 3NPCA 3QKKA 4NW5A 2ITVA 4RG0A 3POOA 4WSQA 2BZIB 4DGGA 4RSSA 5JK3A 2WMQA 3R1YA 4BZNA 4O6LA 4E26A 4FSMA 4CLIA 2EB2A 1UNGA 2YACA 4NTSA 3FDNA 5K5XA 4DTBA 5TOZA 5M4CA 3GC0A 5HBHA 5AR8A 1NVSA 1OUYA 3ZC6A 4L3LA 1H08A 1YXTA 1NW1A 2OZOA 5AP4A 3GNIB 2GNLA 3QWJA 3BLQA 4RIWA 4U45A 5AR5A 5LCKA 3R8LA 3BLRA 4BGGA 4FOCA 5EQPA 1HOWA 2J0KA 1XR1A 2QLQA 3KN6A 4QP2A 1CDKA 3QALE 2VTIA 1H1QA 3PIZA 2J4ZA 4MXXA 5HE1A 5DEWA 1PY5A 1YKRA 4MXCA 4KIKB 3L9PA 3ZZEA 2PTKA 4ZZNA 4MF0A 5CVFA 1BUHA 4O1PA 3SD0A 4KBCA 4UX9A 4C57A 4UMTA 3P79A 1KE9A 4FSTA 3EKKA 4BBFA 3DB8A 3HUBA 3R9RA 3PE1A 2JGZA 4JX7A 2X39A 5A4CA 4C0TA 3VNTA 4XBUA 2FUMA 5BVEA 3WI6A 5HNBA 5CENA 4DTAA 5CXHA 3O8UA 3B8RA 5BVFA 1J7LA 3LKMA 3ENHA 4QMPA 3KY2A 4BCOA 3EZRA 3EJ1A 4CQEA 4F09A 2PZYA 4C33A 1H0VA 2QOCA 3HMOA 3NUXA 4RZWA 2R3PA 3DK7A 2RKUA 3OWKA 3ZH8A 5J7BA 4FV6A 2YN8A 5HBEA 2WGJA 2FSTX 1S9JA 1NT2A 4CRLA 4JQ8A 4PNKA 2FH9A 2PZRA 4K1BA 1R3CA 3NYNA 3MN3A 2OXXA 2W1DA 2QOOA 2YCQA 3ZYAA 5E9EA 3UC3A 3ZXZA 4CT1A 3F82A 2F2UA 3IG7A 2B7AA 4FNYA 3KRLA 4AXAA 2IN6A 3A4PA 2RFDA 3AG9A 5KX8A 4ZXTA 4WIHA 3RK7A 3VIDA 3W1FA 5EI8A 5KHXA 3FMKA 2WOUA 3GU7A 5AP6A 4H1MA 1K2PA 1OL5A 2OZAA 3PP1A 2X0GA 2VTTA 5CAVA 4MXYA 3G6GA 2BPMA 4CFUA 2CGVA 3CBLA 4WNKA 5H8GA 4EOKA 3EOCA 5FQDC 5B0XA 2CNQA 4RX5A 1TVOA 2O0UA 2W1FA 2XNBA 3IW4A 3IK3A 1QMZA 3F7WA 1R0EA 4FG7A 3R0TA 4NCTC 4ALVA 2ZV9A 4I4EA 3NWWA 3A62A 3PVBA 4IZ7A 2VUWA 3C5UA 1EH4A 4R3RA 4EH4A 5HG8A 1P14A 4U80A 2Y4IC 2PVYA 1H26A 4JDHA 5HVJA 2HWOA 3PPKA 5EDQA 1ZMWA 3A4OX 3PJ8A 4FV9A 1WVWA 2XYNA 1LEZA 4XLIA 4QYEA 1QPEA 2X8EA 1XHAA 4E6CA 4DFZE 4GG5A 2R9SA 3R63A 4MAOA 2QOKA 1IAJA 3AD6A 3R22A 4GVAA 4MK0A 2C3IB 4UXQA 5ETFA 1UWHA 4DN5A 2W17A 5CU2A 2Y0AA 4ZTMA 5L8KA 3BEGA 4M69B 3FMHA 4C61A 4DFUA 1UKIA 1LPUA 4I92A 3IDBA 4KINA 4OTWA 4JT3A 4YTHA 2A1AB 3EWHA 3HVCA 3I6UA 3RHKA 2A27A 3COMA 3O8TA 4BCHA 5M53A 4ZOGA 2OI4X 3VBVA 3RAKA 4J8NA 3OCSA 3QTIA 5JZNA 4BRXA 4CXAA 4HVDA 4NJ3A 3ZFMA 4F4PA 2YM8A 3U6HA 3ZLWA 4G9CA 3CIKA 4E4XA 4EQCA 5CSPA 3EQBA 5LJJA 1JPAA 2V7OA 2GQGA 2JFLA 3NUNA 4DH3A 3G5DA 3FPMA 3A7FA 3C4FA 2C4GA 1IEPA 4JOAA 2B1PA 4PMPA 3ZBFA 4YPDA 3UPXA 1PMVA 5FBOA 5CNOA 5ANDA 3PXYA 5AUUA 3FMJA 3DQXA 3GCQA 1BMKA 2XBJA 3I7CA 4IVCA 5CSHA 4YPSA 5CZIA 5E8WA 4OTFA 4CTBA 3QUPA 2FSLX 2YIXA 3BCEA 4F9WA 3WZUA 4ZLOA 3ORZA 2YLFA 3A7IA 3DZOA 3KL8A 4BCFA 3KF7A 4DLIA 4JG8A 2Z02A 1RQQA 4FKVA 4OTPA 4IX6A 4F64A 3WYYA 4GH2A 2PUNA 3GUBA 4HCTA 5BVNA 3F5XA 2PVFA 1SYKA 3MV5A 4E5WA 3CCNA 2YHVA 1KV2A 3GCSA 5HHWA 3Q52A 1YRPA 4XX9A 5CAQA 1OZ1A 3H3CA 3DXNA 4F6SA 5DT3A 3JS2A 1YXVA 3E92A 3SW4A 4ZJVA 2ITXA 4EH7A 4BTJA 1M17A 3DAEA 3LQ8A 4AOJA 3QTSA 4IWDA 4EWQA 5CEKA 3SRVA 4FTOA 5GJDA 4R1VA 2V0DA 1W8CA 3C7QA 1LP4A 1YOJA 1OMWA 4IX5A 4CZYB 2EXMA 1H00A 2EB3A 3ENMA 1IR3A 1O9UA 3FYKX 2GNJA 2J0MB 3VUKA 5J7HA 4FKTA 5IQHA 4UZDA 2JITA 3A8XA 3NAXA 4S33A 4TWCA 4X3FA 3ZMMA 3AGMA 2VTOA 4CG9A 4XCUA 5CZHA 1MQBA 1J3HA 3VS0A 3MB7A 3UMWA 3DBCA 3KULA 2B0QA 3PLAE 2Z7SA 3LFSA 4FSWA 4QP6A 5AP0A 4W4VA 1H25A 2R2PA 3FHRA 4GJ3A 5FEEA 5AX3A 3HP2A 4RX7A 5IKWA 2VX1A 5M4FA 3Q32A 4NJDA 4EZ3A 2YA9A 2WPAA 2VRXA 4KRDA 4FR4A 4ZS0A 2BAJA 4F0IA 4IAKA 4ZMEA 3IW7A 2VO3A 4FTQA 4LV5A 2IVSA 3PLSA 4LQMA 4A07A 3VQUA 2E9UA 3QTWA 3C9WA 3FLSA 2HY81 3ZTXA 3BQRA 3HMIA 2YWPA 4RWIA
chains in the Genus database with same CATH superfamily
2HENA 4FK3A 3NYVA 3R2YA 4FV5A 3V5TA 3OT8A 1M2QA 4WA9A 2WQOA 3LCOA 4OBQA 5AAFA 3UP7A 2RSVA 2X2KA 4C34A 3LXLA 1WBSA 3Q04A 4Y5HA 4X21A 3TNIA 4I5HA 4YZDA 5HGIA 2PYWA 4HZRA 2WTIA 1RE8A 2PSQA 3E64A 4G17A 5HNIX 4DFYA 1H1PA 5HO8A 2B9HA 2Y4IB 3HV6A 3GB2A 3UVQA 1Q41A 3ITZA 3HLLA 1KOBA 3F3UA 3OUNB 3MFUA 5GJFA 3FI4A 4I5PA 1YDTE 4YZCA 3CTQA 4CZUA 4HGSA 4ZSEA 1ZWSA 1S9IA 5HTIA 2C6KA 4EJ7A 1XBBA 4FTNA 3WARA 2YWVA 2B9IA 3TUCA 3ZCLA 5D7AA 3ZLYA 5HLNA 5DN3A 1PW2A 3QRTA 3LJ0A 4G5PA 4YJOA 3K5VA 3TKIA 5AV4A 2YIWA 3D5XA 1AGWA 2B9JA 3MY0A 4G6OA 2AYPA 4YC6A 2YAKA 3LM5A 3TMOA 3RK9A 2CKOA 3NVKI 3E7VA 2ZM3A 3D7TB 2HZNA 2UUEA 2XVDA 3QA0A 2VWWA 4AZFA 3RCJA 3RI1A 2YEXA 4S31A 2X0PA 1WCCA 3KMWA 3OT3A 4KRCA 4YC3A 5L2SA 3DFAA 3PTGA 1OKYA 2WXVA 3KA0A 3REPA 1PXIA 3FY0A 5HLPA 4BDHA 1XH4A 4L6QA 4I5CA 1U59A 4XP3A 2X2LA 5BNJA 4EQUA 3S4QA 3TKHA 1G8JA 3ULIA 3U6IA 4AW0A 3WF8A 3E62A 4AA0A 3OOMA 1ND4A 1FGKA 2RL5A 4QMOA 1VR2A 4PDOA 5I9UA 3M42A 5JFWA 3FL4A 5T3QA 2XJ0A 3I79A 4F65A 5JKGA 4AE9A 2VAGA 4TPTA 1RJBA 4D1XA 5A14A 3EQIA 3V5PA 2WMVA 1BL6A 4OTQA 3OBGA 3R8UA 3F5UA 1OKVA 2O5KA 4ENXA 5GIPE 1J7UA 4D58A 3SKCA 2YDIA 4FYOA 4MWIA 3FQEA 4GU6A 4N4SA 2YIRA 3AXWA 2OFUA 5LARA 3VF9A 3NW5A 4AZTA 5FM2A 4ASEA 2WQEA 5CASA 4O7NA 1PXKA 3C0IA 3C0HA 4EWHA 4AQCA 4EZ5A 4U40A 4V04A 2E9NA 1G8AA 3N4VA 1JNKA 1X8BA 1H07A 2WMRA 4DEGA 2E9PA 5T68A 5KO1A 3OCTA 4G3FA 5AP2A 1XBAA 3LFQA 3LFDA 3CQUA 3VBXA 4F7SA 4HGEA 1V0PA 4RIXB 4CVAA 3R04A 3F3WA 3VJNA 5DBXA 3BYSA 4H1JA 3VBTA 5M06A 4ZTSA 2ERZE 3BELA 3EN5A 4YZNA 4PV0A 5CI6A 3ROYA 4BYIA 3HMNA 3QQKA 2Y7JA 4UBAA 4CMUA 5DH3A 5J95A 3PIYA 3F3VA 3MPMA 2KTYA 3MIYA 3FZ1A 4YJNA 4FV3A 5DPVA 4NIFB 3LFCA 3P23A 1OPJA 4MVFA 3F61A 2JIVA 2EXEA 5FG8A 3S0OA 2DYLA 2WTDA 4FSNA 5G1XA 4JQEA 2JIUA 4YO6A 4F1OA 4F9AA 5JFVA 3U54A 2XKFA 3F6XA 3U87A 3GQIA 5DRBA 4M68A 1H24A 1TQPA 3BYMA 3E3BX 3GCUA 3KXXA 3UOKA 1VEBA 4FV7A 3LFNA 4FKSA 4QMTA 2H6DA 3UODA 3VUTA 4Y8DA 4DITA 2V55A 2YDJA 4CZTA 2W5BA 1IA9A 3O5AA 4DF3A 2C1BA 4E20A 5ANEA 4ANBA 2OIQA 5AV3A 1W2DA 5TF9A 3TL8A 4AA4A 4DH1A 3BE2A 3HL7A 4I4FA 4JDKA 3DY7A 3CXWA 4HJOA 5DR6A 5HE3A 3IGOA 5I5ZA 5EK7A 1CKJA 3NSZA 3ALNA 4IVDA 1UWJA 4LMNA 4ZLYA 5M4UA 4JRNA 4QTDA 4L53A 4D2SA 3E8DA 5AM7A 4RC3A 3DU8A 5GZ8A 5L6PA 2XF0A 3A61A 5KZ0A 4XP0A 4L67A 3I1AA 1Z57A 3RPYA 4RJ8A 2R0IA 4R5YA 1W0XC 3TIYA 4DFLA 1P4FA 2CMWA 1Q24A 2XIRA 1B38A 3NRMA 3EN7A 2OJFE 3PSCA 2JDSA 1OIYA 3K2LA 4O0TA 3ZLSA 3R73A 4OR5A 2W1HA 1OGUA 3F88A 3MJ1A 3ORMA 1W2FA 3JVSA 4U44A 4USEA 4AXFA 3R8PA 2YABA 5HICA 5HG9A 1Z9XA 3SG8A 3QD0A 5E8SA 2C5YA 5AUTA 4UYNA 4UMPA 5EG3A 3D0EA 3FQSA 4BCKA 2ZB1A 2C6OA 5DVRA 5E1EA 3TTJA 4C4EA 5TR6A 3V01A 3DXQA 3QYWA 2X2MA 2E9OA 4ANSA 4D1ZA 2GQRA 4MCVA 4G1WA 4C8BA 2UW7A 5JSMA 5HG5A 3GVUA 4U5JA 4K2RA 4XG8A 4UYAA 5HTBA 2ESMA 2DQ7X 4UMUA 3UC4A 4IEBA 2BFYA 3BWFA 2YITA 3LXPA 3DKFA 4PMSA 3AC1A 4IH8A 4EOQA 4EYJA 3VBWA 3H9FA 4YTFA 4W9WA 1W98A 3PG1A 2W7XA 1NY3A 4GUBA 4Y95A 3TDWA 1OPLA 2WZJA 3VRYA 1J91A 3PFYA 5C27A 5CEQA 4O4FA 3HAVA 5DOSA 5HZNA 4FVQA 2ZVAA 3IECA 4F1MA 1OL7A 2XRUA 3HV5A 3OF0A 3PY1A 1URWA 2BZHB 3AT3A 1WBWA 2ERKA 3DZQA 3NEWA 5J8IA 4WG4A 5FM3A 1P2AA 3DLZA 3GCVA 4AP7A 2ZV2A 2ETMA 4PL4A 3FJQE 3PXFA 2GFSA 4N6YA 4PPAA 2HZ0A 2W9ZB 5EM5A 3BYVA 4EKLA 4U3YA 4G5JA 4O86A 5BVOA 3W33A 4CRSA 4J95A 4FE2A 4GRBA 4UB7A 4EOPA 2VNWA 2W1IA 3O0GA 2JDTA 3MPAA 1JLUE 3D7ZA 3OW3A 1QPDA 4O21A 4BL1A 2UZVA 3TNWA 2WAJA 3IOKA 1UU7A 2XB7A 3F3TA 3QTZA 5K4JA 4BFMA 2O8YA 3O23A 4O7TA 5DE2A 5JFXA 1OL6A 4BDEA 4DBXA 2R3RA 2VTJA 4D4YA 5B2LA 2C6EA 3BGZA 2XS0A 5FTQA 2FGIA 1Q5KA 1PHKA 4XG3A 4TYHB 3W32A 3KXNA 2WEIA 4MNEA 4PWNA 4ACDA 4BZDA 3BHVA 4TTHB 5L2WA 3DKOA 1PMNA 4TW9A 1H4LA 3UDZA 2IZRA 5A9UA 5L2TA 1XQZA 2C6DA 4RJ7A 4WNOA 4IB5A 3COIA 4D2VA 4AN3A 4QMLA 3VUHA 4C58A 4DGNA 4O7WA 4AW1A 3DPKA 4IIRA 4W8DA 3GU8A 3I5NA 4D0XA 1E1XA 4EOSA 5E8ZA 3Q53A 5BVDA 2IEWA 4P7EA 3MH1A 3H0YA 1ZYJA 4HVHA 2X7OA 2YM6A 3MVJA 3VN9A 4MBJA 4MX9A 4NFNA 3E8CA 1YQJA 5BPYA 4MEDA 5JMSA 1U46A 3FI2A 3FKOA 4YUQA 5E92A 4QMVA 2Z7QA 2ITOA 4RMZA 2XKEA 5IA5A 4QP4A 3Q4ZA 2WNTA 1YVJA 5HE0A 4NTTA 2PHKA 4BDGA 1RDQE 4O38A 2R64A 4Z16A 5CF5A 4FVRA 2O64A 3WF5A 3CGOA 4B99A 2WQBA 4ID7A 3P5KA 4O0UA 4YTCA 2QHNA 2FO0A 5CEMA 2IVVA 3ML1A 2BR1A 3A7GA 4XRJA 2JEDA 3R28A 4MBIA 4Q9ZA 3SG9A 3KRXA 3C0GA 4DHJA 4BKYA 3DDPA 5EM6A 3VAPA 3PSDA 3TV7A 3VS4A 4MBLA 3JUHA 4FZ7A 5D7VA 2PE0A 3JVRA 1AQ1A 3QF9A 5B2MA 1PYEA 3QXOA 4LRMA 2CCIA 4MTAA 2J9MA 3KRJA 1VLRA 4D55A 3WYXA 3MY1A 2VWXA 2VTHA 3E8EA 4UWCA 5CNNA 2XK9A 2GPHA 3VUMA 2VWVA 4V05A 3HECA 2QG5A 1ZLTA 2W0JA 1Y6BA 5EH0A 3TDVA 3QZIA 1TKIA 5C4KA 1ST4A 4QP7A 4HCVA 1YWRA 5C9CA 4IWQA 2VZ6A 2IO6A 3EFJA 2R0UA 3HDMA 1FOTA 1WBOA 2HYYA 4BVUA 3KK9A 4DT8A 4G3EA 3GT8A 4BF2A 1WZYA 1QPCA 2BRGA 4JR3A 4RZVA 4BDJA 5IQGA 1G5SA 4FSQA 2QOQA 4OTHA 4YJUA 3UJGA 3FPQA 1UV5A 4P5ZA 1TQIA 4FTKA 4XG6A 4X3FC 5AUZA 4RX9A 3FI3A 4I6FA 4QYGA 4E6QA 4HNIA 1JVPP 3SVVA 3HAMA 1GZOA 3NUAA 5BYLA 4FYNA 2BRBA 3HMMA 2YJSA 4YJRA 5IDNA 2QCSA 3UTOA 2CKQA 2JDRA 3PA5A 5F9EA 3MPTA 2Y8OA 4LMUA 3WF6A 4RFZA 2VD5A 3UYTA 3FLWA 5IA0A 4E73A 4FTUA 3UNJA 4WNMA 2IZUA 5B2KA 5HORA 3AOXA 3QRUA 4H3QA 3RMFA 4JXFA 2C1AA 2C30A 4ZJJA 4QMZA 4XEYA 2XBAA 3QXPA 2PL0A 5EHLA 2NYAA 3ROCA 4Y83A 1DI8A 2QO9A 2OZAB 3QC9A 4FV1A 4PRJA 4QNAA 3TV4A 3ZHPC 4CV8A 4CKIA 1ST0A 5BVKA 4AS0A 3PRIA 4DLJA 4LOQA 4MYGA 5CYIA 4JX3A 1OKWA 2OIBA 3KC3A 3PWDA 4TNBA 2W1CA 4YJPA 3OXZA 3DBDA 2PULA 4FZ6A 2QOIA 5AR4A 3L8VA 4FI1A 2R3IA 3PXQA 3QCSA 1IRKA 4HYUA 5LVOA 2YCRA 1IAHA 2R3LA 3P7BA 4C3PA 4OTRA 4O0WA 1JKSA 4AN9A 3PY3A 1JOWB 3L8XA 3HUCA 4YZBA 4EK8A 3GFEA 2J2IB 3R83A 4MD9E 3QFVA 4U9AA 2Y6OA 1BKXA 5C26A 2IW8A 2VGOA 2OXDA 1F3MC 4OLIA 1OKZA 3BI6A 3VUIA 4FC0A 4I22A 4USDA 4RWJA 2OGVA 3O17A 5ANJA 2G2IA 1SNXA 4MQ2A 3QCYA 4AZSA 5IF1A 3KEXA 4AA5A 5J9ZA 4N6ZA 4J96A 3H30A 5M07A 4ORKA 4KKHA 2J90A 3ORKA 2BIKB 5IH4A 2C5VA 4NEUA 2QC6A 5AUXA 3OS3A 4ZSGA 3IW6A 3MGYA 3SW7A 2WMUA 3HNGA 1FVTA 4GIIA 3DB6A 4MQ1A 4XP2A 3PVWA 5HTCA 3LLTA 2HAKA 5I9XA 2WFYA 4O22A 1QPJA 4O7SA 2QOLA 3PXKA 3AC2A 3MIAA 4NWMA 5IUIA 2YLEA 4I6HA 3G51A 4LRJA 1PMEA 3TJCA 1WMKA 2OF2A 2QR8A 4BGQA 4E4NA 5F4NA 2H96A 3L9NA 4RRVA 2GSFA 2VTMA 5FP5A 4EH9A 4O96A 4EJNA 4F7JA 2X7GA 3DAKA 4OT5A 4EHVA 1VJYA 3ZU7A 4PDSA 4XG9A 1OIRA 4H3PA 3OEZA 1DAYA 4ZTRA 4GFGA 3LVPA 3N9XA 3U55A 3PYYA 3W10A 3U9NA 2UW8A 4CMOA 4FKGA 3E88A 4PMTA 1UKHA 2E9VA 2W96B 4EOIA 2CKPA 3ZZWA 4J52A 1OL2A 2PVJA 2XCHA 4AQKA 1KWPA 2GS6A 3PXZA 4D4RA 4MKCA 1Q99A 4JAIA 4KAOA 4BCMA 2JBPA 3FXZA 5ITAA 3DXPA 1YI4A 4FTTA 5IZFA 2OH0E 4F1TA 4F9BA 2XAOA 4IX3A 2CNVA 1M2PA 4BHZA 3UQCA 4ITIA 3ZXTA 3OC1A 5EQEA 4BKJA 2P2IA 4AZEA 5HU3A 3V5JA 4FT5A 4HYHA 4TXCA 5GZAA 2OJGA 5DR2A 3SRVB 4JLCA 2XM8A 2WKMA 3IONA 1QCFA 4RVKA 3OUKA 1PYXA 1Q3WA 1Y6AA 3C4WA 3KMMA 4O0XA 1NVRA 2QD9A 3R71A 4FOBA 4JJRA 4PL5A 4EQMA 4HGLA 4GUEA 3TI1A 4DE4A 1ZY4A 3TV6A 3LMGA 2ITWA 4EORA 3E87A 4NW6A 3QHRA 4E4LA 5JEBA 3QX2A 3R7YA 2R3JA 3D2IA 3QQJA 4MXOA 4KIQA 2O2UA 4X3FB 4LGDA 4M14A 2LGCA 3L9LA 5KKRB 3CGFA 5EKNA 2QU5A 3KULB 2I1MA 3FBVA 3VS7A 4XMOA 4ERWA 5DFPA 4WBBB 3R8MA 2XIKA 4KBKA 5IPJA 1STCE 2WMAA 5DG5A 1GIJA 2ITTA 3D4QA 3NW7A 2RGPA 3ODYX 4FTJA 5E8UA 3RPSA 4YNOA 3C4CA 4TKSA 4Y72A 4CFVA 4X2JA 3GFWA 3MWUA 4RT7A 3OY3A 3FLNC 4ZTHA 1REKA 4ZTLA 2W1ZA 4YC8A 2BTSA 5A54A 2J5FA 5H3QA 2G15A 4M97A 4D5HA 3GEQA 5HI2A 5FEQA 3VVHA 4FV0A 2HK5A 3VUDA 2I0VA 2IWIA 4FIHA 3FL5A 4BHNA 1YDRE 4QPMA 3D5WA 5L6WL 5HESA 4RVMA 5K0KA 3ATSA 5EI6A 4E1ZA 5E8YA 2WHBA 4YTIA 1ERKA 1PXNA 2C69A 3I7BA 5IQFA 4BWKA 4M67A 3QKLA 2I0EA 4YBJA 4P2KA 3MW1A 3VW6A 3C5IA 2NRYA 4R7IA 3ALOA 3A60A 4H39A 4WKQA 3RPVA 4YJSA 2HW6A 2WMTA 3GU4A 2ZB0A 2QOHA 3BLHA 3VS1A 4C4JA 3EQGA 1JWHA 4QP3A 4PTCA 2X9FA 4EUUA 5K4IA 5JRQA 4KA3A 1DS5A 3PG3A 2WQNA 5JGDA 4IACA 3KXGA 3ZDUA 4EK3A 3I6WA 3FZPA 2FA2A 4O81A 1SMHA 2DS1A 4R7HA 3WIGA 5CAPA 4DHZA 3II5A 4FKPA 3UVPA 1A9UA 5K3YA 4WO5A 2Y4PA 3AC3A 5CU4A 4EOLA 5DI1A 5IH6A 5JQ8A 5K0XA 2PWLA 3ZO4A 3SGCA 2QNJA 3EQHA 4RA4A 1Y8GA 4GG7A 3AC4A 5I9YA 3R7VA 4UV0A 4FV8A 5AUVA 4FEUA 3W2QA 4R77A 2XYUA 4UWYA 3MESA 3TT0A 5CU0A 2CN5A 2I0HA 2QOFA 3CP9A 4Y46A 2XIXA 4XV2A 4F7LA 3VC4A 4WSYA 2IW6A 3I81A 4DFNA 4XV3A 4JVGA 1I09A 3QCXA 5DGZA 5EDPA 4IBMA 1P5EA 3QAME 3RHXA 4A4LA 1JBPE 4DGOA 1PKDA 2R7BA 3GU6A 3LCSA 3Q4TA 3NYOA 2ACXA 3K3JA 5CF6A 4OTGA 5IQBA 3QD2B 5F20A 4HGTA 3TKUA 3MI9A 4YO4A 4RC4A 3VJOA 4XOZA 2B52A 2VX3A 3FYJX 1CKPA 4QOXA 2PE2A 3WILA 4MUQA 3D9VA 4DH8A 4IWPA 4CKRA 1FINA 5DR9A 5M44A 5I9ZA 5D9HA 5AJQA 5AUYA 3OMVA 2W99B 3ORTA 3QLFA 1SVGA 2J7TA 1F5QA 3V04A 1YWVA 3A8WA 4AG8A 3R1QA 4ZIMA 5JQ5A 5LVLA 2XUUA 4IDTA 4P5QA 5E4HA 1GY3A 4DBNA 4FMQA 3U4WA 2VTRA 4G3GA 3LFAA 3FMEA 1WBNA 5HQ0A 4I23A 5IA1A 3UDSA 3TG1A 1CKIA 3D2KA 5ANIA 1G3NA 2C6IA 2CGXA 4W4YA 1H1WA 3NUUA 2C68A 4LG4A 3P1AA 5HX8A 4DGMA 1PXMA 3K54A 1O6LA 3Q9WA 2C0OA 2Z8CA 1UA2A 4CLJA 5CU3A 4JG6A 4NL0A 2BRHA 4BICA 3OFMA 3NS9A 3DJ5A 2KULA 4L43A 3W2OA 4O0RA 2OW3A 2XRWA 4C3RA 1O6KA 1OUKA 3AD5A 3S00A 4LYNA 4FZFB 1FGIA 1SNUA 2UZTA 3O50A 4OBOA 1I44A 4BDCA 4YHJA 4D9UA 3UOLA 2BDJA 4BYJA 3EHAA 3MJ2A 4NM0A 3VUGA 2JAMA 2R3MA 5F1ZA 2F7EE 4CCBA 3UIBA 4LRKA 4IXPA 2GMXA 4OW8A 5KMMA 3GC8A 4K11A 3SQQA 1DI9A 2XNPA 4I21A 4K9YA 4R3CA 2IG7A 4BTKA 5CX9A 3ORIA 3Q2MA 4C3FA 5LWNA 4RVTA 5F95A 4F63A 3DCVA 2GS2A 4HPUE 4APPA 4IAAA 4BI2A 3Q9ZA 4FSYA 2GTNA 2XKCA 2QONA 2YZAA 3WZJA 2X8IA 1CMKE 5EM7A 3UZRA 3DLSA 2UZWE 4IANA 4QDEA 2RFNA 3MY5A 3R1SA 1F0QA 4D2TA 3FKNA 4J53A 1UNLA 3S2PA 3QTRA 1R39A 4M3QA 4FNZA 4RQVA 4IB3A 3WZEA 3U6JA 3M1SA 3FZTA 5CTPA 4F78A 2ZV8A 2BKKA 3ZM4A 3EQCA 4PTGA 3LIJA 4QO9A 2VTSA 5J1VA 3W0SA 4QMQA 2BAKA 2ETRA 1JQHA 2PMIA 4F0FA 3Q5IA 4RX8A 3TJDA 3OXIA 4C37A 5GZ9A 4N57A 4IADA 3FLZA 5H9BA 4QP8A 4O83A 3UPZA 4BI1A 2LAVA 2OU7A 4TRLA 3C1XA 3DOGA 5AV2A 5E8TA 2XK3A 2VGPA 4D1SA 4FVPA 3DBFA 2CNUA 2VO0A 4ZY5A 4PDYA 5AP3A 3UO6A 3PA3A 4FTIA 4GVJA 3O71A 4EC9A 3IGGA 3LM0A 5HE2A 4EC8A 2B4SB 5JZJA 4JDJA 3FMNA 2PVMA 4E3CA 3FZRA 2G2HA 2JD5A 4PX6A 4BWXA 4HVSA 3PRFA 4O6EA 4F0GA 5CAOA 4F6WA 2OJ9A 1ATPE 3E5AA 2XEZA 3HGKA 3PY0A 4APCA 4AU8A 1H1SA 2Y9QA 4O0YA 4ZTQA 4BIDA 2OO8X 2YAAA 4M13A 3T3UA 2BUJA 5KMLA 3QQUA 4XJ0A 3R9HA 3UOHA 5CXZA 4I0SA 5IEXA 4OBPA 1JAMA 2X8DA 4Q9SA 4PTEA 4QEBA 2J51A 2YJRA 5J9LA 3QGWA 4FKJA 3W0OA 2VWYA 4Y85A 4QPSA 4AZWA 3CPCA 4D0WA 4M8TA 2XK4A 1ZMVA 4LUEA 4ANNA 4L8MA 4MXZA 4JRVA 3EL7A 2PPQA 5GJGA 2WB8A 5AWMA 4DYMA 2YM4A 3BV2A 5AMNA 5FXQA 4IM0A 1ZOHA 4X2GA 5HCZA 1V0BA 1Q8WA 4I93A 3KU2A 2WOTA 3EFWA 4EBVA 3FWQA 4NU1A 3DJ6A 4ACHA 2Y6MA 5CQWA 3G33A 4GK2A 4ZY4A 4QYYA 2NPQA 4B0GA 3LMHA 1JSVA 3TEIA 2W1EA 4FICA 4DHFA 5J1WA 3QZGA 2R3GA 2VN9A 2OIDA 4KWPA 3QL8A 2IVTA 3ORPA 4JBVA 3C51A 3O8PA 4MNEB 3QRIA 4XUFA 4HVGA 5E1SA 2BALA 5AR3A 4BCIA 5HD4A 1HCLA 3TXOA 3HA6A 5JT2A 2F4JA 4A9RA 3JR1A 4IM3A 3VS2A 4ERKA 4R6VA 2PVKA 2BHEA 5JRSA 3V6RA 3VONA 3R9NA 3MVHA 1XH7A 4WBOA 2PMOX 4WOVA 3W18A 5DWRA 2OKRA 3LZBA 2F7ZE 3OVVA 3P7AA 5FXSA 2XANA 4U97A 2AUHA 3UG1A 2ZM1A 1DAWA 3MVLA 5KCVA 3EKNA 4TYIA 3V5LA 3WF7A 4I41A 3OTUA 4KNBA 3SAYA 3FLYA 4FTRA 2GTMA 4BWPA 4S2ZA 4TWOA 5J5SA 3LHJA 1Q61A 2UVXA 3QQFA 3DBEA 3I0OA 4O7LA 1LUFA 4LFIA 4PY1A 4TWNA 3R9DA 2OJJA 2X4FA 5EW9A 1IASA 4ZK5A 2JKKA 3AC5A 3P86A 3QLGA 5FP6A 3NAYA 2C3KA 3DV3A 5IA4A 4I0RA 3UZPA 5DT0A 4NKAA 4IWOA 4QQTA 4U43A 1U4DA 3T9IA 4D2RA 2YIYA 3KF4A 3QWKA 4L68A 3Q3BA 4KBAA 3QUEA 4AN2A 4DEEA 1CM8A 3D5UA 4C35A 4JNWA 3OWLA 4K8AA 2ITZA 2BKZA 4LOOA 2Z7RA 1J1BA 4USFA 4GU9A 3KN5A 3PZEA 2JDOA 5HNGA 1W84A 4K33A 3PDTA 3C4XA 2W1GA 3H9RA 4L01A 4FBXA 4PNIA 3A99A 5LMAA 5DEYA 4CQGA 2C6LA 2UZOA 3Q6WA 3SLSA 1BX6A 2ITPA 4DEDA 4TT7A 3GCPA 5IQCA 4XBRA 4NM5A 1VYZA 3F2AA 5GIOE 4L3PA 4O27B 3V8TA 5CEPA 3Q60A 1E9HA 4CGAA 2CHLA 4QRCA 5CVHA 3P0MA 4RIOA 1YHWA 3WBLA 3R1NA 3G90X 2PUIA 4DG0E 2CN8A 2OF4A 3BHYA 5HIBA 2PUPA 2UW0A 4A7CA 4E8AA 3WE4A 3S1HA 4IQ6A 4B6LA 5EHOA 4RJ3A 3EMGA 2P4IA 3OP5A 5JFSA 2G01A 2R3KA 4LI5A 3EYGA 4OTIA 2UW6A 4TYGA 3SX9A 3BU5A 4CT2A 3OEFX 4F70A 2XNOA 5GNKA 3IOPA 4YJTA 4AZVA 4D4SA 4IM2A 2UZLA 2W4OA 3E63A 3A2CA 2VWZA 3V5QA 5C8KA 3KREA 5FUTA 5LOHA 3GGFA 1LEWA 2P3GX 5L2QA 3SHEA 3W16A 3LLAA 3SV0A 1BYGA 1XKKA 2B53A 3TN8A 3FSKA 3R6XA 3PSBA 4UWBA 4YHFA 5I3OA 5TT7A 4JG7A 3PIXA 5IMXA 5FLFA 5L4QA 4U7ZA 3H0ZA 4DT9A 4YLJA 4F7NA 3ZRMA 4I6BA 4HPTE 1NVQA 3GOPA 3RPOA 4WHZA 4NUSA 3UYSA 3Q4UA 2DWBA 4IC7A 4J97A 4NM7A 3VS5A 2Z2WA 2O63A 3ZSIA 3BEAA 1XJDA 4DAWA 4RJ6A 3QTUA 5HO7A 1B39A 3PVUA 4QTCA 3R9OA 1XBCA 1PF8A 2PY3A 5HLWA 4Z7HA 3POZA 5FWKK 5M55A 3BWJA 4ALWA 1T45A 4JI9A 1JSUA 4RFMA 3U8WA 2CLQA 1ZZ2A 2EU9A 4J1RA 4FEVA 4K77A 2C0IA 1OBDA 4PP9A 4YJVA 3V5WA 3AQVA 3FXWA 5HKMA 1SVEA 4CCUA 2VO7A 4U41A 2W9FB 1WFCA 3DTWA 5DYJA 4YURA 2PZPA 3OROA 1JSTA 4KS7A 3TACA 3C50A 5KMIA 3CKXA 4DDIA 4IFGA 4QYHA 4ASDA 5J9YA 3UQFA 5EQYA 2W06A 4RA5A 2WTKC 3ID6C 3F3ZA 4ZS4A 4ITHA 1MUOA 2YCSA 4G16A 4NKSA 3LCTA 2FVDA 5LMKA 2HIWA 3PE2A 4O4CA 3RAWA 3TWJA 4ZSLA 1ZOGA 2A0CX 3A7JA 4IZAA 4O4BB 3TNHA 3KMUA 3AGLA 4G31A 4BKZA 3VS3A 3DNEA 3OD6X 3DFCB 4FNXA 4FSRA 4RIYA 4OAVB 5CWZA 2XM9A 4P4CA 4NYEA 1R1WA 3CS9A 1J1CA 2PVNA 3ZRKA 5C1QB 3UP2A 4FL2A 5M4IA 5AFVA 1PJKA 4RVLA 4MHAA 4ALUA 5A4QA 5E7RA 4U81A 1QL6A 2OSCA 4AT4A 5HOAA 4C2VA 2G2FA 2CPKE 5BYZA 4O84A 5KZIA 3P9JA 4FZDB 3UOJA 3LPBA 3R00A 4FKLA 3TNQB 5KUPA 4YMJA 3W0NA 3AKLA 4QP9A 4IDVA 3D94A 3SOCA 4DC2A 4WUNA 5A3XA 4AAAA 1PXOA 2W5HA 5BUEA 4CKJA 4D9TA 5IUHA 1Y8YA 4IFCA 5IH5A 2R3QA 5LMBA 4AX8A 4UMRA 5K5NA 5K9IA 3EN6A 3CJGA 3RCDA 5J79A 1OVEA 1U54B 3KGAA 3KXMA 4WUAA 3I60A 4DEBA 3OHTA 3BZ3A 5L3AA 3MS9A 2Q0BA 3DBQA 3GC7A 4XS2A 3OCBA 3EN4A 3VW8A 4L44A 4XG7A 2PVRA 2BFXA 4TYJA 2RF9A 3FMLA 3V51A 3BLAA 1PXJA 4EBWA 3HA8A 3UZTA 5FBNC 4ENYA 2W4KA 5BYYA 1O6YA 2JBOA 3BU6A 3HRFA 3R7GA 5D11A 5KKRC 3VRZA 4D2WA 4DTKA 1YOMA 3JY0A 5HCXA 3LOKA 2G9XA 2OJIA 2NRUA 4E4MA 3HDNA 3EQDA 4JBQA 4L9IA 2PUUA 3COHA 4FG8A 2P0CA 4GYIA 2UVYA 5KMKA 4FK6A 4ZSAA