3FUPA

Crystal structures of jak1 and jak2 inhibitor complexes
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
284
Chain Sequence
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDQMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase JAK2
publication title Dissecting specificity in the Janus kinases: the structures of JAK-specific inhibitors complexed to the JAK1 and JAK2 protein tyrosine kinase domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 284
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fupA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fupA01
4A06A 2H96A 4MK0A 4IEBA 5ANJA 5I3OA 5FXQA 3QQUA 2X2MA 4PMTA 3JXWA 3EQBA 2BDJA 2XRUA 4WA9A 2IVTA 4Q9SA 1H1SA 3UMXA 5EDQA 5E8YA 3V3VA 3W2QA 4B99A 4O2PA 5HORA 2A2AA 2J50A 3KVWA 2OJJA 4JAJA 4YTHA 3EQIA 4OW8A 3ZEWA 2I0YA 4CV8A 3IDCA 5DLSA 4I92A 3QLGA 5JRQA 3PYYA 4GL9A 3HNGA 3QFVA 4X21A 4FYOA 5IQDA 5LMKA 2Z7RA 2XNPA 4DG2E 1YQJA 5BVWA 2YLEA 5J5TA 4NW5A 3BGZA 3TM0A 2ERZE 5GHVA 4XP2A 2RG5A 4B7TA 3NZ0A 2PMLX 1F3MC 1OPKA 2BHEA 3KXZA 4L6QA 4DHFA 4L67A 2QO2A 4IMYA 3KRJA 4RJ4A 2JFLA 4S30A 2W5AA 4RJ7A 2LAVA 3IECA 2JLDA 2VO7A 3OT3A 3Q9YA 4WNPA 4C3RA 2C5YA 4IX6A 4FEUA 3EFLA 4GT4A 3QA0A 3R30A 3UTOA 4BCMA 4DFXE 4E6QA 2OJIA 4CV9A 4GV1A 3DKCA 3R1SA 3BRBA 3ZXTA 2JBOA 2C4GA 2X7FA 3BHTA 3G6GA 5BMMA 5AADA 4AGCA 3R71A 2F4JA 3PVBA 3D2IA 4GU6A 5AEPA 4YZ9A 4OTPA 3RNIA 4FL1A 4AQCA 1LUFA 2W05A 3Q5IA 4OT5A 3VNTA 4CZTA 1UU7A 4BL1A 4U41A 3TNHA 5H9BA 4DEDA 3BE9A 4I0SA 5BPYA 5D9HA 3TIYA 2Z2WA 5IUHA 1PRYA 3BI6A 2QKWB 2HW6A 3NIZA 2X7GA 4A7CA 4QMUA 1ATPE 1ZWSA 3RPSA 4FKGA 3VBXA 4BHNA 4AOTA 3KB7A 4PL3A 3UZTA 1IAJA 3GXLA 3QUPA 5AJQA 2BAJA 4G2FA 4BKJA 2OZOA 3VS5A 4Z7GA 5EM8A 4FA2A 4ALUA 3PJ3A 3FEGA 4AA5A 4FL2A 1PXNA 3CBLA 4V0GA 3ZO1A 5M44A 5DT4A 4ZZMA 2C6MA 1M17A 1O6LA 4IM3A 1FMOE 2A1AB 2V22A 4CTBA 2O64A 5M08A 4R3PA 3R8PA 3DBFA 5HIEA 3TNIA 4X6QC 4I5HA 2CN8A 1U4DA 2P2HA 5CEKA 3S00A 1OPLA 4KD1A 4U44A 4BICA 4OTIA 2VD5A 2B0QA 4MNFA 3NRMA 4EHVA 4ACGA 1SVEA 4QO9A 3ZO4A 2RSVA 3OG7A 3KN5A 4U6RA 3TT0A 2Q83A 3NR9A 1R1WA 3I79A 3HDMA 3KRRA 5CSWA 5A3XA 3BLHA 4H3QA 2GQSA 4DTAA 2QOBA 3C0IA 1UKHA 5FTOA 3D14A 4USDA 5C8KA 5CEIA 3PIZA 4FKQA 4YC8A 2OGVA 4XBUA 3ACKA 4ENXA 2WU7A 3SOAA 5HICA 3E87A 5CSHA 1OVEA 1DS5A 4BIEA 1T45A 5AP0A 5HIDA 3JYAA 2PWLA 2CHLA 3A7FA 3R9NA 3ULIA 5F9EA 2QODA 3RM6A 4O7SA 4RIWB 3U4WA 2H34A 2H6DA 2ITPA 3PXQA 2PY3A 4EOIA 1PMNA 5LWNA 4YJNA 3GU6A 4GKHA 3AT3A 2VTAA 3GU8A 3VBQA 4ACDA 2C5XA 1YOJA 3CCNA 4WKQA 5IH4A 2HY0A 4PL5A 4KNBA 1MUOA 4PMSA 5HESA 3SV0A 3HGKA 4FV1A 3E88A 4YPSA 2VTOA 3U6IA 4QTAA 5IEVA 4I0RA 2F7ZE 5IPJA 5C4LA 4Y83A 5FXSA 3MFTA 5I0BA 2F57A 3O8TA 4BDHA 5GZ9A 5FXRA 4EEVA 1Q41A 4IM2A 1P2AA 4OTDA 4DEBA 3FMDA 4FGRA 5IU2A 3K5VA 2X0GA 5HX6A 3BE2A 3F5PA 4DFUA 4TY1A 2BRBA 3RCDA 5EDPA 4MCVA 1M2QA 1ZMUA 3CP9A 3FMLA 4JG8A 5DVRA 4ZY4A 2YEXA 5K5NA 4PWNA 1Z5MA 4NTSA 4TZRA 4FK3A 4WUAA 4X0MA 1OL7A 3UE4A 1PMUA 3AT2A 3SGCA 3IDBA 2WTWA 2F2UA 2ZVAA 3FQSA 3HYHA 3R04A 4FNWA 4BC6A 2CCIA 2W99B 2PVRA 3DBCA 3BKBA 1ZLTA 2XK7A 4IVDA 2WNTA 3VAPA 4Z7HA 2QC6A 4NT4A 4FIFA 4BVUA 3OTVA 3OXIA 4ZK5A 2VWXA 4CT1A 2PE2A 5I9YA 3GFEA 4D28A 4O22A 1H24A 4RC3A 3DAEA 3QTQA 1YOMA 2GNGA 4MYGA 4A4XA 4CGAA 3H4JA 2XKFA 4XV3A 1FVVA 2AC5A 1JKSA 4IAFA 3A7JA 3TTJA 2I0EA 2O63A 3QF9A 4K18A 4YBKA 3TG1A 3I7BA 4FTRA 3F82A 3TIZA 2Y8OA 4FT9A 4YTIA 4EUTA 4BIBA 4WIHA 3LKMA 1W98A 5L8KA 1WMKA 1OPJA 4AZTA 5BUJA 5EH0A 4EBVA 5AP1A 2ITNA 4IZYA 3LZBA 3S0OA 4KS7A 5AWMA 4E26A 3DKFA 3WI6A 1OKWA 2X8DA 2VZ6A 3DTWA 3W2CA 2A0CX 2OBJA 4KIKB 2QR8A 4JX7A 4EOSA 4UX9A 2O8YA 2QO7A 3QA8A 5TR6A 3A7HA 3MH2A 2RFEA 4EH8A 5HEZA 3VO3A 1OL2A 3C4CA 4LQMA 1YWVA 4IAYA 5AP7A 3P86A 4P4CA 2WD1A 3IW6A 4C4GA 1NY3A 2EUFB 3MFSA 4FZAB 3O0GA 4FTJA 4WD5A 4PDSA 1Y8YA 5I9XA 3JR1A 4XJ0A 2GHLA 4M0YA 4GUEA 5KMIA 4ITHA 2FSOX 3IS5A 3TV7A 3Q60A 4NZWB 3TV6A 5CEOA 3EIDA 4UY9A 4JXFA 1WBOA 3EQPA 2BFYA 2B55A 4XV9A 3RMFA 2VWWA 1ZYLA 4FC0A 3MA3A 1KUTA 5AV2A 1M7NA 5C01A 3IGGA 4CTCA 1V0BA 3A8XA 2IZRA 3QWJA 4FVRA 5L2IA 1CKJA 2PMOX 2VWZA 3UZPA 4O7NA 4L3JA 3UP7A 2YACA 4MD7E 5AR7A 4HYUA 2CNQA 4RIYB 2HW7A 4RIXB 3V51A 2PE0A 3ORMA 4ASZA 3QWKA 4I6HA 2B9HA 5G1XA 1G8AA 4L44A 4EUUA 3AC8A 5J1WA 4EZ5A 1WVXA 3ZH8A 4QYHA 4F70A 5L2SA 3R63A 5CTPA 4I5CA 3OBGA 4RQKA 5E91A 2C6TA 1VEBA 2OF2A 4FSYA 1J7LA 2IWIA 2VWUA 2XBJA 2SRCA 3DLSA 4IQ6A 2DYLA 2E9PA 3AMBA 2HY81 1YW2A 4TXCA 2C5VA 2IZSA 3CPCA 3F5GA 3K3IA 3VF9A 4E6AA 4UXQA 2J5EA 4M13A 3R9HA 2PULA 1UKIA 3CC6A 4K6ZA 4HPTE 3UO4A 5ACKA 3QRTA 4HGTA 4IADA 5DI1A 2VWVA 4ZSGA 4EWQA 2VWBA 5CVFA 2YIQA 4FVPA 4ANOA 2WTKC 4IX5A 2OH4A 3QRJA 4ZTQA 3VUHA 2ETMA 1GIJA 3D7TB 1Y91A 4O0VA 4OTHA 5E7RA 4FT5A 1GZNA 4C2VA 1KSWA 4IB0A 1UU3A 2X39A 4JQ7A 4DFZE 1BKXA 4BCPA 3IW7A 4IAIA 3PRIA 4NIFB 4FV6A 3VS0A 1Q8TA 4R77A 3ZCLA 2R7IA 3BYMA 4GS6A 3RPYA 1WVWA 4CYJA 1Q3DA 2CN5A 5K4IA 4F7LA 4LOOA 4NL0A 5JN2A 4BTJA 4FV3A 5J9ZA 3RPRA 3RNYA 3VUMA 2P0CA 2UZBA 4AAAA 4YZDA 3KREA 4FSTA 3PIXA 4AW0A 3R00A 3PVWA 5ITAA 4LMNA 3QRIA 3QZIA 1J1BA 2HXQA 4X6RA 4AGDA 4ZMFA 2ETRA 4E4XA 4M7IA 3E7VA 2A4LA 4CRLA 3UP2A 5FTGA 2E9UA 3WZJA 3GNIB 4MEDA 4RVKA 4UALA 2QLUA 4FTCA 5IA1A 1CMKE 3V5TA 3KU2A 2QVSE 2GNLA 4JOAA 4FNZA 2GDOA 3P7BA 4F7JA 3N51A 2R3JA 4JX3A 3ALOA 5E90A 4ZOGA 2BRNA 1TQIA 3FZOA 4RZWA 1FVTA 4D4VA 3LCOA 1KE9A 2A19B 2GS2A 3ET7A 4FOCA 4BCJA 2XJ0A 5BVFA 2XK3A 2YJSA 3HKOA 2XEZA 4N6YA 4CRSA 4HVSA 5E4HA 2XVDA 3QCSA 3PZEA 3VC4A 4ANSA 5E8SA 5EOBA 2R3GA 3O17A 5EHYA 3W2SA 5JZJA 1BI8A 3DDPA 4QMMA 3HMIA 4RFMA 2VTJA 4Y85A 4EKKA 2VTSA 5AP5A 5EI8A 3RI1A 4OTGA 4FIJA 3Q4TA 2JKKA 4LGGA 3CQUA 2G01A 3PP1A 2HWOA 3CTQA 3QCXA 2LGCA 3ZU7A 4QQ5A 5CEPA 3CXWA 3R8UA 2G9XA 2OXYA 3R9DA 4EKLA 2HK5A 4FIHA 4DH8A 5IEYA 4F1OA 3QRKA 5EHOA 4RGJA 2WXVA 2PK9A 3SKCA 5J5SA 3LMIA 2ITZA 1KOBA 3NX8A 4EORA 3R28A 3W2RA 2CJMA 3PA3A 3QZGA 4RMZA 4BDAA 3HV6A 3FSKA 2YIXA 3GCPA 3NUSA 3QL8A 4E5BA 2OW3A 5GJGA 3HVCA 5A4QA 3FKLA 4YJUA 2XYUA 5FD2A 5AFVA 1LR4A 5ANDA 3F88A 4I4FA 3SW4A 5LJJA 3FI4A 4FTTA 2EWAA 2UW7A 3OC1A 4JBVA 3LPBA 4JRNA 2J5FA 2YERA 4C36A 3Q4ZA 2VX1A 3BU5A 3C5UA 4IC7A 5FM2A 2JGZA 3EN5A 3H10A 2BALA 3P23A 4FKJA 4QMTA 5M55A 2P2IA 1DAYA 4QRCA 4D55A 4D9UA 4FTKA 2ETKA 5JZNA 4XP0A 3R2YA 4ZJIA 3T9IA 5IF1A 5M4CA 4OAVB 3LFDA 3OEZA 4DYMA 4YJQA 3CKXA 4AWIA 4X2FA 1ZZLA 3MBLA 4ASEA 2WIPA 2C6LA 2WMVA 3UGCA 3H30A 3MTFA 5CSVA 3EL7A 4KIQA 2YWVA 3G90X 2WEIA 4DFNA 5GINE 4ZTRA 2HOGA 4J95A 1OBGA 4IHPA 4O84A 4RIYA 1DI9A 2IZUA 3FMMA 4A9YA 1XKKA 2PVLA 4AACA 1KOAA 4Y95A 2OIBA 3WE4A 2QOCA 1Q99A 4BWKA 2VNWA 3EL8A 4MHAA 3IK3A 4WG5A 4JR7A 4FICA 4LRKA 4X3FB 3OWJA 2R64A 2ZDUA 3MDYA 3LCDA 3FWQA 4AT3A 3PJ1A 5A4LA 5KKRC 3EYGA 4DCAA 3ZFMA 5F4NA 4LV8A 2VRXA 5KZ0A 4B6LA 3FC2A 3UIUA 3ID6C 4I4EA 3QC4A 2BROA 2O0UA 3COKA 2R4BA 3QXOA 5IQFA 1BL6A 4H58A 4C02A 5K5XA 3NAYA 4FKRA 3NUXA 4G6NA 4BCNA 4CD0A 4F4PA 5ICPA 3ODYX 5JQ5A 5CU0A 5JKGA 5IQEA 2ZMDA 3DA6A 3HZTA 2W1DA 2GTNA 2H8HA 4DH5A 4JQEA 4R3CA 4MXYA 4EONA 5CANA 5EYCA 2UUEA 3PLSA 4NIFA 4XHKB 4TWOA 4HVGA 4NM0A 2BAKA 2XIZA 4KUJA 5BVKA 5J79A 3PPJA 5DFPA 4EQMA 3UYSA 3O23A 5CEQA 5TF9A 2YDIA 3ZO2A 4AX8A 5JH6A 1ND4A 2W9ZB 3BYOA 4TYHB 5HZNA 1ZXEA 4GSBA 3MIAA 3E5AA 4WG4A 2ITUA 3UC4A 1O6KA 2JAVA 2F7EE 1KE6A 4O86A 1URWA 2F2CB 4K1BA 1PMEA 3MTLA 3UQGA 2CSNA 2JDSA 5CF4A 3OD6X 2VAGA 2PVKA 3COIA 3CR0A 4ZLOA 2B52A 3WF7A 3SG9A 4BF2A 3PJ2A 3QTIA 4ALVA 1PKDA 4E93A 4QNYA 5LARA 2NRUA 5CYIA 3BLRA 4IZ5A 3PJ8A 3MESA 2VO0A 3PXZA 4C4JA 2PTKA 3CQWA 3TDWA 4ACMA 3L8VA 3LFFA 3FZTA 3VBYA 5L6PA 5AA9A 4GH2A 5CWZA 4B4LA 3P08A 3UNZA 1UWJA 3H9RA 1YKRA 3BZ3A 4WBBB 2CLXA 3TNQB 3E3PA 4TN6A 3IPHA 2XP2A 5FLFA 3KN6A 5DNRA 3U9CA 4BDDA 4F65A 4WUNA 5L8JA 4DITA 4JG6A 2XM9A 5ANOA 3NW7A 3UIBA 5EQYA 5ETAA 3E64A 3N4VA 2P3GX 1UNHA 1H0WA 2XRWA 4KRDA 3IOKA 1VZOA 4F9WA 3TEIA 3PSCA 2W0JA 4EH6A 2VTMA 4EC9A 4QMQA 5M4FA 1FOTA 2QOLA 5DA3A 3OY1A 2YZAA 3FLZA 1XH4A 5L8LA 4F0FA 5KMKA 3WF5A 4XLIA 4YJPA 3AD5A 3A4OX 4FVQA 4A4OA 3V5LA 2J51A 4FSWA 4FZDB 4DH7A 4UMTA 5KHXA 3EFKA 4I24A 4AP7A 3W32A 2BDWA 3QZHA 3MS9A 3LOKA 1ZY5A 4FKOA 4H36A 2BAQA 1I44A 4PDPA 3F66A 1BI7A 3MA6A 3AMAA 5IDNA 2BTSA 4IE9A 5L3AA 3HMNA 3CGOA 3FUPA 2ZV2A 4C2WA 3PXKA 2ERKA 4K0YA 4NM7A 3AGMA 2BFXA 2CDZA 4LYNA 1FINA 4EYJA 4FTNA 4QP9A 3C1XA 2CGVA 4YHFA 3BHVA 5IUGA 3MVHA 1YWRA 2YM4A 4ZIMA 2HXLA 2WOUA 4UMRA 3TJDA 4J71A 4E8AA 1R78A 2VX0A 3TWJA 4FTLA 2CGXA 3KRLA 4MAOA 4H3BA 2WB8A 4FSMA 4BCOA 3NS9A 4FTOA 4LMUA 3FI3A 1OITA 3PLAE 5HG5A 4PQNA 3NWWA 4TYJA 3EN6A 2B4SB 4DH3A 3VUIA 4XG9A 3VRYA 1RJBA 5ANIA 3M42A 1PW2A 3ZDIA 3LM0A 5DRBA 5I9UA 5HX8A 2WMXA 5BVNA 4M3QA 2WOTA 3W10A 5LCKA 2QOQA 2BZKB 3DS6A 3OROA 4GJ3A 5D1JA 4FL3A 1HOWA 2OKRA 4F7SA 3K54A 5LOHA 3F3UA 4ZTNA 4FNXA 3ROYA 4D58A 3I81A 2OI4X 3BBWA 3MJ1A 4KA3A 4MBLA 4DLIA 4Y5QA 5LMAA 2JEDA 4XMOA 4ORKA 4YJRA 3EMGA 3L1SA 5A54A 1BYGA 3KRXA 2GCDA 1H28A 4QP8A 3IKAA 5ANEA 2YM6A 1JLUE 1PXKA 3V6RA 3W2PA 3FLYA 3NYOA 4MXZA 4TYGA 4I6BA 3V8WA 4D4SA 4EHGA 3OY3A 4JS8A 1LEWA 2B7AA 4FODA 1F5QA 3W18A 3UNKA 2YZLA 5C4KA 4QMLA 3ZSGA 2V7OA 4RLKA 5C8MA 4ZLYA 4TYHA 3LFEA 2QNJA 3QLFA 3E7OA 3LXPA 4R5YA 3F7WA 2JDRA 2VX3A 5CZHA 5AR8A 3BIZA 3BX5A 5H2UA 4LFIA 3AXWA 3FLQA 1H4LA 1PXIA 4BB4A 3F2NA 4D2WA 1W83A 1JPAA 3AC1A 4MVFA 3RBWA 1VR2A 4PX6A 1Z57A 4J98A 1H27A 3R9OA 4BI1A 4XG7A 4FUYA 5CQUA 2O5KA 4X2JA 3H0ZA 3R01A 2BZIB 4MXOA 2P4IA 2JITA 4OGRA 5CX9A 5HBHA 1YXSA 2JIUA 2X6DA 3KQ7A 4QTBA 4AU8A 5DPVA 1PF8A 4ASDA 3AG9A 3MVMA 1P14A 3NUNA 4U8ZA 3WARA 1ZY4A 3BEAA 2QKRA 4EC8A 4EK4A 2OJGA 4QTCA 3DXPA 1BLXA 5ETIA 3QAME 5L4QA 1SMHA 5CXHA 3IW4A 4F6WA 3F2RA 3H9FA 4XLVA 4F9AA 3RWQA 4GIIA 4AN9A 4R7BA 3D94A 3FAAA 4JAIA 2IJMA 4ACHA 5HLNA 3HV3A 4K9YA 1GNGA 4V04A 4QD6A 3GU5A 5E8TA 4IXPA 4J97A 4CCBA 3KY2A 1E1VA 5HE2A 4FV4A 2GSFA 3PFQA 3Q32A 5HU9A 1WAKA 4P90A 1SZMA 4XUFA 2KTYA 3RK5A 2C30A 3MGYA 5EHLA 5KUPA 1JSTA 2ZV9A 4FT7A 5LVNA 2BIKB 2Q0NA 5KMJA 1T46A 3BYVA 3ZBXA 5DH3A 2FYSA 3MPAA 4FV2A 2P33A 4QPAA 1BX6A 1CKIA 1CDKA 4DT8A 3R7OA 4O91A 3JVRA 2WMBA 1PXJA 4YJTA 4BDEA 2J0MB 3T3VA 3ERKA 3O8UA 3P0MA 3WOWA 5FQDC 2XMYA 1XWSA 4NJDA 4J52A 5GJFA 2JIIA 5HE1A 2QO9A 4CLIA 3G5DA 3VUDA 1NA7A 4RWLA 2GHMA 2V62A 4GK4A 2OJ9A 5KNJA 3CSVA 4AFEA 4QTDA 3DOGA 3WF8A 5KMOA 3EN7A 1YXUA 4U7ZA 2NNWB 2VNYA 1L3RE 3CGFA 4F6UA 1NVSA 1JAMA 5CAUA 2JC6A 3RM7A 3G0FA 3OP5A 2F9GA 4DTBA 2WFYA 4IB1A 3OBJA 3GCVA 2XK6A 4PMMA 5HO6A 4YURA 4YLJA 5E8XA 3E62A 2UZLA 2X8IA 3GC0A 3ROCA 5IA2A 3CE3A 2OXDA 3SQQA 1OGUA 3UYTA 5TKDA 2VGOA 1O6YA 4IX4A 4FG8A 4MH7A 5HE0A 4AUAA 4UEUA 3DNDA 3R73A 5CNNA 2WIHA 3KXXA 5EYMA 2GNHA 5LVLA 3L8PA 3R1QA 5IKWA 3O2MA 3KXHA 3KXMA 3PY1A 4QP1A 4TPTA 4CQEA 1BMKA 4ONAA 3VBTA 5CASA 4JDHA 5KCVA 2QOFA 4GVJA 2QG7A 4I22A 4JVGA 1VYWA 3U8WA 5LMKC 4QQTA 1CTPE 4F0IA 4I93A 3ZHPC 2ZMCA 3VWAA 4UZHA 4GG7A 4EH2A 4HVDA 2JAMA 3ORKA 4QYEA 4O7YA 4M69B 5AAEA 2Z60A 4G3CA 1MQBA 3QGWA 4GYGA 3LE6A 2UW4A 2VTQA 4YJVA 3OVVA 3W55A 1JKLA 1APME 2CKEA 3MV5A 3T3UA 3DB6A 3IOPA 5F95A 3U51A 2XNOA 3FY2A 4C38A 3R8VA 4TL0A 2GHGA 4J7BA 4DF3A 3VBVA 4FI1A 4IVAA 5CALA 5DBXA 5M56A 4IAKA 4KKEA 3Q6WA 5CQWA 3Q2JA 4A9UA 5FDPA 3FZ1A 4H39A 2R3MA 3Q96A 3QKKA 5FEDA 3I6WA 3VQUA 4E6CA 3RTPA 5L2WA 1AD5A 2XKCA 5LQFA 1H01A 4C0TA 3E63A 4K8AA 3R0TA 3HDNA 4XV1A 2W17A 4FIGA 4JNWA 3TUDA 3LFNA 5HQ0A 3PUPA 1WBPA 5CF8A 4FKIA 3UQFA 3KMMA 4YSMA 2R0IA 2DQ7X 4PP9A 4FIEA 4RJ8A 3VS2A 4MD8E 3FHIA 4PPAA 4YO6A 2JKQA 1MRUA 4C37A 4GJ2A 3I4BA 4W8DA 2W7XA 2CLQA 2I7QA 2PVHA 2V5QA 3JVSA 3LAUA 3R83A 2XB7A 4CKRA 3MN3A 1S9JA 5FTQA 3KL8A 5A6NA 5J9YA 2G2IA 2QU5A 4GMYA 4WNOA 3SAYA 4FYNA 2NRYA 4OR5A 5AAGA 4HGEA 4UV0A 4EZ7A 3OT8A 3P78A 1OB3A 3F5XA 3ZONA 3L9LA 3LFBA 3QYZA 5E8ZA 4P5QA 3FXWA 4M68A 3EWHA 5DHJA 4EOKA 4MWHA 4WHZA 2C0TA 4NUSA 3UOHA 5AIRA 4AFJA 3DJ5A 3UJGA 3HUCA 4FKVA 1G8SA 3R1NA 2C3LA 4PTCA 3PA5A 2YAAA 4GKIA 5D7VA 3BPRA 3QCYA 3JS2A 1DM2A 3G6HA 1W84A 3LMGA 4HW7A 2WTCA 4AA4A 3D5WA 3NMUF 4KIPA 2BZHB 2W06A 3NIEA 1JQHA 4RX9A 3SXFA 3V5JA 5IMEA 3TJCA 4GFGA 1S9IA 4LUEA 4UZDA 2HZNA 3KK8A 3F6XA 3UG2A 4AA0A 2AC3A 1WBTA 3A61A 4ANLA 3SD0A 4Z9LA 1EH4A 2ITYA 4L8MA 5HO7A 4YSJA 5LXMA 3BGQA 2B9IA 3QYWA 1FQ1B 4NKSA 1LEZA 4UWYA 4XG3A 3IQ7A 3QALE 3ZUUA 3U6HA 3MY5A 4NCTA 3A99A 4AGUA 3HV4A 2XNGA 1CM8A 4L3PA 3SG8A 3F3TA 4D2RA 2PUPA 4U3YA 2UZDA 2XKDA 4B9DA 4TW9A 4WSYA 3MPTA 4BCQA 4EWHA 4YTFA 1P4OA 4AW1A 1JNKA 5AR2A 5DMZA 4FNYA 4JIAA 4OBQA 5IH5A 4EJ7A 3Q04A 4RT7A 5FWKK 3W33A 5G6VA 3OOGA 3LVPA 3QX2A 4G34A 3V04A 1F0QA 2YISA 1U5RA 4DGLC 4TNBA 1H8FA 3RCJA 4ZZOA 3TUBA 1PKGA 4HGSA 3UC3A 5J9LA 3LCSA 3VHKA 1XJDA 1Y8GA 4EK3A 3QBNA 2EB2A 3VHEA 2JFMA 2WQOA 5EW8A 2QG5A 2R3NA 5JFSA 5GIOE 2XYNA 4O21A 3JUHA 1WBVA 3FL4A 3WZUA 3ZEPA 4Q5HA 4BTFA 4RJ3A 4YLLA 4X2NA 3DFCB 4FKLA 2OICA 1Z9XA 1B39A 4E73A 2YCSA 3L9PA 3S4QA 1PY5A 1NT2A 4GVAA 4JIKA 4YGAA 4IFGA 4R8QA 5ETCA 2E2BA 2WAJA 3COHA 4FTQA 4CEGA 4FG7A 4E1ZA 3GCQA 5KBQA 4MD9E 3N4UA 1ZZ2A 3QUDA 3LFCA 3O51A 1OUYA 4RRVA 5AV1A 5FP6A 3GU7A 4RZVA 1Q8UA 4PDYA 1E9HA 3DKGA 2PPQA 2YDJA 4RJ6A 2OH0E 2X2LA 4M69A 2B53A 5E8VA 5B7VA 2R3FA 4DC2A 5CEMA 3A7GA 2W5HA 2XCKA 3QD2B 2R3HA 2VTRA 2WHBA 5A14A 5M51A 3E92A 2CKPA 3NCGA 4DTKA 3D9VA 4X7QA 5AR4A 1OMWA 5EK7A 4B8LA 4WBOA 3DKOA 3TN8A 3D15A 3S95A 1IA9A 4X3JA 3NSZA 5CT0A 4BDKA 5BUIA 3ENMA 2YIWA 3PTGA 4FV8A 4RIWA 2PVNA 5BQ0A 1Q4LA 3WZKA 2KULA 4HCVA 2W4OA 2FUMA 4FEWA 4FEXA 2WMRA 3Q53A 4MNEB 5CVGA 2V0DA 2QU6A 4AT5A 2VN9A 3MFUA 3F3VA 1KWPA 3MIYA 4HNFA 4ZZNA 2BRHA 3E8CA 3FLNC 1Q3WA 5CNOA 3ZM4A 3OUKA 5A46A 3HP5A 1LPUA 4LOPA 1JWHA 4D9TA 3KK9A 4A9SA 4XX9A 2IPXA 4R78A 3LW0A 3C50A 4RX8A 4I5PA 3IO7A 3PPKA 4R7HA 4NYEA 2HZ0A 5M57A 2YWPA 4NJ3A 3NEWA 4A9TA 4RPVA 3ZXZA 1QPEA 3BYUA 3BLQA 3O8PA 5DEWA 4QMOA 4HCUA 4BZNA 2Y9QA 4O7WA 3GOPA 4XG6A 4L01A 5JQ8A 3UPZA 4OLIA 1WZYA 3OWPA 4ERWA 1ERKA 3G9LX 3PG1A 3PSDA 4Y72A 4QNAA 5BMSA 3O71A 1XO2B 4BIDA 1R3CA 5CI7A 3ZSHA 4PNIA 4AN2A 1UA2A 3FMJA 3WF9A 3AOXA 4XYFA 2GS7A 2PZIA 3LXKA 5DIAA 5AR3A 3QD3A 4G6OA 3QTXA 4XBRA 3OWLA 2PZ5A 4HZRA 4FZ6A 4DLJA 5IQIA 2YA9A 3CPBA 2BKKA 2WMWA 4F7NA 1RW8A 3VVHA 4C61A 4LG4A 4Y73A 5TE0A 3VW6A 4ZSEA 4PY1A 4MBJA 3VJNA 2YJRA 3ALNA 2X9EA 2F7XE 3QD4A 3ZSIA 3OTUA 4CKIA 1YDSE 5IEXA 4IB3A 2ZAZA 2HYYA 4QYFA 5IQHA 3RHKA 1IG1A 2O3PA 3ZLYA 4IM0A 4YLKA 3DU8A 5JK3A 2PUNA 4GEOA 2PVYA 2QHMA 3FMHA 3SHEA 3RGFA 2Y7JA 3ATTA 4ANNA 5T3QA 2EXMA 3UOLA 4FV5A 3QKMA 1KE7A 4GU9A 5M07A 1JSUA 3EHAA 3PIYA 4M97A 5D11A 3G9NA 4YUQA 3MB6A 2R5TA 2QD9A 2BR1A 4U43A 5CAVA 3C9WA 2JDVA 3O7LB 3THBA 3LIJA 5AM6A 4QMZA 4IBMA 4O0TA 5ETFA 1ZYSA 3GVUA 4JLCA 4ZY6A 5IQCA 1SVGA 4DE4A 4C35A 3ORTA 4GFOA 4W4YA 4FX3A 1WBWA 3FKOA 4ZAUA 1IRKA 4E4NA 3GT8A 4G9CA 4JBOA 4YJSA 3DTCA 4IW0A 2J2IB 2WELA 1KE8A 3F2AA 3K3JA 4FZ7A 3SRVB 1MRVA 3F9NA 4JR3A 4KIKA 3KF4A 1M14A 5F20A 1J1CA 3A4PA 3CJGA 3PSBA 4UYNA 3V5PA 5TT7A 3ZO3A 4ENYA 5KBRA 3QHWA 2XKEA 4DBXA 3WZEA 1V0PA 1H1QA 2C1AA 3RPOA 4YNOA 2BILB 4ZTMA 5CAPA 5J7BA 3JY0A 2BDFA 4QP4A 5FRIA 5J87A 4AE9A 5AM7A 4CFUA 2XBAA 3LQ3A 4W4WA 4EOPA 2J90A 2R3OA 1G5SA 1GIHA 4DT9A 4UYAA 1H07A 3LJ1A 5K4JA 3H3CA 3FMEA 4EJNA 3VUTA 3UO5A 2R3RA 3EKNA 3ZUVA 4G6LA 3HV7A 1TKIA 3BV2A 4NWMA 3NYNA 2WQMA 4NFNA 1SM2A 1VYZA 4P7EA 3G51A 5CAQA 4JT3A 3POOA 4E20A 2GQRA 4EOOA 5HVKA 4J96A 3R8MA 3WYXA 3BU6A 3LFAA 4EK8A 3LCTA 3M2WA 4J8MA 2WU6A 5HNBA 3ACJA 4BWPA 5KO1A 4RIXA 4YJOA 3CLYA 5FBOA 2J0JA 2Y4IC 4IWOA 3G15A 4RC2A 3DJ6A 3R6XA 2X6EA 4HNIA 1OUKA 4EOJA 3EQGA 3HUBA 3CS9A 3I0QA 3S1HA 3ETAA 3UPXA 5H8BA 2GTMA 3PE2A 2NP8A 2R3LA 4DEHA 3F61A 3PY0A 3UIMA 5HD4A 1J7IA 4BCFA 2XNMA 4O0YA 3V01A 3ANQA 3MSSA 4F1TA 5I9VA 5LVMA 3NNUA 1OIUA 5C27A 4JG7A 3FLWA 3SC1A 3U9NA 2UZVA 3EZRA 3SXRA 2IG7A 5M09A 2W9FB 5HGIA 2OF4A 2UZNA 2W1EA 2WMAA 3RKBA 3PE1A 4LV5A 4NH1A 5AUWA 4EH4A 2CGWA 4P5ZA 3N4TA 3D7TA 3QQLA 1WVYA 4IANA 1GJOA 1Y6BA 5M4UA 4OBOA 4ID7A 3CY2A 4BYIA 5BYLA 1PYXA 4AN3A 2VTPA 1YDTE 3DQWA 4R6VA 4IDVA 4NK9A 4ZS4A 2W4KA 1YI3A 3DQXA 3KRWA 4DN5A 2Z02A 3PJCA 3R9RA 1H0VA 3GC7A 3KULB 1XH8A 4RA5A 4WO5A 2UW5A 2OSCA 3EQFA 4AZSA 4MKCA 2ESMA 4R7IA 5EW3A 1STCE 4AZFA 3GU4A 1HCKA 3DAKA 4U97A 2UZOA 4UWCA 4C4FA 1OL5A 5JT2A 4Z3VA 2QLQA 4YC3A 4TRLA 3FYJX 2UZUE 3R21A 3DCVA 3QTSA 3R2BA 4F9YA 4BBFA 2YM5A 2I40A 2Z7SA 3OOMA 5ACBC 3ZLWA 2PL0A 4JDIA 4U0IA 5CI6A 1G3NA 1XH9A 4FT0A 3C4FA 2PHKA 3DXNA 3RWPA 5AUZA 5EOLA 4PV0A 3COMA 4BDBA 4J8NA 4RC4A 1PXPA 3LFQA 4S2ZA 3UOJA 3TKHA 4C62A 4DEEA 4RBLA 3RAKA 4ASXA 4IZAA 5HG7A 5BX0A 2B1PA 5C26A 3BGPA 3EQCA 2HIWA 3GI3A 3FC1X 4KINA 4ZJVA 4O81A 5EYDA 4HYIA 4KS8A 1U5QA 4HCTA 4Q5EA 2PYWA 2YITA 2ZJWA 5A6OA 3T9TA 3GQIA 2EXCX 3NNVA 2CMWA 2VTNA 1RQQA 4FTMA 3TXOA 4LOQA 1P4FA 1QPDA 4ARKA 4F63A 4ACCA 4CKJA 2QOIA 4ANQA 4WT6A 4U80A 3VS7A 4C4EA 3RHXA 3KA0A 5JGAA 3SRVA 4IWQA 2FO0A 3AC3A 1SVHA 3EOCA 4KIOA 4N70A 3ZYAA 1K3AA 2GNFA 3V8TA 2YDKA 3V5WA 1X8BA 1V0OA 4FKPA 3NCZA 2WEVA 3NAXA 4GRBA 4BBMA 5CXZA 2C3KA 1H08A 1YHWA 4D4RA 2RIOA 3ZRLA 3HMOA 4FV7A 3QTUA 3QX4A 4G3DA 1OIQA 4HGLA 4FKUA 3DBEA 5AAFA 3FZSA 2R3QA 3TI1A 3A60A 4BBEA 3R7EA 4RFZA 1J3HA 3DGKA 3GEQA 2UZEA 1QCFA 3F7ZA 3GC8A 4J1RA 2YCFA 3DNEA 4XCUA 3ZBFA 4CFMA 1UU8A 1NVRA 1U46A 4XRJA 4KSQA 2IN6A 4NCTC 1Y6AA 5CZIA 4HVIA 4U42A 5K9IA 4TWNA 3WYYA 4CCUA 3VS4A 1PHKA 4YC6A 1OKYA 3AC2A 4CFVA 5KKRB 2CCHA 1H26A 3I0OA 4TT7A 1Q8ZA 4KWPA 1JSVA 3KXGA 1YI6A 3ZDUA 5JFXA 4TYEA 4YZMA 4XG2A 3NDMA 3C4EA 3DDQA 4L52A 4D1ZA 1A9UA 2FB8A 3PWYA 2B9FA 3NW6A 2QURA 4X3FA 3QTZA 3TKUA 1J7UA 1BUHA 4JBPA 3MH0A 2W5BA 5HCXA 2FSMX 2WMSA 3ZRKA 2UW6A 3CD8A 5JFWA 2C6DA 1JBPE 3A7IA 4MXXA 5BNJA 5H8GA 2DS1A 2X4FA 4K33A 3QTRA 4BN1A 4GCJA 5CSXA 5DR6A 5T68A 3C7QA 4FGBA 4M14A 1OIRA 2PVJA 1ZOEA 4D4YA 4E7WA 3Q4UA 4YR8A 2F49A 2IVVA 2BUJA 4FSUA 4G3EA 2OIDA 4UBAA 3HL7A 3VUGA 2VWIA 2WQNA 3QQJA 2YFXA 1ZYJA 1URCA 4IVBA 2JIVA 3D5XA 2UW3A 5IUIA 3S2PA 4EK6A 4E5AX 1FBNA 2O2UA 2PMIA 3UZRA 3RAHA 2WMTA 2C6EA 2ZDTA 3KULA 3QQGA 1IEPA 5FBNC 2UVYA 3RZFA 3EFWA 5HBJA 2XIRA 5DRDA 2RFNA 4C4IA 5JEBA 4ZXTA 4RG0A 4TYIA 3POZA 4GK2A 3DY7A 3FYKX 3VQHA 2ZOQA 2HELA 1OM1A 4K11A 4XEYA 4OUCA 4EHEA 5JMSA 4OAUC 1YRPA 3VS6A 4QYGA 5KZIA 3ANRA 4FT3A 4FOBA 2X2KA 3NGAA 4HYHA 5IA5A 1GZ8A 3TTIA 4AZVA 4DA5A 4IWDA 2C6KA 2X81A 5CU3A 3QUEA 2W96B 4CQGA 2XIKA 1VJYA 3NW5A 1GAGA 3WF6A 4CZUA 3P7AA 4D2SA 1TQPA 3L8SA 2XF0A 4GYIA 4S33A 2XNNA 5AX9A 3TZMA 2E9OA 4L7SA 5EM5A 4XS2A 4O7VA 3VJOA 3BHYA 5LWMA 4WRSA 3OCBA 2ZV7A 3TZ8A 2R3IA 4FK6A 5H3QA 1H1RA 4D5HA 1XBBA 3HRBA 4GIHA 4PDOA 4IB5A 5D12A 4I21A 4MXCA 1XH5A 4K2RA 5DEYA 5CT7A 4E6DA 5K0XA 5JGDA 4WOVA 5E92A 4QP6A 3NUAA 1QPJA 3E8NA 4M0ZA 3D5UA 3DAJA 4OTRA 5IA3A 2VTTA 3R8ZA 5FP5A 3OW4A 2RFDA 2JDTA 4MBIA 4DFLA 1M52A 3IW5A 3PZHA 2P55A 1H1WA 2IW6A 4G5PA 4M67A 4OTFA 1NXKA 3Q9WA 3Q9XA 4LI5A 4I6QA 5HNGA 3IG7A 4R5SA 3PXYA 2Y4PA 3NNWA 4QP2A 3QKLA 4XV2A 5DR2A 5CENA 4A4LA 4G16A 1W82A 4CFNA 3ULZA 4GT3A 2WZJA 2WPAA 4FIIA 4O83A 3BQRA 3HP2A 3OXTA 2VTIA 2X1NA 1H25A 4DCEA 4DINA 4PNKA 4Z16A 4I41A 3FXZA 4H3PA 3A62A 2Z7LA 1PXMA 3NUPA 4ZSJA 1YOLA 2BKZA 3OHTA 4DGMA 2YCQA 4BGHA 4BYJA 2BPMA 3MY0A 3MVLA 1XBCA 4LGDA 5L2TA 3T8OA 3NUYA 4WRGA 5KX8A 2WQBA 2OZAB 1Q5KA 1H00A 4FKTA 3S3IA 4EOMA 5BVDA 5LCJA 4C34A 4F64A 2QHNA 4ALWA 3DK6A 4BHZA 4RJ5A 2UZWE 4G1WA 5HKMA 2JDOA 2PZRA 4L46A 3ZUTA 3QGYA 4E5WA 5D7AA 3ORIA 2ITQA 3M11A 2WKMA 4O0SA 3UVRA 1UNGA 1PJKA 4F99A 4BGQA 3W1FA 4PF4A 4PL4A 3BEGA 3Q3BA 4DGNA 4BWXA 2C0OA 2BHHA 2GMXA 2W1GA 5CF5A 5E1EA 1Q24A 2C6IA 1YDRE 3FSFA 4P2KA 4FSZA 3MVJA 3ZM9A 3MY1A 4UMPA 2NO3A 2XJ1A 3FQHA 4YO4A 2OWBA 2X8EA 3BHUA 3K2LA 5DR9A 3HMPA 4C3PA 4O7ZA 3DPKA 3AC4A 4PPBA 4BRXA 1IR3A 2PVMA 2Y6OA 5EYKA 4A07A 2XNBA 3I60A 4EK5A 2ZB1A 4MX9A 3D0EA 1REKA 3CQEA 3QQKA 3CY3A 1W8CA 4N0SA 4AW5A 3GCSA 3EQRA 4LRJA 2QOOA 2UVZA 4TNDA 5I4NA 4QT1A 5FGKA 1R0EA 1WFCA 3PY3A 4EH3A 2C47A 4IZ7A 4HVHA 3SA0A 3H0YA 4GW8A 3BYSA 3MW1A 4NM5A 3UODA 4E4MA 4DH1A 2VWYA 2G2FA 3LHJA 1JKKA 2E9NA 1UWHA 2RKUA 3CIKA 4QYYA 2GFCA 4CMTA 4NTTA 4WSQA 2YM7A 3QCQA 1FGIA 2JD5A 4TKSA 4W9XA 4GT5A 4N6ZA 4IC8A 3NYVA 4FEQA 5GIPE 4ZEGA 3R7UA 4R1VA 3Q4CA 5DGZA 4JDJA 2BMCA 4BTMA 1I09A 1ZOGA 5B2MA 4O0XA 4H1MA 5HIBA 3RK9A 4ZMEA 1SYKA 4DGOA 1U54B 1YXXA 1XBAA 3DV3A 4NSTA 4WG3A 4DG3E 2CKOA 4N57A 3OEFX 4LL0A 5IQGA 4BCGA 3E93A 3AQVA 3KCKA 5F1ZA 3NLBA 4NW6A 5HTCA 2XH5A 3WILA 4FTAA 4L7FA 3IONA 4U3ZA 4C58A 3LCKA 4ZS0A 3ZLXA 4QMNA 3FBVA 2Z7QA 2HCKA 3VW8A 3EZVA 4G31A 1J91A 2AYPA 3HLLA 4IAZA 3HA8A 5DG5A 4CZYB 2WMQA 3WIGA 4E4LA 4LRMA 4M66A 3FJQE 2XIXA 2C3IB 4G3GA 4D1SA 4Y5HA 3UG1A 2W1CA 5IISA 2R2PA 4OTWA 5M4IA 4AGWA 4K77A 3EB0A 4D0WA 4F9CA 5HHWA 4D0XA 4AE6A 4ITJA 5HCYA 5IZFA 1DI8A 5M53A 3KFAA 4ITIA 3LXLA 4F08A 1QMZA 1SNUA 3Q52A 3GP0A 5HD7A 4ZJJA 4BCHA 4DEIA 3O96A 2QR7A 2OK1A 4NKAA 4OTQA 4AS0A 3LM5A 5AV0A 5EQEA 2XJ2A 2PZPA 3GB2A 2OG8A 2HZ4A 4IWPA 4MXAA 4KBKA 5HOAA 4GG5A 3U4UA 1XR1A 4RSSA 1UNLA 3RPVA 3PG3A 4CSVA 2R3PA 1A48A 5B2KA 3LMHA 5AR5A 4YBJA 2J0KA 3VULA 4BCIA 2VGPA 4ZY5A 3LLTA 3ORLA 2ITWA 4IVCA 4RIOA 4YZCA 4D2TA 2XCHA 5KE0A 4BTKA 3B2TA 4U79A 4CMOA 3NYXA 5AUTA 4CG8A 4QOXA 4RWJA 5TOZA 2HZIA 4FSRA 2FSTX 4G17A 3B8RA 5CVHA 4RQVA 2C5NA 5AUVA 4EOLA 5BYYA 4BZOA 4BI2A 3OMVA 4C3FA 2PUIA 3HAMA 4KBAA 5AUYA 4XOZA 2YM8A 4PP7A 3CEKA 2B54A 3HV5A 3F5UA 5CF6A 3SX9A 2IW8A 1PXOA 1W7HA 3UNJA 4EZ3A 1XH7A 2FH9A 2XK9A 3MH3A 4FKWA 4IFCA 2VUWA 4TWPA 5BVOA 4W4VA 3HEGA 3O50A 3FDNA 4L9IA 4I1ZA 5M06A 1HCLA 3OFMA 4L53A 5ANKA 2GU8A 4EH7A 5I9WA 2G1TA 2YAKA 1OKZA 2DWBA 2OZAA 2W1IA 3KMWA 3SW7A 4U45A 2R3KA 2C6OA 3E8EA 3L8XA 3I5NA 3WZDA 4FV0A 2H9VA 2WTJA 3L9NA 4R1YA 4O0WA 4AZEA 3ATSA 3BV3A 3MI9A 3SLSA 1IASA 2C68A 4IAAA 4BY9E 3D2KA 4APPA 4FTUA 4LL5A 4GFMA 5IG1A 4CNHA 1SNXA 4RVMA 4C33A 3O7LD 4D2VA 2Z8CA 3EYHA 3C51A 1QPCA 4X2KA 4CLJA 4IJPA 3IGOA 2J6MA 5E9EA 5AV3A 4FTIA 3QZFA 4JL9A 2WGJA 3Q9ZA 5HG8A 2NPQA 3R1YA 5C9CA 3UBDA 2FA2A 2XM8A 3C5IA 2ONLA 1NVQA 2CGUA 2WQEA 3D4QA 2G2HA 3IDPA 1RE8A 4FBXA 1H1PA 1E1XA 5AUUA 5BYZA 3DZQA 4DFYA 2J0LA 1GOLA 3OCTA 3QD0A 4QMYA 2C69A 3U6JA 3UMWA 2JBPA 2OIQA 4G9RA 2YCRA 4YMJA 4HYSA 3ORNA 3TNWA 1Q61A 4F0GA 5JRSA 4EHZA 3SXSA 3EN4A 3DBQA 3OZ6A 1REJA 2FVDA 2W1HA 5C8NA 3BU3A 1YXVA 3C4ZA 3PA4A 2B9JA 3HRCA 2OLCA 3DK3A 3OCGA 4ZTHA 3UO6A 4B8MA 3FXXA 2ZM4A 4F09A 4O38A 5AP2A 3R02A 4C57A 2BRMA 3W2OA 2IVUA 4MF1A 3QHRA 4U81A 3OF0A 1XHAA 3BCEA 1U54A 4F6SA 4MWIA 5JFVA 2BZJA 5DN3A 2Y6MA 3II5A 4D2PA 3OUNB 3DT1A 5J1VA 4M15A 1WBSA 5LVPA 2OFUA 4NU1A 4ANBA 1OIYA 3FZRA 5DYJA 3FI8A 5T6KA 2IZTA 4ANMA 1ZMVA 3W8LA 4H1JA 3PPZA 4AF3A 4IACA 4BDJA 3DK7A 3W16A 2V7AA 3P9JA 3QU0A 2EB3A 4X2GA 2ITTA 2W1FA 3FE3A 2ZB0A 2BTRA 2C1BA 3DZOA 3KC3A 4X3FC 5GJDA 4YP8A 2YABA 5LMBA 2WMUA 2IW9A 2UV2A 3FZPA 5HTIA 2JKMA 4XG8A 1JVPP 4DGGA 1MRYA 3KKVA 4V05A 5AUXA 1O9UA 3ZTXA 3FI2A 3GBZA 3OWKA 5KMMA 1OBDA 4AOJA 2IO6A 3LXNA 3GOKA 1YVJA 4QQCA 4PTEA 5EDRA 5D41A 2XNEA 4AG8A 4BDFA 5L2QA 4ZP5A 4DFBA 1P5EA 3TV4A 1GIIA 2AUHA 5DWRA 5AX3A 5EM6A 3QXPA 5HLPA 1JKTA 4PRJA 1Q97A 3MH1A 2EU9A 3C4WA 3WBLA 1M2RA 4HPUE 1OECA 3NPCA 3A2CA 3RVGA 3MWUA 5IQBA 3WE8A 3DB8A 1MP8A 3BELA 4AZWA 5D10A 3KVXA 3K5UA 4OBPA 1ZOHA 3G2FA 1OKVA 3HMMA 3ZC6A 3MB7A 5J95A 5B2LA 3RAWA 3MFRA 1LP4A 3FPQA 2GFSA 5A9UA 4Q2AA 4KBCA 3C0HA 1U59A 2VV9A 3W8QA 2GPHA 4FMQA 2ZM1A 3UDBA 4KKHA 5CY3A 3PWDA 5EFQA 1WCCA 2I0HA 2C0IA 2UW0A 2X4ZA 3BHHA 1TQMA 4EOQA 4TTHB 2ZM3A 1JOWB 3CD3A 3QRUA 5AMNA 2XK8A 2YIYA 3TL8A 5FEEA 4USFA 2RL5A 4R3RA 3ZMMA 1GZKA 4EI4A 4FKSA 3V5QA 4PMPA 3FMKA 4CMUA 3N9XA 1IA8A 2YHVA 4S31A 5J8IA 4I6FA 3EN9A 5EKOA 4JRVA 5AIKA 3MJ2A 2QI8A 5I9ZA 4FSNA 2GQGA 2J7TA 2OO8X 4FSQA 3KXNA 2PU8A 1UVRA 3GUBA 4IH8A 3FV8A 5DE2A 3VS1A 4KAOA 5E8WA 4BFMA 4BI0A 3TNPC 5GNKA 5A4EA 5JSMA 4KB8A 2XUUA 3FMNA 3UIXA 2IVSA 5IQAA 4RFYA 3RK7A 4V01A 5BVEA 4LM5A 1Q62A 1Q8YA 1XQZA 4ZTSA 3Q6UA 4EH5A 3LJ0A 3P5KA 1YHVA 4BZDA 1DAWA 4O96A 4RA4A 1YXTA 4RVTA 3ZRMA 3NVMB 4H05A 1CKPA 3RINA 1YWNA 4L3LA 5E1SA 5AV4A 3U87A 4L45A 3VBWA 1KE5A 2EXEA 3AMYA 5GZAA 4O6EA 2WTKB 2YM3A 1MQ4A 4AXAA 3VN9A 1CSNA 3EKKA 1ZAOA 1UU9A 3LFSA 4I5MA 4G3FA 5FEQA 4DAWA 5E8UA 3RAIA 1XH6A 4U40A 5L6WL 3HECA 1K2PA 3ZC5A 5HU3A 4Q9ZA 2RFSA 2W4JA 3BBTB 3B2WA 4MNEA 2C5OA 2VTHA 3G0EA 4IX3A 3F69A 4O6LA 1PMVA 2ZYBA 4O7LA 3ZZWA 2QONA 4XRLA 4E3CA 4C59A 2XIYA 3EFJA 1GZOA 3TKIA 4UB7A 4YU2A 4O2ZA 2BIYA 5HLWA 4FE2A 1FPUA 2QOKA 3FL5A 3UQCA 3NVKI 3FY0A 2OU7A 1OZ1A 4CFXA 2I0VA 3EJ1A 3R7IA 2Y0AA 2GS6A 4YZBA 5J7HA 3KF7A 1KV2A 3PP0A 3OW3A 4CFFA 2YIRA 3PXFA 4BCKA 3CJFA 2BVAA 4UN0C 2CNVA 1PYEA 5IDPA 2PMNX 3JPVA 3ZZEA 1AGWA 3FKNA 1W0XC 2VU3A 4JJRA 4S32A 2UW9A 3AGLA 2OXXA 4O0RA 3PXRA 1R39A 3QTWA 4JI9A 3UVPA 4BGGA 3KGAA 4YTCA 2UW8A 3NNXA 4PUZA 1YHSA 2X7OA 1BL7A 3U55A 3F3ZA 4O7TA 2GNJA 2YLFA 3ELJA 3LQ8A 4QPMA 4NFMA 5AP3A 3V6SA 5EI2A 5CAOA 3KEXA 3AT4A 3V8SA 1WBNA 3OCSA 4YPDA 3TACA 4Y46A 4C7TA 2OJFE 3E8DA 5EM7A 3FQEA 3DXQA 1A06A 1KV1A 4I94A 4ZSLA 3DFAA 4W9WA 3VUKA 2EVAA 4C4HA 3AC5A 2PUUA 4KKGA 4CFWA 4BR3A 4RVLA 3D7ZA 4O0UA 4W8EA 1AQ1A 4M84A 5BUEA 3FHRA 4MF0A 5K0KA 4II5A 4LUDA 4YNEA 1Y57A 4DG0E 2ITVA 3FPMA 3HX4A 3ITZA 4YZNA 5HCZA 3JY9A 3M1SA 3WIKA 3PVGA 2REIA 2GNIA 2DUVA 4I0TA 3Q5ZA 1OL6A 4XG4A 2HAKA 4O27B 4JBQA 4PPCA 2X9FA 4N4SA 3SOCA 3ZS5A 4D5KA 2CPKE 4BKZA 4O7RA 5ANGA 2RGPA 3QC9A 4AOIA 4CVAA 4FUXA 1M7QA 3BQCA 5FG8A 4U9AA 3AD6A 3BWFA 4ZSAA 5FDXA 4I3ZA 5K3YA 3REPA 2PE1A 2UVXA 2R9SA 5IA0A 4D1XA 3PVUA 5CU6A 4ZTLA 4JQ8A 2QCSA 1Q8WA 4UMUA 5I5ZA 3KMUA 3PRFA 4UXLA 5B0XA 3RP9A 5I3RA 3VRZA 5AA8A 4NEUA 4XNEA 5HBEA 4F1MA 4EBWA 5AP6A 5F94A 1ZARA 3ZLSA 2ACXA 4U5JA 1IAHA 1PXLA 1ZYDA 4USEA 4XOYA 4MTAA 4C8BA 4XH6A 3GGFA 4S34A 3TUCA 3L9MA 3CTJA 4EQUA 2J9MA 3MYGA 2ZV8A 4GK3A 4PTGA 5HO8A 4WNKA 5CLPA 3R8LA 4QMPA 4LGHA 4FR4A 4I20A 4QMWA 3VF8A 4FZFB 2OFVA 4CYIA 3SVVA 4CXAA 4HZSA 2XA4A 3GFWA 4L00A 2BCJA 4RWIA 3TCPA 3HAVA 4BDGA 2RG6A 4FF8A 2Y4IB 2CKQA 3Q2MA 4QP3A 3BWJA 2HWPA 5KMLA 4KABA 3EH9A 4G5JA 3IW8A 1ZMWA 3D5VA 3P4KA 4MQ2A 5H8EA 2FGIA 5A4CA 4O82A 1YI4A 2O65A 2WO6A 5DOSA 2QQ7A 3B8QA 3QQHA 3UOKA 4QTEA 3P79A 3DLZA 3R7GA 5HG9A 3GENA 5L6OA 2QOHA 1OI9A 1ZYCA 2UZTA 4KRCA 4FG9A 4EYMA 3U54A 3R7VA 2VO3A 4HJOA 3ORPA 5HE3A 4FV9A 4QP7A 3EQHA 5CU2A 2RF9A 3ZFYA 3GQLA 3I7CA 2V55A 3C0GA 5GZ8A 3VIDA 3TDVA 4IJ9A 4F9BA 2C3JA 4APCA 4V0GB 4RWKA 3LQ5A 4KSPA 1ZRZA 4B0GA 5C03A 5CSPA 1NW1A 4JDKA 4L42A 4XP3A 2PSQA 1FVRA 3FLSA 4J53A 4YHTA 3PDTA 4M8TA 4ZLZA 4I23A 4MQ1A 2J4ZA 4QMXA 5CS6A 2VO6A 3ODZX 5DT0A 3R22A 4QMSA 5CU4A 5HI2A 5AP4A 4DEGA 3RALA 5C1QB 3E3BX 5HNIX 2I6LA 1UV5A 5HVYA 4GUBA 2G15A 3H9OA 4DBNA 3OXZA 4IIRA 3GCUA 4IDTA 2YN8A 4UWBA 5IA4A 3AD4A 5FUTA 2VTLA 3MPMA 5HTBA 3I6UA 4WNMA 5IH6A 4M12A 2WTDA 5KMNA 2I1MA 2E9VA 3I1AA 3P7CA 1FMKA 3CKWA 3ORZA 4AT4A 4BKYA 1L8TA 3DBDA 1GY3A 4ERKA 2PVFA 1OL1A 4Y8DA 3CTHA 1FGKA 5DT3A 1R0PA 5EQPA 3TZ7A 4Z55A 1QL6A 5LVOA 2WTVA 3HRFA 3NUUA 4O1PA 4BDCA 3C13A 4EQCA 3R7YA 5IMXA 3VS3A 4CG9A 3EQDA 3F3WA 3HA6A 2XEYA 5EG3A 2Q0BA 5EKNA 4FEVA 1TVOA 4RX7A 1RDQE 2XZSA 1B6CB 4RX5A 3LJ2A 4EL9A 4J99A 4RLLA 2R0UA 4QMVA 2ONLC 3QQFA 4OT6A 3ZOSA 2PZYA 1K9AA 4UMQA 3GC9A 3ENHA 5HVJA 2HENA 2XS0A 5A4TA 2XK4A 3G33A 3C4XA 4EH9A 3ZFXA 3I5ZA 2BRGA 3P1AA 4O1OA 4W4XA 1M2PA 4CT2A 5JGBA 2A27A 4BDIA 4TWCA 3RZBA 4QQJA 4YHJA 5KHWA 3LLAA 4NM3A 3RJCA 5EI6A 1V1KA 3ORXA 4L43A 2CNUA 4HOKA 5TO8A 4L68A 1B38A 2ITOA 5FM3A 3UVQA 3OS3A 2J0IA 3SDJA 4AW2A 2ITXA 3TZ9A 2R7BA 2W1ZA 3A8WA 3DJ7A 2JKOA 2FSLX 4A9RA 4DEAA 5EW9A 3D83A 3KCFA 2WTIA 4QPSA
chains in the Genus database with same CATH superfamily
4A06A 2H96A 4MK0A 4IEBA 5ANJA 5I3OA 5FXQA 3QQUA 2X2MA 4PMTA 3UDSA 3JXWA 3EQBA 2BDJA 2XRUA 4WA9A 2IVTA 4Q9SA 1H1SA 3UMXA 5EDQA 5E8YA 3V3VA 3W2QA 4B99A 4O2PA 5HORA 2A2AA 2J50A 3KVWA 2OJJA 4JAJA 4YTHA 3EQIA 4OW8A 3ZEWA 2I0YA 4CV8A 3IDCA 5DLSA 4I92A 3QLGA 5JRQA 3PYYA 4GL9A 3HNGA 3QFVA 4X21A 4FYOA 5IQDA 5LMKA 2Z7RA 2XNPA 4DG2E 1YQJA 5BVWA 2YLEA 5J5TA 4NW5A 3BGZA 3TM0A 2ERZE 5GHVA 4XP2A 2RG5A 4B7TA 3NZ0A 2PMLX 1F3MC 1OPKA 2BHEA 3KXZA 4L6QA 4DHFA 4L67A 2QO2A 4IMYA 3KRJA 4RJ4A 2JFLA 4S30A 2W5AA 4RJ7A 2LAVA 3IECA 2JLDA 2VO7A 3OT3A 3Q9YA 4WNPA 4C3RA 2C5YA 4IX6A 4FEUA 3EFLA 4GT4A 3QA0A 3R30A 3UTOA 4BCMA 4DFXE 4E6QA 2OJIA 4CV9A 4GV1A 3TMOA 3DKCA 3R1SA 3BRBA 3ZXTA 2JBOA 2C4GA 2X7FA 3BHTA 3G6GA 5BMMA 5AADA 4AGCA 3R71A 2F4JA 3PVBA 3D2IA 4GU6A 5AEPA 4YZ9A 4OTPA 3RNIA 4FL1A 4AQCA 1LUFA 2W05A 3Q5IA 4OT5A 3VNTA 4CZTA 1UU7A 4BL1A 4U41A 3TNHA 5H9BA 4DEDA 3BE9A 4I0SA 5BPYA 5D9HA 3TIYA 2Z2WA 5IUHA 4QEBA 1PRYA 3BI6A 2QKWB 2HW6A 3NIZA 2X7GA 4A7CA 4QMUA 1ATPE 1ZWSA 3RPSA 4FKGA 3VBXA 4BHNA 4AOTA 3KB7A 4PL3A 3UZTA 1IAJA 3GXLA 3QUPA 5AJQA 2BAJA 4G2FA 4BKJA 2OZOA 3VS5A 4Z7GA 5EM8A 4FA2A 4ALUA 3PJ3A 3FEGA 4AA5A 4FL2A 1PXNA 3CBLA 4V0GA 3ZO1A 5M44A 5DT4A 4ZZMA 2C6MA 1M17A 1O6LA 4IM3A 1FMOE 2A1AB 2V22A 4CTBA 2O64A 5M08A 4R3PA 3R8PA 3DBFA 5HIEA 3TNIA 4X6QC 4I5HA 2CN8A 1U4DA 2P2HA 5CEKA 3S00A 1OPLA 4KD1A 4U44A 4BICA 4OTIA 2VD5A 2B0QA 4MNFA 3NRMA 4EHVA 4ACGA 1SVEA 4QO9A 3ZO4A 2RSVA 3OG7A 3KN5A 4U6RA 3TT0A 2Q83A 3NR9A 1R1WA 3I79A 3HDMA 3KRRA 5CSWA 5A3XA 3BLHA 4H3QA 2GQSA 4DTAA 2QOBA 3C0IA 1UKHA 5FTOA 3D14A 4USDA 5C8KA 5CEIA 3PIZA 4FKQA 4YC8A 4I6LA 2OGVA 4XBUA 3ACKA 4ENXA 2WU7A 3SOAA 5HICA 3E87A 5CSHA 1OVEA 1DS5A 4BIEA 1T45A 5AP0A 5HIDA 3JYAA 2PWLA 3UDTA 2CHLA 3A7FA 3R9NA 3ULIA 5F9EA 2QODA 3RM6A 4O7SA 4RIWB 3U4WA 2H34A 2H6DA 2ITPA 3PXQA 2PY3A 4EOIA 1PMNA 5LWNA 4YJNA 3GU6A 4GKHA 3AT3A 2VTAA 3GU8A 3VBQA 4ACDA 2C5XA 1YOJA 3CCNA 2XANA 4WKQA 5IH4A 2HY0A 4PL5A 4KNBA 1MUOA 4PMSA 5HESA 3SV0A 3HGKA 4FV1A 3E88A 4YPSA 2VTOA 3U6IA 4QTAA 5IEVA 4I0RA 2F7ZE 5IPJA 5C4LA 4Y83A 5FXSA 3MFTA 5I0BA 2F57A 3O8TA 4BDHA 5GZ9A 5FXRA 4EEVA 1Q41A 4IM2A 1P2AA 4OTDA 4DEBA 3FMDA 4FGRA 5IU2A 3K5VA 2X0GA 5HX6A 3BE2A 3F5PA 4DFUA 4TY1A 2BRBA 3RCDA 5EDPA 4MCVA 1M2QA 1ZMUA 3CP9A 3FMLA 4JG8A 5DVRA 4ZY4A 2YEXA 5K5NA 4PWNA 1Z5MA 4NTSA 4TZRA 4FK3A 4WUAA 4BJJB 4X0MA 1OL7A 3UE4A 1PMUA 3AT2A 3SGCA 3IDBA 2WTWA 2F2UA 2ZVAA 3FQSA 3HYHA 3R04A 4FNWA 4BC6A 2CCIA 2W99B 2PVRA 3DBCA 3BKBA 1ZLTA 2XK7A 4IVDA 2WNTA 3VAPA 4Z7HA 2QC6A 4NT4A 4FIFA 4BVUA 3OTVA 3OXIA 4ZK5A 2VWXA 4CT1A 2PE2A 5I9YA 3GFEA 4D28A 4O22A 1H24A 4RC3A 3DAEA 3QTQA 1YOMA 2GNGA 4MYGA 4A4XA 4CGAA 3H4JA 2XKFA 4O4CA 4XV3A 1FVVA 2AC5A 1JKSA 4IAFA 3A7JA 3TTJA 2I0EA 2O63A 3QF9A 4K18A 1ST0A 4YBKA 3TG1A 3I7BA 4FTRA 3F82A 3TIZA 2Y8OA 4FT9A 4YTIA 4EUTA 4BIBA 4WIHA 3LKMA 1W98A 5L8KA 1WMKA 1OPJA 4AZTA 5BUJA 1W2FA 5EH0A 4EBVA 5AP1A 2ITNA 4IZYA 3LZBA 3S0OA 4KS7A 5AWMA 4E26A 3DKFA 3WI6A 1OKWA 2X8DA 2VZ6A 3DTWA 3W2CA 2A0CX 2OBJA 4KIKB 2QR8A 4JX7A 4EOSA 4UX9A 2O8YA 2QO7A 3QA8A 5TR6A 3A7HA 3MH2A 2RFEA 4DHZA 4EH8A 5HEZA 3VO3A 1OL2A 3C4CA 4LQMA 1YWVA 4IAYA 5AP7A 3P86A 4P4CA 2WD1A 3IW6A 4C4GA 1NY3A 2EUFB 3MFSA 4FZAB 3O0GA 4FTJA 4WD5A 4PDSA 1Y8YA 5I9XA 3JR1A 4XJ0A 2GHLA 4M0YA 4GUEA 5KMIA 4ITHA 2FSOX 3IS5A 3TV7A 3Q60A 4NZWB 3TV6A 5CEOA 3EIDA 4UY9A 4JXFA 1WBOA 3EQPA 2BFYA 2B55A 4XV9A 3RMFA 2VWWA 1ZYLA 4FC0A 3MA3A 1KUTA 5AV2A 1M7NA 5C01A 3IGGA 4CTCA 1V0BA 3A8XA 2IZRA 3QWJA 4FVRA 5L2IA 1CKJA 2PMOX 2VWZA 3UZPA 4O7NA 3W0QA 4L3JA 3UP7A 2YACA 4MD7E 5AR7A 4HYUA 2CNQA 4RIYB 2HW7A 4RIXB 3V51A 2PE0A 3ORMA 4ASZA 3QWKA 4I6HA 2B9HA 5G1XA 1G8AA 4L44A 4EUUA 3AC8A 5J1WA 4EZ5A 1WVXA 3ZH8A 4QYHA 4F70A 5L2SA 3R63A 5CTPA 4I5CA 3OBGA 4RQKA 5E91A 2C6TA 1VEBA 2OF2A 4FSYA 1J7LA 2IWIA 2VWUA 2XBJA 2SRCA 3DLSA 4IQ6A 2DYLA 2E9PA 3AMBA 2HY81 1YW2A 4TXCA 2C5VA 2IZSA 3CPCA 3F5GA 3K3IA 3VF9A 4E6AA 4UXQA 2J5EA 4M13A 3R9HA 2PULA 1UKIA 3CC6A 4K6ZA 4HPTE 3UO4A 5ACKA 3QRTA 4HGTA 4IADA 5DI1A 2VWVA 4ZSGA 4EWQA 2VWBA 5CVFA 2YIQA 4FVPA 4ANOA 2WTKC 4IX5A 2OH4A 3QRJA 4ZTQA 3VUHA 2ETMA 1GIJA 3D7TB 1Y91A 4O0VA 4OTHA 5E7RA 4FT5A 1GZNA 4C2VA 1KSWA 4IB0A 1UU3A 2X39A 4JQ7A 4DFZE 1BKXA 4BCPA 3IW7A 4IAIA 3PRIA 4NIFB 4FV6A 3VS0A 1Q8TA 4R77A 3ZCLA 2R7IA 3BYMA 4GS6A 3RPYA 1WVWA 4CYJA 1Q3DA 2CN5A 5K4IA 4F7LA 4LOOA 4NL0A 5JN2A 4BTJA 4FV3A 5J9ZA 3RPRA 3RNYA 3VUMA 2P0CA 2UZBA 4AAAA 4YZDA 3KREA 4FSTA 3PIXA 4AW0A 3R00A 3PVWA 5ITAA 4LMNA 3QRIA 3QZIA 1J1BA 2HXQA 4X6RA 4AGDA 4ZMFA 2ETRA 4E4XA 4M7IA 3E7VA 2A4LA 4CRLA 3UP2A 5FTGA 2E9UA 3WZJA 3GNIB 4MEDA 4RVKA 4UALA 2QLUA 4FTCA 5IA1A 1CMKE 3V5TA 3KU2A 2QVSE 2GNLA 4JOAA 4FNZA 2GDOA 3P7BA 4F7JA 3N51A 2R3JA 4JX3A 3ALOA 5E90A 4ZOGA 2BRNA 1TQIA 3FZOA 4RZWA 1FVTA 4D4VA 3LCOA 1KE9A 2A19B 2GS2A 3ET7A 4FOCA 4BCJA 2XJ0A 5BVFA 2XK3A 2YJSA 3HKOA 2XEZA 4N6YA 4CRSA 4HVSA 5E4HA 2XVDA 3QCSA 3PZEA 3VC4A 4ANSA 5E8SA 5EOBA 2R3GA 3O17A 5EHYA 3W2SA 5JZJA 1BI8A 3DDPA 4QMMA 3HMIA 4RFMA 2VTJA 4Y85A 4EKKA 2VTSA 5AP5A 5EI8A 2XALA 3RI1A 4OTGA 4FIJA 3Q4TA 2JKKA 4LGGA 3CQUA 2G01A 3PP1A 4FJVA 2HWOA 3CTQA 3QCXA 2LGCA 3ZU7A 5BV3A 4QQ5A 5CEPA 3CXWA 3R8UA 2G9XA 2OXYA 3R9DA 4EKLA 2HK5A 4FIHA 4DH8A 5IEYA 4F1OA 3QRKA 5EHOA 4RGJA 2WXVA 2PK9A 3SKCA 5J5SA 3LMIA 2ITZA 1KOBA 3NX8A 4EORA 3R28A 3PFYA 3W2RA 2CJMA 3PA3A 3QZGA 4RMZA 4BDAA 3HV6A 3FSKA 2YIXA 3GCPA 3NUSA 3QL8A 4E5BA 2OW3A 5GJGA 3HVCA 5A4QA 3FKLA 4YJUA 2XYUA 5FD2A 5AFVA 1LR4A 5ANDA 3F88A 4I4FA 3SW4A 5LJJA 3FI4A 4FTTA 2EWAA 2UW7A 3OC1A 4JBVA 3LPBA 4JRNA 2J5FA 2YERA 4C36A 3Q4ZA 2VX1A 3BU5A 3C5UA 4IC7A 5FM2A 2JGZA 3EN5A 3H10A 2BALA 3P23A 4FKJA 4QMTA 5M55A 2P2IA 1DAYA 4QRCA 4D55A 4D9UA 4FTKA 2ETKA 3W0SA 5JZNA 4XP0A 3R2YA 4ZJIA 3T9IA 5IF1A 5M4CA 4OAVB 3LFDA 3OEZA 4DYMA 4YJQA 3CKXA 4AWIA 4X2FA 1ZZLA 3MBLA 4ASEA 2WIPA 2C6LA 2WMVA 3UGCA 3H30A 3MTFA 5CSVA 3EL7A 4KIQA 2YWVA 3G90X 2WEIA 4DFNA 5GINE 4ZTRA 2HOGA 4J95A 1OBGA 4IHPA 4O84A 4RIYA 1DI9A 2IZUA 3FMMA 4A9YA 1XKKA 2PVLA 2AQXA 4AACA 1KOAA 4Y95A 2OIBA 3WE4A 2QOCA 1Q99A 4BWKA 2VNWA 3EL8A 4MHAA 3IK3A 4WG5A 4JR7A 4FICA 4LRKA 4X3FB 3OWJA 2R64A 2ZDUA 3MDYA 3LCDA 3FWQA 4AT3A 3PJ1A 5A4LA 5KKRC 3EYGA 4DCAA 3ZFMA 5F4NA 4LV8A 2VRXA 5KZ0A 4B6LA 3FC2A 3UIUA 3ID6C 4I4EA 3QC4A 1TFFA 2BROA 2O0UA 3COKA 2R4BA 3QXOA 5IQFA 1BL6A 4H58A 4C02A 5K5XA 3NAYA 4FKRA 3NUXA 4G6NA 4BCNA 4CD0A 4F4PA 5ICPA 3ODYX 5JQ5A 5CU0A 5JKGA 5IQEA 2ZMDA 3DA6A 3HZTA 2W1DA 2GTNA 2H8HA 4DH5A 4JQEA 4R3CA 4MXYA 4EONA 5CANA 5EYCA 2UUEA 3PLSA 4NIFA 4XHKB 4TWOA 4HVGA 4NM0A 2BAKA 2XIZA 4KUJA 5BVKA 5J79A 3PPJA 5DFPA 4EQMA 3UYSA 3O23A 4AXCA 5CEQA 5TF9A 2YDIA 3ZO2A 4AX8A 5JH6A 1ND4A 2W9ZB 3BYOA 4TYHB 5HZNA 1ZXEA 4GSBA 3MIAA 3E5AA 4WG4A 2ITUA 3UC4A 1O6KA 2JAVA 2F7EE 1KE6A 4O86A 1URWA 2F2CB 4K1BA 1PMEA 3MTLA 3UQGA 2CSNA 2JDSA 5CF4A 3OD6X 2VAGA 2PVKA 3COIA 3CR0A 4ZLOA 2B52A 3WF7A 3SG9A 4BF2A 3PJ2A 3QTIA 4ALVA 1PKDA 4E93A 4QNYA 5LARA 2NRUA 5CYIA 3BLRA 4IZ5A 3PJ8A 3MESA 2VO0A 3PXZA 4C4JA 3W0MA 2PTKA 3CQWA 3TDWA 4ACMA 3L8VA 3LFFA 3FZTA 3VBYA 5L6PA 5AA9A 4GH2A 5CWZA 4B4LA 3P08A 3UNZA 1UWJA 3H9RA 1YKRA 3BZ3A 4WBBB 2CLXA 3TNQB 3E3PA 4TN6A 1G8KA 3IPHA 2XP2A 5FLFA 3KN6A 5DNRA 3U9CA 4BDDA 4F65A 4WUNA 5L8JA 4DITA 4JG6A 2XM9A 5ANOA 3NW7A 3UIBA 5EQYA 5ETAA 3E64A 3N4VA 2P3GX 1UNHA 1H0WA 2XRWA 4KRDA 3IOKA 3O5AA 1VZOA 4F9WA 3TEIA 3PSCA 2W0JA 4EH6A 2VTMA 4EC9A 4QMQA 5M4FA 1FOTA 2QOLA 5DA3A 3OY1A 2YZAA 3FLZA 1XH4A 5L8LA 4F0FA 5KMKA 3WF5A 4XLIA 4YJPA 3AD5A 3A4OX 4FVQA 4A4OA 3V5LA 2J51A 4FSWA 4FZDB 4DH7A 4UMTA 5KHXA 3EFKA 4I24A 4AP7A 3W32A 2BDWA 3QZHA 3MS9A 3LOKA 1ZY5A 4FKOA 4H36A 2BAQA 1I44A 4PDPA 3F66A 1BI7A 3MA6A 3AMAA 5IDNA 2BTSA 4IE9A 5L3AA 3HMNA 3CGOA 3FUPA 2ZV2A 4C2WA 3PXKA 2ERKA 4K0YA 4NM7A 3AGMA 2BFXA 2CDZA 4LYNA 1FINA 4EYJA 4FTNA 4QP9A 3C1XA 2CGVA 4YHFA 3BHVA 5IUGA 3MVHA 1YWRA 2YM4A 4ZIMA 2HXLA 2WOUA 4UMRA 3TJDA 4J71A 4E8AA 1R78A 2VX0A 3TWJA 4FTLA 2CGXA 3KRLA 4MAOA 4H3BA 2WB8A 4FSMA 4BCOA 3NS9A 4FTOA 4LMUA 3FI3A 1OITA 3PLAE 5HG5A 4PQNA 3NWWA 4TYJA 3EN6A 2B4SB 4DH3A 3VUIA 4XG9A 3VRYA 1RJBA 5ANIA 3M42A 1PW2A 3ZDIA 3LM0A 5DRBA 5I9UA 5HX8A 2WMXA 5BVNA 4M3QA 2WOTA 3W10A 5LCKA 2QOQA 2BZKB 3DS6A 3OROA 4GJ3A 5D1JA 4FL3A 1HOWA 2OKRA 4F7SA 3K54A 5LOHA 3F3UA 4ZTNA 4FNXA 3ROYA 4D58A 3I81A 2OI4X 3BBWA 3MJ1A 4KA3A 4MBLA 4DLIA 4Y5QA 5LMAA 2JEDA 4XMOA 4ORKA 4YJRA 3EMGA 3L1SA 5A54A 1BYGA 3KRXA 2GCDA 1H28A 4QP8A 3IKAA 5ANEA 2YM6A 1JLUE 1PXKA 3V6RA 3W2PA 3FLYA 3NYOA 4MXZA 3ML1A 4TYGA 4I6BA 3V8WA 4D4SA 4EHGA 3OY3A 4JS8A 1LEWA 2B7AA 4FODA 1F5QA 3W18A 3UNKA 2YZLA 5C4KA 4QMLA 3ZSGA 2V7OA 4RLKA 5C8MA 4ZLYA 4TYHA 3LFEA 2QNJA 3QLFA 3E7OA 3LXPA 4AXDA 4R5YA 3F7WA 2JDRA 2VX3A 5CZHA 5AR8A 3BIZA 3BX5A 5H2UA 4LFIA 3AXWA 3FLQA 1H4LA 1PXIA 4BB4A 3F2NA 4D2WA 1W83A 1JPAA 3AC1A 4MVFA 3RBWA 1VR2A 4PX6A 1Z57A 4J98A 1H27A 3R9OA 4BI1A 4XG7A 4FUYA 5CQUA 2O5KA 4X2JA 3H0ZA 3R01A 2BZIB 4MXOA 2P4IA 2JITA 4OGRA 5CX9A 5HBHA 1YXSA 2JIUA 2X6DA 3KQ7A 4QTBA 4AU8A 5DPVA 1PF8A 4ASDA 3AG9A 3MVMA 1P14A 3NUNA 4U8ZA 3WARA 1ZY4A 3BEAA 2QKRA 4EC8A 4EK4A 2OJGA 4QTCA 3DXPA 1BLXA 5ETIA 3QAME 5L4QA 1SMHA 5CXHA 3IW4A 4F6WA 3F2RA 3H9FA 4XLVA 4F9AA 3RWQA 4GIIA 4AN9A 4R7BA 3D94A 3FAAA 4JAIA 2IJMA 4ACHA 5HLNA 3HV3A 4K9YA 1GNGA 4V04A 4QD6A 3GU5A 5E8TA 4IXPA 4J97A 4CCBA 3KY2A 1E1VA 5HE2A 4FV4A 2GSFA 3PFQA 3Q32A 5HU9A 1WAKA 4P90A 1SZMA 4XUFA 2KTYA 3RK5A 2C30A 3MGYA 5EHLA 5KUPA 1JSTA 2ZV9A 4FT7A 5LVNA 2BIKB 2Q0NA 5KMJA 1T46A 3BYVA 3ZBXA 5DH3A 2FYSA 3MPAA 4FV2A 2P33A 4QPAA 1BX6A 1CKIA 1CDKA 4DT8A 3R7OA 4O91A 3JVRA 2WMBA 1PXJA 4YJTA 4BDEA 2J0MB 3T3VA 3ERKA 3O8UA 3P0MA 3WOWA 5FQDC 2XMYA 1XWSA 4NJDA 4J52A 5GJFA 2JIIA 5HE1A 2QO9A 4CLIA 3G5DA 3VUDA 1NA7A 4RWLA 2GHMA 2V62A 4GK4A 2OJ9A 5KNJA 3CSVA 4AFEA 4QTDA 3DOGA 3WF8A 5KMOA 3EN7A 1YXUA 4U7ZA 2NNWB 2VNYA 1L3RE 3CGFA 4F6UA 1NVSA 1JAMA 5CAUA 2JC6A 3RM7A 3G0FA 3OP5A 2F9GA 4DTBA 2WFYA 4IB1A 3OBJA 3GCVA 2XK6A 4PMMA 5HO6A 4YURA 4YLJA 5E8XA 3E62A 2UZLA 2X8IA 3GC0A 3ROCA 5IA2A 4DDGA 3CE3A 2OXDA 3SQQA 1W2DA 1OGUA 3UYTA 5TKDA 2VGOA 1O6YA 4IX4A 4FG8A 4MH7A 5HE0A 4AUAA 4UEUA 3DNDA 3R73A 5CNNA 2WIHA 3KXXA 5EYMA 2GNHA 5LVLA 3L8PA 3R1QA 5IKWA 3O2MA 3KXHA 3KXMA 3PY1A 4QP1A 4TPTA 4CQEA 1BMKA 4ONAA 3VBTA 5CASA 4JDHA 5KCVA 3W0PA 2QOFA 4GVJA 2QG7A 2X0PA 4I22A 4JVGA 1VYWA 3U8WA 5LMKC 4QQTA 1CTPE 4F0IA 4I93A 3ZHPC 2ZMCA 3VWAA 4UZHA 4GG7A 4EH2A 4HVDA 2JAMA 3ORKA 4QYEA 2XAOA 4O7YA 4M69B 5AAEA 2Z60A 4G3CA 1MQBA 3QGWA 4GYGA 3LE6A 2UW4A 2VTQA 4YJVA 3OVVA 3W55A 1JKLA 1APME 2CKEA 3MV5A 3T3UA 3DB6A 3IOPA 5F95A 3U51A 2XNOA 3FY2A 4C38A 3R8VA 4TL0A 4O4EA 2GHGA 4J7BA 4DF3A 3VBVA 4FI1A 4IVAA 5CALA 5DBXA 5M56A 4IAKA 4KKEA 3Q6WA 5CQWA 3Q2JA 4A9UA 5FDPA 3FZ1A 4H39A 2R3MA 3Q96A 3QKKA 5FEDA 3I6WA 3VQUA 4E6CA 3RTPA 5L2WA 1AD5A 2XKCA 5LQFA 1H01A 4C0TA 3E63A 4K8AA 3R0TA 3HDNA 4XV1A 2W17A 4FIGA 4JNWA 3TUDA 3LFNA 5HQ0A 3PUPA 1WBPA 5CF8A 4FKIA 3UQFA 3KMMA 4YSMA 2R0IA 2DQ7X 4PP9A 4FIEA 4RJ8A 3VS2A 4MD8E 3FHIA 4PPAA 4YO6A 2JKQA 1MRUA 4C37A 4GJ2A 3I4BA 4W8DA 2W7XA 2CLQA 2I7QA 2PVHA 2V5QA 3JVSA 3LAUA 3R83A 2XB7A 4CKRA 3MN3A 1S9JA 5FTQA 3KL8A 5A6NA 5J9YA 4AAYA 2G2IA 2QU5A 4GMYA 4WNOA 3SAYA 4FYNA 2NRYA 4OR5A 5AAGA 4HGEA 4UV0A 4EZ7A 3OT8A 3P78A 1OB3A 3F5XA 3ZONA 3L9LA 3LFBA 3QYZA 5E8ZA 4P5QA 3FXWA 4M68A 3EWHA 5DHJA 4EOKA 4MWHA 4WHZA 2C0TA 4NUSA 3UOHA 5AIRA 4AFJA 3DJ5A 3UJGA 3HUCA 4FKVA 1G8SA 3R1NA 2C3LA 4PTCA 3PA5A 2YAAA 4GKIA 5D7VA 3BPRA 3QCYA 3JS2A 1DM2A 3G6HA 1W84A 3LMGA 4HW7A 2WTCA 4AA4A 3D5WA 3NMUF 4KIPA 2BZHB 2W06A 3NIEA 1JQHA 4RX9A 3SXFA 3V5JA 5IMEA 3TJCA 4GFGA 1S9IA 4LUEA 4UZDA 2HZNA 3KK8A 3F6XA 3UG2A 4AA0A 2AC3A 1WBTA 3A61A 4ANLA 3SD0A 4Z9LA 1EH4A 2ITYA 4L8MA 5HO7A 4YSJA 5LXMA 3BGQA 2B9IA 3QYWA 1FQ1B 4NKSA 1LEZA 4UWYA 4XG3A 3IQ7A 3QALE 3ZUUA 3U6HA 3MY5A 4NCTA 3A99A 4AGUA 3HV4A 2XNGA 1CM8A 4L3PA 3SG8A 3F3TA 4D2RA 2PUPA 4U3YA 2UZDA 2XKDA 4B9DA 4TW9A 4WSYA 3MPTA 4BCQA 4EWHA 4YTFA 1P4OA 4AW1A 1JNKA 5AR2A 5DMZA 4FNYA 4JIAA 4OBQA 5IH5A 4EJ7A 3Q04A 4RT7A 5FWKK 3W33A 3AKJA 5G6VA 3OOGA 3LVPA 3QX2A 4G34A 3V04A 1F0QA 2YISA 1U5RA 4DGLC 4TNBA 1H8FA 3RCJA 4ZZOA 3TUBA 1PKGA 4HGSA 3UC3A 5J9LA 3LCSA 3VHKA 1XJDA 1Y8GA 4EK3A 3QBNA 2EB2A 3VHEA 2JFMA 2WQOA 5EW8A 2QG5A 2R3NA 5JFSA 5GIOE 2XYNA 4O21A 3JUHA 1WBVA 3FL4A 3WZUA 3ZEPA 4Q5HA 4BTFA 4RJ3A 4YLLA 4X2NA 3DFCB 4FKLA 2OICA 1Z9XA 1B39A 4E73A 2YCSA 3L9PA 3S4QA 1PY5A 1NT2A 4GVAA 4JIKA 4YGAA 2IEWA 4IFGA 4R8QA 5ETCA 2E2BA 2WAJA 3COHA 4FTQA 4CEGA 4FG7A 4E1ZA 3GCQA 5KBQA 4MD9E 3N4UA 1ZZ2A 3QUDA 3LFCA 3O51A 1OUYA 4RRVA 5AV1A 5FP6A 3GU7A 4RZVA 1Q8UA 4PDYA 1E9HA 3DKGA 2PPQA 2YDJA 4RJ6A 2OH0E 2X2LA 4M69A 2B53A 5E8VA 5B7VA 2R3FA 4DC2A 5CEMA 3A7GA 2W5HA 2XCKA 3QD2B 2R3HA 2VTRA 2WHBA 5A14A 5M51A 3E92A 2CKPA 3NCGA 4DTKA 3D9VA 4X7QA 5AR4A 1OMWA 5EK7A 4B8LA 4WBOA 3DKOA 3TN8A 3D15A 3S95A 1IA9A 4X3JA 3BLAA 3NSZA 5CT0A 4BDKA 5BUIA 3ENMA 2YIWA 3PTGA 4FV8A 4RIWA 2PVNA 5BQ0A 1Q4LA 3WZKA 2KULA 4HCVA 2W4OA 2FUMA 4FEWA 4FEXA 2WMRA 3Q53A 4MNEB 5CVGA 2V0DA 2QU6A 4AT5A 2VN9A 3MFUA 3F3VA 1KWPA 3MIYA 4HNFA 4ZZNA 2BRHA 3E8CA 3FLNC 1Q3WA 5CNOA 3ZM4A 3OUKA 5A46A 3HP5A 1LPUA 4LOPA 1JWHA 4D9TA 3KK9A 4A9SA 4XX9A 2IPXA 4R78A 3LW0A 3C50A 4RX8A 4I5PA 3IO7A 3PPKA 4R7HA 4NYEA 2HZ0A 5M57A 2YWPA 4NJ3A 3NEWA 4A9TA 4RPVA 3ZXZA 1QPEA 3BYUA 3BLQA 3O8PA 5DEWA 4QMOA 4HCUA 4BZNA 2Y9QA 4O7WA 3GOPA 4XG6A 4L01A 5JQ8A 3UPZA 4OLIA 1WZYA 3OWPA 4ERWA 1ERKA 3G9LX 3PG1A 3PSDA 4Y72A 4QNAA 5BMSA 3O71A 1XO2B 4BIDA 1R3CA 5CI7A 3ZSHA 4PNIA 4BJJA 4AN2A 1UA2A 3FMJA 3WF9A 4AXEA 3AOXA 4XYFA 2GS7A 2PZIA 3LXKA 5DIAA 3AKLA 5AR3A 3QD3A 4G6OA 3QTXA 4XBRA 3OWLA 2PZ5A 4HZRA 4FZ6A 4DLJA 5IQIA 2YA9A 3CPBA 2BKKA 2WMWA 4F7NA 1RW8A 3VVHA 4C61A 4LG4A 4Y73A 5TE0A 3VW6A 4ZSEA 4O4DA 4PY1A 4MBJA 3VJNA 2YJRA 3ALNA 2X9EA 2F7XE 3QD4A 3ZSIA 3OTUA 4CKIA 1YDSE 5IEXA 4IB3A 2ZAZA 2HYYA 4QYFA 5IQHA 3RHKA 1IG1A 2O3PA 3ZLYA 4IM0A 4YLKA 3DU8A 5JK3A 2PUNA 4GEOA 2PVYA 2QHMA 3FMHA