3FUPA

Crystal structures of jak1 and jak2 inhibitor complexes
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
284
Chain Sequence
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDQMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Dissecting specificity in the Janus kinases: the structures of JAK-specific inhibitors complexed to the JAK1 and JAK2 protein tyrosine kinase domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 284
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fupA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fupA01
2WOTA 4U41A 4JBPA 5HO7A 3VS6A 4Y83A 3OT3A 4U3YA 5CEOA 1UKIA 1Q8YA 2OBJA 3ZFXA 1JQHA 1QMZA 2WEVA 3BGPA 3UIMA 4FIGA 3OFMA 4TYHA 1HOWA 4KIQA 3KXXA 4Z7GA 3CBLA 3HV3A 4ZSAA 4AT4A 1OECA 5IA2A 5LQFA 3FWQA 3OCBA 4XLIA 4KIKB 5ICPA 2HY81 2XZSA 4DC2A 2Z7LA 2B0QA 2WOUA 4EHEA 5L3AA 1R0EA 4HGSA 2QOCA 4XOZA 4YBKA 3TJCA 4C57A 1UU8A 5E9EA 4UYAA 3PLAE 3R0TA 3KGAA 4G31A 1OBGA 2YAKA 4OW8A 1WBWA 1XBCA 3Q9XA 3E5AA 4PPCA 4Y95A 5C4KA 5HI2A 3NVKI 2WO6A 1M52A 4O7TA 4BY9E 4XJ0A 5CNOA 2R3LA 4OTPA 5F4NA 4FL3A 3MYGA 4PV0A 4YPSA 4C33A 2QVSE 2YHVA 4FR4A 3OWJA 3GP0A 4L3LA 4BWKA 5HNIX 4UWYA 4WRGA 3BYMA 4HVIA 3MH1A 3D7TA 4O83A 2EXCX 4FVQA 2YCRA 4X3FA 3VULA 4PDPA 4EH9A 2W7XA 4AE6A 5HBHA 5KKRC 2FO0A 3F5XA 3C4FA 2YM3A 4Q2AA 3DBCA 2I0YA 4XUFA 5FP5A 1JVPP 2X7FA 1R0PA 2PVLA 2UZTA 2WQNA 2XKEA 2XMYA 4L45A 1PHKA 5DG5A 3LFEA 2ZDTA 2PVKA 3NNVA 3W2QA 4E93A 4R7HA 4FA2A 3ODYX 3G0FA 3QQUA 4FYOA 4YBJA 4YJRA 4CLJA 3A62A 5KMMA 2B4SB 4D4YA 3TNHA 3QC4A 2BTRA 3C9WA 4IEBA 3TZ7A 3ULIA 3LMGA 1H26A 3NAXA 4GRBA 3NZ0A 5HIDA 4E4MA 1FVVA 3V01A 2XNGA 3DK7A 4J99A 5GINE 3F5PA 1RJBA 3PE2A 3FMNA 4IXPA 3HMPA 2BAQA 5CU3A 4E5AX 2OLCA 3LMIA 3KF7A 4S31A 3UC3A 2WQOA 3EYGA 5L6OA 1YRPA 3ZOSA 3O2MA 1WAKA 3GC8A 2GFCA 1YHSA 4QMUA 3BBTB 1J7LA 3R7YA 3NWWA 2Y4IC 5GJFA 3AC2A 2JLDA 1WBSA 1ZZLA 3ORMA 4U8ZA 3R9NA 4A7CA 4F0FA 4R3PA 2ZOQA 1W98A 3L8PA 3VS3A 2PZRA 1I44A 3HV4A 2OXXA 3AC1A 3QQKA 1GJOA 4YSJA 4FKIA 2A19B 4BR3A 5AUZA 3LPBA 4EHGA 3OXZA 5HG9A 3P78A 4YLKA 5I4NA 4QP6A 3KXHA 3QGYA 3A7HA 3HDNA 3QA0A 5AIRA 2ITNA 2PY3A 3TN8A 1YHVA 4GU6A 4YJPA 1H25A 1H00A 3I0QA 3Q96A 3O8PA 3NCZA 5DN3A 3SRVA 4LQMA 3WZKA 4ZY5A 1PXLA 2X81A 4OBQA 3WYXA 2JAMA 3UYSA 4B7TA 3R9OA 2C6LA 4XS2A 3F3UA 3LXNA 3D2KA 4EKKA 5EI8A 4OTQA 4JIAA 4G17A 2CPKE 3W10A 2REIA 2F7ZE 2PPQA 4PL3A 3ALOA 3GC9A 4AZTA 1P4FA 3ZMMA 3W33A 4F6UA 3IGOA 4OGRA 1UU3A 2C47A 4M12A 4HZRA 4RJ7A 4W4WA 5HIBA 3IOPA 5AUXA 3TG1A 4N70A 3OCTA 5AP0A 1J7IA 5A4QA 3K5VA 4M0YA 2H6DA 3F6XA 5E8XA 4O7YA 1UKHA 4DT9A 4IZ7A 5LMKA 3VS0A 3CGFA 2WKMA 5I9WA 1MQBA 3EQFA 3EQIA 4FX3A 3UOJA 4FEUA 3VS4A 1OB3A 4DFUA 2WHBA 3ZM9A 4GU9A 4IX6A 4R78A 2YWPA 2OH0E 4BIDA 1UWJA 2YIWA 3R1QA 5AR4A 2JDTA 2IG7A 3VN9A 4C7TA 3ZXZA 3R04A 4H58A 4C36A 2YIXA 2Z7SA 1U59A 2WMSA 5J1WA 4BL1A 3EWHA 3BU3A 3H0YA 5JRQA 4WG4A 4LL5A 4DH8A 5IA1A 3FYJX 3QCQA 1OVEA 4MD7E 1U54B 3OUNB 4FTKA 5ANOA 4GCJA 1YDTE 4R1VA 4QMLA 2HZ4A 4QQ5A 2Q83A 4EHVA 3DJ5A 3UNKA 3H9FA 3HUBA 3KRXA 4YHTA 2GHMA 1BMKA 3BIZA 5DRDA 2OH4A 3CJFA 3F3WA 5EKNA 4FIEA 3KMUA 3E7OA 1JSTA 4JG6A 4D58A 2C3LA 1V1KA 2GNFA 5CI6A 5M4FA 3CPCA 2W1HA 2YWVA 3WF9A 3RAIA 3KN5A 3MESA 2Y7JA 2GNIA 3HRCA 3R8VA 1XWSA 4O38A 4YZMA 3G90X 3R63A 1KOBA 1EH4A 5K5NA 2J5FA 3MPMA 1G3NA 5CEKA 1TKIA 5EDRA 3FLZA 3PXQA 4MYGA 4M67A 4E1ZA 2IJMA 2VUWA 2X4ZA 2ZV8A 4AZFA 5D9HA 4XRLA 2H34A 4FSWA 3HL7A 1LUFA 5C27A 4QMZA 2J0LA 3FXXA 5LCKA 1H1SA 4S30A 4F9CA 2QG5A 4XV3A 1M17A 3G51A 3UG2A 4FNYA 4IAYA 5AP4A 4ZY4A 3ZTXA 3KK9A 5CSHA 3QWKA 1M2PA 2RKUA 3ZUVA 2UZNA 3TTIA 5TOZA 2BZJA 3V5LA 5LXMA 1L8TA 3IW4A 2FA2A 3ZLXA 4IZYA 5JQ5A 2HW6A 2NRUA 2YIYA 3CKWA 4B9DA 4PF4A 3Q52A 4XEYA 4DFXE 4FTAA 2ZJWA 3I6WA 5KHXA 5DT3A 4C2VA 3AC3A 1WMKA 2OWBA 4RQVA 2WU7A 5BYZA 2UW9A 5FEDA 3N4UA 4R6VA 2GQGA 1OI9A 4EBWA 3PZEA 3D9VA 2YITA 3KMWA 3FLNC 4QQCA 2RFSA 2EVAA 4KINA 2CGXA 2GDOA 4UWBA 1WVYA 3OMVA 4FZ7A 4KIKA 2VTOA 4MNEB 5GJGA 4DGMA 4FE2A 4WNMA 4O0RA 3DB8A 4QP9A 3UO4A 1YKRA 3H9OA 4RSSA 5AM6A 5AUYA 1O6KA 5A46A 2Z7RA 2RL5A 4KRCA 4R5SA 4D0XA 5J9LA 3ANRA 4LUEA 2VTLA 1OGUA 3GCQA 5DGZA 5E8VA 4YMJA 5IQFA 5CF5A 3CEKA 3LCOA 4JX7A 1ERKA 3HP5A 2QOQA 5E8TA 4ZXTA 1J3HA 4Y72A 3TI1A 4ACDA 5BVOA 3CSVA 3MB6A 4YTIA 4PTGA 1OBDA 4BICA 4DTBA 5CAPA 2QQ7A 2YERA 4QMXA 1W83A 5CU6A 4BDCA 3A7FA 2PVJA 3I81A 4AN3A 4N57A 2ZDUA 3GU4A 4BCQA 4F63A 3I60A 4X21A 5IKWA 3ZFYA 4CV8A 3JXWA 4E7WA 5A6OA 1KV2A 5HEZA 3HLLA 3COMA 3C4EA 3IW5A 5D11A 4ZLYA 3R7GA 3UGCA 2WMVA 2P0CA 3LKMA 3U87A 1FMOE 3R8LA 2WTWA 3VQUA 5BX0A 1FOTA 4A4LA 1Q3DA 4EONA 2GFSA 2XH5A 2XK8A 3UC4A 2ITOA 2R2PA 3ORKA 5DT4A 5HVYA 5JZNA 3FY2A 1BUHA 1VR2A 2VZ6A 2OJ9A 4EZ3A 1VYWA 2VWUA 4FT0A 4C4GA 2CJMA 4FSNA 4QP7A 4D55A 5DR2A 3RI1A 3TTJA 1FPUA 4ZLZA 3D15A 4EH6A 3F61A 1GNGA 4O7LA 4E6AA 5A14A 5HD7A 2BALA 4EC8A 3MA6A 4FZFB 3D5XA 2ITQA 2QO2A 2PUUA 3V5QA 4ZTQA 3TKHA 4OAUC 4GIHA 4NTTA 2V7AA 1Q8ZA 3ZZEA 2DUVA 5E7RA 3V6SA 3GB2A 4UMTA 2B53A 4UB7A 4YO4A 2J4ZA 4RJ4A 5HBJA 5L2IA 2PHKA 3UP2A 2CCHA 4LGDA 3NX8A 3FSFA 2Z60A 1VJYA 3AC5A 4LM5A 3W1FA 4O96A 3A4PA 4QNAA 2GS6A 2OXDA 3PE1A 5IQAA 4KAOA 4E5WA 4IVBA 4EOPA 5DE2A 3PA4A 4R5YA 4FSQA 4M15A 4LL0A 4DF3A 5AX3A 5T68A 4ZY6A 3PYYA 4ZOGA 2AC5A 4FK6A 4BF2A 4PMPA 4TYJA 1FVTA 5A3XA 4RBLA 4GEOA 3RGFA 3BLHA 1JSVA 4IZ5A 2V5QA 2XYNA 5AEPA 1PKGA 3NYXA 2O65A 4YC8A 3BLQA 5HBEA 5CU0A 5L2WA 2UVZA 3Q2JA 3NS9A 4BDGA 4NCTA 4EOOA 4RFMA 5B0XA 1WVXA 3OHTA 4ID7A 5E8ZA 3TNQB 1IR3A 4N4SA 2HZIA 3CKXA 3Q5IA 2J51A 4EOQA 4O22A 3HZTA 3TDVA 1B39A 4UMUA 4FUYA 4KS7A 5J8IA 4IX5A 1ZY4A 3DV3A 4XG6A 2XNMA 1ZARA 3RWQA 5CSVA 2VTMA 1YXSA 5CVHA 5M53A 3UMWA 3ZDIA 4YJVA 4Z9LA 1W8CA 4LV8A 3TUDA 2UW4A 1Z5MA 3V5TA 1W84A 5DLSA 4I24A 3TIZA 2UVXA 3GOPA 5CX9A 3HECA 4GV1A 5CZIA 1WFCA 2JDOA 2E9PA 4TY1A 5CSPA 2WU6A 4XV2A 3R30A 3SOCA 2OZAB 3ERKA 2OK1A 1J91A 2C6DA 2H96A 4RWKA 3ORXA 4AA5A 5ACBC 4A9UA 1U54A 3D7ZA 2SRCA 3I79A 5FTQA 3QALE 3RNIA 5M4UA 4G5PA 3PVWA 4WUNA 2PUPA 2F7XE 3VBTA 4U7ZA 4H3QA 4FI1A 4F08A 4I5MA 3NUYA 4QQJA 4BCNA 4BCOA 4A9YA 4HW7A 3OD6X 3QA8A 5E8SA 2C6IA 4JRVA 4QP2A 2FH9A 3V6RA 4IWDA 4EWQA 4Z3VA 3F2RA 1M2QA 3RJCA 4FL1A 1JNKA 2EB2A 3II5A 4K33A 4WBBB 4BDIA 3KC3A 5AV0A 4CQGA 3ROCA 2R3HA 4F1MA 2JFLA 4TRLA 5K4IA 3ZSHA 1J1BA 2PTKA 3NW5A 2QOKA 4NJDA 2WTIA 3QD0A 3ZUTA 5JFSA 3M11A 2PE0A 4OLIA 1SNXA 3OY3A 3R7UA 5KNJA 5AA9A 5JGDA 2G2FA 4ZJJA 2RFDA 4RX9A 5M57A 4J52A 2F49A 2UW5A 5KZIA 4ZTMA 5DH3A 2V0DA 2YJRA 4FTQA 5ANIA 1P2AA 3DAKA 4QYEA 4EQCA 4ERWA 3DXPA 3ATTA 3DBFA 2BKZA 5L8LA 4JVGA 2OGVA 2XIKA 3O50A 4NU1A 4IB5A 5GIOE 4CLIA 1H1QA 2VO6A 1ZRZA 3I0OA 5F20A 4EK3A 3OZ6A 5L2SA 2XK4A 3VS7A 3DXQA 1JKLA 5EOLA 4BCFA 5C03A 4IM0A 4IANA 4UALA 4HVDA 2I40A 3KF4A 3R7IA 4DYMA 5F1ZA 4XX9A 3C1XA 2ZV2A 2PUIA 3R7OA 4FL2A 3WE8A 4ASXA 3G9LX 4QO9A 4FV1A 3K5UA 4PP9A 4U79A 4EZ5A 3V5WA 3W18A 1YXUA 2PZPA 4QMNA 4H05A 5E92A 3VS2A 4IC7A 4JBOA 3MSSA 5DOSA 4D5HA 4ARKA 2AUHA 4BIBA 4WNPA 1OMWA 2VGOA 4CG9A 2CHLA 3ZEWA 5CAUA 4YZBA 2GTNA 2QOFA 4MNEA 4QMOA 5AR2A 1P5EA 2JITA 3C0GA 1ZLTA 5AM7A 4F9BA 2NO3A 2W17A 2QODA 4JDHA 3I5ZA 3SHEA 5KE0A 4GUBA 3MDYA 1Q97A 4BWPA 3PJ1A 3RM7A 3EB0A 3LXPA 2XVDA 3ACKA 1B6CB 3F5GA 5CNNA 4F0GA 2HWOA 4ANNA 4QT1A 4UV0A 4R3CA 2YM6A 3QRKA 4GW8A 1RQQA 2BIYA 3FZPA 3EQDA 1MQ4A 3OOMA 5AA8A 1H0WA 2RSVA 4DH3A 4DLJA 3VVHA 2DWBA 4GT4A 2Q0NA 3R71A 2QU5A 2ZMCA 3B8QA 3O8UA 5CU2A 5GNKA 5KBQA 5J87A 3Q3BA 3R00A 4FTNA 1YWNA 2B1PA 1MRUA 4FICA 4QYYA 3C51A 4AGUA 4KSPA 5LMKC 5CT0A 4LOOA 3VAPA 3VQHA 5I0BA 5CANA 2PVHA 4CMOA 4FKWA 2OSCA 2FSOX 1E1XA 2C5NA 4FBXA 4I22A 4CV9A 4RRVA 3W2RA 3UIUA 2GTMA 1TQPA 1WBNA 1XH8A 3KRJA 4E6CA 3QFVA 5HGIA 4O0SA 1CKIA 1YDRE 4O81A 4E6QA 3DLSA 3ITZA 4E26A 4QP4A 3RWPA 1XBAA 3R2YA 3AT2A 3P7CA 4AX8A 1H28A 3CPBA 3FJQE 4GK4A 4EH7A 4F99A 1YDSE 4DBNA 3QXPA 3O96A 3QTWA 2FYSA 4O7NA 2BMCA 3ZSGA 5CEQA 1FVRA 1XH9A 1DM2A 4L68A 1KE7A 2GPHA 3EKKA 4AW1A 5AFVA 3L9NA 4DINA 4YR8A 2ITPA 5FLFA 3WZEA 3LFFA 5JFVA 3LQ8A 1TQIA 5B2LA 4LI5A 1ND4A 3PXZA 4NKSA 3QTSA 4XG4A 4B4LA 4XYFA 4DGNA 5CVGA 5IEXA 3D94A 5AR3A 2LAVA 2BRMA 4A4OA 4ZMFA 3R21A 4ASZA 1GOLA 1SMHA 2WAJA 3DAJA 4ZTNA 4WNKA 2G2HA 3U9NA 5LVOA 3F82A 5JK3A 3DOGA 2HXLA 4D2WA 3EN6A 3TT0A 1DI9A 4QTEA 2VRXA 3FE3A 1PMUA 3P4KA 4G3DA 4OTIA 1ZWSA 3Q9YA 3FMDA 2PE1A 3FMEA 1OL6A 2GNLA 5DBXA 5ETFA 4RIYA 2W5HA 4QYFA 3D5WA 5DRBA 5FEEA 3F3TA 4MX9A 4WKQA 4ZJVA 4QMPA 2BRGA 4FIFA 3UVRA 4FIJA 4O86A 3ZSIA 2H8HA 3MBLA 4B6LA 3FMMA 2W06A 3WF7A 3R1YA 3Q6UA 1H24A 3BWFA 5AADA 2VGPA 3WBLA 1XH5A 3EYHA 5CLPA 1PMNA 3MVHA 4RX7A 2YJSA 1Q41A 4XP3A 3DTWA 4KS8A 2W1IA 3QQLA 3Q53A 3UG1A 3IGGA 2R3MA 4RJ8A 5J5SA 4XP0A 4AOJA 2ETRA 4Q5EA 3DJ6A 2VO7A 3NSZA 4YZNA 3TDWA 2J0IA 2BKKA 4GVJA 1DI8A 3OROA 4M84A 2B54A 4AQCA 3FZSA 2OZAA 1LEZA 3OWPA 2IVTA 1NY3A 4BDKA 3WF5A 3NPCA 1BYGA 3D83A 2PVFA 3R83A 4GFMA 5CSXA 3KFAA 3DK3A 4WSYA 3RBWA 1VYZA 4U5JA 1SVEA 4IMYA 2YDKA 3LCSA 4AF3A 3DKFA 3BHVA 3C0IA 3E64A 4FKTA 3FLYA 1I09A 4LGHA 4AW5A 2KTYA 4TNDA 5HLPA 4F9YA 3IW6A 4QMTA 1TQMA 4DE4A 5AUTA 4D2SA 1H1RA 1O9UA 3S4QA 4DEGA 5I9XA 1CSNA 3EHAA 2BPMA 4D2RA 1YVJA 5CQUA 5HX8A 2CGVA 4BBFA 5HCZA 2YN8A 1NA7A 2WELA 5EDPA 4YHJA 5AR5A 4JR7A 3ZEPA 2JAVA 3GC7A 5IUGA 5M09A 3UQFA 4OTFA 3VF9A 2PUNA 3QCYA 5F9EA 3EOCA 3U6IA 5CYIA 3FEGA 2G2IA 2XKCA 4IB0A 5BPYA 3FDNA 2C5VA 3TNIA 1KE8A 5AAFA 3VO3A 3VBWA 3IG7A 3MFSA 4N6YA 3OCSA 2VNWA 3TL8A 2RG5A 2XNBA 3NUSA 4I0SA 2ITUA 3BKBA 4QD6A 3UOLA 4F9AA 2RFNA 5ETAA 5HTBA 2G9XA 2PYWA 2VX0A 3KCKA 3QTZA 1Q99A 3HUCA 1BKXA 2C4GA 3P1AA 2CN8A 2OICA 2UW7A 1F3MC 1JSUA 2E9NA 2W1CA 5JFWA 5BYLA 4FKGA 3RPOA 3UYTA 3Q5ZA 3A4OX 4X6RA 2QHMA 4I5PA 4MBJA 1QPJA 3AT3A 2J5EA 3FKOA 5ANGA 4F4PA 5L4QA 2KULA 2C5OA 3NYNA 3TEIA 3DBQA 3KXGA 3KB7A 2XBAA 4FSYA 4K8AA 4EOKA 4EYJA 4F70A 3FI3A 4NW5A 3VHEA 2VTTA 3CY2A 3LCKA 2YCFA 3LFQA 4BZDA 1H08A 1OL1A 3BHHA 5HQ0A 3COIA 4JRNA 3DB6A 2VTAA 3CGOA 4FEQA 3EFJA 3T9TA 4FSZA 3EFWA 4GYGA 1ZMWA 2R3OA 4ANQA 3Q9ZA 2OJJA 4UMPA 4F7JA 1IA8A 4MD9E 4MQ1A 2DYLA 2BILB 2CNVA 1ATPE 2BUJA 5IA3A 3UODA 2GNGA 3IK3A 3P9JA 4WRSA 5EM6A 4G6NA 3IONA 3DGKA 3O17A 4BGHA 2UZVA 5GHVA 4C3FA 1PRYA 4DEBA 3E92A 3EQHA 4OBOA 3FKNA 4Q9SA 4JDKA 4XLVA 4A9SA 4AZEA 2VTRA 3QKLA 4RX5A 3FXWA 2YDIA 1YXXA 1PMVA 1Y57A 4M3QA 4FEXA 4P7EA 3ETAA 4ACCA 4DH7A 3BU5A 4FT7A 4QPAA 3KVWA 2C0OA 4JQ7A 4TYGA 4YJNA 4E4NA 4AT5A 5DI1A 5EI2A 5IU2A 3HMOA 3D5VA 3ENMA 4DEHA 2G1TA 4Q9ZA 5A4EA 3CP9A 5CQWA 2F2CB 5FGKA 1PXJA 3PVBA 3R9RA 3PRFA 4PDSA 3FQHA 2WMQA 5KO1A 4AAAA 2ITZA 2QO7A 3B2WA 3D2IA 4FGBA 3QUPA 2WQBA 4L7SA 4RZVA 5ANKA 4RLKA 3LM0A 4I4EA 4YZ9A 4GT5A 2OFUA 3IQ7A 3KKVA 4L43A 4MH7A 4Y5QA 1OUKA 2WMBA 2R4BA 3ZM4A 3DNEA 2YAAA 4CG8A 3LAUA 2VWBA 1PXNA 4O2PA 4L8MA 4ZSLA 3V3VA 3FPQA 4ALWA 4AOTA 3A60A 4YZDA 4F7LA 5LCJA 1XR1A 4JS8A 2CLQA 3W2PA 4DGGA 4MK0A 3NNXA 4IM3A 3MWUA 3QRIA 2X1NA 4UMRA 1UNHA 3R8PA 2QLUA 1YWVA 1PMEA 2V55A 5D41A 5I3RA 4OR5A 2JKMA 4O0YA 2XIXA 3E87A 1DAYA 3R8ZA 5HZNA 4IW0A 3AD5A 2YM8A 5H8EA 2QI8A 5HCYA 2W5BA 4O21A 1R1WA 4YURA 3TV6A 5CEIA 5AAEA 2W4OA 1OIYA 5JN2A 5EYMA 3BHYA 3RMFA 4FKQA 4YC3A 4LYNA 5FD2A 3UOKA 3ZFMA 4B8MA 5LVLA 4QMQA 2WTVA 1JLUE 4H1MA 3HA8A 2IW6A 3BHUA 4JQ8A 4BC6A 5KX8A 2I1MA 3LJ1A 3ORTA 5M08A 1E1VA 3EN7A 2W9ZB 1Q4LA 3KULB 4X7QA 4MXXA 3W8QA 2C68A 4NM3A 1Y8GA 4UEUA 3BLRA 3IDBA 3V51A 1WBVA 3SA0A 4J7BA 5KKRB 3RPYA 4GK3A 3LHJA 3NCGA 4JDIA 3MPAA 1REKA 3PRIA 2C3JA 2ONLA 3QLFA 2UZBA 5IH5A 2BROA 4ORKA 3OVVA 4TWPA 2O0UA 2JBPA 2VTPA 4RFYA 3C7QA 5DVRA 2ZM4A 5E1EA 3KXMA 3NW7A 4HYUA 3CTHA 4FNXA 4P90A 4K77A 4W9XA 3WIKA 4BTJA 2A4LA 3PP0A 2E9OA 4CMTA 3OW4A 2CNQA 1ZMUA 4XHKB 4C0TA 1BLXA 3OXTA 3QTQA 4V01A 2R3GA 2UZEA 4EBVA 5J79A 3KK8A 2J0JA 4MEDA 3Q2MA 2BRBA 5FWKK 2FSMX 4JT3A 4YUQA 2VTHA 5JFXA 3L9PA 1YXTA 3TZ8A 4EOJA 3OG7A 4I20A 5CAOA 3VW8A 2W1GA 1JBPE 4L01A 4PMSA 5BUEA 2QR8A 3HYHA 2J9MA 4NZWB 3LFDA 5AP6A 3S1HA 2VTJA 4FT3A 1VEBA 1XH7A 3QRTA 2FSLX 3NIEA 5IA4A 4X2GA 1IAHA 1Y6BA 2CCIA 3HAVA 5CWZA 4IADA 2GSFA 4IQ6A 3CC6A 5I9ZA 4QP8A 4DG0E 4I21A 4BDHA 3KXNA 3PY1A 3CTQA 2GNHA 3NUPA 4GMYA 5AJQA 3EFKA 3TACA 3SD0A 4DLIA 1OZ1A 4HNFA 1SNUA 3PJ3A 5HG8A 3ZLYA 3LXKA 2B9HA 4ZSJA 5I9YA 1GIIA 2VV9A 5D1JA 1KSWA 2C0IA 3H0ZA 3RCDA 2C6MA 4U44A 3C50A 4IVAA 4TNBA 3KN6A 3MI9A 3VWAA 5IF1A 3RHXA 2HK5A 1OL2A 4FOBA 5FUTA 4L42A 5HNGA 1OIRA 1YI3A 1Y8YA 4GJ2A 1W7HA 3C5IA 2J50A 2XK9A 2XA4A 2QC6A 3KRLA 4DHFA 3O23A 4L46A 4OUCA 3WZDA 4NSTA 3HX4A 1K2PA 3ODZX 4RC2A 2GCDA 4HCTA 3U51A 5IQGA 4ZK5A 5FQDC 2ZM3A 3EL8A 3IPHA 2BRNA 2E9UA 2RGPA 2V22A 5BYYA 4M97A 3QZGA 1P14A 2HCKA 4PQNA 3M1SA 3ELJA 1R3CA 4DBXA 1SM2A 4FNWA 3E88A 4QTDA 4M7IA 3V04A 3L1SA 3DFAA 1QCFA 2P2HA 5AR8A 4IDVA 5IUIA 1BL7A 3MFTA 4XMOA 5EFQA 4V05A 4AW0A 5C8MA 2YA9A 3K3JA 5FP6A 4DG3E 1M2RA 4EH2A 4YU2A 2XNEA 3A7IA 3Q4TA 5D7AA 4H39A 4ANSA 4E6DA 4ANBA 2YCSA 1GZ8A 2VTQA 2BAKA 2P3GX 4FSTA 4WSQA 3RZBA 2OIQA 2R3RA 4TL0A 4D4RA 2YZLA 4BZNA 4CCUA 5LWMA 4BGQA 3ORPA 4L00A 2UW3A 4CXAA 3KRRA 4D1ZA 3FL5A 4TWCA 4GFGA 2VWXA 4XG2A 3PLSA 5JSMA 3VUHA 2WZJA 4XV1A 5IISA 4FVRA 4O0XA 5A4TA 4DAWA 4AE9A 3WF6A 3TCPA 1ZOEA 3OBJA 4FF8A 5CT7A 5L6PA 3FPMA 5TT7A 5EM8A 4KNBA 5FXQA 5CXHA 4I5CA 2XNPA 4MXYA 5M4CA 3ACJA 4QRCA 3O7LB 1BX6A 4CRLA 4FTJA 3K54A 3UVPA 5AAGA 1JKKA 3I4BA 3DZQA 3FLQA 2BCJA 5IQDA 5IH6A 4IZAA 3G33A 3BCEA 4ITJA 4RG0A 4J96A 2Z2WA 3FHRA 4FSRA 4I6BA 5G1XA 4C4HA 4PP7A 4QQTA 3TM0A 3OP5A 3PWDA 4BTFA 4EOLA 3MVMA 4O7ZA 4XBRA 1PJKA 5EI6A 1BI8A 1OL5A 3O71A 4G9RA 4PPBA 5BVEA 4CTCA 4PY1A 4ZS4A 4O27B 1UU7A 2XCKA 4QTBA 4MF0A 1Q8TA 2C6TA 4QTAA 2PMNX 3G0EA 1YHWA 4F1TA 1IA9A 3FLWA 3R7EA 5AP7A 4YJQA 4NT4A 4ZZMA 4JOAA 3TNWA 4IHPA 4JNWA 4CYJA 3R9HA 4NM5A 2ERZE 3ORIA 2PMOX 3QRJA 3QTUA 2VX3A 3VUKA 4AACA 4AU8A 4BCJA 3A8XA 3IS5A 4BTKA 5KMOA 2VX1A 4EJ7A 3PZHA 3QCSA 4FKRA 4G2FA 4IX4A 5A9UA 4O1OA 5K5XA 2Z8CA 2GS2A 3UTOA 3T8OA 3VJNA 2G15A 4D1SA 4ZS0A 3GOKA 4QPSA 3EZRA 1PXKA 3GBZA 4W4XA 3MTLA 5EKOA 4FKLA 1SZMA 2ITXA 2XEYA 2WTCA 3OXIA 3JVRA 4EEVA 4PMTA 3JY0A 4G5JA 3EN5A 5CAVA 2QURA 2JKKA 4FKUA 5L8KA 1H1WA 3SLSA 5ETIA 5K4JA 3QX4A 5DT0A 4RIYB 1A06A 2CDZA 2WMAA 3PXYA 5AP3A 3RKBA 5IEYA 4NWMA 3KU2A 1F5QA 3CCNA 2XJ2A 3KULA 3MS9A 4FKSA 4JDJA 3WIGA 3W2CA 5K9IA 2R0IA 4TXCA 4CEGA 3MJ1A 4A07A 2C1AA 3UO5A 4P2KA 5CVFA 2O8YA 4EK4A 4Y73A 4AZSA 4GS6A 3UQCA 2NP8A 3F66A 2HOGA 3ZRLA 3LJ0A 2W4KA 4W4VA 2WXVA 3DQWA 4AXAA 4BI1A 2WMUA 4RMZA 3OF0A 3FYKX 1ZOGA 3KQ7A 4PDOA 3ORLA 3U6HA 4YJUA 3F69A 4ZMEA 3FMJA 4UN0C 4O7SA 3KMMA 1T46A 3A2CA 3QQGA 4J8MA 5EQYA 4PUZA 4FC0A 3CY3A 3AOXA 4NFNA 4ZTRA 4X6QC 3WILA 4CTBA 3EQRA 4YTHA 4DTAA 4FKOA 4CVAA 4AZWA 3VF8A 4DT8A 2X8EA 4MBIA 3P86A 3ALNA 1ZAOA 3ORNA 4KWPA 1PYXA 3JVSA 3SV0A 3UIBA 4YO6A 3E8DA 3I7BA 3RP9A 4R8QA 2IO6A 1Z57A 3MV5A 5L8JA 2ETKA 1Q8UA 3GNIB 4FODA 4YZCA 3SAYA 4CGAA 3NMUF 4FG8A 2VN9A 2GQSA 3Q4UA 3BV2A 4K11A 2QOHA 4JI9A 1CTPE 1BL6A 1PXMA 3CR0A 4MXZA 4D2PA 4RFZA 4IAZA 4O1PA 5DPVA 2VWZA 3ZDUA 3WI6A 4D2TA 2PVNA 4U6RA 4HVGA 1XO2B 3TKIA 1IAJA 3PSCA 4EUTA 2OI4X 3E7VA 3COKA 4LUDA 4X3FC 4V0GB 3WZJA 2UV2A 4D0WA 3R28A 2PL0A 1YOLA 3WYYA 5FTGA 4RVLA 3LQ5A 4GYIA 4HOKA 4G6OA 5CF6A 4PPAA 5IEVA 4I4FA 4C4IA 4GKIA 4FOCA 4A9TA 3S00A 1K3AA 2A0CX 4D9TA 3LFCA 2P4IA 3QYWA 3GI3A 4J8NA 4RJ5A 4DGOA 5FM3A 5AUUA 3ROYA 3N4VA 3N51A 3P23A 2R5TA 2XYUA 4PL5A 4XG3A 4OTHA 4BDEA 1GAGA 2X2MA 4IC8A 5FXSA 4U9AA 3VS5A 4E20A 2R7BA 3U55A 2FSTX 4YPDA 4FTTA 4FIHA 4BI0A 2YLFA 2F7EE 4ZTLA 3RZFA 3UZPA 4A4XA 3DDQA 3FZOA 3RK9A 2YFXA 2HIWA 3F2NA 4YSMA 1H4LA 3DBDA 4ZAUA 3FMLA 3EQCA 2CKPA 3GENA 4ENYA 1BI7A 4MWHA 3S3IA 3ZO2A 3W2OA 2X2KA 1Q61A 2IZTA 4BYJA 3FLSA 4F0IA 5IA5A 1G8SA 4O0UA 2UZUE 3FMHA 3G9NA 3LCTA 4TWNA 4O0TA 5J95A 2VTNA 4HJOA 4EC9A 5L2QA 4WIHA 4BDBA 5JGBA 2Y6MA 4DCAA 2QOBA 3RAWA 4GVAA 3HRBA 5AV4A 3D14A 3DKCA 2X6DA 2GNJA 3MW1A 4HYSA 3UMXA 4X0MA 4L7FA 2R3IA 4NFMA 2IWIA 3DBEA 4RVTA 5AX9A 5DIAA 5EHLA 3GEQA 5HKMA 4AP7A 1JWHA 4QMYA 5LARA 5AP1A 2J0MB 4HCUA 4BHZA 3GC0A 4UZDA 1RDQE 1IEPA 2HW7A 5IG1A 4UYNA 4DGLC 4E3CA 4YLJA 4UXQA 2QHNA 5CALA 3LLTA 4E4XA 3BU6A 3VUMA 1CM8A 5LVNA 3PJ8A 2PE2A 4LV5A 5KHWA 3PVUA 4NK9A 3GCUA 2FB8A 2QLQA 5AMNA 5HCXA 1STCE 3PVGA 4XG8A 3RCJA 2IPXA 2J0KA 3BRBA 4EQMA 1U4DA 3E8NA 3PUPA 5I9UA 2FVDA 1O6YA 3H3CA 4TN6A 2UVYA 3AGLA 2W0JA 2BDJA 3QF9A 2BRHA 3QRUA 5M55A 4ZTSA 4MXOA 2LGCA 3KA0A 2XK6A 2R7IA 5C01A 4JL9A 4LRJA 3DFCB 5EG3A 3VJOA 2YM4A 3AMYA 4S33A 3R02A 4AFEA 4D5KA 3V8SA 3BELA 3MY1A 2R64A 4DCEA 4P5QA 3KRWA 3ZO4A 3BGZA 3C4CA 1OPKA 1ZYDA 4IJ9A 4XG9A 5JQ8A 3AD6A 3PP1A 4BGGA 2HY0A 3FI4A 3QL8A 4CT1A 2PMIA 1YW2A 3CIKA 4CMUA 5IQEA 3BHTA 3C4XA 3BI6A 5HESA 4JIKA 1H27A 1J7UA 3OW3A 5JT2A 4L44A 4GT3A 4FTIA 3BQCA 2E9VA 1O6LA 3EJ1A 5AV3A 3NR9A 4L3PA 5L2TA 4TTHB 3OTVA 4EK8A 1NVRA 4AFJA 2YM7A 4GIIA 3BX5A 4FT9A 3M42A 4AS0A 4XNEA 4DFYA 4O6EA 5HD4A 3QTXA 2DS1A 2HZ0A 3BYOA 4ANLA 5KBRA 1NT2A 5D7VA 4ANMA 4C3PA 1OPLA 1HCKA 3MFRA 2W9FB 4KIOA 3QZIA 3RNYA 5M44A 2HENA 4MHAA 1V0PA 4IWOA 4XG7A 3IW7A 1G8AA 1REJA 4NIFB 3PPZA 4PX6A 1R78A 2C6OA 5KZ0A 1R39A 3GU5A 5HE2A 3REPA 4D1XA 4RC3A 5DWRA 2C6EA 1YI4A 4AG8A 4CZYB 4F6SA 1S9IA 4DEDA 4W8DA 1IRKA 2AYPA 4C2WA 4FG9A 3EL7A 2PSQA 4PWNA 3GXLA 4M66A 3ZCLA 4ZZNA 4FV7A 4CFVA 5CASA 1TVOA 3LMHA 4RT7A 3LFNA 2X2LA 5LMAA 2I6LA 4YNOA 4CFUA 4EHZA 4DN5A 5BMMA 4DTKA 4O0WA 4I0TA 4EOIA 4CKJA 4BDDA 3PG3A 2OJIA 5ANEA 2CGWA 5HG7A 5IQBA 1PY5A 1U5QA 3E62A 2WTKC 5HHWA 3POZA 4IM2A 3NIZA 4BCKA 4FTUA 3R1NA 1WCCA 2Y0AA 4GSBA 1ZY5A 3FV8A 3E3BX 4GK2A 2WB8A 3ZZWA 4HVHA 2W5AA 4QMMA 4BKZA 3QUEA 4EUUA 2A27A 4TT7A 4GL9A 4NW6A 1RW8A 1VZOA 5ITAA 4FV0A 2OF2A 3FZ1A 1Q5KA 3V5PA 3WARA 5HE3A 2XK3A 3UPXA 2VO3A 3QCXA 1OL7A 3THBA 4DFBA 2C6KA 1H0VA 2UW0A 3BGQA 4M13A 1OKZA 2XNOA 4JX3A 1YXVA 4M69B 4C4FA 4ACGA 5LJJA 4GFOA 4LOQA 3W32A 3AC8A 2F57A 4IFCA 1WBTA 4W8EA 2OO8X 4IVDA 5HOAA 3GCPA 3I5NA 3JPVA 3OT8A 5FTOA 2I0VA 5CF4A 4LOPA 4C34A 3G6HA 1JKTA 2WPAA 5DHJA 3P5KA 5AR7A 4FGRA 5HVJA 4BB4A 3P7BA 2WIPA 3PSDA 2BZIB 2ZB0A 4C35A 5A4LA 4R7BA 4YC6A 2ZV7A 3FBVA 4TYEA 5CTPA 4X2NA 4UBAA 4PDYA 2IW8A 3HP2A 5HORA 2QOOA 2XB7A 3PTGA 4V0GA 4JJRA 2HXQA 5C1QB 3AD4A 3PXRA 5CEMA 3FKLA 3MIYA 3PA5A 4G3FA 4LG4A 5EYCA 4P4CA 2WD1A 3PIYA 2IZRA 4QYGA 4EH8A 4NUSA 2BFXA 2P2IA 4ZIMA 2BHHA 3QWJA 2ZB1A 3SQQA 4JBVA 5A6NA 2Y9QA 1FGIA 5AIKA 5CAQA 3A99A 3RM6A 2OJGA 3ORZA 1WBOA 2XRUA 2ESMA 4E8AA 2CN5A 2UZOA 4KKHA 4EOMA 3PWYA 1PF8A 2JBOA 4ZJIA 2GU8A 2RIOA 2JIVA 3HRFA 3TNPC 2UW6A 5FG8A 4A9RA 2W1DA 3DNDA 4ITHA 3QLGA 1T45A 3ZUUA 4FV9A 5CS6A 4U80A 4G9CA 4O7WA 1FQ1B 2B9JA 4RIOA 3NUNA 3DK6A 4QP3A 5HNBA 3E63A 3MN3A 2A1AB 5BVKA 3BQRA 4RJ3A 5M56A 3AQVA 2XJ1A 4YGAA 3UO6A 3DAEA 4RLLA 1GZNA 4FKVA 4BRXA 4O82A 1L3RE 2C5YA 3PFQA 4EI4A 1URWA 4RGJA 3E3PA 3P0MA 3QYZA 2B55A 4IH8A 4Y8DA 5EDQA 3VBVA 4K6ZA 4MNFA 4TW9A 5DYJA 1Q3WA 2ZVAA 3EKNA 1XQZA 2VAGA 3NYOA 4MXCA 5IH4A 5F94A 4L9IA 4O7RA 3ZHPC 3U4UA 1MUOA 2WMWA 4FTRA 2IVSA 5K0XA 5C4LA 3LFBA 3Q6WA 3QC9A 3SDJA 3UVQA 4Z55A 4KBCA 5FXRA 2FUMA 3QX2A 3JR1A 4ZZOA 5EHOA 4AW2A 1AD5A 4AZVA 4O6LA 4IIRA 2CKEA 3RPVA 1XHAA 2J2IB 3BZ3A 4U97A 1LPUA 3FQEA 1MRVA 3LZBA 5AWMA 3VUIA 3WF8A 4FKPA 4IDTA 3FI8A 2ETMA 2VNYA 1PXOA 4TYIA 4IJPA 3LOKA 2UZDA 2WQEA 4NCTC 1OKYA 5J1VA 2VTSA 3NAYA 4RVMA 3QHWA 3SOAA 4HPTE 4KUJA 4XRJA 1YWRA 5JEBA 4WHZA 2QONA 2W1EA 1E9HA 3OC1A 2YLEA 3ZRMA 5EW8A 3DS6A 5BUJA 4I41A 3OTUA 5BVFA 2GHLA 4HZSA 4BBEA 3QGWA 2ITWA 4G34A 1JAMA 2O64A 3EH9A 5IDNA 3G15A 4E73A 3QQHA 4WA9A 3SW4A 3JUHA 3QD2B 3H9RA 1B38A 2X0GA 2JKQA 3NNUA 4MXAA 4RJ6A 3IO7A 3Q60A 4OT5A 4ZSGA 1QPDA 3C5UA 3POOA 5HO8A 5ACKA 3RK5A 5C9CA 4CRSA 4I0RA 1H07A 1DS5A 2JDRA 3VW6A 3OWKA 3CJGA 5FBOA 3ATSA 3H4JA 3UZTA 4IAFA 2JFMA 2XS0A 3QTRA 2CSNA 3SX9A 4NH1A 4RZWA 5T3QA 5CEPA 4K2RA 4U81A 3SVVA 2QU6A 2C30A 4QMSA 2ZM1A 5TF9A 3B2TA 3WZUA 2BIKB 1YQJA 4AA0A 1LP4A 4ENXA 5HTIA 2OIBA 4UZHA 2BZKB 4AN2A 3MFUA 3C0HA 3OEZA 5E8UA 4OTGA 2IVVA 4LMUA 4X2KA 4CFMA 3MJ2A 4ALUA 5CU4A 4FKJA 4IACA 4IB1A 4NIFA 3AT4A 4DFNA 3W16A 3ID6C 2X7OA 4IAIA 3UDBA 4BCMA 3GFEA 2YIQA 2ITTA 5IA0A 3NNWA 3LXLA 3GU8A 4WG3A 4U0IA 4Y85A 2W99B 1GZKA 3PXKA 2OXYA 4J71A 4FV6A 3VIDA 4RIWB 5DMZA 3U54A 1AQ1A 3LCDA 3FI2A 2OKRA 3JY9A 3PY0A 3Q4ZA 2JIIA 4H1JA 3UJGA 4BYIA 3B8RA 2P55A 3PY3A 1KV1A 3DJ7A 1APME 2QG7A 3EN9A 3S95A 3UNZA 3BYSA 4B8LA 2NPQA 5DEYA 4C61A 1JOWB 1Q62A 4AWIA 4CFNA 4ZTHA 2OW3A 4APPA 1JPAA 3QZHA 2OG8A 4EK6A 4EYMA 3RTPA 2AC3A 3R6XA 1FGKA 1SVHA 3HA6A 2WIHA 3O7LD 5HO6A 4PNKA 3TUBA 4EL9A 4MBLA 3RAHA 1OIUA 3DT1A 2F9GA 3QQFA 5ANJA 5BVNA 5ETCA 4U40A 3FC1X 3QTIA 4M0ZA 4ZSEA 2Y4IB 3ZBFA 3HGKA 4FV5A 4LRMA 4R1YA 2XCHA 4FTLA 5BNJA 4NJ3A 2O3PA 4DFZE 3TKUA 4QNYA 4MKCA 2UZWE 5G6VA 3EFLA 4CFXA 2G01A 3PXFA 5BVDA 5H3QA 4UX9A 3IOKA 4AOIA 3Q04A 3MH2A 4GJ3A 4HPUE 2X8DA 2C0TA 4M69A 5E8WA 1OUYA 4C4JA 2F4JA 2Z02A 4RWIA 3ZU7A 4DG2E 2VD5A 2YCQA 5HG5A 3GFWA 3GUBA 3T9IA 2ACXA 3HDMA 2R3QA 2WGJA 3G6GA 5AV2A 4V04A 4C38A 4FZ6A 4FTOA 4L6QA 4BWXA 5GZAA 3SXFA 3UQGA 3KL8A 3EN4A 3EQGA 5IDPA 3IKAA 4BCHA 4R3RA 3HMNA 4UMQA 4WUAA 3I7CA 2BTSA 4F6WA 5H2UA 4PMMA 4X3JA 2EUFB 3RHKA 4J98A 4Z16A 4WT6A 2F2UA 3A61A 1FINA 3HVCA 5CY3A 4M8TA 4MTAA 1UWHA 3KEXA 4PL4A 1QPCA 2W96B 4QMVA 1M7QA 2A2AA 3EIDA 3AXWA 4RVKA 5DEWA 4CFWA 4O7VA 1WBPA 5TE0A 5EQPA 5IQCA 1UA2A 1GIHA 4KD1A 3MTFA 3P79A 2JIUA 3V8WA 3F3VA 4MWIA 4LFIA 4S2ZA 2DQ7X 5GIPE 1A48A 1OKWA 2VWYA 3WE4A 4USEA 4BDJA 3K2LA 2PZIA 2XP2A 5DR6A 4ACMA 3BE2A 4JBQA 3C4ZA 1UVRA 3FAAA 2WFYA 3KCFA 5DNRA 3VUDA 5C8KA 1IASA 2OF4A 3BBWA 3FMKA 4DH5A 4K18A 5AP5A 3VHKA 3R73A 3S2PA 3ZONA 4C62A 5LVMA 4C8BA 2HZNA 1X8BA 4I6FA 4DEIA 2EB3A 3DU8A 3OBGA 4EORA 3U8WA 5K0KA 4ACHA 3ZC6A 3L9LA 3P7AA 4II5A 3HV5A 2PULA 4Q5HA 4AT3A 3CLYA 1PYEA 2PZ5A 4FTCA 3GU7A 2RG6A 1KUTA 2YIRA 3QHRA 5HICA 4BI2A 5FDPA 4BHNA 5EOBA 5I9VA 1V0OA 2BR1A 4FNZA 4H36A 5H8GA 4QPMA 4LGGA 3VNTA 3VUGA 4O84A 4WG5A 4XP2A 1XJDA 3A7JA 2O5KA 4TKSA 5CZHA 4TZRA 4FZAB 3QXOA 4ZEGA 1KE6A 3HV7A 4RA4A 4I6QA 1G5SA 5T6KA 4CNHA 2XM9A 3OWLA 3UOHA 3VRYA 2YABA 4JG8A 4WNOA 3LW0A 1PXPA 4JAJA 5GZ9A 1Y6AA 3TIYA 2X9EA 2GHGA 3DY7A 2CGUA 3FZRA 3RALA 1Q8WA 2ERKA 4NKAA 5J9YA 4ZP5A 5LVPA 2BFYA 5KMLA 3QD4A 3TXOA 3SG9A 3CQUA 4JAIA 2X4FA 3ULZA 2W4JA 4DFLA 4KABA 3BPRA 4U43A 2PZYA 3PJCA 3RPRA 2BDWA 2UUEA 4B99A 4FG7A 2X8IA 3LFAA 2VWIA 2R3KA 4KA3A 1NW1A 5FEQA 5HVKA 3K3IA 1XBBA 5M07A 3EQBA 4NTSA 4APCA 5IQIA 1ZYCA 3NRMA 3VUTA 4Y46A 3PPJA 2XKFA 1FMKA 5E91A 3QKMA 3DCVA 4L67A 2JEDA 3R01A 2BVAA 3OCGA 1UNLA 2B7AA 3FQSA 2J6MA 3AG9A 3NUUA 3D4QA 3VS1A 4RX8A 4OTRA 4QP1A 5EM7A 5TR6A 1KE9A 4C59A 4G3GA 3FSKA 3M2WA 3Q32A 4FV8A 4G16A 4H3BA 5B2MA 5CSWA 1MP8A 3RAKA 3EZVA 3T3UA 5EK7A 4PTCA 2WNTA 1NXKA 4C4EA 2FGIA 3R2BA 2E2BA 3VBXA 4B0GA 5HTCA 2O63A 4I23A 4KB8A 4CQEA 4FSUA 4EWHA 3N9XA 4U45A 4WD5A 3DXNA 3A7GA 4AUAA 5KMIA 5J5TA 3KREA 4DA5A 4IVCA 1F0QA 4JLCA 4L53A 2NRYA 3GCSA 3GU6A 3O0GA 3VRZA 3IW8A 3NW6A 3PJ2A 4RC4A 4FVPA 5DR9A 5ANDA 3SXSA 4UY9A 4D28A 4BBMA 1WVWA 2WTDA 3MA3A 4J1RA 1CKJA 2RFEA 2YM5A 4FMQA 5EHYA 2PK9A 3KVXA 4YHFA 3RVGA 1URCA 4J95A 3SW7A 3PG1A 4EJNA 3FUPA 4WO5A 3NYVA 3W55A 4YJOA 3QD3A 4BKYA 3H30A 1CMKE 3SC1A 2Y6OA 4YJSA 1W82A 4X2FA 4DITA 1LEWA 3MGYA 4M14A 1KE5A 3QBNA 2XNNA 1M14A 2IZSA 4XOYA 4HGLA 4J53A 1ZYSA 2R0UA 3IDCA 4RIWA 3UIXA 4R77A 2C5XA 2QOIA 2R3PA 5FM2A 4EOSA 2WTJA 4N6ZA 2I0EA 5M51A 3Q9WA 4IE9A 5EM5A 4DEEA 4DEAA 4RIXB 4CKRA 2NNWB 4IAAA 5BMSA 3QZFA 2J90A 5F95A 4EH5A 1QPEA 4USDA 2WEIA 3BWJA 4D9UA 5H8BA 3ZO1A 4FV3A 1YI6A 4FV4A 3I1AA 5EW3A 3GCVA 4F64A 3W2SA 2QOLA 5JGAA 4UXLA 4ALVA 3EQPA 4CYIA 3CQEA 4HNIA 3NEWA 1M7NA 2O2UA 4HGTA 2BAJA 4NM0A 2Z7QA 3RINA 5IZFA 5J7BA 3TUCA 2QO9A 3LVPA 4XV9A 5K3YA 5AUVA 1ZYJA 1NVQA 3R7VA 4C02A 3N4TA 3W8LA 4UWCA 3BEGA 5E1SA 2XIRA 4MVFA 4MQ2A 3JYAA 5HLWA 3GT8A 1CDKA 3FL4A 2WQMA 3MY0A 2YEXA 2ZAZA 1ZMVA 2Y8OA 3E93A 5LMBA 2XM8A 4GG5A 2GQRA 1J1CA 3D5UA 5BUIA 2PU8A 3UBDA 4YTCA 3CS9A 2WMTA 1H1PA 4EH4A 2V62A 2GS7A 3DZOA 4FZDB 4CKIA 3AMBA 4IWQA 3SXRA 3BYVA 4WOVA 4Y5HA 1XH4A 4TWOA 1HCLA 4IBMA 3PSBA 4NM7A 4MAOA 2XBJA 3L9MA 3MH3A 3BEAA 4D4SA 1UU9A 3LLAA 2XRWA 4G1WA 4ASEA 3LE6A 3L8VA 5GZ8A 4F09A 5B2KA 3CQWA 3ZC5A 2XJ0A 3OS3A 4U3ZA 1UV5A 4EZ7A 5DFPA 3MIAA 1H8FA 3R8MA 3O51A 4I6HA 2XIZA 4RQKA 4PRJA 5CENA 2R3FA 1K9AA 3F3ZA 4K9YA 5BQ0A 3EMGA 4BCIA 1OPJA 3HNGA 4CZTA 2OIDA 3PIXA 3DDPA 4G6LA 4WBOA 3RK7A 4FEWA 3TV7A 3LIJA 5J9ZA 2X6EA 2W05A 4FYNA 2YISA 3DKOA 3NLBA 4I3ZA 4TYHB 4AN9A 4GG7A 3I6UA 3NUXA 1ZYLA 4I1ZA 3HAMA 4CFFA 1Y91A 3H10A 2J7TA 3MY5A 4KIPA 2VWWA 3DA6A 2CMWA 3FZTA 4IAKA 3SG8A 2Y4PA 4QOXA 3R9DA 1YOJA 3TJDA 4F65A 3D0EA 3V8TA 4F1OA 4HVSA 3MVJA 4LMNA 3LFSA 2W1FA 4K1BA 2VO0A 3AMAA 4W9WA 2C3IB 3JS2A 3QAME 4HYHA 3TZMA 3COHA 4CZUA 2XF0A 4E5BA 2C69A 5DA3A 3LJ2A 2HYYA 1KOAA 4BZOA 1ZXEA 4DH1A 4KBAA 1W0XC 3F2AA 4RPVA 2CNUA 2YACA 4X2JA 4YJTA 4PNIA 4I94A 3ET7A 4FTMA 3QKKA 5KMNA 1V0BA 2QKRA 4GKHA 3QUDA 5JMSA 3KXZA 4QMWA 3VC4A 3HKOA 3BE9A 5EQEA 4IFGA 2EXMA 2XKDA 3D7TB 5AUWA 4IB3A 5E8YA 4ANOA 4H3PA 5EW9A 4X3FB 4C3RA 4BTMA 2RF9A 4YTFA 4FK3A 4ITIA 2BZHB 5HE1A 5CXZA 4XH6A 4IX3A 5JZJA 5IUHA 4KRDA 3OY1A 2QKWB 3DPKA 1ZOHA 2ONLC 3FC2A 5FDXA 3FXZA 5HIEA 4W4YA 5EH0A 5I3OA 5J7HA 1DAWA 5KMJA 4R7IA 3RPSA 3HMMA 4AGCA 3VBQA 4C37A 4YP8A 4ASDA 3E8EA 5IPJA 2C3KA 1XH6A 1H01A 3HEGA 2B52A 2UW8A 2ITYA 2QD9A 2IN6A 4HGEA 3MPTA 2W1ZA 5HE0A 4KBKA 3DQXA 3NVMB 2ZMDA 1RE8A 2JD5A 1UNGA 3NUAA 4K0YA 1XKKA 4OTDA 2VU3A 4XBUA 4I92A 4KSQA 5A54A 3T3VA 4BDFA 1A9UA 3F7WA 5KUPA 2HWPA 4NL0A 1QL6A 2R3NA 2X7GA 4MF1A 2B9IA 4EH3A 1S9JA 3MH0A 4F7NA 5TO8A 3OEFX 3G5DA 1NVSA 3HMIA 3DLZA 3CD8A 4OT6A 4ZLOA 4BCPA 2X39A 4PTEA 3UPZA 3V5JA 2PMLX 3IECA 3R1SA 3ZLWA 4CT2A 1KWPA 4NEUA 3F7ZA 2PVRA 3UNJA 5AV1A 2EXEA 4F7SA 5LWNA 5CI7A 3KY2A 3ZRKA 2JKOA 3U6JA 2JC6A 3IDPA 3F88A 5EYKA 4O2ZA 5KMKA 1ZZ2A 2R9SA 2PVYA 2XIYA 3VBYA 3U9CA 4BCGA 4USFA 1IG1A 3SRVB 3ZS5A 3ZBXA 4QTCA 2JDVA 4ERKA 3UP7A 1Z9XA 4L3JA 3UZRA 4MCVA 2V7OA 4S32A 3F5UA 4N0SA 5JH6A 3LQ3A 4C58A 1SYKA 1SVGA 3C4WA 2CKQA 2BDFA 3DTCA 2C1BA 4BVUA 3PPKA 4BIEA 2CLXA 4FIIA 2QNJA 2OU7A 2IVUA 3HV6A 4TPTA 4EQUA 3AC4A 4FEVA 4YLLA 3F9NA 4G3EA 3UE4A 3SKCA 3GQLA 5C26A 1PXIA 3GVUA 4Z7HA 3CTJA 4JG7A 4HYIA 4P5ZA 4OTWA 3FHIA 5M4IA 1P4OA 1PW2A 2GMXA 2XUUA 2EWAA 1LR4A 3MVLA 5JRSA 1GY3A 2B9FA 1GZOA 1OM1A 3S0OA 5E90A 1OIQA 2Q0BA 4L52A 4QYHA 2R3JA 3ZYAA 4RIXA 3NGAA 2BHEA 5AP2A 4CD0A 2X9FA 4O91A 4MD8E 2P33A 3FY0A 5FBNC 1FBNA 4XCUA 2XK7A 1GIJA 5BVWA 3E8CA 2I7QA 3TV4A 1Q24A 4HCVA 5H9BA 4AGWA 3GGFA 2EU9A 2VTIA 2WMRA 5LOHA 3BYUA 3PIZA 1OITA 1JKSA 4IWPA 4S34A 4A06A 4FV2A 3R8UA 3TZ9A 4EK5A 4I93A 1CKPA 2OJFE 2VWVA 4J97A 4RWLA 5KCVA 3SGCA 3PDTA 4CCBA 5HX6A 1OKVA 2CKOA 5TKDA 3ZO3A 4EKLA 2ITVA 1MRYA 3R22A 4FT5A 4KKGA 4OBPA 3U4WA 4AA4A 3DKGA 1WZYA 3WOWA 2WMXA 2PVMA 4I5HA 4YNEA 5A4CA 3ANQA 5L6WL 4RWJA 4D2VA 2IZUA 4O0VA 4FUXA 3OUKA 5HU3A 2YZAA 4JXFA 3NDMA 4JR3A 3Q4CA 4GUEA 2YDJA 4JQEA 3MB7A 5D10A 3G2FA 3OOGA 3A8WA 5M06A 3QQJA 4D4VA 2ZYBA 2JGZA 3CXWA 4BFMA 4U42A 5HU9A 5C8NA 3CD3A 4FSMA 2OFVA 5IMEA 5EYDA 3ZXTA 4G3CA 3AGMA 5IMXA 1PKDA 5GJDA 4LRKA 4BN1A 4CSVA 5FRIA 4NYEA 1U46A 2UZLA 3L8SA 3QU0A 3CE3A 2JDSA 4BDAA 5B7VA 3ZLSA 3P08A 3GQIA 5D12A 2QR7A 3L8XA 5JKGA 4AGDA 4ONAA 3BV3A 2IW9A 4RA5A 3PA3A 5HLNA 3TWJA 5CF8A 2HELA 5IQHA 3LM5A 2HAKA 2XEZA 3ENHA 4KKEA 4M68A 5I5ZA 4BKJA 1U5RA 3O8TA 4OAVB 1YOMA 2QCSA 1AGWA 2I0HA 2H9VA 4GH2A 2PWLA 4E4LA 3C13A 4F9WA 5E4HA 2ZV9A 2OZOA 3ZH8A 2WTKB
chains in the Genus database with same CATH superfamily
2WOTA 4U41A 4JBPA 5HO7A 3VS6A 3UDZA 4Y83A 3OT3A 4U3YA 5CEOA 1UKIA 1Q8YA 2OBJA 3ZFXA 1JQHA 1QMZA 2WEVA 3BGPA 3UIMA 4FIGA 3OFMA 4DTAA 4TYHA 4AXDA 1HOWA 4KIQA 3KXXA 4Z7GA 3CBLA 3HV3A 4ZSAA 4AT4A 1OECA 5IA2A 5LQFA 3FWQA 3OCBA 4XLIA 4KIKB 5ICPA 2HY81 2XZSA 4DC2A 2Z7LA 2B0QA 2WOUA 4EHEA 5L3AA 1R0EA 4HGSA 2QOCA 4XOZA 4O4BB 4YBKA 3TJCA 1UU8A 4C57A 4UYAA 5E9EA 3R0TA 3KGAA 4G31A 1OBGA 3PLAE 2YAKA 4OW8A 1WBWA 1XBCA 3Q9XA 3E5AA 4PPCA 4Y95A 5C4KA 5HI2A 3NVKI 2WO6A 1M52A 4O7TA 4BY9E 4XJ0A 5CNOA 2R3LA 4OTPA 5F4NA 4FL3A 3MYGA 4PV0A 4YPSA 4C33A 2QVSE 2YHVA 4FR4A 3OWJA 3GP0A 4L3LA 4BWKA 5HNIX 4UWYA 4WRGA 3BYMA 4HVIA 3MH1A 3D7TA 1VLRA 4O83A 2EXCX 3AKLA 4FVQA 2YCRA 4X3FA 1W2FA 3VULA 4PDPA 4EH9A 2W7XA 4AE6A 5HBHA 4JMQA 4AQKA 5KKRC 2FO0A 3F5XA 3C4FA 2YM3A 4Q2AA 3DBCA 2I0YA 4XUFA 5FP5A 1JVPP 2X7FA 1R0PA 2PVLA 2UZTA 2WQNA 2XKEA 2XMYA 4L45A 1PHKA 5DG5A 3LFEA 2ZDTA 2PVKA 3NNVA 3W2QA 4E93A 4R7HA 4FA2A 3ODYX 3G0FA 3QQUA 4FYOA 4YBJA 4YJRA 4CLJA 3A62A 5KMMA 2B4SB 4D4YA 3TNHA 3QC4A 2BTRA 3C9WA 4IEBA 3TZ7A 3ULIA 3LMGA 1H26A 3NAXA 4GRBA 3NZ0A 5HIDA 4E4MA 1FVVA 3V01A 2XNGA 3DK7A 4J99A 5GINE 3F5PA 1RJBA 3PE2A 3FMNA 4IXPA 3HMPA 2BAQA 5CU3A 4E5AX 2OLCA 3LMIA 3KF7A 4S31A 3UC3A 2WQOA 3EYGA 5L6OA 1YRPA 3ZOSA 3O2MA 1WAKA 3GC8A 2GFCA 1YHSA 4QMUA 3BBTB 1J7LA 3R7YA 3NWWA 2Y4IC 5GJFA 3AC2A 2JLDA 1WBSA 1ZZLA 3ORMA 4U8ZA 3R9NA 4A7CA 4F0FA 4R3PA 2ZOQA 1W98A 3L8PA 3VS3A 2PZRA 1I44A 3HV4A 2OXXA 3AC1A 3QQKA 4AXEA 4BJJA 1GJOA 4YSJA 4FKIA 2A19B 4BR3A 5AUZA 3LPBA 4EHGA 4O4DA 3OXZA 3TMOA 5HG9A 3P78A 4YLKA 5I4NA 4QP6A 3KXHA 3QGYA 3A7HA 3HDNA 3QA0A 5AIRA 2ITNA 2PY3A 3TN8A 1YHVA 4GU6A 4YJPA 1H25A 1H00A 3I0QA 3Q96A 3O8PA 3NCZA 5DN3A 3SRVA 4LQMA 3WZKA 4ZY5A 1PXLA 2X81A 4OBQA 3WYXA 2JAMA 3UYSA 4B7TA 3R9OA 2C6LA 4XS2A 3F3UA 3LXNA 3D2KA 4EKKA 5EI8A 4OTQA 4JIAA 4G17A 2CPKE 3W10A 2REIA 2F7ZE 2PPQA 4PL3A 3ALOA 3GC9A 4AZTA 1P4FA 3ZMMA 3W33A 4F6UA 3IGOA 4OGRA 1UU3A 2C47A 4M12A 4HZRA 4RJ7A 4W4WA 5HIBA 3IOPA 5AUXA 3TG1A 4N70A 3OCTA 5AP0A 1J7IA 5A4QA 3K5VA 4M0YA 2H6DA 3F6XA 5E8XA 4O7YA 1UKHA 4DT9A 4IZ7A 5LMKA 3VS0A 2XARA 3CGFA 2WKMA 5I9WA 1MQBA 3EQFA 3EQIA 4FX3A 3UOJA 4FEUA 3VS4A 1OB3A 4DFUA 2WHBA 3ZM9A 4GU9A 4IX6A 4R78A 2YWPA 2OH0E 4BIDA 1UWJA 2YIWA 3R1QA 5AR4A 2JDTA 2IG7A 3VN9A 4C7TA 3ZXZA 3R04A 4H58A 4C36A 2YIXA 2Z7SA 1U59A 2WMSA 5J1WA 4BL1A 3EWHA 3BU3A 3H0YA 5JRQA 4WG4A 4LL5A 4DH8A 5IA1A 3FYJX 3QCQA 1OVEA 4MD7E 1U54B 3OUNB 4FTKA 5ANOA 4GCJA 1YDTE 4R1VA 4QMLA 2HZ4A 4QQ5A 2Q83A 4EHVA 3DJ5A 3UNKA 3H9FA 3HUBA 3KRXA 4YHTA 2GHMA 1BMKA 3BIZA 5DRDA 2OH4A 3CJFA 3F3WA 5EKNA 4FIEA 3KMUA 3E7OA 1JSTA 4JG6A 4D58A 2C3LA 1V1KA 2GNFA 5CI6A 5M4FA 3CPCA 2W1HA 2YWVA 3WF9A 3RAIA 3KN5A 3MESA 2Y7JA 2GNIA 3HRCA 3R8VA 1XWSA 4O38A 4YZMA 3G90X 3R63A 1KOBA 1EH4A 5K5NA 2J5FA 3MPMA 1G3NA 5CEKA 1TKIA 5EDRA 3FLZA 3PXQA 4MYGA 4M67A 4E1ZA 2IJMA 2VUWA 2X4ZA 2ZV8A 4AZFA 5D9HA 4XRLA 2H34A 4FSWA 3HL7A 1LUFA 5C27A 4QMZA 2J0LA 3FXXA 5LCKA 1H1SA 4S30A 4F9CA 2QG5A 4XV3A 1M17A 3G51A 3UG2A 4FNYA 4IAYA 5AP4A 4ZY4A 3ZTXA 3KK9A 5CSHA 3QWKA 1M2PA 2RKUA 3ZUVA 2UZNA 3TTIA 5TOZA 2BZJA 3V5LA 5LXMA 1L8TA 3IW4A 2FA2A 3ZLXA 4IZYA 5JQ5A 2HW6A 2NRUA 2YIYA 3CKWA 4B9DA 4PF4A 3Q52A 4XEYA 4DFXE 4FTAA 2ZJWA 3I6WA 5KHXA 5DT3A 4C2VA 3AC3A 1WMKA 2OWBA 4RQVA 2WU7A 5BYZA 2UW9A 5FEDA 3N4UA 4R6VA 2GQGA 1OI9A 4EBWA 3PZEA 3D9VA 2YITA 3KMWA 3FLNC 4QQCA 2RFSA 2EVAA 4KINA 2CGXA 2GDOA 4UWBA 1WVYA 3OMVA 4FZ7A 4KIKA 2VTOA 4MNEB 5GJGA 4DGMA 4FE2A 4WNMA 4O0RA 3DB8A 4QP9A 3UO4A 1YKRA 3H9OA 4RSSA 5AM6A 5AUYA 1O6KA 5A46A 2Z7RA 2RL5A 4KRCA 4R5SA 4D0XA 5J9LA 3ANRA 4LUEA 2VTLA 1OGUA 3GCQA 5DGZA 5E8VA 4YMJA 5IQFA 5CF5A 3CEKA 3LCOA 4JX7A 1ERKA 3HP5A 2QOQA 5E8TA 4ZXTA 1J3HA 4Y72A 3TI1A 4ACDA 5BVOA 3CSVA 3MB6A 4YTIA 4PTGA 1OBDA 4BICA 4DTBA 5CAPA 2QQ7A 2YERA 4QMXA 1W83A 5CU6A 4BDCA 3A7FA 2PVJA 3I81A 4AN3A 4N57A 2ZDUA 3GU4A 4BCQA 4F63A 3I60A 4X21A 5IKWA 3ZFYA 4CV8A 3JXWA 4E7WA 5A6OA 1KV2A 5HEZA 3HLLA 3COMA 3C4EA 3IW5A 5D11A 4ZLYA 3R7GA 3UGCA 2WMVA 2P0CA 3LKMA 3U87A 1FMOE 3R8LA 2WTWA 3VQUA 5BX0A 1FOTA 4A4LA 1Q3DA 4EONA 2GFSA 2XH5A 2XK8A 3UC4A 2ITOA 2R2PA 3ORKA 5DT4A 5HVYA 5JZNA 3FY2A 1BUHA 1VR2A 2VZ6A 2OJ9A 4EZ3A 1VYWA 2VWUA 4FT0A 4C4GA 2CJMA 4FSNA 4QP7A 4D55A 5DR2A 3RI1A 3TTJA 1FPUA 4ZLZA 3D15A 4EH6A 3F61A 1GNGA 4O7LA 4E6AA 5A14A 5HD7A 2BALA 4EC8A 3MA6A 4FZFB 3D5XA 2ITQA 2QO2A 2PUUA 3V5QA 4ZTQA 3TKHA 4OAUC 4GIHA 4NTTA 2V7AA 1Q8ZA 3ZZEA 2DUVA 5E7RA 3V6SA 3GB2A 4UMTA 2B53A 4UB7A 4YO4A 2J4ZA 4RJ4A 5HBJA 5L2IA 2PHKA 3UP2A 2CCHA 4LGDA 3NX8A 3FSFA 2Z60A 1VJYA 3AC5A 4LM5A 3W1FA 4O96A 3A4PA 4QNAA 3W0NA 2GS6A 2OXDA 3PE1A 5IQAA 4KAOA 4E5WA 4IVBA 4EOPA 5DE2A 3PA4A 4R5YA 4FSQA 4M15A 4LL0A 4DF3A 5AX3A 5T68A 4ZY6A 3PYYA 4ZOGA 2AC5A 4FK6A 4BF2A 4PMPA 4TYJA 1FVTA 5A3XA 4RBLA 4GEOA 3RGFA 3BLHA 1JSVA 4IZ5A 2V5QA 4QEBA 2XYNA 5AEPA 1PKGA 3NYXA 2O65A 4YC8A 3BLQA 5HBEA 5CU0A 5L2WA 2UVZA 3Q2JA 3NS9A 4BDGA 4NCTA 4EOOA 4RFMA 5B0XA 1WVXA 3OHTA 4ID7A 5E8ZA 3TNQB 1IR3A 4N4SA 2HZIA 3CKXA 3Q5IA 2J51A 4EOQA 4O22A 3HZTA 3TDVA 1B39A 4UMUA 4FUYA 4KS7A 5J8IA 4IX5A 1ZY4A 3DV3A 4XG6A 2XNMA 1ZARA 3RWQA 5CSVA 2VTMA 1YXSA 5CVHA 5M53A 3UMWA 3ZDIA 4YJVA 4Z9LA 1W8CA 4LV8A 3TUDA 2UW4A 1Z5MA 3V5TA 1W84A 5DLSA 4I24A 3TIZA 2UVXA 3GOPA 5CX9A 3HECA 4GV1A 5CZIA 1WFCA 2JDOA 2E9PA 4TY1A 5CSPA 2WU6A 4XV2A 3R30A 3SOCA 2OZAB 3ERKA 2OK1A 1J91A 2C6DA 2H96A 4RWKA 3ORXA 4AA5A 5ACBC 4A9UA 1U54A 3D7ZA 2SRCA 3I79A 5FTQA 3QALE 3RNIA 5M4UA 4G5PA 3PVWA 4WUNA 2PUPA 2F7XE 3VBTA 4U7ZA 4H3QA 4FI1A 4F08A 4I5MA 3NUYA 4QQJA 4BCNA 4BCOA 4A9YA 4HW7A 3OD6X 3QA8A 5E8SA 2C6IA 4JRVA 4QP2A 2FH9A 3V6RA 4IWDA 4EWQA 4Z3VA 3F2RA 1M2QA 3RJCA 4FL1A 1JNKA 2EB2A 3II5A 4K33A 4WBBB 4BDIA 3KC3A 5AV0A 4CQGA 3ROCA 2R3HA 4F1MA 2JFLA 4TRLA 5K4IA 3ZSHA 1J1BA 2PTKA 3NW5A 2QOKA 4NJDA 2WTIA 3QD0A 3ZUTA 5JFSA 3M11A 2PE0A 4OLIA 4DHZA 1SNXA 3OY3A 3R7UA 5KNJA 5AA9A 5JGDA 2G2FA 4ZJJA 2RFDA 4RX9A 5M57A 4J52A 2F49A 2UW5A 5KZIA 4ZTMA 5DH3A 2V0DA 2YJRA 4FTQA 5ANIA 1P2AA 3DAKA 4QYEA 4EQCA 4ERWA 3DXPA 3ATTA 3DBFA 2BKZA 5L8LA 4JVGA 2OGVA 2XIKA 3O50A 4NU1A 4IB5A 5GIOE 4CLIA 1H1QA 2VO6A 1ZRZA 3I0OA 5F20A 4EK3A 3OZ6A 5L2SA 2XK4A 3VS7A 3DXQA 1JKLA 5EOLA 4BCFA 5C03A 4IM0A 3UDTA 4IANA 4UALA 4HVDA 2I40A 3KF4A 3R7IA 4DYMA 5F1ZA 4XX9A 3C1XA 2ZV2A 2PUIA 3R7OA 4FL2A 3WE8A 4ASXA 3G9LX 4QO9A 4FV1A 3K5UA 4PP9A 4U79A 4EZ5A 3V5WA 3W18A 1YXUA 2PZPA 4QMNA 4H05A 5E92A 3VS2A 4IC7A 4JBOA 3MSSA 5DOSA 4D5HA 4ARKA 2AUHA 4BIBA 4WNPA 1OMWA 2VGOA 4CG9A 2CHLA 3ZEWA 5CAUA 4YZBA 2GTNA 2QOFA 4MNEA 4QMOA 5AR2A 1P5EA 2JITA 3C0GA 1ZLTA 5AM7A 4F9BA 2NO3A 2W17A 2QODA 4JDHA 3NFFB 3I5ZA 3SHEA 5KE0A 4GUBA 3MDYA 1Q97A 4BWPA 3PJ1A 3RM7A 3EB0A 3LXPA 2XVDA 3ACKA 1B6CB 3F5GA 5CNNA 4F0GA 2HWOA 4ANNA 4QT1A 4UV0A 4R3CA 2YM6A 3QRKA 4GW8A 1RQQA 2BIYA 3FZPA 3EQDA 1MQ4A 3OOMA 5AA8A 1H0WA 2RSVA 4DH3A 4DLJA 3VVHA 2DWBA 4GT4A 2Q0NA 3R71A 2QU5A 2ZMCA 3B8QA 3O8UA 5CU2A 5GNKA 5KBQA 5J87A 3Q3BA 3R00A 4FTNA 1YWNA 2B1PA 1MRUA 4FICA 4QYYA 3C51A 4AGUA 4KSPA 5LMKC 5CT0A 4LOOA 3VAPA 3VQHA 5I0BA 5CANA 2PVHA 4CMOA 4FKWA 2OSCA 2FSOX 1E1XA 2C5NA 4FBXA 4I22A 4CV9A 4RRVA 3W2RA 3UIUA 2GTMA 1TQPA 1WBNA 1XH8A 3KRJA 4E6CA 3QFVA 5HGIA 4O0SA 1CKIA 1YDRE 4O81A 4E6QA 4BJJB 3DLSA 3ITZA 4E26A 4QP4A 3RWPA 1XBAA 3R2YA 3AT2A 3P7CA 4AX8A 1H28A 3CPBA 3FJQE 4GK4A 4EH7A 4F99A 1YDSE 4DBNA 3QXPA 3O96A 3QTWA 2FYSA 4O7NA 2BMCA 3ZSGA 3AKKA 5CEQA 1FVRA 1XH9A 1DM2A 4L68A 1KE7A 2GPHA 3EKKA 4AW1A 5AFVA 3W0MA 3L9NA 4DINA 4YR8A 2ITPA 5FLFA 3WZEA 3LFFA 5JFVA 3LQ8A 1TQIA 5B2LA 4LI5A 1ND4A 3PXZA 4NKSA 3QTSA 4XG4A 4B4LA 4XYFA 4DGNA 5CVGA 5IEXA 3D94A 5AR3A 2LAVA 2BRMA 4A4OA 4ZMFA 3R21A 4ASZA 1GOLA 1SMHA 2WAJA 3DAJA 4ZTNA 4WNKA 2G2HA 3U9NA 5LVOA 3F82A 5JK3A 3DOGA 2HXLA 4D2WA 3EN6A 3TT0A 1DI9A 4QTEA 2VRXA 3FE3A 1PMUA 3P4KA 4G3DA 4OTIA 1ZWSA 3Q9YA 3FMDA 2PE1A 3FMEA 1OL6A 2GNLA 5DBXA 5ETFA 4RIYA 2W5HA 4QYFA 3D5WA 5DRBA 5FEEA 3F3TA 4MX9A 4WKQA 4ZJVA 4QMPA 2BRGA 4FIFA 3UVRA 4FIJA 4O86A 3ZSIA 2H8HA 3MBLA 4B6LA 3FMMA 2W06A 3WF7A 3R1YA 3Q6UA 1H24A 3BWFA 5AADA 2VGPA 3WBLA 1XH5A 3EYHA 5CLPA 1PMNA 3MVHA 4RX7A 2YJSA 1Q41A 4XP3A 3DTWA 4KS8A 2W1IA 3UDSA 3QQLA 3Q53A 3UG1A 3IGGA 2ZFYA 2R3MA 4RJ8A 5J5SA 4XP0A 4AOJA 2ETRA 4Q5EA 3DJ6A 2VO7A 3NSZA 4YZNA 3TDWA 2J0IA 2BKKA 4GVJA 1DI8A 3OROA 4M84A 2B54A 4AQCA 3FZSA 2OZAA 1LEZA 3OWPA 2IVTA 1NY3A 4BDKA 3WF5A 3NPCA 1BYGA 3D83A 2PVFA 3R83A 4GFMA 5CSXA 3KFAA 3DK3A 4WSYA 3RBWA 1VYZA 4U5JA 1SVEA 4IMYA 2YDKA 3LCSA 4AF3A 3DKFA 3BHVA 3C0IA 3E64A 4FKTA 1G8JA 3FLYA 1I09A 4LGHA 4AW5A 2KTYA 4TNDA 5HLPA 4F9YA 3IW6A 4QMTA 1TQMA 4DE4A 5AUTA 4D2SA 3W0OA 1H1RA 1O9UA 3S4QA 4DEGA 5I9XA 1CSNA 3EHAA 2BPMA 4D2RA 1YVJA 5CQUA 5HX8A 2CGVA 4BBFA 5HCZA 2YN8A 1NA7A 2WELA 5EDPA 4YHJA 5AR5A 4JR7A 3ZEPA 2JAVA 3GC7A 5IUGA 5M09A 3UQFA 4OTFA 3VF9A 2PUNA 3QCYA 5F9EA 3EOCA 3U6IA 5CYIA 3FEGA 2G2IA 2XKCA 4IB0A 2AQXA 5BPYA 3FDNA 2C5VA 3TNIA 1KE8A 5AAFA 3VO3A 3VBWA 3IG7A 3MFSA 4N6YA 2X0QA 2VNWA 3OCSA 3TL8A 2RG5A 2XNBA 3NUSA 4I0SA 2ITUA 3BKBA 4QD6A 3UOLA 4F9AA 2RFNA 5ETAA 5HTBA 2G9XA 2PYWA 2VX0A 3KCKA 3QTZA 1Q99A 3HUCA 1BKXA 2C4GA 3P1AA 2CN8A 2OICA 2UW7A 1F3MC 1JSUA 2E9NA 2W1CA 5JFWA 5BYLA 4FKGA 3RPOA 3UYTA 3Q5ZA 3A4OX 4X6RA 2QHMA 4I5PA 4MBJA 1QPJA 3AT3A 2J5EA 3FKOA 5ANGA 4F4PA 5L4QA 2KULA 2C5OA 3NYNA 3TEIA 3DBQA 3KXGA 3KB7A 2XBAA 4FSYA 4K8AA 4EOKA 4EYJA 4F70A 3FI3A 4NW5A 3VHEA 2VTTA 3CY2A 3LCKA 2YCFA 3LFQA 4BZDA 1H08A 1OL1A 3BHHA 5HQ0A 3COIA 4JRNA 3DB6A 2VTAA 3CGOA 4FEQA 3EFJA 3T9TA 4FSZA 3EFWA 4GYGA 1ZMWA 2R3OA 4ANQA 3Q9ZA 2OJJA 4UMPA 4F7JA 1IA8A 4MD9E 4MQ1A 2DYLA 2BILB 2CNVA 1ATPE 2BUJA 3W0SA 5IA3A 3UODA 2GNGA 3IK3A 3P9JA 4WRSA 5EM6A 4G6NA 3IONA 3DGKA 3O17A 4BGHA 2UZVA 5GHVA 4C3FA 1PRYA 4DEBA 3E92A 3EQHA 4OBOA 3FKNA 4Q9SA 4JDKA 4XLVA 4A9SA 4AZEA 2VTRA 3QKLA 4RX5A 3FXWA 2YDIA 1YXXA 1PMVA 1Y57A 4M3QA 4FEXA 4P7EA 3ETAA 4ACCA 4DH7A 3BU5A 4FT7A 4QPAA 3KVWA 2C0OA 4JQ7A 4TYGA 4YJNA 4E4NA 4AT5A 5DI1A 5EI2A 5IU2A 3HMOA 3D5VA 3ENMA 4DEHA 2G1TA 4Q9ZA 5A4EA 3CP9A 5CQWA 2F2CB 5FGKA 1PXJA 3PVBA 3R9RA 3PRFA 4PDSA 3FQHA 2WMQA 5KO1A 4AAAA 2ITZA 2QO7A 3B2WA 3D2IA 4FGBA 4MUQA 3QUPA 2WQBA 4L7SA 4RZVA 5ANKA 4RLKA 3LM0A 4I4EA 4YZ9A 4GT5A 2OFUA 3IQ7A 3KKVA 4L43A 4MH7A 4Y5QA 1OUKA 2WMBA 2R4BA 3ZM4A 3DNEA 2YAAA 4CG8A 3LAUA 2VWBA 1PXNA 4O2PA 4L8MA 4ZSLA 3V3VA 3FPQA 4ALWA 4AOTA 3A60A 4YZDA 4F7LA 5LCJA 1XR1A 4JS8A 2CLQA 3W2PA 4DGGA 4MK0A 3NNXA 4IM3A 3MWUA 3QRIA 2X1NA 4UMRA 3W0PA 1UNHA 3R8PA 2QLUA 1YWVA 1PMEA 2V55A 5D41A 5I3RA 4OR5A 2JKMA 4O0YA 2XIXA 3E87A 1DAYA 3R8ZA 5HZNA 4IW0A 3AD5A 2YM8A 5H8EA 2QI8A 5HCYA 2W5BA 4O21A 1R1WA 4YURA 3TV6A 5CEIA 5AAEA 2W4OA 1OIYA 5JN2A 4LDTA 5EYMA 3BHYA 3RMFA 4FKQA 4YC3A 4LYNA 5FD2A 3UOKA 3ZFMA 4B8MA 5LVLA 4QMQA 2WTVA 1JLUE 4H1MA 3HA8A 2IW6A 3BHUA 4JQ8A 4BC6A 5KX8A 2I1MA 1TFFA 3LJ1A 3ORTA 5M08A 1E1VA 3EN7A 2W9ZB 1Q4LA 3KULB 4X7QA 4MXXA 3W8QA 2C68A 5BV3A 4NM3A 1Y8GA 4UEUA 3BLRA 3IDBA 3V51A 1WBVA 3SA0A 4J7BA 5KKRB 3RPYA 4GK3A 3LHJA 3P5JC 3NCGA 4JDIA 3MPAA 1REKA 3PRIA 2C3JA 2ONLA 3QLFA 2UZBA 5IH5A 2BROA 4ORKA 3OVVA 4TWPA 2O0UA 2JBPA 2VTPA 4RFYA 3C7QA 5DVRA 2ZM4A 5E1EA 3KXMA 3NW7A 4HYUA 3CTHA 4FNXA 4P90A 4K77A 4W9XA 3WIKA 4BTJA 2A4LA 3PP0A 2E9OA 4CMTA 3OW4A 2CNQA 1ZMUA 4XHKB 4C0TA 1BLXA 3OXTA 3QTQA 4V01A 2R3GA 2UZEA 4EBVA 5J79A 3KK8A 2J0JA 4MEDA 3Q2MA 2BRBA 5FWKK 2FSMX 4JT3A 4YUQA 2VTHA 5JFXA 3L9PA 1YXTA 3TZ8A 4EOJA 3OG7A 4I20A 5CAOA 3VW8A 2W1GA 1JBPE 4L01A 4PMSA 5BUEA 2QR8A 3HYHA 2J9MA 4NZWB 3LFDA 5AP6A 3S1HA 2VTJA 4FT3A 1VEBA 1XH7A 3QRTA 2FSLX 3NIEA 5IA4A 4X2GA 1IAHA 1Y6BA 2CCIA 3HAVA 5CWZA 4IADA 2GSFA 4IQ6A 3CC6A 5I9ZA 4QP8A 4DG0E 4I21A 4BDHA 3KXNA 3PY1A 3CTQA 2GNHA 3NUPA 4GMYA 5AJQA 3EFKA 3TACA 3SD0A 4DLIA 1OZ1A 4HNFA 1SNUA 3PJ3A 5HG8A 3ZLYA 2X0PA 3LXKA 2B9HA 4ZSJA 5I9YA 1GIIA 2VV9A 5D1JA 1KSWA 2C0IA 3H0ZA 3RCDA 2C6MA 4U44A 3C50A 3PFYA 4IVAA 4TNBA 3KN6A 3MI9A 3VWAA 5IF1A 3RHXA 2HK5A 1OL2A 4FOBA 5FUTA 4L42A 5HNGA 1OIRA 1YI3A 1Y8YA 4GJ2A 1W7HA 3C5IA 2J50A 2XK9A 2XA4A 2QC6A 3KRLA 4DHFA 3O23A 4L46A 4OUCA 3WZDA 4NSTA 3HX4A 1K2PA 3ODZX 4RC2A 2GCDA 4HCTA 3U51A 5IQGA 4ZK5A 5FQDC 2ZM3A 3EL8A 3IPHA 2BRNA 2E9UA 2RGPA 2V22A 5BYYA 2X0OA 4M97A 3QZGA 1P14A 2HCKA 4PQNA 3M1SA 3ELJA 1R3CA 4DBXA 1SM2A 4FNWA 3E88A 4QTDA 4M7IA 3V04A 3L1SA 3DFAA 1QCFA 2P2HA 5AR8A 4IDVA 5IUIA 1BL7A 3MFTA 4XMOA 5EFQA 4V05A 4AW0A 5C8MA 2YA9A 3K3JA 5FP6A 4DG3E 1M2RA 4EH2A 4YU2A 2XNEA 3A7IA 3Q4TA 5D7AA 4H39A 4ANSA 4E6DA 4ANBA 2YCSA 1GZ8A 2VTQA 2BAKA 2P3GX 4FSTA 4WSQA 3RZBA 2OIQA 2R3RA 4TL0A 4D4RA 2YZLA 4BZNA 4CCUA 5LWMA 4BGQA 3ORPA 4L00A 2UW3A 4CXAA 3KRRA 4D1ZA 3FL5A 4TWCA 4GFGA 2VWXA 4XG2A 3PLSA 5JSMA 3VUHA 2WZJA 4XV1A 5IISA 4FVRA 4O0XA 5A4TA 4DAWA 4AE9A 3WF6A 3TCPA 1ZOEA 2XAOA 3OBJA 4FF8A 5CT7A 5L6PA 3FPMA 5TT7A 5EM8A 4KNBA 5FXQA 5CXHA 4I5CA 2XNPA 4MXYA 5M4CA 3ACJA 4QRCA 3O7LB 1BX6A 4CRLA 4FTJA 3K54A 3UVPA 5AAGA 1JKKA 3I4BA 3DZQA 3FLQA 2BCJA 5IQDA 5IH6A 4IZAA 3G33A 3BCEA 4ITJA 4RG0A 4J96A 2Z2WA 3FHRA 4FSRA 4I6BA 5G1XA 4C4HA 4PP7A 4QQTA 3TM0A 3OP5A 3PWDA 4BTFA 4EOLA 3MVMA 4O7ZA 4XBRA 1PJKA 5EI6A 1BI8A 1OL5A 3O71A 4G9RA 4PPBA 5BVEA 4CTCA 4PY1A 4QDVA 4ZS4A 4O27B 1UU7A 2XCKA 4QTBA 4MF0A 1Q8TA 2C6TA 4QTAA 2PMNX 3G0EA 1YHWA 4F1TA 1IA9A 3FLWA 3R7EA 5AP7A 4YJQA 4NT4A 4ZZMA 4JOAA 3TNWA 4IHPA 4JNWA 4CYJA 3R9HA 4NM5A 2ERZE 3ORIA 2PMOX 3QRJA 3QTUA 2VX3A 3VUKA 4AACA 4AU8A 4BCJA 3A8XA 3IS5A 4BTKA 5KMOA 2VX1A 4EJ7A 3PZHA 3QCSA 4FKRA 4G2FA 4IX4A 5A9UA 4O1OA 5K5XA 2Z8CA 2GS2A 3UTOA 3T8OA 3VJNA 2G15A 4D1SA 4ZS0A 3GOKA 4QPSA 3EZRA 1PXKA 3GBZA 4W4XA 3MTLA 5EKOA 4FKLA 1SZMA 2ITXA 2XEYA 2WTCA 3OXIA 3JVRA 4EEVA 4PMTA 3JY0A 4G5JA 3EN5A 5CAVA 2QURA 2JKKA 4FKUA 5L8KA 1H1WA 3SLSA 5ETIA 5K4JA 3QX4A 5DT0A 4RIYB 1A06A 2CDZA 2WMAA 3PXYA 5AP3A 3RKBA 5IEYA 4NWMA 3KU2A 3TYKA 1F5QA 3CCNA 2XJ2A 3KULA 3MS9A 4FKSA 4JDJA 3WIGA 3W2CA 5K9IA 2R0IA 4TXCA 4CEGA 3MJ1A 4A07A 2C1AA 3PUFC 3UO5A 4P2KA 5CVFA 4FJVA 2O8YA 4EK4A 4Y73A