5I9UA

Crystal structure of ephrin a2 (epha2) receptor protein kinase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
294
structure length
281
Chain Sequence
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 2
publication title Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 281
sequence length 294
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5i9uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5i9uA01
2EB3A 4FKVA 5A4TA 2YIQA 3VF8A 5BVNA 2OG8A 2B1PA 3GOPA 4O0XA 2GHGA 2IJMA 3LJ2A 3I4BA 2W99B 4GT4A 5CT7A 3V5WA 4FKQA 4I4EA 3AC2A 5D10A 3TNHA 2UW8A 2HELA 1DS5A 4S30A 1ZMWA 4ZJIA 3DPKA 4ANBA 4D2TA 4QMQA 4IAYA 4I6QA 2IW9A 5JQ5A 4N6ZA 5FP5A 3TG1A 3WZJA 4PTEA 4WNKA 4X21A 4DH3A 5F20A 2G01A 2OJGA 4BZOA 2HOGA 3BHTA 4NT4A 2RFDA 4EOLA 3KRWA 3NR9A 3UO5A 2XVDA 4KBKA 4AOTA 4D2SA 5HTBA 3QUEA 4BKJA 1H26A 2B9JA 3R8LA 4OBOA 5DE2A 2KULA 2R2PA 4N4SA 2BRMA 4WRSA 1OL2A 4MK0A 4YHFA 1F0QA 4CG8A 5K9IA 3UG1A 4FKIA 3I81A 2VWXA 4DA5A 4E4NA 4EYMA 3P7AA 3Q52A 3WF9A 4CRSA 5E8ZA 4BCHA 2OJ9A 1J1BA 4IX4A 4JDJA 1OPLA 2Y6MA 3EOCA 3Q60A 3RWPA 4FSRA 5LCKA 2A2AA 4HYIA 4LL5A 4FKJA 1PXNA 1SMHA 2UV2A 2NO3A 4RJ7A 2RFEA 5AR3A 4CZTA 3FKOA 4ZZOA 3E87A 5BUIA 1PRYA 4HYUA 4EK6A 5I9WA 3R21A 1FGKA 4GYIA 5DR2A 4ZMEA 1JSUA 4PWNA 4M0ZA 3MFSA 5BYYA 2IZSA 1IA8A 3ENMA 4HYHA 5KZIA 4IACA 4B6LA 3BHVA 5AA8A 2CKOA 4BCJA 3T8OA 2EXEA 2DUVA 2OI4X 1W7HA 4TNBA 4B8LA 4O22A 3EH9A 4OGRA 1H08A 4IVCA 4DGLC 5GINE 3NRMA 5JZNA 2J0KA 3SXRA 5IF1A 1WZYA 4GT5A 4YC6A 3DB8A 3NEWA 2YFXA 3S4QA 2UW4A 2DS1A 3WF6A 2BTSA 4FI1A 4G2FA 5IEYA 2YJRA 1UU9A 4HNFA 3HDMA 3ZXTA 2H9VA 2OJIA 4F65A 4GMYA 2FGIA 3RALA 5A6OA 3FZRA 4R77A 4PNIA 1GZOA 5ETIA 2NRYA 4ALWA 3R9NA 4UMTA 4FGRA 1OITA 1W82A 2R4BA 2BHHA 4Q5HA 4QQ5A 1XJDA 4H3QA 2BCJA 2CNQA 3HAVA 1V1KA 4FTRA 5EKNA 1OUYA 2JDRA 1WBPA 5I9YA 3QCSA 4OTPA 3VS0A 3F5PA 4FG9A 1YRPA 3T9IA 3TDWA 3CS9A 4ENXA 3KRRA 1CKPA 3GC8A 5DN3A 3EHAA 4I0RA 3PXYA 2W5HA 4IJPA 3D15A 5GHVA 3IECA 4TYGA 2BKKA 4D1XA 2VTNA 4BBEA 2W1FA 4FKGA 5FTQA 3QU0A 2UZTA 2YEXA 2UW9A 4AGDA 2WNTA 3UG2A 3GC9A 4D0WA 1YI3A 4GSBA 3ZM9A 1M17A 2I0YA 4RIYB 5H8BA 3ZRLA 2OFVA 3QQHA 4O27B 3NNXA 5HI2A 3M2WA 5C8MA 3T3UA 2QR8A 3KFAA 5TT7A 5M4CA 2OZAA 2VD5A 5DT4A 2Q83A 3TEIA 5AR4A 4YNEA 1PXKA 4EZ7A 2YCSA 3Q4CA 3ELJA 1DAWA 5C9CA 1M7QA 3EFKA 3D2KA 5IUGA 4CMTA 4F1OA 4JG7A 5IQGA 2YHVA 3PRIA 5EHYA 4UMUA 3A99A 1E1VA 2G15A 3WILA 4E5WA 5FBOA 2PU8A 5AR5A 2P55A 3WZKA 3ZYAA 4ZJVA 5F95A 2WTKC 3OUNB 2R9SA 2PPQA 4FIEA 2GPHA 4OT5A 4MD8E 2C0OA 3PLSA 4QP1A 3SVVA 4IVBA 3GXLA 4FV4A 4EZ5A 4USDA 1GIHA 3MA6A 2VTIA 4XJ0A 1J7LA 5BYLA 2C47A 4CFWA 2VO6A 3IGGA 3O50A 5HE2A 3R7UA 2ONLC 4RIWA 3O7LD 5AUWA 5BNJA 3U9CA 1PJKA 3C7QA 1J1CA 3BWFA 2AUHA 5GNKA 3CC6A 4BTKA 3TTIA 3ZO1A 3GT8A 3VBQA 4YJTA 3C13A 4IB1A 3N51A 4Y83A 3TZMA 3IW4A 4X3FA 3WZDA 3H9FA 3LFAA 4OAUC 1UKIA 1STCE 4PX6A 4RLKA 1PXJA 2OSCA 3A4PA 5HLNA 3K3JA 4V01A 4BL1A 2XH5A 3ZO4A 3IOKA 3DAEA 4YJNA 3CTQA 3VJOA 3P78A 4BI1A 4YTHA 4ZZMA 1SVEA 4BGHA 3F6XA 1VJYA 2YCRA 4ITHA 4LGGA 4L45A 2X81A 3QRJA 4DHFA 4L3LA 3GU6A 2V7OA 3FHIA 3LMIA 3H30A 4KSPA 4XV2A 4ALVA 4FSTA 3VRZA 4D58A 5L2WA 1IA9A 4XOYA 3H9RA 2GFCA 3KVWA 2CN8A 1Q8YA 4FV2A 2OIQA 3H10A 4FT7A 4TYIA 5DGZA 5BVOA 4FICA 3ORMA 4U42A 3VC4A 3BI6A 4V0GA 5CZHA 5ANDA 3BLRA 3ID6C 3NYNA 4J53A 1REKA 3C4FA 1IG1A 5J9LA 2FYSA 4CEGA 3L8XA 3LW0A 3DAKA 3P23A 2XMYA 4WO5A 3SW4A 3VW6A 4PP7A 1R0PA 1IASA 1OUKA 1CDKA 2YIXA 3AXWA 4BWPA 3R7GA 4QP4A 1YXUA 3QQUA 4W4VA 5AJQA 5H8EA 3OY3A 5HVJA 3UVPA 3VJNA 1CKIA 2JIVA 3AD6A 3QQLA 4YLLA 3UP2A 4FG8A 4AT4A 2XK3A 4RJ5A 5AWMA 2PTKA 4I20A 4IZ5A 4DEIA 3VUGA 3IDBA 4QMNA 5IH4A 1O6LA 4M14A 1RJBA 3Q4UA 2O64A 4FTCA 3E63A 3KCFA 3PLAE 5ETFA 4JL9A 4U0IA 3EN6A 2QHNA 3DFAA 2R3MA 4YJOA 4JQ8A 5I9XA 4IX3A 3ZUTA 4R7IA 3Q6UA 5LCJA 4U43A 5LVLA 4BC6A 2RGPA 2W1IA 4AN3A 2WMBA 5JSMA 3QFVA 3DTCA 4NTTA 4QMLA 3COHA 5DVRA 3FWQA 1FINA 2RIOA 4GK2A 2OIBA 2VNWA 4FZ6A 1ZYDA 4L7SA 5AV2A 4AZVA 4BCKA 4C34A 2YLEA 5HNGA 4EK5A 3CD8A 4R5SA 5KE0A 3SV0A 2WEVA 3KMMA 3R71A 4L01A 3ALOA 2PSQA 4NKSA 4I5MA 2XUUA 3GBZA 3FYKX 3PJ3A 2E9VA 2EXMA 3NYXA 4BR3A 1O6KA 4QD6A 5HIEA 2J4ZA 3IS5A 4AA4A 3OWJA 2OIDA 4EOIA 3CSVA 4CT2A 3IO7A 4TYJA 4DC2A 3A8XA 1LEZA 1U54B 1WVWA 3M42A 4U45A 4RZWA 4ANNA 3ORIA 2A0CX 4OTRA 5M56A 2XJ2A 2HIWA 1G3NA 4U81A 3EB0A 3V8WA 3GGFA 5J5TA 4FTOA 4Y8DA 4E20A 2VTRA 1GZ8A 3ZRMA 3EQHA 3RM6A 3VNTA 3DZQA 3ZS5A 3SHEA 2HW7A 2F7XE 2R64A 1JBPE 3JPVA 2YM8A 1VYZA 3LQ5A 3MB6A 1QPJA 5FM2A 3R9OA 4BCPA 4EEVA 5HG5A 3NIZA 3MSSA 5D1JA 4O38A 1SVHA 1GJOA 1JSVA 2XF0A 3B2TA 2C5XA 3ACKA 3NWWA 3CQWA 4OBQA 5JRSA 5FDXA 3VUKA 3BYOA 4GU6A 4S34A 2VWZA 4C4HA 4MNEA 3S95A 5CAUA 4R3CA 5LOHA 5HCZA 3MFRA 4G1WA 1VEBA 4TWCA 2BAQA 4ASEA 2EUFB 4EC9A 3BZ3A 4RFZA 4AN9A 2J50A 1KE7A 2PVLA 3W10A 4PDOA 2VTMA 1F5QA 5EYKA 3LQ8A 3BX5A 3R7YA 1B39A 5KKRB 3ZO3A 3EN9A 4ZTRA 2QKRA 4FKLA 3QLFA 5CU4A 4IAIA 1PXOA 4XS2A 5F1ZA 4WNPA 4GIHA 5CXZA 3ENHA 2R3RA 1Q8ZA 3G9NA 3R83A 4M12A 3F5GA 2Z7RA 5BPYA 2W9ZB 5HQ0A 4J71A 3LFFA 4AW2A 3WIGA 4BICA 3FMKA 4LL0A 3UMWA 5TR6A 2WQOA 4Q9SA 2C5VA 4F6UA 3PA4A 3IKAA 4O0VA 3O17A 4RC4A 3R7VA 2Z02A 2WOTA 3IW8A 3UPZA 1XBCA 3N4UA 4J95A 4F7LA 1PXPA 5CALA 2VX1A 3ODYX 3OEZA 4DGNA 5AIKA 2A19B 3EN7A 3AD5A 2OJFE 2W1ZA 3A2CA 3FYJX 1H1PA 4FKOA 3ATTA 5KMNA 2Z7SA 3ORPA 3RM7A 3MVLA 4YSJA 3TV4A 4NZWB 2J0IA 5C1QB 3TKIA 2V5QA 4NIFB 4RRVA 3RAKA 4B4LA 3MFTA 2YACA 2QODA 4GK3A 4YJPA 4QOXA 3HX4A 4WG3A 4O7LA 1URWA 2XNOA 1V0BA 4XP2A 1XKKA 5L8KA 2C1AA 2R5TA 3EMGA 3G51A 3UIXA 4BCQA 2ZOQA 4HW7A 1MRYA 2JAMA 3FKNA 3HP5A 4R5YA 4EKKA 4F7JA 4PDYA 2REIA 4PRJA 3EQPA 3V5PA 3QLGA 4HVDA 4XV3A 3JXWA 5D41A 4A4LA 3HEGA 2X8DA 5DHJA 4IWDA 3TJCA 3E8EA 4XBRA 4O2PA 4RPVA 3VS3A 3WI6A 2O8YA 3VUHA 4EH4A 5JZJA 1XBBA 2JKMA 4HCVA 3LCKA 2CLXA 4OUCA 4WOVA 3ETAA 1PMUA 3FMMA 2PK9A 3P79A 4EHVA 3ITZA 3NYVA 4XG2A 4RQVA 3RPOA 2EWAA 3EL8A 4ACCA 4CXAA 5KZ0A 1QPDA 4O0YA 3ZZEA 4BGQA 4HGEA 4IHPA 4C0TA 5HCYA 4G3EA 1H0VA 2YERA 2ONLA 3OWLA 2BVAA 4LFIA 4BDIA 4D28A 2WMQA 4BYJA 4C61A 4CFMA 4ZTMA 2H34A 4TWNA 1AD5A 4IB3A 3C50A 2ITTA 2GDOA 4L44A 3MA3A 2W1GA 1GIIA 2QNJA 1DI8A 1H4LA 3QWKA 4EBWA 3SG9A 1OIUA 2IZUA 5BX0A 5CXHA 4BY9E 1I09A 3TIZA 3OBJA 4IBMA 2WHBA 2QO2A 3CE3A 4YO4A 4HVHA 2ZM3A 2GNHA 2F4JA 4YR8A 4FVRA 3CTHA 4G6OA 1UU8A 4GK4A 4TWOA 4R8QA 5HNIX 4F0FA 2X1NA 2HY0A 4GVJA 3CKWA 3G90X 4KKHA 1RQQA 4RJ4A 1SNXA 4FIGA 3SAYA 1BL7A 5FUTA 2SRCA 1PMNA 4FEQA 4X2GA 5IQAA 4BDKA 4L9IA 3QAME 4JG6A 5AX3A 2YN8A 5AP4A 4E4MA 2ZB0A 4U7ZA 3DQWA 4LUEA 5CNOA 5CX9A 4EH2A 1YQJA 4FKPA 4LRMA 3F7WA 3K2LA 4O6LA 1FVTA 4RFMA 2G2HA 5E1EA 4ARKA 4LV5A 3RKBA 2H6DA 2BZKB 4KA3A 4FF8A 4FK3A 3R9HA 2PYWA 1GAGA 4RJ3A 4UMRA 3Q5IA 4G5PA 3F69A 3H0ZA 3VHEA 4C4JA 1FBNA 1KV2A 4FTQA 3W2PA 4A9UA 1UU7A 2C6LA 2HXQA 4RIYA 5H8GA 4FX3A 4OLIA 3E93A 4JQ7A 5C8NA 3W2CA 3BHUA 2H8HA 1HCLA 3FI8A 4TYHB 2O5KA 4C59A 3D4QA 3G0FA 3ERKA 4I5PA 3TKUA 3EL7A 4AW5A 2NRUA 3NUYA 3UO4A 4FTIA 3OS3A 2ZDTA 4MNFA 5I0BA 3BELA 3H0YA 3WZUA 5JFXA 1J7IA 3IG7A 2OXXA 4UBAA 5C27A 5HESA 4TKSA 3FL5A 2JEDA 3CJFA 5BMMA 2XNEA 4D0XA 3MIAA 3NUXA 3HV6A 4NKAA 4E6AA 2WOUA 3QQJA 2B54A 3NNVA 3NCZA 4HPTE 5FP6A 3UQFA 3OG7A 3ZO2A 2BZHB 4MTAA 2WTDA 1Q62A 2FH9A 1XH5A 4RZVA 3NVKI 1FMKA 3CY2A 3E7VA 2J5EA 5KMIA 2PMLX 5JN2A 4TXCA 3H4JA 5CLPA 1H27A 1FGIA 4FSMA 3VBVA 3FUPA 4IADA 4M13A 3PJCA 4NEUA 2XK7A 4TZRA 2UVZA 2VWVA 3PDTA 5H3QA 3AT3A 2XBAA 4FIHA 4DEDA 3W33A 4E6CA 4I22A 3PJ8A 5HX6A 4O0RA 4FYNA 5AADA 3FKLA 4XHKB 3RHXA 2XIRA 2X6DA 3I7BA 1OVEA 4RX7A 2IW8A 4QTEA 1QPCA 2YLFA 5DEWA 3UZPA 3JY9A 4R7BA 3MYGA 2FSLX 3AQVA 4HZSA 5CSVA 5KO1A 4IX5A 2WTJA 4P5ZA 3COMA 4AS0A 1ZYJA 4RBLA 3IONA 2JIIA 4IAZA 5AFVA 3MGYA 2BIKB 3RI1A 2B4SB 3ZUVA 4DG0E 4YPSA 3SD0A 3F3WA 3SLSA 2WIPA 3NVMB 4Q2AA 4JI9A 5DIAA 1YHWA 4I3ZA 3DXQA 3PZHA 4UZHA 4ZY6A 4DGOA 1UWHA 4I4FA 3WF5A 2CLQA 4CFVA 2BMCA 4L43A 5AUZA 4FZAB 4QNAA 4IFGA 1ZYCA 4F9WA 1ATPE 4KAOA 2R7BA 4YBKA 4AZWA 3M11A 3HGKA 4GVAA 4N0SA 4J99A 3BGPA 2C3IB 5AA9A 4O7SA 3DBEA 3IW5A 3RGFA 1YXXA 2XNBA 3G6HA 3FZPA 4XG8A 3VUDA 3AC1A 4NFMA 3DV3A 4D5HA 2OLCA 4O6EA 5HLPA 2GNIA 5EOBA 1XH4A 3R2BA 5LVOA 5EW8A 1OM1A 3LXLA 3PUPA 4U3YA 4D9TA 4WSYA 2HENA 3F2AA 5CI7A 4RX5A 2F57A 2QOBA 4RIXB 1KV1A 3QL8A 3PWYA 3DJ6A 4B7TA 4JIKA 1PXIA 4EHZA 4K0YA 2VAGA 4YUQA 4FYOA 1P4OA 3FLQA 3MPTA 4X2KA 2YAAA 5JT2A 3E92A 4IE9A 4F08A 3BBWA 4CZUA 2O0UA 3ZCLA 5BVKA 4XEYA 3TV6A 3IQ7A 2IWIA 3LHJA 3V5QA 5T6KA 4BDDA 2BRBA 3R7EA 4BIEA 2C0IA 1BI7A 4E93A 4ZLZA 3F3UA 3PXFA 4X6QC 3GU4A 3EQIA 3UOKA 4JX3A 3OCBA 5CS6A 3ULZA 4KS7A 4EK3A 4DG2E 5JFSA 2X4ZA 5EG3A 2ZJWA 3MVJA 4PPBA 3UO6A 4HVIA 4FE2A 5HHWA 1O6YA 4OTFA 2HWPA 5J8IA 5HVKA 4TRLA 4E3CA 3KF4A 1E1XA 2YM6A 2C5YA 5M55A 3EN5A 4HVSA 4CYJA 4DH8A 1APME 5A54A 4FT3A 4RX8A 1JQHA 3NUUA 4P2KA 5DFPA 4LI5A 5EYDA 5M06A 5L6WL 4BDBA 4NH1A 2BDJA 2BAJA 2CGWA 4EOSA 4G3DA 2J90A 5EHOA 3N4VA 4EH8A 1QPEA 5D7AA 4GKIA 4XUFA 3Q96A 2HZIA 2UW5A 4FUXA 2WQBA 2HK5A 4GFGA 4CMOA 1OI9A 3VS4A 3DK7A 4W9XA 5IQFA 3AMBA 4N70A 4L6QA 4OBPA 4V04A 2YDKA 5IA3A 4A07A 4EOMA 3LLAA 4F1TA 3C4CA 2C4GA 3CTJA 3QZFA 4YO6A 1Z9XA 5ETCA 4G9CA 5DOSA 4AZTA 2FUMA 4FT0A 5AIRA 4AGWA 3R63A 1YHVA 3KXZA 4Z9LA 2V7AA 4PTGA 5IH6A 3LIJA 3PPJA 3CEKA 3KRJA 5E8WA 3TNWA 3BKBA 2V0DA 4CG9A 3HLLA 1YVJA 4X2NA 2JKKA 4FV5A 4FTUA 1P2AA 1FMOE 2WMAA 4HGTA 4EOJA 2OKRA 3Q6WA 4UXQA 4QTCA 5AAGA 5L3AA 3D7TB 2GQGA 4R1YA 4L67A 1Q4LA 2VNYA 1CM8A 4J1RA 5CU0A 5M53A 2JDOA 5AP1A 2UVXA 3ZONA 3HECA 1G8SA 4XP0A 4AX8A 3L8SA 3PVUA 2G9XA 4UXLA 3GNIB 5AP3A 3OFMA 1OBDA 4QNYA 4S31A 5AX9A 2C6EA 3R1NA 2X0GA 4ZTQA 3VBTA 3ZM4A 1YI4A 1KE9A 2GHLA 4Q9ZA 5M51A 3BV2A 3UNKA 3TTJA 5FG8A 5KMLA 3FL4A 2F49A 4FEVA 2PZPA 3RPVA 5C03A 4QMTA 5CEOA 1ZAOA 5M57A 3R7IA 4KKGA 4TT7A 2ETMA 4PDSA 4TN6A 5LARA 2IZRA 3S2PA 4TW9A 4CFFA 4DITA 5KMMA 4FIFA 4RG0A 5AUTA 2J0MB 2XM9A 2IN6A 1B6CB 2HW6A 3AMYA 4QP9A 3ZXZA 4IAKA 3D5VA 4ALUA 3KU2A 4UY9A 2XIKA 3Q9XA 2NNWB 4NUSA 1XWSA 4G34A 2GMXA 4FIIA 4A4XA 3ZSIA 4IEBA 4LGHA 1G5SA 4FSWA 2B0QA 1V0PA 3OT3A 3OVVA 4DFUA 5EM5A 2WEIA 5IKWA 5AP6A 3U4WA 4O7WA 4NIFA 1NT2A 2W1CA 5C26A 5IA4A 1ZRZA 4LOQA 4FKUA 4O0SA 5CU2A 1H1SA 1H0WA 3DBFA 2WU6A 5FDPA 3GP0A 4FKTA 4AOJA 4IWQA 2WPAA 3UBDA 3V8TA 4DEBA 4EOOA 4C8BA 3CD3A 4JJRA 4RFYA 4DH1A 4D2RA 3MPAA 3E5AA 5CVFA 3AMAA 2XNPA 2YIYA 4MXXA 4XG7A 3HV7A 4ZSLA 3WBLA 5I9ZA 2GU8A 2YWPA 4M3QA 2ITVA 4MF1A 3VW8A 4BIDA 1Y8GA 4NFNA 3TIYA 2ESMA 1Q8UA 4ZTLA 3E62A 3AGLA 1IEPA 3JVRA 5JFVA 3F3TA 3H9OA 4CKIA 5EYMA 5ANKA 5TF9A 3CR0A 3DKFA 1S9JA 4ZSAA 3DBQA 3SX9A 4KUJA 1CKJA 3L9MA 5KHWA 1WBSA 3P1AA 4GRBA 3LCTA 4GH2A 4I93A 4RVLA 4D1SA 3OTUA 5IH5A 4OAVB 5IA1A 2FSMX 2QOLA 4M68A 3EFLA 3EIDA 3V51A 2R3HA 2I40A 3PPKA 4O7ZA 3BV3A 4LRJA 4O2ZA 4A9RA 4BBMA 3OOGA 4DG3E 2YIRA 3COIA 3OD6X 3ZMMA 3WF7A 4USEA 4H58A 4O84A 4A9YA 3Q2JA 4M97A 3LMHA 4ACDA 4NM5A 4BVUA 1OBGA 3BHYA 4ANLA 5EYCA 3A7IA 1HOWA 5JMSA 4G17A 2PE1A 2R7IA 4BRXA 2JLDA 3Q4TA 4O1OA 4U5JA 4C4GA 1PKGA 2XKEA 1TQIA 4RVKA 3RAWA 4IVAA 2W4KA 4UALA 5L2TA 1PXMA 3R22A 3HVCA 1UV5A 2HCKA 3BQCA 4FKWA 5GIPE 3P7BA 2ETKA 3UYTA 1BLXA 5EM6A 1MRVA 4GV1A 2F7ZE 4J98A 2XKDA 1MRUA 2WMRA 3II5A 2CHLA 4QP7A 4AE6A 5CEMA 3VQHA 5F4NA 5KBRA 4EONA 1GIJA 3KMWA 4GG5A 3FC2A 4C37A 1PY5A 2WIHA 3GQLA 3MY1A 4QYHA 5CYIA 2QVSE 4EJ7A 1XH7A 4S2ZA 4I5HA 1JKTA 3A61A 1V0OA 5IPJA 4CGAA 4K18A 2PUNA 4MVFA 3QD0A 2C6KA 5T3QA 3RCJA 3VF9A 3SXFA 2WZJA 5DI1A 4L68A 3RK9A 3OCSA 4AA5A 3HV4A 3PA3A 4Y95A 4FV1A 3DDQA 2ERZE 3DJ5A 4ZSJA 4MQ1A 3QRTA 3DZOA 4RA5A 2QOQA 1P14A 3FLSA 4GW8A 2JDVA 1LEWA 1X8BA 3GENA 4BBFA 3T9TA 4NL0A 3VS6A 5K4IA 4ZJJA 1ZY5A 1GNGA 3I5ZA 4LMUA 4TYHA 3PJ1A 4L53A 4QMYA 4QP8A 3BYUA 3P7CA 4KIKB 5FLFA 4PMMA 2CGXA 5HE3A 2PVKA 5IISA 4DT8A 1T46A 2UZBA 5CSPA 4JBPA 3GI3A 2QG5A 4C3PA 4L42A 3VO3A 2UUEA 4ASZA 1ZYLA 5AP5A 2E9PA 3DXNA 3CLYA 3QKLA 3C4ZA 5JFWA 3I5NA 2PUPA 5K3YA 2G2IA 2G1TA 3Q53A 2BILB 2JBOA 5J7HA 4E4XA 5JKGA 4Y46A 1W83A 2WMWA 4YC3A 1LR4A 4XV9A 1YXSA 4BI2A 3Q04A 4XG6A 4MWIA 4D2VA 3UVRA 2ITZA 3Q9YA 4FOBA 4DH7A 3LE6A 3LPBA 1FVRA 2XK4A 5CWZA 4H05A 3V5TA 3VUMA 2BRHA 2VTTA 4CRLA 3VAPA 4RJ8A 3I6WA 4F64A 3QKKA 5HBEA 3HNGA 5LJJA 1ERKA 2ACXA 3E8DA 3FLWA 3EYGA 2O3PA 3LFEA 3MFUA 4N6YA 4K9YA 4DCAA 1YDTE 4D5KA 1DAYA 4UWCA 4YJQA 4DTBA 2QC6A 4YZMA 2CSNA 2R3PA 4AZEA 4JBQA 2VWUA 3G6GA 3NZ0A 1YWNA 4OTDA 3QHRA 2I1MA 4BGGA 4TY1A 5EK7A 4F70A 3FDNA 4DN5A 3O96A 5CVGA 3HMOA 4F09A 1NVRA 3UOHA 3FJQE 2YABA 4PNKA 4ERWA 3W32A 1FOTA 2YAKA 4KKEA 4ZZNA 1PMVA 4GU9A 4GL9A 3LQ3A 2XP2A 4PL5A 2GCDA 2QD9A 4BCIA 3MY0A 5E90A 3EZRA 3UNZA 4F0GA 2B53A 4CKJA 3C5UA 4EQCA 2E9NA 3DCVA 1OECA 4NWMA 4EHGA 1H1QA 4HOKA 4QMPA 4V05A 3GUBA 3PE2A 4XBUA 1UA2A 5AP2A 2X7FA 3IDCA 3HKOA 4FNXA 1ZY4A 2W4JA 4Z7GA 4IIRA 3PVWA 2J0LA 2IG7A 4O0UA 2B9HA 3PXQA 3SOCA 3SXSA 1FVVA 3GU8A 3PYYA 4E7WA 5CAPA 4AU8A 3TKHA 4FV6A 4MWHA 4RWIA 4LUDA 3UJGA 4IVDA 2YITA 4RIXA 3ZFXA 1DI9A 3F3ZA 2P4IA 1Q3WA 4E8AA 2GS2A 3LFSA 4RQKA 4DTAA 2X8EA 1KUTA 4GUEA 2UZWE 3P08A 5CEPA 4JOAA 3L9PA 2HZ4A 4YZCA 4F4PA 5IQDA 3QXPA 4D55A 4FTMA 4RC3A 3E64A 3CGFA 2ZMDA 4QP6A 3LFCA 5E8TA 5HE1A 3RK7A 3OWKA 5E8VA 5KUPA 2G2FA 1UNLA 1JKKA 4K77A 2XYNA 2JDSA 2XK6A 4Z55A 3HV5A 3MTLA 3NW5A 4GEOA 1YW2A 2HXLA 4XYFA 1A06A 1WBOA 2YCQA 2EXCX 1EH4A 1MQBA 3UOJA 4JG8A 2P0CA 4P7EA 1H25A 4W4WA 2VUWA 3BBTB 4MAOA 5LVMA 5E9EA 5J7BA 4FVQA 3TM0A 2HYYA 1WFCA 3G2FA 2PWLA 2EVAA 2GTMA 3CP9A 3QGYA 4CKRA 3F3VA 2X4FA 3G33A 5HTIA 2QOCA 4FOCA 5CQUA 1RDQE 3TN8A 4YHTA 5AV0A 5ACBC 3AC4A 3MVHA 3FC1X 5DT0A 2VN9A 4EK8A 4O7VA 3MH1A 4O82A 3CKXA 2QO9A 4QPMA 3RZBA 5FTOA 4PL4A 4WUAA 4QTDA 3QKMA 4DT9A 1SZMA 3VVHA 2JBPA 3QC4A 1P5EA 3ZSGA 3OXTA 3BQRA 5HD7A 3ZFMA 5CQWA 5HO7A 4X7QA 2HWOA 4DLIA 4ZTNA 3TDVA 3PG3A 3P4KA 2OXDA 4FTAA 4ONAA 4HPUE 4IX6A 4RWKA 1YKRA 2UZUE 1JPAA 5LMBA 5LQFA 4S33A 5M07A 4EL9A 3LM5A 3ZDIA 2WGJA 3D2IA 3THBA 5EI8A 2GTNA 2QCSA 3D7TA 4BN1A 4C02A 3QBNA 3HAMA 3VN9A 4AT5A 3WYXA 1YDSE 3ALNA 4G3CA 1YXVA 4TPTA 3QZHA 3QD2B 3C0HA 4JDHA 3PSDA 4PUZA 1IR3A 3MB7A 3IGOA 1URCA 2VO7A 3HYHA 4FSZA 1GZKA 2QOHA 4NM3A 3WARA 4G6NA 3KMUA 5BUEA 4JS8A 3PPZA 4ZMFA 4KIPA 3VULA 4QMUA 1KE6A 1PW2A 2YJSA 3O71A 3Q4ZA 4KS8A 5DLSA 3UGCA 1R39A 2X39A 3AG9A 3TUDA 4JXFA 4PTCA 2XKFA 5FXRA 3FPQA 2PUUA 4KBCA 5TOZA 5IMEA 1H07A 1XR1A 1TVOA 4GCJA 5DBXA 4H1MA 2GQSA 2QG7A 1H01A 3PIYA 2QOIA 4MCVA 4DFLA 3E3PA 5ICPA 4QTBA 5J9YA 2F2UA 4FGBA 5EI2A 4YTCA 3TNIA 4DH5A 2R3JA 3JYAA 5HD4A 3W2RA 5HLWA 3LOKA 2R3OA 2WQMA 3A7FA 4CTCA 4O1PA 4G3GA 1BI8A 5K4JA 1OIQA 2OF4A 1UVRA 3QTWA 3REPA 2FA2A 2VGPA 3B2WA 3MY5A 2P2HA 5BVWA 5FM3A 2CCIA 1ND4A 5AR8A 3UC3A 3U55A 3OP5A 4UB7A 4YZDA 1JVPP 3KK8A 2HZNA 3D94A 3NDMA 3QCXA 2VWYA 4FV7A 4HCTA 4U41A 3IPHA 4BDCA 4ZS4A 2O2UA 1WVYA 4I94A 5E8UA 1XH6A 4ANOA 2PE2A 4FBXA 4D4RA 5L2IA 1OZ1A 1BX6A 3KULA 4O0WA 3UP7A 3LJ1A 2XRUA 3V3VA 2QQ7A 4C2VA 4CZYB 3AT4A 2Z60A 4F63A 2X7OA 3GC0A 4WG5A 4U40A 3P0MA 4ACHA 3DAJA 3FZTA 2C30A 3UTOA 2RF9A 3FXZA 5KKRC 3DU8A 5FWKK 4R3PA 1Y6AA 3ORZA 4XP3A 2ZVAA 3PJ2A 4QYFA 4ZTHA 3QF9A 4ITJA 3KXNA 4FV3A 5LMAA 4XLVA 4ACMA 5ANEA 3FXXA 4ANMA 4C3RA 5J95A 3NW7A 4B9DA 1Q8TA 4IANA 2WMSA 4ZS0A 4UN0C 2C1BA 3V8SA 3G0EA 3W8LA 1TQPA 4GFOA 4PP9A 3QALE 4U44A 4JT3A 3R1SA 5DEYA 1Y57A 2P33A 4D4SA 1BMKA 3I60A 4GG7A 2E9OA 4CFXA 4MXYA 4X3JA 2OU7A 1YOLA 3TCPA 3V04A 3DLZA 4YSMA 5JQ8A 3QTRA 3LAUA 5J1VA 4I5CA 4WBBB 3U6JA 3PY3A 3FHRA 4BCGA 3B8QA 2ERKA 2PHKA 4BWKA 5M08A 3KKVA 4ZLOA 4O96A 3GB2A 4FSYA 4AOIA 4IZ7A 2C68A 3EQFA 2IW6A 5CVHA 3FSKA 1UNGA 4FNZA 3JUHA 2F7EE 3O0GA 4PMSA 4DINA 4MEDA 1Q24A 4C3FA 1H24A 3BEGA 4FR4A 5A9UA 2P3GX 3R02A 4UYNA 2DWBA 5M4FA 4CSVA 1NXKA 1W0XC 3LFBA 3OY1A 1WBNA 3V01A 3NUSA 3FI4A 4RX9A 1NY3A 4NSTA 3I1AA 2C5OA 2BRNA 3A4OX 4KIQA 4F6WA 5G1XA 5D7VA 3FLYA 1Y91A 4EQMA 4O81A 4YGAA 3W18A 4L46A 2YM5A 4BDHA 5E4HA 3A7JA 5CF8A 1IRKA 2X7GA 5F9EA 5IUIA 3PXZA 3DJ7A 3A7HA 5EW9A 5HEZA 4U3ZA 4AGCA 3OF0A 2JGZA 1JKLA 4R78A 4C35A 3WYYA 2LAVA 2W7XA 3LFQA 4J97A 5CAOA 4H36A 2W96B 3BWJA 3E7OA 3QZIA 2YCFA 3ZBXA 4F1MA 3QRIA 4LQMA 1WBTA 4EWHA 3PFQA 4KRCA 1F3MC 4JDIA 5AR7A 4G5JA 2Q0NA 3BGZA 5IQCA 5ANJA 4KIKA 3ZC5A 1AGWA 1FQ1B 3BLHA 4Y72A 3ZEPA 4AW1A 2ZV8A 2WFYA 2V22A 4YMJA 3FPMA 2Z2WA 5JK3A 4E6DA 4IB0A 3HDNA 3RP9A 3F88A 4MXCA 3V5LA 3MTFA 5AAEA 5EKOA 5B7VA 2J6MA 2PZ5A 4ENYA 1KSWA 4YHJA 5EFQA 3OMVA 3OROA 5CAVA 1L8TA 4FTLA 5E1SA 4AZFA 4E4LA 3S1HA 2OICA 2Y9QA 4K33A 4BTMA 5KMJA 3JR1A 3NUNA 2I7QA 4MD7E 2R3IA 2UZNA 2VTJA 3HMNA 4JBVA 3QTQA 5CU6A 3TZ7A 5A6NA 1OGUA 1IAJA 5HZNA 1DM2A 4M7IA 4QQJA 3V6RA 3UMXA 1MP8A 4W4YA 1ZARA 4I0SA 3WE8A 4QP3A 5J87A 5GIOE 4G9RA 1NA7A 2X2LA 2PUIA 4S32A 4WIHA 1Q99A 4M84A 1MUOA 3EQBA 4RIOA 3TXOA 3RJCA 4APPA 4C2WA 4AG8A 3KGAA 5IUHA 4G3FA 1OKZA 4ITIA 4TL0A 2BIYA 1OKWA 5IEVA 4QQTA 1YOJA 3NYOA 2JD5A 3HP2A 4JLCA 4ASXA 2JIUA 2NPQA 2ZB1A 3MI9A 2UVYA 3LFNA 4WRGA 5EH0A 5HG9A 5HVYA 1ZYSA 2XJ1A 5GZ9A 5DR9A 5BMSA 5IZFA 4U8ZA 3LJ0A 4W4XA 4XRLA 3OEFX 1Q3DA 4EHEA 4CQGA 3QA0A 5G6VA 4RGJA 4YZ9A 1KE8A 3KL8A 1YOMA 2BZIB 4MXOA 3R8ZA 3TZ9A 4Z16A 3UODA 4P90A 4B0GA 1P4FA 2C0TA 3AOXA 4B8MA 5LWNA 5A4CA 1BKXA 2X6EA 1UWJA 2R0IA 4QT1A 3FBVA 5I5ZA 4CVAA 3QQGA 4Y5QA 5AEPA 1YI6A 1ZZ2A 4FZ7A 4ZOGA 4JAJA 3G9LX 3PSBA 4IM2A 4XG3A 5M4UA 2VX0A 2PVRA 4J52A 3UOLA 4TWPA 5AV4A 3CGOA 3PE1A 4JVGA 4UMQA 4AN2A 4CLIA 2VO0A 4L3PA 1OMWA 5K5NA 1PF8A 3K5VA 4K8AA 5HGIA 4PDPA 3FMNA 2UZDA 3NS9A 4ZEGA 4EK4A 4M67A 4HVGA 3N4TA 3IK3A 5FEEA 1UKHA 3C4XA 3OTVA 3MH3A 3FY2A 2YM3A 4FTNA 3HMMA 4FT9A 3HMIA 4ZLYA 5J5SA 4NM7A 5CAQA 1CSNA 3L9NA 5DR6A 1WBVA 2JITA 2CGUA 3Q2MA 5EDRA 1YWVA 3VS1A 5FGKA 1PKDA 4JAIA 5L6OA 4PPAA 2BRGA 2E2BA 4UWBA 3O23A 3EQGA 5LMKA 3HA8A 2UZEA 4TYEA 4YP8A 4BIBA 1SM2A 4O83A 2PVFA 3QTXA 1OIRA 2RFSA 5ANGA 3LCDA 3SW7A 5IQBA 2WQEA 3MVMA 4PF4A 4JNWA 5ACKA 5GJFA 3HZTA 4PY1A 3ZLSA 5KCVA 4IM3A 3GCVA 3QTIA 2EB2A 4WT6A 4EORA 3UYSA 4CFNA 2W4OA 1SNUA 3CPCA 1M2QA 3DBCA 4K1BA 4BDAA 4FK6A 5E8YA 3W8QA 2A1AB 3DS6A 4XG4A 3UIMA 3FY0A 3C5IA 2V62A 2X9FA 2R3LA 2ZV7A 3MWUA 4BCNA 4M69A 4QMXA 2Y4IB 3K5UA 3UPXA 4K2RA 2CJMA 1K9AA 2YA9A 4A9TA 5FXSA 5HNBA 3W55A 1U46A 4L3JA 4GIIA 5HO6A 3KRXA 4CFUA 5KNJA 3U6IA 1PMEA 4IQ6A 5FBNC 4DLJA 1B38A 3PVGA 2CDZA 4D1ZA 3O8UA 4NK9A 2J5FA 2DYLA 1OPJA 2ZV2A 3FZSA 3LZBA 4AACA 5HORA 4YZBA 4L00A 2B7AA 3FI2A 4KNBA 4BZDA 1XO2B 4JQEA 3DXPA 2PMIA 3BCEA 2R3FA 4AFJA 4MD9E 5B0XA 2CN5A 2PY3A 4XV1A 5JEBA 3KRLA 4ZSGA 3PIXA 1RW8A 3F61A 2Z7LA 3MBLA 5CU3A 2O65A 2VTQA 3GEQA 4I6HA 5AV3A 2C6TA 5A4EA 4FNYA 3BEAA 5L4QA 3HUBA 1KE5A 4IZYA 4UX9A 2JDTA 3MJ2A 2XNGA 3R1YA 4IXPA 1JNKA 4BKYA 2I0EA 5E8SA 3JY0A 2UW3A 3HRFA 3W2OA 2HZ0A 3MN3A 3AC3A 3DNEA 4F9BA 2VWWA 1SVGA 4EI4A 4FKRA 1A48A 5M09A 2XCHA 4AA0A 3RNIA 3TWJA 4KD1A 4CV8A 3KXGA 4QPAA 3ZZWA 2QONA 2VTSA 4FSNA 4HGLA 5HICA 4DEHA 2QLQA 3L8PA 4C4FA 3KN5A 3ULIA 4PV0A 4MYGA 4XNEA 3LKMA 3ANRA 3GCUA 4QTAA 4WBOA 4C62A 3CCNA 4AGUA 1Q8WA 3TJDA 3CY3A 4JDKA 4YJUA 2J7TA 2ZM4A 4DFBA 4UMPA 4FEUA 4FL2A 4TNDA 5I4NA 3UC4A 3DT1A 5EQYA 4WG4A 3GOKA 5DG5A 5BQ0A 4B99A 3GCSA 3DK6A 4MH7A 5C01A 3R8VA 1W8CA 2RSVA 2WB8A 1OKYA 2BROA 4DFZE 3LMGA 2VTAA 2ZM1A 3L9LA 2WTKB 3EJ1A 3KULB 3QWJA 5EW3A 3RMFA 1J91A 3UQCA 5M44A 3I0OA 3RZFA 1XH9A 4FNWA 3UE4A 3DFCB 1QMZA 2HY81 3FQHA 3R8PA 1MQ4A 4A7CA 1JOWB 4FMQA 5AV1A 1ZOGA 2RL5A 2I0HA 4IB5A 4NW6A 4GKHA 4YC8A 2WTVA 4BB4A 4MF0A 2FSOX 2Y4IC 4O86A 4R3RA 3BU3A 3MS9A 2OJJA 3VBYA 3QYWA 4I21A 2OBJA 3BU5A 5H2UA 4OTIA 3QUPA 4MXAA 1NVQA 3GFWA 2AYPA 2XZSA 3PP1A 3FE3A 3EWHA 5HKMA 4F9AA 3S3IA 2XNNA 4DGMA 2PE0A 2PMOX 5A3XA 5CI6A 2CKQA 5BUJA 4H3PA 4U97A 5L2SA 5A46A 3MDYA 4AP7A 3NUAA 3DOGA 2XB7A 3SDJA 1ZWSA 3NAXA 4MX9A 4CQEA 1H28A 3U54A 4H1JA 2BFYA 3COKA 3OCTA 4LV8A 4AW0A 5DA3A 3U51A 4I6BA 3ZLWA 4MBJA 3CPBA 5I3OA 3ORNA 4CCUA 3NNWA 4DFYA 4UWYA 4UEUA 4Z3VA 4FODA 5A4LA 3D14A 2PVJA 4G31A 3FZ1A 4J8MA 2VU3A 4WUNA 5AM6A 3TUCA 3OUKA 2C6IA 3QQFA 4KRDA 4Q5EA 3M1SA 4XLIA 3I79A 3FMLA 5C8KA 3FI3A 2XS0A 1ZLTA 3DBDA 3CIKA 3VUTA 4WHZA 1XBAA 5LVPA 2JC6A 3ET7A 4U6RA 3EQRA 3UIUA 3UZTA 1NVSA 4EOQA 4EUTA 2B55A 3WIKA 5AUXA 4J96A 4CV9A 4EJNA 2VO3A 2PZRA 5DRDA 4QRCA 4BKZA 4I41A 4NTSA 3NLBA 2W06A 1GOLA 3FLNC 3TT0A 3GCPA 4A4OA 2IVSA 1OL5A 5LXMA 4WSQA 3KXXA 3RHKA 4LGDA 5IA0A 3P9JA 1PYEA 3FAAA 4DF3A 2V55A 1IAHA 4CYIA 4CT1A 3RK5A 5ETAA 4RSSA 1T45A 2BDFA 3CBLA 3QD4A 5DWRA 4DCEA 1XHAA 3S0OA 4U9AA 2J0JA 4DE4A 3NCGA 2WAJA 4U80A 4E5BA 2C69A 2Z8CA 3PSCA 5HX8A 5EM8A 2GSFA 3I7CA 5GJDA 1Z57A 3KXMA 4YJVA 3VUIA 4ACGA 3HMPA 5CTPA 1PYXA 3E3BX 5FQDC 2OF2A 4M66A 4WNMA 4BZNA 5K0XA 5KHXA 4QYEA 2ITYA 1WMKA 3R28A 2YDJA 4FZFB 5JGDA 3SRVA 3WF8A 4M8TA 3MH0A 4X2FA 4E1ZA 4FA2A 4FTJA 4FVPA 4BDGA 4MHAA 3ZC6A 3BYVA 5C4LA 2QHMA 4DYMA 3NIEA 3MJ1A 4I23A 3SOAA 1R0EA 3BRBA 2BPMA 2UZVA 2QO7A 3EFWA 3QTSA 4R7HA 4KBAA 4W8DA 3G5DA 4EH5A 5T68A 4G6LA 5I9UA 4JRNA 1PXLA 4WD5A 2XNMA 5CY3A 5IQIA 3GVUA 3IDPA 5HE0A 3NSZA 5IQEA 2BUJA 2OK1A 3A7GA 3EQDA 3QRUA 5FEQA 3UQGA 4AE9A 1NW1A 4UYAA 2J2IB 3OXIA 3S00A 4YLJA 3QX4A 1HCKA 4L52A 3UIBA 4BWXA 4F7SA 2XK9A 3ZLXA 2I0VA 2Y7JA 3AD4A 1M2PA 4FZDB 4I92A 5AR2A 2QOKA 4II5A 4AQCA 3TZ8A 1Y6BA 1BYGA 5CSWA 4Y73A 4QP2A 4YURA 2BZJA 4LOOA 2XEZA 2CPKE 4GFMA 4RVTA 3FEGA 2YWVA 4OTQA 4P4CA 3TUBA 2R3GA 3GU5A 4EH7A 5J1WA 3BHHA 3IOPA 4C4IA 2RG6A 2QU6A 4IMYA 4R6VA 1YXTA 3V5JA 2KTYA 3SQQA 2ITQA 3U87A 2IO6A 4YZNA 1K3AA 2PVMA 2WMXA 2XYUA 4LG4A 3R7OA 5EDPA 4XX9A 3AC8A 1BL6A 2C3JA 2ITPA 4CTBA 4YBJA 3Q32A 5IA5A 5A4QA 4H39A 4BTJA 3GQIA 4U79A 1M14A 2VTLA 3F66A 3ROYA 2W05A 3OXZA 4FG7A 4HZRA 5GZAA 5IEXA 2BHEA 4YJRA 3ZEWA 1G8AA 5EQEA 3PG1A 5DNRA 5CF5A 2OW3A 2XIZA 3L1SA 2BDWA 3VBXA 3HRCA 1M2RA 3POOA 3BYSA 4YJSA 4F6SA 4NM0A 4F7NA 5JH6A 2PVYA 3JVSA 4LMNA 1QCFA 3LCSA 3O51A 2A4LA 2ZMCA 3BLQA 4QQCA 4DFXE 3ODZX 2F9GA 2JAVA 3ZSHA 2VTPA 2Q0BA 1KOAA 5B2MA 3RPSA 5FEDA 2ZYBA 4EWQA 2UW6A 3DA6A 1PHKA 4O7RA 3C9WA 3F82A 5AUUA 4JR3A 3PZEA 2BAKA 5D9HA 1YDRE 2ITNA 3PY1A 4BHZA 2I6LA 4PMPA 2GNGA 4O7NA 4IZAA 2ITUA 2ITOA 2IVTA 4MBLA 3ZBFA 4CNHA 3KB7A 4F0IA 3FMEA 5ANOA 5KBQA 2JFMA 5IDNA 3LXPA 2ETRA 3E88A 3NGAA 4K11A 5EI6A 3U4UA 2YDIA 5L8JA 3PY0A 1JSTA 4WA9A 3DDPA 4M0YA 1JWHA 4EOPA 2Y0AA 2X2KA 1U5QA 4MXZA 3U8WA 3BGQA 4M69B 4M15A 4AFEA 1OKVA 5K5XA 5KX8A 2A27A 1R3CA 3R73A 4OTGA 3F9NA 2WMTA 5HBJA 4RLLA 5TE0A 2CNUA 3HRBA 3T3VA 4OT6A 5K0KA 2YM4A 5CT0A 4UV0A 3R9DA 4CCBA 3FQSA 2VWIA 3WE4A 3BPRA 4APCA 5CEIA 2ZDUA 3MH2A 5AP0A 2IVVA 1Z5MA 2QOFA 1J7UA 2OZOA 4W9WA 4C4EA 3DQXA 1OL1A 4DEEA 4P5QA 3QHWA 1OL7A 3W2SA 3QYZA 3ATSA 3NW6A 1TQMA 2O63A 4YTIA 3D83A 2VRXA 3D9VA 2C6OA 2VTOA 2GHMA 2ITWA 4DAWA 3RVGA 3EZVA 3NUPA 5HG8A 3ZDUA 2XJ0A 3W16A 2ZV9A 4KABA 2C6DA 3QCQA 3R9RA 2W1DA 2JKOA 3DKOA 3W1FA 2WXVA 2BTRA 3KN6A 5HO8A 5IMXA 2W5AA 3P86A 3WOWA 4C58A 4A9SA 1BUHA 2GNJA 2JKQA 3D5UA 4ZY4A 1OPKA 3ROCA 4DGGA 1ZXEA 1LUFA 3RAIA 4O91A 4E5AX 4BCMA 3SC1A 2XK8A 3DKCA 4NJDA 4IWOA 1SYKA 4IM0A 4FTTA 4FTKA 2XEYA 4PMTA 1YHSA 4C38A 3DNDA 5DT3A 2CGVA 4IDTA 3SG8A 3ORTA 4EUUA 5B2KA 3ORLA 4EQUA 3QUDA 2WKMA 5DYJA 4TTHB 3OWPA 4EH6A 2OH0E 5EHLA 4G16A 4F99A 5JGAA 3OW3A 4E73A 2W5BA 3NNUA 2J9MA 3WZEA 2R0UA 3DLSA 3Q3BA 4AXAA 2Y4PA 2VWBA 2WTIA 3NX8A 3SKCA 4ZAUA 4FV0A 4ZTSA 1L3RE 4QMMA 4NYEA 4DBNA 4ANQA 4DFNA 3R8MA 2QURA 5LMKC 4BYIA 1Q97A 4NJ3A 3I6UA 2R3KA 3OCGA 3G15A 3VIDA 2GQRA 3MIYA 4XG9A 2E9UA 4RT7A 4HCUA 5CZIA 3UNJA 2C3KA 2OWBA 4IJ9A 1U5RA 2PVHA 3Q9ZA 2X8IA 4W8EA 1YWRA 3L8VA 1GY3A 3IW6A 4XCUA 3GFEA 2YZLA 4EYJA 3P5KA 2WTWA 4JX7A 3QQKA 5FXQA 4KSQA 4J8NA 3H3CA 3B8RA 5IG1A 3EKNA 1JLUE 1U4DA 1TKIA 2FO0A 3KQ7A 4GS6A 4XH6A 4HYSA 1QL6A 5EDQA 4XRJA 2X9EA 4BFMA 4FSQA 1XQZA 2B52A 3BU6A 5IU2A 3RNYA 5EM7A 3K54A 4GYGA 1Q61A 2W9FB 5AUYA 2PVNA 1JAMA 2XCKA 4EC8A 4EBVA 5IQHA 5CANA 3PRFA 1H00A 5DH3A 2RG5A 1KOBA 5HG7A 3TL8A 1XH8A 3A62A 3C51A 4X2JA 4ZXTA 3KY2A 3QXOA 4DTKA 2WELA 4I0TA 4FL1A 3CQEA 1LPUA 4NU1A 4ZK5A 4NCTC 1REJA 3RWQA 2PZYA 3PTGA 4KIOA 3ZUUA 3Q9WA 3ZOSA 1JKSA 5FRIA 2GNFA 5L2QA 4DBXA 5JRQA 3KK9A 3V6SA 3VBWA 3HA6A 4WNOA 4K6ZA 3A8WA 3FMDA 3TV7A 2EU9A 3RPYA 2RKUA 1ZOHA 4PPCA 5F94A 3HUCA 2W1EA 4R1VA 2C6MA 2UZOA 3RPRA 1H8FA 3LXNA 4QMZA 3BE2A 4YLKA 4E26A 3QTZA 5HBHA 2CMWA 3PP0A 1RE8A 3C0GA 3A60A 2P2IA 4NW5A 5J9ZA 5L8LA 4IC8A 2VGOA 3IW7A 3C4WA 4BDJA 3U6HA 3D7ZA 4FV8A 4QYYA 2R3NA 3Q5ZA 4ZP5A 4I24A 1OB3A 5E7RA 3RBWA 3KA0A 5I9VA 4QMSA 5IDPA 4WKQA 3ZU7A 3ORKA 2YM7A 1VZOA 3I0QA 4D2PA 3BIZA 1WAKA 4QYGA 5LVNA 2QI8A 3LCOA 3ZFYA 4KB8A 3RAHA 3ZTXA 2VX3A 4BF2A 4D4VA 1FPUA 5HCXA 2J51A 2XIYA 5CEQA 4O7YA 5C4KA 4C57A 1E9HA 5GJGA 2OZAB 4UZDA 2VTHA 5E91A 5CSHA 4IWPA 5CF4A 2UW7A 4ID7A 5EQPA 4FEWA 3KEXA 3MV5A 5CF6A 3F5UA 3KF7A 3FXWA 4IDVA 1Q41A 2PL0A 2CKEA 1VYWA 4KWPA 5CSXA 4ZIMA 4EKLA 2B9IA 3EQCA 2PMNX 4ANSA 2XM8A 3QA8A 2HAKA 3C1XA 1R1WA 4C7TA 2X2MA 2Z7QA 3DTWA 4ZY5A 3EKKA 4L7FA 4CLJA 3SRVB 2WMUA 3LM0A 4RA4A 3VQUA 3EN4A 1M52A 2WO6A 2QLUA 2FB8A 3R0TA 4FT5A 4MKCA 3ORXA 2JFLA 4I1ZA 3TACA 4BHNA 3KVXA 3R30A 4IAFA 3MPMA 3O7LB 4IFCA 4PL3A 2VZ6A 3D5XA 4RIWB 4RC2A 3SA0A 5AM7A 2XA4A 3UDBA 5KMOA 2R3QA 4KINA 5D11A 4OTWA 2IZTA 4LOPA 5BVFA 5L6PA 2QOOA 4Y85A 4MQ2A 3PVBA 3QTUA 4A06A 3GU7A 4GJ3A 4J7BA 3RTPA 3NMUF 5BYZA 3VWAA 2XIXA 2UZLA 4GUBA 4ERKA 4AWIA 2IVUA 1S9IA 3NAYA 4AZSA 4X3FB 3CJGA 5HIDA 4AAAA 4I6FA 4RWLA 3PXRA 1Y8YA 3R6XA 4AUAA 5H9BA 1WCCA 3OZ6A 4RWJA 3ZLYA 2CNVA 2YISA 5B2LA 3BE9A 2LGCA 4QMVA 3F2RA 4Y5HA 2WQNA 2QR7A 3HV3A 3FLZA 5AAFA 4HNIA 1U59A 3O2MA 4D4YA 4FEXA 4L8MA 5FD2A 2IPXA 2FVDA 3R00A 2DQ7X 3BYMA 1J3HA 3DKGA 4LRKA 3ZRKA 4AT3A 2VV9A 5HOAA 3QZGA 4FKSA 4RMZA 3DY7A 3NPCA 4IH8A 5M4IA 3QC9A 3VRYA 4V0GB 2CKPA 3LXKA 3KXHA 3RINA 3UVQA 3D5WA 3E8NA 1Q5KA 4IW0A 3VS5A 1GZNA 1CTPE 2C3LA 4AF3A 3D0EA 2XBJA 4IC7A 3EFJA 1R78A 5DRBA 3E8CA 3VS7A 4DEGA 2QU5A 3CXWA 3FZOA 4QMOA 4DEAA 4YU2A 5DPVA 3FMJA 3OT8A 3W2QA 2XKCA 4CMUA 2UW0A 5D12A 3U9NA 2XRWA 5CASA 5E8XA 1VR2A 4BCFA 2ITXA 3ACJA 3VS2A 3JS2A 4C33A 2BALA 4GT3A 2CCHA 2C5NA 2WU7A 3DK3A 4F9CA 5E92A 5BVDA 4YNOA 2AC5A 4E6QA 3LLTA 4O0TA 3KCKA 3UZRA 4FIJA 1UNHA 3QCYA 4O21A 2Y8OA 5TO8A 4BCOA 3SGCA 4OTHA 2WTCA 5HU9A 4D9UA 3OBGA 4YTFA 5A14A 3QRKA 4RVMA 2GNLA 4OR5A 2BKZA 4EZ3A 2GS6A 4QPSA 3F7ZA 3QD3A 4JR7A 5AMNA 4ZSEA 3R8UA 3FV8A 3TI1A 1K2PA 4X0MA 4EH9A 2FSTX 4O7TA 4GJ2A 3LFDA 1H1RA 1UU3A 4HJOA 4D2WA 2W17A 3O8TA 4JRVA 5TKDA 3QGWA 3KREA 3R2YA 3CQUA 3OC1A 3DGKA 4ORKA 1W84A 2OGVA 2ZAZA 4FUYA 3R04A 5I3RA 4EH3A 1I44A 2NP8A 4XMOA 3EYHA 1WBWA 1ZMVA 2RFNA 3R01A 4N57A 4X3FC 4QMWA 5DMZA 4MBIA 3FQEA 3GC7A 4FC0A 3AT2A 3ZHPC 5CEKA 5GZ8A 4BI0A 5AUVA 5CNNA 2W1HA 3F5XA 1WVXA 2AC3A 2QKWB 2WD1A 4LM5A 2YZAA 4LYNA 4BDFA 4F9YA 4C36A 1M7NA 3LVPA 3TNPC 4H3BA 2W0JA 3KC3A 5EOLA 1OL6A 3OOMA 2BR1A 3C0IA 1ZZLA 2Y6OA 4FL3A 3R1QA 3MESA 3DB6A 3PXKA 4QO9A 4PQNA 2PZIA 4ASDA 5KMKA 2WMVA 5FTGA 3VHKA 2YIWA 3C4EA 3N9XA 5J79A 5HIBA 2B9FA 1KWPA 4JIAA 5CENA 5ITAA 4BDEA 4MNEB 1W98A 3AGMA 1ZMUA 2F2CB 3F2NA 1A9UA 4XOZA 3O8PA 4HGSA 1AQ1A 1U54A 4FSUA 4X6RA 5AP7A 3OHTA 4CD0A 4USFA 2OFUA 3POZA 3GCQA 5IA2A 2OXYA 2OH4A 3HL7A 5ANIA 5JGBA 4Z7HA 3QX2A 5LWMA 3RCDA 1OIYA 3K3IA 2OO8X 2BFXA 3MW1A 3PA5A 1H1WA 1O9UA 2GFSA 4OW8A 3AC5A 2PULA 4FV9A 4NCTA 4YPDA 3OW4A 2H96A 3FMHA 3FSFA 5HTCA 1CMKE 1ZOEA 4IAAA 3ZH8A 4EOKA 3PWDA 4JBOA 3ANQA 5BVEA 3TNQB 4BTFA 5HU3A 3PIZA 4RJ6A 1LP4A 2GS7A
chains in the Genus database with same CATH superfamily
2EB3A 4FKVA 5A4TA 2YIQA 3VF8A 5BVNA 2OG8A 2B1PA 3GOPA 4O0XA 2GHGA 2IJMA 3LJ2A 3I4BA 2W99B 4GT4A 5CT7A 3V5WA 4FKQA 4I4EA 4JMQA 3AC2A 5D10A 3TNHA 2UW8A 2HELA 1DS5A 4S30A 1ZMWA 4ZJIA 3DPKA 4ANBA 4D2TA 4QMQA 4IAYA 4I6QA 2IW9A 5JQ5A 4N6ZA 5FP5A 3TG1A 3WZJA 4PTEA 4WNKA 4X21A 4DH3A 5F20A 2G01A 2OJGA 4BZOA 2HOGA 3BHTA 4NT4A 2RFDA 4EOLA 3KRWA 3NR9A 3UO5A 2XVDA 4KBKA 4AOTA 4D2SA 5HTBA 3QUEA 4BKJA 1H26A 2B9JA 3R8LA 4OBOA 5DE2A 2KULA 2R2PA 4N4SA 2BRMA 4WRSA 1OL2A 4MK0A 4YHFA 1F0QA 4CG8A 5K9IA 3UG1A 4FKIA 3I81A 2VWXA 4DA5A 4E4NA 4EYMA 3P7AA 3Q52A 3WF9A 4CRSA 5E8ZA 4BCHA 2OJ9A 1J1BA 4IX4A 4JDJA 1OPLA 2Y6MA 3EOCA 3Q60A 3RWPA 4FSRA 5LCKA 2A2AA 4HYIA 4LL5A 4FKJA 1PXNA 1SMHA 2UV2A 2NO3A 4RJ7A 2RFEA 5AR3A 4CZTA 3FKOA 4ZZOA 3E87A 5BUIA 1PRYA 4HYUA 4EK6A 5I9WA 3R21A 1FGKA 4GYIA 5DR2A 4ZMEA 1JSUA 4PWNA 4M0ZA 3MFSA 5BYYA 2IZSA 1IA8A 3ENMA 4HYHA 5KZIA 4IACA 4B6LA 3BHVA 5AA8A 2CKOA 4BCJA 3T8OA 2EXEA 2DUVA 2OI4X 1W7HA 4TNBA 4B8LA 4O22A 3EH9A 4OGRA 1H08A 4IVCA 4DGLC 5GINE 3NRMA 5JZNA 2J0KA 3SXRA 5IF1A 1WZYA 4GT5A 4YC6A 3DB8A 3NEWA 2YFXA 3S4QA 2UW4A 2DS1A 3WF6A 2BTSA 4FI1A 4G2FA 5IEYA 2YJRA 1UU9A 4HNFA 3HDMA 3ZXTA 2H9VA 2OJIA 4F65A 4GMYA 2FGIA 3RALA 5A6OA 3FZRA 4R77A 4PNIA 1GZOA 5ETIA 2NRYA 4ALWA 3R9NA 4UMTA 4FGRA 1OITA 1W82A 2R4BA 2BHHA 4Q5HA 4QQ5A 1XJDA 4H3QA 2BCJA 2CNQA 3HAVA 1V1KA 4FTRA 5EKNA 1OUYA 2JDRA 1WBPA 4O4DA 5I9YA 3QCSA 4OTPA 3VS0A 3F5PA 4FG9A 1YRPA 3T9IA 3TDWA 3CS9A 4ENXA 3KRRA 1CKPA 3GC8A 5DN3A 3EHAA 4I0RA 3PXYA 2W5HA 4IJPA 3D15A 5GHVA 3IECA 4TYGA 2BKKA 4D1XA 2VTNA 4BBEA 2W1FA 4FKGA 5FTQA 3QU0A 2UZTA 2YEXA 2UW9A 4AGDA 2WNTA 3UG2A 3GC9A 4D0WA 1YI3A 4GSBA 3ZM9A 1M17A 2I0YA 4RIYB 5H8BA 3ZRLA 2OFVA 3QQHA 4O27B 4QEBA 3NNXA 5HI2A 3M2WA 5C8MA 3T3UA 2QR8A 3KFAA 5TT7A 5M4CA 2OZAA 2VD5A 5DT4A 2Q83A 3TEIA 5AR4A 4YNEA 1PXKA 4EZ7A 2YCSA 3Q4CA 3ELJA 1DAWA 5C9CA 1M7QA 3EFKA 3D2KA 5IUGA 4CMTA 4F1OA 4JG7A 5IQGA 2YHVA 3PRIA 5EHYA 4UMUA 3A99A 1E1VA 2G15A 3WILA 4E5WA 5FBOA 2PU8A 5AR5A 2P55A 3WZKA 3ZYAA 4ZJVA 5F95A 2WTKC 3OUNB 2R9SA 2PPQA 4DDGA 4FIEA 2GPHA 4OT5A 4MD8E 2C0OA 3PLSA 4QP1A 3SVVA 4IVBA 3GXLA 4FV4A 4EZ5A 4USDA 1GIHA 3MA6A 2VTIA 4XJ0A 1J7LA 5BYLA 2C47A 4CFWA 2VO6A 3IGGA 3O50A 5HE2A 3R7UA 2ONLC 4RIWA 3O7LD 5AUWA 5BNJA 3U9CA 1PJKA 3C7QA 1J1CA 3BWFA 2AUHA 5GNKA 3BLAA 3CC6A 4BTKA 3TTIA 3ZO1A 3GT8A 3VBQA 4YJTA 3C13A 4IB1A 3N51A 4Y83A 3TZMA 3W0PA 3IW4A 4X3FA 3WZDA 3H9FA 3LFAA 4OAUC 1UKIA 1STCE 4PX6A 4RLKA 1PXJA 2OSCA 3UDTA 3A4PA 5HLNA 3K3JA 4V01A 4BL1A 2XH5A 3ZO4A 3IOKA 3DAEA 4YJNA 3CTQA 3VJOA 3P78A 4BI1A 4YTHA 4ZZMA 1SVEA 4BGHA 3F6XA 1VJYA 2YCRA 4I6LA 4ITHA 4LGGA 4L45A 2X81A 3QRJA 4DHFA 4L3LA 3GU6A 2V7OA 3FHIA 3LMIA 3H30A 4KSPA 4XV2A 4ALVA 4FSTA 3VRZA 4D58A 1TFFA 5L2WA 1IA9A 4XOYA 3H9RA 2GFCA 3KVWA 2CN8A 1Q8YA 4FV2A 2OIQA 3H10A 4FT7A 4TYIA 5DGZA 5BVOA 4FICA 3ORMA 4U42A 3VC4A 3BI6A 4V0GA 5CZHA 5ANDA 3BLRA 3ID6C 3W0QA 3NYNA 4J53A 1REKA 3C4FA 1IG1A 5J9LA 2FYSA 4CEGA 3L8XA 3LW0A 3DAKA 3P23A 2XMYA 4WO5A 3SW4A 3VW6A 4PP7A 1R0PA 1IASA 1OUKA 1CDKA 1XMMA 2YIXA 3AXWA 4BWPA 3R7GA 4QP4A 1YXUA 3QQUA 4W4VA 5AJQA 5H8EA 3OY3A 5HVJA 3UVPA 3VJNA 1CKIA 2JIVA 3AD6A 3QQLA 4YLLA 3UP2A 4FG8A 4AT4A 2XK3A 4RJ5A 5AWMA 2PTKA 4I20A 4IZ5A 4DEIA 3VUGA 4QDEA 3IDBA 4QMNA 5IH4A 1O6LA 4M14A 1RJBA 3Q4UA 2O64A 4FTCA 3E63A 3KCFA 3PLAE 5ETFA 4JL9A 4U0IA 3EN6A 2QHNA 3DFAA 2R3MA 4YJOA 4JQ8A 5I9XA 4IX3A 3PFYA 3ZUTA 4R7IA 3Q6UA 5LCJA 4U43A 5LVLA 4BC6A 2RGPA 2W1IA 4AN3A 2WMBA 5JSMA 3QFVA 3DTCA 4NTTA 4QMLA 3COHA 5DVRA 3FWQA 1FINA 2RIOA 4GK2A 2OIBA 2VNWA 4FZ6A 1ZYDA 4L7SA 5AV2A 4AZVA 4BCKA 4C34A 2YLEA 5HNGA 4EK5A 3CD8A 2XAOA 4R5SA 5KE0A 4AAYA 3SV0A 2WEVA 3KMMA 3R71A 4L01A 3ALOA 2PSQA 4NKSA 4I5MA 2XUUA 3GBZA 3FYKX 3PJ3A 2E9VA 2EXMA 3NYXA 4BR3A 1O6KA 4QD6A 5HIEA 2J4ZA 3IS5A 4AA4A 3OWJA 2OIDA 4EOIA 3CSVA 4CT2A 3IO7A 4TYJA 4DC2A 3A8XA 1LEZA 1U54B 1WVWA 3M42A 4U45A 4RZWA 4ANNA 3ORIA 2A0CX 4OTRA 5M56A 2XJ2A 2HIWA 1G3NA 4U81A 3EB0A 3V8WA 3GGFA 5J5TA 4FTOA 4Y8DA 4AQKA 4E20A 2VTRA 1GZ8A 3ZRMA 3EQHA 3RM6A 3VNTA 3DZQA 3ZS5A 3SHEA 2HW7A 2F7XE 2R64A 1JBPE 3JPVA 2YM8A 1VYZA 3LQ5A 3MB6A 1QPJA 5FM2A 3R9OA 4BCPA 4EEVA 5HG5A 3NIZA 3MSSA 5D1JA 4O38A 1SVHA 1GJOA 1JSVA 2XF0A 3B2TA 2C5XA 3ACKA 3NWWA 3CQWA 4OBQA 5JRSA 5FDXA 3VUKA 3BYOA 4GU6A 4S34A 2VWZA 4C4HA 4MNEA 3S95A 5CAUA 4R3CA 5LOHA 5HCZA 3MFRA 4G1WA 1VEBA 4TWCA 2BAQA 4ASEA 2EUFB 4EC9A 3BZ3A 4LDTA 4RFZA 4AN9A 2J50A 1KE7A 2PVLA 3W10A 4PDOA 2VTMA 1F5QA 5EYKA 3LQ8A 3BX5A 3R7YA 1B39A 5KKRB 3ZO3A 3EN9A 4ZTRA 2QKRA 4FKLA 3QLFA 5CU4A 4IAIA 1PXOA 4XS2A 5F1ZA 4WNPA 4GIHA 5CXZA 3ENHA 2R3RA 1Q8ZA 3G9NA 3R83A 4M12A 3F5GA 2Z7RA 5BPYA 2W9ZB 5HQ0A 4J71A 3LFFA 4AW2A 3WIGA 4BICA 3FMKA 4LL0A 3UMWA 5TR6A 2WQOA 4Q9SA 2C5VA 4F6UA 3PA4A 3IKAA 4O0VA 3O17A 4RC4A 3R7VA 2Z02A 2WOTA 3IW8A 3UPZA 1XBCA 3N4UA 4J95A 4F7LA 1PXPA 5CALA 2VX1A 3ODYX 3OEZA 4DGNA 5AIKA 2A19B 3EN7A 3AD5A 2OJFE 2W1ZA 3A2CA 3FYJX 1H1PA 4FKOA 3ATTA 5KMNA 2Z7SA 3ORPA 3RM7A 3MVLA 4YSJA 3TV4A 4NZWB 2J0IA 5C1QB 3TKIA 2V5QA 4NIFB 4RRVA 3RAKA 4B4LA 3MFTA 2YACA 2QODA 4GK3A 4YJPA 4QOXA 3HX4A 4WG3A 4O7LA 1URWA 2XNOA 1V0BA 4XP2A 1XKKA 5L8KA 2C1AA 2R5TA 3EMGA 3G51A 3UIXA 4BCQA 2ZOQA 4HW7A 1MRYA 2JAMA 3FKNA 3HP5A 4R5YA 4EKKA 4F7JA 4PDYA 2REIA 4PRJA 4AXCA 3EQPA 3V5PA 3QLGA 4HVDA 4XV3A 3JXWA 5D41A 4A4LA 3HEGA 2X8DA 5DHJA 4IWDA 3TJCA 3E8EA 4XBRA 4O2PA 4RPVA 3VS3A 3WI6A 2O8YA 3VUHA 4EH4A 5JZJA 1XBBA 2JKMA 4HCVA 3LCKA 2CLXA 4OUCA 4WOVA 3ETAA 1PMUA 3FMMA 2PK9A 3P79A 4EHVA 3ITZA 3NYVA 4XG2A 4RQVA 3RPOA 2EWAA 3EL8A 4ACCA 4CXAA 5KZ0A 1QPDA 4O0YA 3ZZEA 4BGQA 3UDSA 4HGEA 4IHPA 4C0TA 5HCYA 4G3EA 1H0VA 2YERA 2ONLA 3OWLA 2BVAA 4LFIA 4BDIA 4D28A 2WMQA 4BYJA 4C61A 4CFMA 4ZTMA 2H34A 4TWNA 1AD5A 4IB3A 3C50A 2ITTA 2GDOA 4L44A 3MA3A 2W1GA 1GIIA 2QNJA 1DI8A 1H4LA 3QWKA 4EBWA 3SG9A 1OIUA 2IZUA 5BX0A 5CXHA 4BY9E 1I09A 3TIZA 3OBJA 4IBMA 2WHBA 3TMOA 2QO2A 3CE3A 4YO4A 4HVHA 2ZM3A 2GNHA 2F4JA 4YR8A 4FVRA 3CTHA 4G6OA 1UU8A 4GK4A 4TWOA 4R8QA 5HNIX 4F0FA 2X1NA 2HY0A 4GVJA 3CKWA 3G90X 4KKHA 1RQQA 4RJ4A 4AXFA 1SNXA 4FIGA 3SAYA 1BL7A 5FUTA 2SRCA 1PMNA 4FEQA 4X2GA 5IQAA 4BDKA 4L9IA 3QAME 4JG6A 5AX3A 2YN8A 5AP4A 4E4MA 2ZB0A 4U7ZA 3DQWA 4LUEA 5CNOA 5CX9A 4EH2A 1YQJA 4FKPA 4LRMA 3F7WA 3K2LA 4O6LA 1FVTA 4RFMA 2G2HA 5E1EA 4ARKA 4LV5A 3RKBA 2H6DA 2BZKB 4KA3A 4FF8A 4FK3A 3R9HA 2PYWA 1GAGA 4RJ3A 4UMRA 3Q5IA 4G5PA 3F69A 3H0ZA 3VHEA 4C4JA 1FBNA 3O5AA 1KV2A 4FTQA 3W2PA 4A9UA 1UU7A 2C6LA 1VLRA 2HXQA 4RIYA 5H8GA 4FX3A 4OLIA 3E93A 4JQ7A 5C8NA 3W2CA 3BHUA 2H8HA 1HCLA 3FI8A 4TYHB 2O5KA 4C59A 3D4QA 3G0FA 3ERKA 4I5PA 3TKUA 3EL7A 4AW5A 2NRUA 3NUYA 3UO4A 4FTIA 3OS3A 2ZDTA 4MNFA 5I0BA 3BELA 3H0YA 3WZUA 5JFXA 1J7IA 3IG7A 2OXXA 4UBAA 5C27A 5HESA 4TKSA 3FL5A 2JEDA 3CJFA 5BMMA 2XNEA 4D0XA 3MIAA 3NUXA 3HV6A 4NKAA 4E6AA 2WOUA 3QQJA 2B54A 3NNVA 3NCZA 4HPTE 5FP6A 3UQFA 3OG7A 3ZO2A 2BZHB 4MTAA 2WTDA 1Q62A 2FH9A 1XH5A 4RZVA 3NVKI 1FMKA 3CY2A 3E7VA 2J5EA 5KMIA 2PMLX 5JN2A 4TXCA 3H4JA 5CLPA 1H27A 1FGIA 4FSMA 3VBVA 3FUPA 4IADA 4M13A 3PJCA 4NEUA 2XK7A 4TZRA 2UVZA 2VWVA 3PDTA 5H3QA 3AT3A 2XBAA 4FIHA 4DEDA 3W33A 4E6CA 4I22A 3PJ8A 5HX6A 4O0RA 4FYNA 5AADA 3FKLA 4XHKB 3RHXA 2XIRA 2X6DA 3I7BA 1OVEA 4RX7A 2IW8A 4QTEA 1QPCA 2YLFA 5DEWA 3UZPA 3JY9A 4R7BA 3MYGA 2FSLX 3AQVA 4HZSA 5CSVA 5KO1A 4IX5A 2WTJA 4P5ZA 3COMA 4AS0A 1ZYJA 3ML1A 4RBLA 3IONA 2JIIA 4IAZA 5AFVA 2X0OA 3MGYA 2BIKB 3RI1A 2B4SB 3ZUVA 4DG0E 4YPSA 3SD0A 3F3WA 3SLSA 2WIPA 3NVMB 4Q2AA 4JI9A 5DIAA 1YHWA 4I3ZA 3DXQA 3PZHA 4UZHA 4ZY6A 4DGOA 1UWHA 4I4FA 3WF5A 2CLQA 4CFVA 2BMCA 4L43A 5AUZA 4FZAB 4QNAA 4IFGA 1ZYCA 4F9WA 1ATPE 4KAOA 2R7BA 4YBKA 4AZWA 3M11A 3HGKA 4GVAA 4N0SA 4J99A 3BGPA 2C3IB 5AA9A 4O7SA 3DBEA 3IW5A 3RGFA 1YXXA 2XNBA 3G6HA 3FZPA 4XG8A 3VUDA 3AC1A 4NFMA 3DV3A 4D5HA 2OLCA 4O6EA 5HLPA 2GNIA 3TYKA 5EOBA 1XH4A 3R2BA 5LVOA 5EW8A 1OM1A 3LXLA 3PUPA 4U3YA 4D9TA 4WSYA 2HENA 3F2AA 5CI7A 4RX5A 2F57A 2QOBA 4RIXB 1KV1A 3QL8A 3PWYA 3DJ6A 4B7TA 4JIKA 1PXIA 4EHZA 4K0YA 3UDZA 2VAGA 4YUQA 4FYOA 1P4OA 3FLQA 3MPTA 4X2KA 2YAAA 5JT2A 3E92A 4IE9A 4F08A 3BBWA 4CZUA 2O0UA 3ZCLA 5BVKA 4XEYA 3TV6A 3IQ7A 2IWIA 3LHJA 3V5QA 5T6KA 4BDDA 2BRBA 3R7EA 4BIEA 2C0IA 1BI7A 4E93A 4ZLZA 3F3UA 3PXFA 4X6QC 3GU4A 3EQIA 3UOKA 4JX3A 3OCBA 5CS6A 3ULZA 4KS7A 4EK3A 4DG2E 5JFSA 2X4ZA 5EG3A 2ZJWA 3MVJA 4PPBA 3UO6A 4HVIA 4FE2A 5HHWA 1O6YA 4OTFA 2HWPA 5J8IA 5HVKA 4TRLA 4E3CA 3KF4A 1E1XA 2YM6A 2C5YA 5M55A 3EN5A 4HVSA 4CYJA 4DH8A 1APME 5A54A 4FT3A 4RX8A 1JQHA 3NUUA 4P2KA 5DFPA 4LI5A 5EYDA 5M06A 5L6WL 4BDBA 4NH1A 2BDJA 2BAJA 2CGWA 4EOSA 4G3DA 2J90A 5EHOA 3N4VA 4EH8A 1QPEA 5D7AA 4GKIA 4XUFA 3Q96A 2HZIA 2UW5A 4FUXA 2WQBA 2HK5A 4GFGA 4CMOA 1OI9A 3VS4A 3DK7A 4W9XA 5IQFA 3AMBA 4N70A 4L6QA 4OBPA 4V04A 2YDKA 5IA3A 4A07A 4EOMA 3LLAA 4F1TA 3C4CA 2C4GA 3CTJA 3QZFA 4YO6A 1Z9XA 4O4BB 4G9CA 5DOSA 5ETCA 4AZTA 2FUMA 4FT0A 5AIRA 4AGWA 3R63A 1YHVA 3KXZA 4Z9LA 2V7AA 4PTGA 5IH6A 3LIJA 3PPJA 3CEKA 3KRJA 5E8WA 3TNWA 3BKBA 2V0DA 4CG9A 3HLLA 1YVJA 4X2NA 2JKKA 4FV5A 4FTUA 1P2AA 1FMOE 2WMAA 3VONA 4HGTA 4EOJA 2OKRA 3Q6WA 4UXQA 4QTCA 5AAGA 5L3AA 3D7TB 2GQGA 4R1YA 4L67A 1Q4LA 2VNYA 1CM8A 4J1RA 5CU0A 5M53A 2JDOA 5AP1A 2UVXA 3ZONA 3HECA 1G8SA 4XP0A 4AX8A 3L8SA 3PVUA 2G9XA 4UXLA 3GNIB 5AP3A 3OFMA 1OBDA 5BV3A 4QNYA 4S31A 5AX9A 2C6EA 3R1NA 2X0GA 4ZTQA 3VBTA 3ZM4A 1YI4A 1KE9A 2GHLA 4Q9ZA 5M51A 3BV2A 3UNKA 3TTJA 5FG8A 5KMLA 3FL4A 2F49A 4FEVA 2PZPA 3RPVA 5C03A 4QMTA 5CEOA 1ZAOA 5M57A 3R7IA 4KKGA 4TT7A 2ETMA 4PDSA 4TN6A 5LARA 2IZRA 3S2PA 4TW9A 4CFFA 4DITA 5KMMA 4FIFA 4RG0A 5AUTA 2J0MB 2XM9A 2IN6A 1B6CB 2HW6A 3AMYA 4QP9A 3ZXZA 4IAKA 3D5VA 4ALUA 3KU2A 4UY9A 2XIKA 3Q9XA 2NNWB 4NUSA 1XWSA 4G34A 2GMXA 4FIIA 4A4XA 3ZSIA 4IEBA 4LGHA 1G5SA 4FSWA 2B0QA 1V0PA 3OT3A 3OVVA 4DFUA 5EM5A 2WEIA 5IKWA 5AP6A 3U4WA 4O7WA 4NIFA 1NT2A 2W1CA 5C26A 5IA4A 1ZRZA 4LOQA 4FKUA 4O0SA 5CU2A 1H1SA 1H0WA 3DBFA 2WU6A 5FDPA 3GP0A 4FKTA 4AOJA 4IWQA 2WPAA 3UBDA 3V8TA 4DEBA 4EOOA 4C8BA 3CD3A 4JJRA 4RFYA 4DH1A 4D2RA 3MPAA 3E5AA 5CVFA 3AMAA 2XNPA 2YIYA 4MXXA 4XG7A 3HV7A 4ZSLA 3WBLA 5I9ZA 2GU8A 2YWPA 4M3QA 2ITVA 4MF1A 3VW8A 4BIDA 1Y8GA 4NFNA 3TIYA 2ESMA 1Q8UA 4ZTLA 3E62A 3AGLA 1IEPA 3JVRA 5JFVA 3F3TA 3H9OA 4CKIA 5EYMA 5ANKA 5TF9A 3CR0A 3DKFA 1S9JA 4ZSAA 3DBQA 3SX9A 4KUJA 1CKJA 3L9MA 5KHWA 1WBSA 3P1AA 4GRBA 3LCTA 4GH2A 4I93A 4RVLA 4D1SA 3OTUA 5IH5A 4OAVB 5IA1A 2FSMX 2QOLA 4M68A 3EFLA 3EIDA 3V51A 2R3HA 2I40A 3PPKA 4O7ZA 3BV3A 4LRJA 4O2ZA 4A9RA 4BBMA 3OOGA 4DG3E 2YIRA 3COIA 3OD6X 3ZMMA 3WF7A 4USEA 4H58A 4O84A 4A9YA 3Q2JA 4M97A 3LMHA 4ACDA 4NM5A 4BVUA 1OBGA 3BHYA 3AKLA 4ANLA 5EYCA 3A7IA 1HOWA 5JMSA 4G17A 2PE1A 2R7IA 4BRXA 2JLDA 3Q4TA 4O1OA 4U5JA 4C4GA 1PKGA 2XKEA 1TQIA 4RVKA 3RAWA 4IVAA 2W4KA 4UALA 5L2TA 1PXMA 3R22A 3HVCA 1UV5A 2HCKA 3BQCA 4FKWA 5GIPE 3P7BA 2ETKA 3UYTA 1BLXA 5EM6A 1MRVA 4GV1A 2F7ZE 4J98A 2XKDA 1MRUA 2WMRA 3II5A 2CHLA 4QP7A 4AE6A 5CEMA 3VQHA 5F4NA 5KBRA 4EONA 1GIJA 3KMWA 4GG5A 3FC2A 4C37A 1PY5A 2WIHA 3GQLA 3MY1A 4QYHA 5CYIA 2QVSE 4EJ7A 1XH7A 4S2ZA 4I5HA 1JKTA 3A61A 1V0OA 5IPJA 4CGAA 4K18A 2PUNA 4MVFA 3QD0A 2C6KA 5T3QA 3RCJA 3VF9A 3SXFA 2WZJA 5DI1A 4L68A 3RK9A 3OCSA 4AA5A 3HV4A 3PA3A 4Y95A 4FV1A 3DDQA 2ERZE 3DJ5A 4ZSJA 4MQ1A 3QRTA 3DZOA 4RA5A 2QOQA 1P14A 3FLSA 4GW8A 2JDVA 1LEWA 1X8BA 3GENA 4BBFA 3T9TA 4NL0A 3VS6A 5K4IA 4ZJJA 1ZY5A 1GNGA 3I5ZA 4LMUA 4TYHA 3PJ1A 4L53A 4QMYA 4QP8A 3BYUA 3P7CA 4KIKB 5FLFA 4PMMA 2CGXA 5HE3A 2PVKA 5IISA 4DT8A 1T46A 2UZBA 5CSPA 4JBPA 3GI3A 2QG5A 4C3PA 4L42A 3VO3A 2UUEA 4ASZA 1ZYLA 5AP5A 2E9PA 3DXNA 3CLYA 3QKLA 3C4ZA 5JFWA 3I5NA 2PUPA 5K3YA 2G2IA 2G1TA 3Q53A 2BILB 2JBOA 5J7HA 4E4XA 5JKGA 4Y46A 1W83A 2WMWA 4YC3A 1LR4A 4XV9A 1YXSA 4AXEA 4BI2A 3Q04A 4XG6A 4MWIA 4D2VA 3UVRA 2ITZA 3Q9YA 4FOBA 4DH7A 3LE6A 3LPBA 1FVRA 2XK4A 5CWZA 4H05A 3V5TA 3VUMA 2BRHA 2VTTA 4CRLA 3VAPA 4RJ8A 3I6WA 4F64A 3QKKA 5HBEA 3HNGA 5LJJA 1ERKA 2ACXA 3E8DA 3FLWA 3EYGA 2O3PA 3LFEA 3MFUA 4N6YA 4K9YA 4DCAA 1YDTE 4D5KA 1DAYA 4UWCA 4YJQA 4DTBA 2QC6A 4YZMA 2CSNA 2R3PA 4AZEA 4JBQA 2VWUA 3G6GA 3KIOC 3NZ0A 1YWNA 4OTDA 3QHRA 2I1MA 4BGGA 4TY1A 5EK7A 4F70A 3FDNA 4DN5A 3O96A 5CVGA 3HMOA 4F09A 1NVRA 3UOHA 3FJQE 2YABA 4PNKA 4ERWA 3W32A 1FOTA 2YAKA 4KKEA 4ZZNA 1PMVA 4GU9A 4GL9A 3LQ3A 2XP2A 4PL5A 2GCDA 2QD9A 4BCIA 3MY0A 5E90A 3EZRA 3UNZA 4F0GA 2B53A 4CKJA 3C5UA 4EQCA 2E9NA 3DCVA 1OECA 4NWMA 4EHGA 1H1QA 4HOKA 4QMPA 4V05A 3GUBA 3PE2A 4XBUA 1UA2A 5AP2A 2X7FA 3IDCA 3HKOA 4FNXA 1ZY4A 2W4JA 4Z7GA 4IIRA 3PVWA 2J0LA 2IG7A 4O0UA 2B9HA 3PXQA 3SOCA 3SXSA 1FVVA 3GU8A 3PYYA 4E7WA 5CAPA 3W0MA 4AU8A 3TKHA 4FV6A 4MWHA 4RWIA 4LUDA 3UJGA 4IVDA 2YITA 4RIXA 3ZFXA 1DI9A 3F3ZA 2P4IA 1Q3WA 4E8AA 2GS2A 3LFSA 4RQKA 4DTAA 2X8EA 1KUTA 4GUEA 2UZWE 3P08A 5CEPA 4JOAA 3L9PA 2HZ4A 4YZCA 4F4PA 1TZDA 5IQDA 3QXPA 4D55A 4FTMA 4RC3A 3E64A 3CGFA 2ZMDA 4QP6A 3LFCA 5E8TA 5HE1A 3RK7A 3OWKA 5E8VA 5KUPA 2G2FA 1UNLA 1JKKA 4K77A 2XYNA 2JDSA 2XK6A 4Z55A 3HV5A 3MTLA 3NW5A 4GEOA 1YW2A 2HXLA 4XYFA 1A06A 1WBOA 2YCQA 2EXCX 1EH4A 1MQBA 3UOJA 4JG8A 2P0CA 4P7EA 1H25A 4W4WA 2VUWA 3BBTB 4MAOA 5LVMA 5E9EA 5J7BA 4FVQA 3TM0A 2HYYA 1WFCA 3G2FA 2PWLA 2EVAA 2GTMA 3CP9A 3QGYA 4CKRA 3F3VA 2X4FA 3G33A 5HTIA 2QOCA 4FOCA 5CQUA 1RDQE 3TN8A 4YHTA 5AV0A 5ACBC 3AC4A 3MVHA 3FC1X 5DT0A 2VN9A 4EK8A 4O7VA 4F78A 3MH1A 4O82A 3CKXA 2QO9A 4QPMA 3RZBA 5FTOA 4PL4A 4WUAA 4QTDA 3QKMA 4DT9A 1SZMA 3VVHA 2JBPA 3QC4A 2XARA 1P5EA 3ZSGA 3OXTA 3BQRA 5HD7A 3ZFMA 5CQWA 5HO7A 4X7QA 2HWOA 4DLIA 4ZTNA 3TDVA 3PG3A 3P4KA 2OXDA 4FTAA 4ONAA 4HPUE 4IX6A 4RWKA 1YKRA 2UZUE 1JPAA 5LMBA 5LQFA 4S33A 5M07A 4EL9A 3LM5A 3ZDIA 2WGJA 3D2IA 3THBA 5EI8A 2GTNA 2QCSA 3D7TA 4BN1A 4C02A 3QBNA 3HAMA 3VN9A 4AT5A 3WYXA 1YDSE 3ALNA 4G3CA 1YXVA 4TPTA 3QZHA 3QD2B 3C0HA 4JDHA 3PSDA 4PUZA 1IR3A 3MB7A 3IGOA 1URCA 2VO7A 3HYHA 4FSZA 1GZKA 2QOHA 4NM3A 3WARA 4G6NA 3KMUA 5BUEA 4JS8A 3PPZA 4ZMFA 4KIPA 3VULA 4QMUA 1KE6A 1PW2A 2YJSA 3O71A 3Q4ZA 4KS8A 2X0QA 5DLSA 3UGCA 1R39A 2X39A