4M68A

Crystal structure of the mouse mlkl kinase-like domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
277
structure length
268
Chain Sequence
QIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVLRAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRSSSTIYVSPERLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDGILERLSAVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Mixed lineage kinase domain-like protein
publication title Structural Insights into RIP3-Mediated Necroptotic Signaling
pubmed doi rcsb
source organism Mus musculus
total genus 82
structure length 268
sequence length 277
ec nomenclature
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4m68A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4m68A01
3FDNA 2YLFA 4FKIA 3R8PA 3L9PA 4S2ZA 4D4RA 4FTCA 4H36A 4ZTMA 3D4QA 4ZY6A 3HV3A 4J98A 4C62A 4F7SA 2HW7A 4X0MA 4IB5A 2QG5A 1M7QA 3FLQA 2EXCX 4V05A 3LFSA 3R8LA 3SHEA 2F57A 3W32A 3LFAA 5CEOA 5CLPA 3C13A 4GU9A 2IZRA 3C4EA 3GCSA 3QD4A 4FT9A 4F6WA 1H28A 1FINA 3KF7A 5BVEA 3D7TB 3UIUA 3R71A 3D5XA 4DGGA 3R63A 4E5BA 4F0IA 3E92A 4YJSA 5FBOA 3HV6A 4MHAA 2JBPA 3BBTB 3I6UA 4WRSA 4BDEA 2Z7LA 1ZMWA 3MSSA 5KMKA 2W1FA 3ROCA 4EEVA 2ZJWA 3BGQA 3ENMA 3HUBA 4RJ4A 4BI2A 4IVAA 4BBEA 3P5KA 4DFXE 4RWKA 4LOPA 3QQUA 5J87A 2R3FA 4HGLA 1R1WA 3ERKA 1KSWA 3U4UA 3D83A 4AZVA 2BRGA 5HESA 1W0XC 4JDHA 3GC0A 5BVKA 1XKKA 4L3LA 3THBA 5C03A 1Y8GA 2PZRA 3NZ0A 4OTDA 3UIBA 3DBEA 3F3UA 2P0CA 3F2RA 3W2PA 4IWPA 4QMYA 4WNKA 4S32A 1WZYA 2OH4A 3GU4A 5EDRA 3EQRA 1JPAA 4PPCA 1AQ1A 4EQMA 2NP8A 4BCJA 4DINA 4C37A 2JKMA 2J6MA 3PIYA 5CQWA 5CSWA 2PMIA 4UN0C 5M4UA 1JOWB 5E8YA 1SZMA 3BEGA 5BUEA 5M44A 3RALA 4JXFA 1YVJA 1UKIA 2OK1A 4BDBA 2EXMA 5A4CA 4FV5A 4ALWA 1YW2A 5BVWA 5JSMA 2BZIB 4U3ZA 4FV7A 3KF4A 2I0EA 2ERZE 2JFMA 5JRSA 2BKKA 3HMIA 4MH7A 3S2PA 5FP5A 3TCPA 2FUMA 1H1WA 2YIQA 3CS9A 5ACKA 3ZUTA 4QQTA 1WBSA 3FI3A 3HV4A 2VTAA 4DEGA 1WAKA 2B55A 3CKWA 4RC2A 5FXQA 3VUMA 3LW0A 4FTAA 3BIZA 1BI8A 3UNJA 4EKKA 4ZZNA 3PXKA 2SRCA 3LPBA 4AXAA 4CMOA 3MH2A 1CKPA 4A9YA 4OAUC 2RFEA 3OUKA 5CALA 2B53A 3BE9A 3GENA 5CEKA 1P4OA 1WBTA 4R8QA 1S9IA 3CGOA 3NYNA 3PUPA 4MNEA 3QZHA 4I93A 4IB1A 3S00A 4J52A 1JAMA 5GZ9A 4KRDA 1OKZA 5JFXA 1NVQA 3LFQA 2XNPA 4B8MA 5EFQA 2X2KA 4WT6A 5E8UA 4DEIA 4TYIA 4MWHA 4ANOA 2XK3A 2WMWA 2YM5A 4D4YA 2XK9A 3KRWA 4EL9A 4FV3A 5CANA 4HNFA 4Q5HA 2RG5A 2O64A 3ANRA 3UE4A 4O7RA 2A1AB 3RP9A 5FGKA 3QU0A 5IQDA 4AG8A 4FTJA 4GSBA 4DFYA 4IZ7A 4L52A 2YCFA 4S33A 5TKDA 3HMNA 4ZSJA 3CPCA 4FKJA 1NT2A 4YO4A 2R3LA 5AAEA 4OBPA 1IASA 3EIDA 4D55A 4FGRA 2PVLA 3POZA 5CYIA 4LV5A 5BYYA 5F1ZA 5HD4A 4O7NA 3ORNA 3KXZA 3GU7A 3CC6A 4FF8A 3WZUA 5AP5A 3AC8A 4WHZA 1RW8A 2GNIA 4XG9A 3VBXA 3KXNA 5LOHA 5EOBA 4F6SA 2UW9A 4O0TA 2X9EA 4UWBA 3FKOA 4DH8A 1OIQA 4AGUA 4H1JA 2R3QA 3TKHA 2WTIA 3QL8A 5IUGA 3W2OA 3MVMA 4RT7A 5A4LA 2IG7A 3DJ5A 4RG0A 4N57A 3ANQA 4JIKA 2YIWA 4I6FA 3ZSHA 3SLSA 3PA4A 2IO6A 2WD1A 3EN6A 3TZ7A 4IM0A 4M69A 3DAKA 3TIYA 2ERKA 3COMA 4YJVA 5FTQA 3U8WA 3DFCB 4FA2A 2R7IA 5IEXA 3FHIA 1OIRA 2R3RA 2PVKA 2PE0A 3DOGA 4KSPA 4NIFA 4ZZMA 5E92A 4JBOA 3D5UA 2C4GA 5HD7A 4AZSA 3QX2A 4P2KA 3G6GA 3G90X 1AD5A 3Q4CA 4PTGA 4QQ5A 3FQEA 4EONA 4CG8A 2XM9A 4BIBA 2WTKB 3PXYA 4OTQA 2FA2A 4EI4A 4GS6A 3UC4A 4IFGA 4CFMA 3PXZA 2UZEA 3CKXA 4GRBA 5IG1A 2VWYA 4A9UA 4LRKA 3NAXA 5FEQA 3GCVA 4FV4A 2Z7SA 4II5A 3ACKA 4FL1A 1LPUA 4C3PA 3MPTA 2R3HA 5CF4A 3FSFA 3WF5A 2VTLA 3TNHA 5L8LA 4NYEA 5C9CA 2J2IB 4I23A 4BCPA 3CD3A 5BUJA 4BWKA 5HIBA 2GNLA 3VUIA 4AA5A 2VO3A 5A6NA 5HVKA 2I40A 2DWBA 4FTUA 3VBTA 5IH4A 3MH1A 1R0EA 5JFSA 2GHMA 2FGIA 2ZAZA 4NWMA 4QTAA 2ETKA 1ZXEA 3P7CA 5TOZA 4C36A 2VTPA 3PE1A 4FV1A 4V04A 2LAVA 3WZDA 3FUPA 3AC3A 4AOJA 4CG9A 4IHPA 4I22A 4Y5QA 3IW7A 3GCUA 3E8CA 3QWJA 3UGCA 4RX8A 4ZY4A 3FC2A 3VW6A 1QPDA 4A4OA 3QGYA 3QTRA 3ZFXA 1J7LA 5HE0A 5IUHA 1U54A 3PVGA 1O6YA 1YRPA 2VTNA 3E8NA 4E4XA 1OGUA 3LZBA 4RWIA 1W8CA 4AZTA 4H3PA 3NYVA 4FI1A 3MA6A 3SW4A 2GNGA 3QLFA 5HLWA 3VF8A 2B1PA 3VQHA 1F5QA 3FC1X 3G2FA 4BC6A 4I5HA 2ZMCA 4BDKA 5DFPA 1R78A 4GL9A 4DEAA 5TT7A 2P55A 2JIIA 1NXKA 1OZ1A 4IBMA 3ZU7A 1PXIA 1XQZA 4M3QA 4KUJA 5EOLA 2WKMA 4L43A 3R6XA 2VD5A 3PG3A 4J53A 4NFMA 3PPKA 4PWNA 3CP9A 4AACA 3MIAA 3LJ2A 2QC6A 3TUDA 3OFMA 4I5PA 5CF8A 4RIXA 3ZO4A 2WMUA 3EQDA 2XKDA 3T3UA 4APCA 3DBFA 2BRBA 3K5VA 4NU1A 4L45A 2IZSA 2VNYA 3LE6A 5DRDA 1GZ8A 5J9ZA 2GHGA 4NM3A 4IZYA 3P7BA 2H8HA 4PX6A 4D0WA 1Q8UA 3ZO3A 2XJ2A 2GS6A 2WZJA 3FL5A 2XK8A 4GYIA 5D12A 3EFWA 4OBOA 4UB7A 1H24A 1OM1A 5CZIA 5ANOA 4MNEB 1UU7A 3C4CA 5D10A 3TN8A 3VS2A 2C0OA 4YSMA 2VTMA 3UZTA 2E9OA 5C26A 3DJ7A 4NL0A 3F88A 4UMPA 3FI2A 2EXEA 3GXLA 2YDIA 1FVVA 4O7TA 2OSCA 2B9IA 4WNPA 2C1BA 2WPAA 4Y73A 3FXZA 3GUBA 3NW7A 2HK5A 4FV0A 4PL5A 1XBBA 4U40A 5I9YA 3PY1A 4K77A 4KKEA 5D9HA 4C35A 3BX5A 3EZVA 3LMGA 4ZSGA 2YLEA 3CIKA 4R77A 1H27A 4XOZA 1IRKA 4HGTA 5AUXA 3T8OA 4ZJVA 3Q60A 5HTCA 2GS7A 4FSZA 3AMAA 4EJ7A 5FM3A 4MBIA 5J9LA 3W2RA 4W4WA 2OZAA 5K9IA 1CTPE 1ZYCA 3PSBA 5EYCA 3ULZA 4Z7GA 4IAIA 3F9NA 3DT1A 4MX9A 3VS6A 2HZNA 2OKRA 4F65A 1VEBA 3RCJA 2BILB 1URCA 3L1SA 4FYNA 5FM2A 2PVFA 4JBQA 2QOCA 5K4JA 4O7LA 5EQYA 3AT4A 5I9WA 5KKRC 4ZK5A 2HELA 4EOSA 2WMQA 3REPA 2BZKB 2Y4IC 4XP2A 4Z9LA 3V8TA 4I1ZA 5M4CA 4ZIMA 1FMKA 2Y8OA 4Y72A 4ANLA 3ZH8A 5CNNA 5AUUA 2OJ9A 3D14A 2C5XA 2ITYA 3MBLA 1PJKA 3A60A 4GK4A 4OTGA 2B9FA 4EZ5A 2CGUA 4V0GA 4DEHA 5TR6A 3UNKA 3ETAA 2YN8A 3IG7A 1WVWA 4UBAA 4M69B 4C59A 4O22A 4MCVA 3V5TA 4PTEA 1UU9A 3GI3A 3K3IA 3OS3A 4UYAA 2FSMX 2PZPA 4JI9A 5A14A 3VUGA 4FE2A 2OJJA 2X7OA 2A27A 2WQNA 3PVBA 4QMMA 1O6KA 2QG7A 4BZDA 3G9LX 1H08A 4TNBA 3V8WA 4B4LA 4IJ9A 5C4LA 1OITA 4FTQA 4NM7A 1P14A 3F3WA 3G5DA 4CSVA 4WBOA 2C30A 3Q32A 5AX9A 3QKKA 4OAVB 5DMZA 4WNOA 4BR3A 5C8KA 5AV3A 3O7LB 2QD9A 3ZONA 4CZTA 3UP2A 5LXMA 1LR4A 4FSNA 5CNOA 3KCFA 3UO6A 3CTQA 4RQVA 3QHRA 4ZJIA 5EI2A 3QUPA 5K0KA 5J95A 3ACJA 4H39A 3KRRA 4EOOA 3ZFMA 3OY1A 2OIDA 4ID7A 2P2IA 2EU9A 1U59A 3QAME 2JDRA 4QMPA 4AGDA 4K18A 3EYHA 3H3CA 3ORZA 4N6ZA 5HE1A 3RK5A 1XWSA 5FTGA 3P79A 3QZFA 3R02A 2YDKA 4BI0A 4JVGA 2QKRA 3BBWA 2C6DA 3TEIA 3GT8A 5HIEA 3LCDA 5EM6A 3KKVA 2OGVA 3FMMA 3ELJA 1KE7A 3PJCA 5AP2A 1YXVA 3W33A 4DEDA 4C2WA 4EOIA 4C4GA 3C5UA 3H9RA 1OB3A 3G51A 4ITJA 4LYNA 3RZFA 2CGWA 5CF6A 3QRKA 4M14A 4PPBA 3VRZA 4JNWA 3UVQA 4HW7A 1NW1A 1XBCA 4LGDA 2RFSA 5LARA 3HECA 5I9ZA 3OCTA 4IM3A 4S34A 3H9FA 4YLKA 4D28A 5J5TA 3FZSA 1YWNA 5I4NA 1OL2A 1H1RA 4JX7A 4DG2E 2WEVA 3LLAA 3OEZA 2FSOX 4RX5A 1Q24A 4O0XA 4E26A 2WNTA 4E6DA 4K33A 3E87A 5CSHA 3FMJA 4TYHA 1BMKA 4O86A 1XH6A 4RIXB 5CU0A 4EH9A 1FVTA 3A8WA 3SXFA 2I0YA 5L2WA 4M12A 4KBAA 4EOMA 1F0QA 4E5WA 3U6HA 3WIGA 3QUEA 3KMMA 5JFWA 3FE3A 2O63A 3VS4A 1PRYA 2OFUA 4TYEA 4AFEA 4E4MA 3CE3A 5IQAA 5FXRA 4KIKB 2YM8A 2AC5A 1J91A 3GCQA 3R28A 4ZLYA 4FT5A 4MWIA 4I5MA 1ZZ2A 4YGAA 4XYFA 1IAHA 3AC1A 3DK7A 2FO0A 3PA5A 5TE0A 4R3RA 4D1SA 2IJMA 2F4JA 2OH0E 2X7FA 5H3QA 4IH8A 2PHKA 3QHWA 2XRUA 3SRVB 3Q3BA 3QTXA 4F1OA 1UA2A 2QHNA 1K9AA 5HBHA 1KV2A 3BI6A 4O0YA 4ZSAA 3COHA 3MB6A 2HZ4A 3I81A 3RAWA 3L8SA 3KXGA 3FQHA 3TZ9A 5CT0A 3HGKA 3LQ8A 3QRTA 4IACA 4HGEA 2CGVA 3R9RA 2VX3A 2P2HA 2XK4A 4BKJA 2V55A 2OICA 5H8EA 3EL8A 1UU3A 2QOKA 2XYNA 3GU6A 1JLUE 4GVJA 4X3JA 4IAKA 3JXWA 4ASXA 1QPCA 3Q6UA 4D2TA 2ETRA 3LAUA 4WG5A 2X8IA 3NSZA 4TPTA 3Q9YA 5EYKA 3GOPA 2G2FA 1YXXA 5L6WL 4K9YA 3HVCA 3TNIA 4GCJA 3EOCA 4EK8A 1OECA 1T45A 3LFNA 3OD6X 4RC3A 3B8QA 3T9IA 4HVGA 3L8PA 1QCFA 3SA0A 4L01A 1H0WA 3EQPA 4QQJA 4ZZOA 4KINA 4JR7A 5B2KA 2XF0A 1YDSE 3QRIA 2PZYA 2YITA 4GIHA 4BTKA 5BMSA 3ATSA 4O38A 1OUKA 4AW5A 3ORMA 4HCVA 4YNEA 2H6DA 4MYGA 2G1TA 3FXWA 5JGBA 3O8TA 2Y0AA 5ACBC 3O17A 1ZOHA 5LVOA 3MFSA 3R9OA 4EYJA 3NNWA 2PL0A 5CVFA 4FTNA 1Y8YA 3BWFA 4F63A 4GKIA 5HBJA 4FEQA 4JAJA 3BQRA 4I0SA 4Y83A 4QOXA 4DGMA 4WNMA 3E93A 2NNWB 2Y6OA 4HPUE 1K3AA 4O0SA 1W83A 5I5ZA 5FP6A 1JSUA 5CSPA 2G9XA 2J9MA 2PU8A 2H9VA 1SVGA 4W8DA 5A4QA 4DT9A 2H96A 1ZYSA 4GEOA 4QP6A 2NPQA 4DE4A 4USFA 5LJJA 1GIJA 3SW7A 2IVVA 4HVHA 3BGZA 2IVTA 3CJFA 2CCIA 3FMLA 4NFNA 1WVXA 4R5YA 3RKBA 3CEKA 4DH1A 2JD5A 1H25A 4C4IA 2YM4A 3VBQA 5LCKA 4WKQA 3LFEA 2XYUA 2J0KA 4L46A 5JMSA 1KUTA 2C68A 3QUDA 5EDQA 3V04A 4HZRA 2X0GA 3KRJA 2ITNA 3D7ZA 5HHWA 5EK7A 3NR9A 3W1FA 2OU7A 5AR5A 3MV5A 3PJ8A 3W8QA 4XG3A 3BHVA 3EZRA 5BVFA 3CY2A 3SXSA 3RK7A 4XP3A 4A4XA 3FZRA 1A48A 3NNUA 4BRXA 2FB8A 3QTQA 4GKHA 3MI9A 2PVYA 4KABA 2J0LA 5AEPA 2LGCA 4IMYA 4G6LA 2BTRA 1I09A 3H10A 4KWPA 4LV8A 3R01A 3KA0A 3WF8A 4NJ3A 2XRWA 2YWPA 1H07A 2WELA 3BLQA 5IISA 3RPVA 4NTSA 1BLXA 3MY0A 2JDOA 2QLUA 4KD1A 2C6IA 3VULA 4EKLA 4KKHA 4HZSA 3VS3A 1X8BA 3A7HA 1PKGA 2Z60A 3EFKA 4D2RA 1MRVA 2YHVA 4GV1A 4OBQA 5GNKA 2FH9A 1URWA 3CGFA 2G01A 4FBXA 4KSQA 2YAAA 3HMPA 3IGOA 4XBRA 5IKWA 3WE4A 4C33A 5DLSA 4EOPA 3B8RA 4UEUA 4RFMA 3UDBA 1QMZA 2ONLA 3TZMA 5G6VA 4G3DA 4ALVA 2XM8A 3BU6A 4IADA 5A4EA 3SAYA 4KIPA 2PE1A 3P23A 4HOKA 4XEYA 3DS6A 3LQ5A 4BDJA 2GFCA 4UXQA 5AADA 5BX0A 4CCBA 3MA3A 4I6HA 3KXXA 3VQUA 3JY9A 2WMRA 1Q5KA 3NYXA 5K5XA 3FLYA 3G0FA 4YTIA 5K4IA 2JC6A 4O82A 4PUZA 5DN3A 5E8VA 3ZMMA 3Q9ZA 3CBLA 3AGLA 4ACGA 5DBXA 2Y4PA 4PY1A 3I6WA 5L2TA 5HX8A 3AD5A 4AUAA 2HY81 2JFLA 1KV1A 3F2NA 5HE2A 1IA9A 4IFCA 4YPSA 4ITHA 2QO2A 5CY3A 3UQGA 3FZPA 4RMZA 4JDKA 4RFYA 2E2BA 3ORKA 4RX9A 4IIRA 5HGIA 3R7GA 3K2LA 4FG9A 2V62A 3H9OA 4RVLA 5E8SA 2QU5A 2R3IA 1CSNA 3ZRLA 5KMNA 4WOVA 4PMPA 3NUAA 5DNRA 3WILA 4CFUA 1JQHA 4CFWA 1B39A 3NYOA 5K0XA 5GJFA 4AW2A 2KTYA 3R2YA 4FG7A 4ZTQA 4D9UA 2J7TA 4UWCA 3W18A 4K1BA 4U42A 2WTVA 4FNWA 1XO2B 3HRFA 3ORXA 2PTKA 3WYYA 2R0UA 4D4VA 4O81A 4MQ2A 5CAUA 1ZWSA 5LCJA 4XG2A 1H01A 4IX3A 4FYOA 3DGKA 2V7AA 1ND4A 3DBQA 2W05A 4FUYA 4OTRA 2XB7A 3UYSA 3O8UA 3RTPA 3FWQA 4JRVA 4ZEGA 4XLIA 2YM3A 4YBKA 4DEEA 4FL3A 4YZDA 3EWHA 3PPZA 3VHKA 4BZOA 4YJOA 4Z3VA 4U80A 4RJ3A 1J1CA 4HYSA 3NVKI 4GFOA 3V6RA 3GEQA 5HTBA 4I6BA 4F6UA 2GSFA 4FZ7A 3UG2A 2HENA 3NRMA 4XHKB 4CCUA 3RPOA 3BV2A 4IAFA 4M13A 3ZXZA 3Q4ZA 4DTAA 1M17A 4U9AA 2AC3A 3UOHA 4E20A 2BR1A 2PVMA 3QZGA 4WUNA 3QRUA 5CI6A 4H3BA 3F3VA 4KNBA 3JYAA 2FSLX 4YC6A 5BNJA 2ITXA 5ICPA 3DK3A 1KE5A 1ZAOA 2W1EA 3N51A 4YC3A 5T6KA 3LXLA 3O71A 2PWLA 2CKOA 2UZVA 4PMSA 3LQ3A 5HIDA 3R30A 1H4LA 3EKKA 3DA6A 5A9UA 4I20A 4KS8A 2I1MA 5CSVA 3HMMA 2WMBA 4YNOA 4RQKA 1GZKA 4TTHB 4CQGA 5JZNA 4IX5A 5IA1A 5ITAA 4CLIA 4NZWB 2X4ZA 4FIJA 3FYKX 4TWPA 4OTFA 5JRQA 1PYEA 3L9NA 4FUXA 4J8MA 1TKIA 3VVHA 4A9SA 4BBMA 5L2IA 3D5WA 1CDKA 1GZNA 1PXKA 3C4ZA 3QGWA 4XG4A 4D58A 5HNIX 1R3CA 2WQOA 4QMNA 4ANSA 4FIHA 4ZOGA 4AW1A 5L8KA 1KOBA 4USDA 3R0TA 5A46A 4YJQA 4P90A 4G6NA 1Y6AA 1XH7A 3A7JA 3P0MA 3VIDA 4ALUA 4YR8A 4MXYA 3D2KA 4WUAA 4FC0A 3BHYA 3S0OA 2W1CA 4PRJA 3I79A 4DFLA 3QTWA 2B7AA 3F2AA 4MQ1A 4QD6A 1O9UA 2VTIA 4RWJA 3NUXA 1Q3WA 3FLWA 4IZ5A 4G5PA 4HYIA 3K5UA 4TN6A 1CM8A 4ACHA 4YTCA 3CQUA 3R7UA 2ITUA 3ZTXA 3ZUVA 3HZTA 1U4DA 3LJ0A 3QBNA 4AT3A 4MEDA 4MXXA 4HVSA 5KUPA 4E3CA 3CCNA 3K54A 2YIRA 3EQBA 3OW4A 5D7AA 2VTSA 4O6EA 5KMOA 1OPLA 1PXJA 2REIA 1JVPP 1WBPA 4BB4A 1UNGA 2QLQA 4BKYA 2XH5A 4QPAA 4FKWA 3G9NA 3ALOA 5AUZA 3DLSA 2GQRA 1YDTE 2HIWA 3ZRKA 5F4NA 4C38A 1BL6A 3TNWA 3EMGA 4BYIA 1Q41A 2QOQA 4EH7A 1FQ1B 1XH4A 2HWOA 3RHXA 1FGKA 5DOSA 5JN2A 1WVYA 3KCKA 2OBJA 4XJ0A 1OL1A 2VV9A 3IQ7A 3FMDA 4X6QC 4D1XA 3CTJA 3D94A 2CLQA 2B52A 4JLCA 3PZHA 3RAKA 4AW0A 3EHAA 2XNMA 3FLZA 2XMYA 5DT3A 5B0XA 3V5JA 5IQFA 4KAOA 1BL7A 3HRCA 4C57A 1OVEA 1W7HA 2BFXA 2JIVA 3IW8A 4B99A 2QQ7A 3QQHA 1IA8A 4CTBA 1PKDA 5M4IA 4DT8A 2WQBA 4N4SA 4NJDA 3C0HA 5AM7A 3QF9A 4G3CA 4ZS0A 4A4LA 5HVJA 3ZS5A 3EQIA 3I1AA 1ZY5A 2KULA 4AFJA 3MVHA 4UMQA 5KKRB 3HLLA 2OF4A 3FQSA 3R21A 3LJ1A 4L6QA 2W1DA 3P1AA 3CSVA 1WBNA 1YOMA 2XIYA 4ENYA 2HZ0A 3PWYA 4EH8A 3VS7A 3DNDA 2IVUA 3TI1A 4YMJA 1XH8A 4FSUA 4BVUA 3E88A 5AMNA 3UC3A 3FKNA 1ZOGA 2OO8X 2BIKB 1XHAA 4CRSA 5L3AA 4ZTHA 1H1SA 3NNVA 3UPXA 4O83A 4RJ7A 4O2ZA 5CASA 4GMYA 3P4KA 3KGAA 4EOJA 4K2RA 5IQHA 5TF9A 3NS9A 4UZHA 4IAAA 2C0TA 4LOQA 4DGNA 4IXPA 1ZRZA 2RF9A 4DEBA 3N4UA 1J7IA 1V0PA 2VRXA 3DY7A 3R1YA 4AT4A 4YHJA 5E7RA 2GFSA 1H00A 2OW3A 4XUFA 4IVDA 2QOBA 4DYMA 3BHUA 2JIUA 1MQ4A 5DHJA 4EK3A 2JAVA 1B38A 5IQIA 1YXSA 4X21A 5KE0A 3ZM4A 3FSKA 4E5AX 1U5RA 2YACA 3U51A 3O23A 2XIRA 4FKGA 4M97A 4DFZE 3POOA 3Q9WA 4JDJA 1HCKA 4NW5A 2BDJA 3PLSA 3QYWA 4QT1A 2JKKA 4CYIA 1V0OA 2W4JA 1MUOA 2ZMDA 3O96A 1PMEA 2JDSA 2VTHA 3BPRA 4GUEA 4MXAA 3WZKA 4BICA 4F9BA 1BI7A 1J1BA 4QO9A 4C8BA 3FHRA 4M84A 1ATPE 4IEBA 4YTHA 4F70A 2OLCA 4FEWA 5IQEA 2ITOA 4NUSA 3TV7A 4KRCA 4DH3A 3HV5A 1Q8TA 2WOUA 4QYGA 4B8LA 4BGGA 4M68A 2CKPA 4LL5A 5F9EA 2OJFE 3RJCA 2BROA 2CHLA 5FG8A 3QRJA 2GS2A 4QP3A 1OL6A 2OXDA 4JDIA 4QTBA 4E6AA 1UNHA 3M1SA 1R0PA 2J5EA 3RCDA 4AZFA 5FEDA 2VX0A 5T68A 3NCZA 3VO3A 3CLYA 3HP2A 1FGIA 2R2PA 5J79A 3R8UA 5BVNA 5L4QA 1XBAA 5DI1A 2XNEA 3MPAA 2PVHA 5AIRA 3TKIA 1GJOA 4H05A 4PDYA 2CPKE 4X3FB 5EH0A 3Q4UA 3MH0A 3TTIA 4O0RA 2QODA 5JZJA 3PRIA 5DR2A 5B2MA 3WARA 3R83A 3OWJA 3QZIA 4G1WA 2G2IA 3ZZWA 4ZLZA 1BKXA 3OHTA 2ZYBA 1H0VA 2J50A 2UVZA 4X2FA 2WGJA 3LHJA 4ANMA 2ZDTA 2VO7A 4JG7A 3UVRA 3VWAA 4EC8A 4OW8A 2Z7RA 4FIIA 3BHHA 3OOMA 2B9JA 3FPMA 4LGGA 3CQWA 3MTLA 3KN5A 1IR3A 3PP1A 5LMKA 4KIKA 3MVJA 4J97A 1WMKA 3ODZX 3GFEA 4YURA 4FTIA 4K6ZA 4MKCA 2PUIA 3KULB 2WAJA 1P5EA 4MBJA 5CAPA 3EN5A 2VTRA 2WXVA 2O65A 3ORTA 4QP1A 3SRVA 2QR7A 4WBBB 2YZLA 2W99B 4TXCA 5AR4A 3HNGA 3KN6A 2WTCA 2BCJA 3G15A 2WQMA 2HAKA 4DN5A 1Q8YA 4GIIA 4UX9A 2X39A 3OF0A 3EH9A 3TJDA 4JJRA 1A9UA 2UZNA 3UMXA 5LWMA 1JKLA 5DH3A 4BIEA 4XH6A 3NGAA 4QYFA 2IZUA 2W4OA 4LG4A 5AV2A 5IZFA 3V5PA 4MBLA 4UMTA 4WIHA 5AR3A 4M0YA 3U9NA 4UY9A 2R9SA 2VO0A 2HY0A 5A54A 4OR5A 5C4KA 5AP4A 4RIYB 3SVVA 5LWNA 3BYSA 3CY3A 1OKWA 2XEYA 3EYGA 3R73A 3O2MA 3E62A 4V01A 4HVIA 2PULA 4L3PA 3ZO1A 4JRNA 4U45A 1SNXA 4H58A 1YI3A 3NUYA 2F49A 3DU8A 4MXOA 2JBOA 5LMAA 3VRYA 5JQ8A 4E1ZA 3IOPA 1YKRA 3AC2A 3AC4A 3PTGA 4J71A 4ANNA 1OPJA 1ZYDA 4CYJA 3WIKA 5JGAA 4RIOA 4LMNA 4FT7A 2GNJA 3PSCA 4FMQA 4BGQA 3D5VA 2VWBA 3ALNA 4CVAA 5M51A 4IWDA 1YXTA 1UU8A 5HOAA 5HQ0A 4E4LA 1ZMVA 3AT3A 4O21A 4BDIA 4XRLA 4BGHA 4NSTA 5M08A 3Q04A 3LXNA 4QMTA 4FGBA 5AIKA 3A4OX 3II5A 2QNJA 3DAJA 4WD5A 3FZOA 4L00A 5HCZA 2UV2A 2Q0BA 3OCSA 3G0EA 3MFUA 1BYGA 4IE9A 4OTIA 3W55A 4EZ7A 3RI1A 3F66A 3SV0A 1LP4A 3PA3A 2WTKC 5AUYA 3NUPA 3VUKA 2J0JA 3VHEA 3BZ3A 3OMVA 3MJ1A 1KE6A 5AAFA 3SG9A 4F9WA 4EOLA 5J9YA 3S4QA 2BIYA 2ZM1A 4QMSA 4ACMA 2YFXA 4OT5A 3R1SA 5FWKK 4CT2A 2GDOA 2OJGA 3GNIB 4OTWA 4BWPA 3OY3A 4AN9A 2C6KA 4NH1A 3KL8A 2WMVA 5AV0A 3GU8A 4M15A 3OTUA 1Q3DA 4K0YA 4QNYA 3NWWA 1Y6BA 4LQMA 4ZTSA 4BCGA 2YA9A 4ZY5A 1TQMA 4RVMA 4TY1A 4M7IA 3VS0A 2DS1A 2QR8A 1Q97A 2WU6A 3Q6WA 5AP6A 2IPXA 3IK3A 4LFIA 4BDHA 5GJGA 1ZYJA 3UMWA 3VUTA 2VU3A 4TYGA 5K3YA 3OW3A 2EWAA 3BELA 2BVAA 3DTCA 2G15A 3I5ZA 3MS9A 4XP0A 5E90A 4DLIA 3MWUA 3DBCA 4R1VA 2F7EE 2WMTA 2DQ7X 4E6QA 2XNOA 3GB2A 3PP0A 3VS5A 4IX4A 1KWPA 2VWIA 3MFTA 2W1IA 4FT3A 3PFQA 2WIHA 5FQDC 3R7OA 2XJ1A 2GTNA 1U5QA 2OG8A 5AWMA 4FKUA 1Z57A 5HG5A 3ZC5A 4CZYB 3RMFA 3RVGA 4FKVA 3ZRMA 5I0BA 4F9YA 5KBRA 3FY0A 3GGFA 3RK9A 1SMHA 4P4CA 5HNGA 4EH4A 2BRMA 4FSQA 4DHFA 2X81A 3FZ1A 4JQ7A 5CWZA 3U6JA 4C02A 1M7NA 2C3IB 2QOFA 4C34A 3PWDA 4JT3A 4KIOA 1HOWA 4RVTA 4W8EA 4EHEA 5HX6A 1PXPA 3IDCA 4R78A 3TZ8A 4ZJJA 4PMTA 4I4FA 4J96A 4JG8A 3CR0A 3PYYA 5FRIA 4GK2A 5J7HA 3BCEA 5L8JA 4D0XA 2WIPA 3AMBA 4BTMA 5CAOA 4CFXA 1TQPA 4R7IA 4AGWA 5E9EA 2C0IA 2IN6A 5G1XA 4F7JA 4JX3A 3C4XA 4CQEA 4ASDA 1E9HA 4J1RA 4EK4A 2BAKA 3A4PA 4TYJA 3U55A 4NKSA 3R7YA 1TQIA 5I9XA 2F2UA 4L44A 4C4FA 3O51A 2BMCA 3HMOA 2W0JA 4RIWA 4WA9A 1L3RE 3UBDA 4EOKA 4W4XA 5FXSA 1LEWA 3OG7A 5CVGA 1YHVA 4FZAB 2WTWA 3HRBA 4YJUA 3ZLXA 4TKSA 5IA4A 1UKHA 4G9CA 4DTKA 4R1YA 5B7VA 3L8VA 5M09A 5LVPA 5J1VA 4QMZA 5ANKA 2ITQA 4AE6A 4FIGA 4A9TA 5TO8A 2W17A 2PMLX 5DR9A 4O7YA 4XLVA 3ROYA 3LXKA 4M8TA 1AGWA 3Q2JA 4AP7A 3NX8A 4I6QA 3KFAA 4X2JA 4L53A 4XX9A 3O8PA 4E4NA 4CMTA 5DT0A 4C4JA 5M57A 3GU5A 3LM0A 4ITIA 2XP2A 2YJRA 3DK6A 4RLLA 3RAIA 4X7QA 2I7QA 2DUVA 4BCQA 3ZDUA 4FTKA 4PNIA 1XR1A 1OKVA 3BE2A 4DCEA 4XV9A 2XCKA 5HLNA 1G3NA 3MB7A 1G5SA 2Q83A 4G17A 3ZCLA 2FSTX 4L68A 3UVPA 3QCYA 4BCKA 3OOGA 4EBWA 1UWJA 3DJ6A 1PY5A 4CFNA 1KE8A 2XS0A 3OWLA 3Q4TA 3W2SA 2XKCA 3TV6A 2YDJA 4O0WA 4BHZA 3KREA 3PZEA 3NVMB 2BZJA 1YQJA 2RFDA 4BTJA 3RINA 1OL5A 4FKSA 3SQQA 2B0QA 2Z8CA 3FBVA 3V5WA 3IO7A 5EDPA 4DH7A 4FVPA 3ZOSA 4CT1A 5LVNA 2R5TA 3A99A 4BCNA 5BPYA 2PSQA 2R3JA 3HAVA 1UWHA 4AN3A 4BTFA 4CLJA 3IOKA 5IA2A 4F7NA 2QOOA 2ZV7A 3Q5IA 1P2AA 3E8DA 3S3IA 4QTEA 1WBOA 1DM2A 1M2RA 3I60A 5F94A 4F0FA 5H8BA 3KK9A 3DDPA 2HW6A 2F7XE 4YZNA 4ANBA 3E3PA 1Q8ZA 2B54A 3LFFA 4IWOA 4TRLA 1ZY4A 5C8MA 5KHXA 5DYJA 2XA4A 5EW9A 4EH3A 3TACA 2ITZA 4PTCA 4DC2A 5L6PA 4GJ2A 2C5OA 4X2KA 3VBYA 4GT4A 2R64A 5A4TA 3CTHA 3OEFX 1FVRA 3NUSA 3DTWA 4QMUA 5D11A 5EM5A 4LUDA 3ODYX 5KBQA 3DKOA 4IM2A 1RQQA 3OUNB 4YTFA 5J7BA 4QMOA 4O7SA 4YLJA 3P78A 1JBPE 1REJA 2R3KA 4RX7A 1G8AA 3DAEA 5H2UA 2XJ0A 4WG4A 4D4SA 1TVOA 4A7CA 5ANJA 3G6HA 4BF2A 3MVLA 1YWVA 4I0RA 4JQEA 4QNAA 3ZDIA 3NW5A 3RPYA 1Q4LA 4I5CA 3C7QA 4B9DA 3BLHA 3DZOA 5EG3A 3DZQA 3UZPA 4NCTA 2ITVA 2UW0A 2XZSA 2PE2A 2Y6MA 2XBAA 3Q96A 4KB8A 2C6EA 2CJMA 4EK5A 4YZMA 3DB6A 1PMNA 1JSTA 4IJPA 5GZAA 1VYZA 4FNYA 4QRCA 2ZDUA 3GVUA 3ZEPA 1REKA 4FKTA 4TWOA 3VNTA 1K2PA 2C6MA 3VC4A 3NIZA 4CD0A 5HLPA 3PDTA 2QURA 4FIEA 4G6OA 3VAPA 4JL9A 5BVDA 5HZNA 4FX3A 5AP0A 3ZZEA 5HCXA 4DFBA 5IF1A 1U46A 3LKMA 5HKMA 4MVFA 1WBVA 4EJNA 1Q8WA 5FD2A 4TL0A 4GK3A 4FICA 4DTBA 3MESA 2VWUA 4TZRA 3QTZA 4YJNA 4RZVA 3OCGA 3R22A 1KE9A 4PV0A 1RJBA 3LOKA 4KA3A 2YIYA 1OBDA 3ZXTA 2C47A 3FXXA 4U7ZA 1ZYLA 1JKTA 3ATTA 4QYEA 2BUJA 4EHGA 4QTCA 3P7AA 3SKCA 2CMWA 4R3PA 4D5HA 2XKEA 1OPKA 4AWIA 4Q9SA 3SC1A 2VWZA 1CKIA 2X6DA 2J5FA 3FL4A 3HUCA 3QTSA 4RZWA 5JQ5A 2B4SB 3NAYA 4CV9A 4P5QA 2I6LA 3OWPA 5ETFA 3SOAA 4C4EA 3IECA 3EQCA 4YZCA 2J90A 3OC1A 4RIWB 4TWNA 5LVMA 1LEZA 3R04A 2PMOX 2VGOA 4QP7A 1QL6A 3HL7A 5L6OA 3VUHA 4FZ6A 3BLRA 5AA8A 1PYXA 3BYUA 2W06A 3UOLA 3DXPA 2CN5A 4I3ZA 3DXNA 4UZDA 3BU5A 4AF3A 2PK9A 2Y9QA 3V8SA 4B0GA 5LMBA 4RC4A 1H8FA 4H3QA 1W84A 1V1KA 4N0SA 3V3VA 4USEA 2YCRA 4GVAA 1GIHA 4FK6A 2GQSA 4GW8A 3JR1A 4JAIA 5HG9A 3NEWA 2A19B 3WZEA 4UXLA 4BN1A 2XCHA 5KO1A 4YC8A 4YLLA 3HA8A 2XIKA 4E6CA 4BY9E 3PXFA 4F64A 1A06A 3LLTA 3BQCA 1XH9A 4F09A 4HPTE 2ZV2A 2YZAA 5GHVA 4RJ8A 5HCYA 4UMUA 3RNYA 4BIDA 2VN9A 2YEXA 4XS2A 2IW9A 4D9TA 2GPHA 5DWRA 1O6LA 3OTVA 2C6TA 1MP8A 3F3TA 5CQUA 5E1EA 4IC8A 4X6RA 4ZMFA 3H0ZA 4WRGA 3W2CA 4MD8E 4D2WA 4PDPA 3OT8A 5EI8A 4HJOA 4TWCA 3V01A 4MAOA 4QP2A 4R7HA 4U44A 3SD0A 2WB8A 5CEQA 2BHEA 3OCBA 4FL2A 4FVQA 5FLFA 5B2LA 4WSYA 2W1ZA 5DVRA 5CXHA 4CKJA 3BGPA 3RPSA 3R00A 5FDXA 4UV0A 2UW5A 4WG3A 3AD6A 3KQ7A 3C50A 5CEIA 5HVYA 3BWJA 3LFBA 1BUHA 5EM7A 4O27B 4GJ3A 4ZTLA 4FSYA 4GU6A 3CD8A 4FSRA 4CTCA 4CNHA 3JY0A 4F9AA 3R1NA 5KMLA 4ZLOA 3OXTA 2QVSE 4U79A 3ZYAA 5I3OA 4IB3A 2W1GA 3MY1A 3F69A 2Z2WA 4FKOA 3NPCA 2O5KA 5D1JA 5KNJA 5CT7A 4FV6A 1T46A 1GIIA 5DGZA 4EWHA 3OBJA 5EQEA 3OBGA 3FY2A 3E7VA 4MXCA 4QPMA 4X2GA 4ZP5A 3QD0A 3RWQA 3TTJA 3WYXA 2X1NA 4KBKA 5EYDA 3QQFA 4FKQA 4FOCA 1S9JA 1P4FA 2QU6A 3DKFA 4OTPA 4YJPA 3F61A 1GNGA 2A0CX 3BKBA 2R0IA 3P86A 4RLKA 4FKPA 5EW3A 3R8MA 5I3RA 2WMXA 1M2PA 1ZZLA 4X3FA 3VUDA 3ZLSA 3UP7A 3QTIA 2GU8A 2OI4X 4L9IA 3UODA 4DGOA 3AQVA 3D0EA 3F5XA 2P3GX 2UVYA 3UJGA 4YSJA 2EUFB 5J5SA 1JKKA 4A9RA 4IZAA 3QCQA 4RFZA 4MXZA 4QMXA 3W8LA 3ZLYA 3SGCA 4AAAA 5K5NA 3MY5A 4CXAA 5BQ0A 4FTLA 5JH6A 3N4TA 2VTOA 3MPMA 4JIAA 5M07A 2OXYA 4EYMA 2QI8A 5IEYA 3ZSIA 1MRYA 3WBLA 4F0GA 4D2VA 2HYYA 4O7VA 1GAGA 4Y95A 3IDBA 4BDAA 2QOIA 2X9FA 4CZUA 1G8SA 1PMUA 2QO9A 3HEGA 3Q5ZA 3QA0A 5CXZA 1M2QA 3IW5A 5L2QA 3RAHA 3KULA 5BYLA 1Y91A 4M0ZA 3F6XA 2R3OA 4YZBA 1PMVA 3DQXA 5EHOA 2HXQA 3KRXA 2VZ6A 4IX6A 3A61A 5KMJA 4FV8A 1RE8A 3VS1A 4FKLA 5JKGA 3AC5A 4F9CA 5I9VA 5E8TA 5DPVA 4U41A 2YISA 3KEXA 1YI6A 4Z16A 3AXWA 1H26A 3A8XA 3GQIA 1ZARA 5C01A 2OXXA 1DS5A 5FBNC 4W9XA 3E63A 4FG8A 5C1QB 3M42A 3EFLA 5CSXA 4CKIA 4EWQA 3IGGA 4W4YA 2CNUA 4O1PA 4D2SA 5CEPA 3QXOA 2C6OA 3TM0A 3R1QA 3ZBXA 4XCUA 2PUUA 4ARKA 1DI8A 4JG6A 3BV3A 4RIYA 4U43A 3D2IA 4ZSLA 3FEGA 4J99A 1M14A 4I24A 3UG1A 3KRLA 5EYMA 4O6LA 2QOLA 3LCTA 3SDJA 4QMQA 5DIAA 3R9NA 1IG1A 4FIFA 4XOYA 5GINE 4BCMA 3TV4A 4EH2A 3UO4A 4BHNA 3QC9A 4RJ6A 5H9BA 5KHWA 4O0VA 2V5QA 3QD3A 3HP5A 5IA3A 2UZLA 2F7ZE 2IWIA 1H1PA 1STCE 3MN3A 2X6EA 4EZ3A 4QP8A 2BPMA 4LM5A 5CF5A 4EK6A 4OUCA 3FLNC 4FNZA 5FTOA 1OIYA 4ZAUA 2C3JA 3DNEA 1OBGA 3COKA 3DDQA 3R8VA 3EQFA 3DV3A 3WE8A 5CU2A 5EKNA 2CSNA 3O7LD 2E9NA 3C51A 3FKLA 4UMRA 5CU4A 2PUPA 4JQ8A 1NVSA 4FK3A 1ZMUA 4KS7A 2Y4IB 5AR7A 5T3QA 5AP3A 4FEVA 4BKZA 5IQBA 4G2FA 5DRBA 2WO6A 3N9XA 4IVBA 3FMNA 4MD9E 4F4PA 3LFDA 4RBLA 3ZC6A 2BALA 5HU3A 5CS6A 3NUUA 3KB7A 3NLBA 5IQGA 4QP9A 5E8WA 4EH6A 2HCKA 4C2VA 1DI9A 3F5PA 1YXUA 5E1SA 4IAZA 3VW8A 4DH5A 5KZIA 4O1OA 3W2QA 4AE9A 2VNWA 2X4FA 3E8EA 1OKYA 3V51A 3DKCA 5CI7A 4XG8A 4X2NA 2R3MA 1VYWA 4MF0A 5IA5A 4P5ZA 1SVEA 4HYUA 3QKLA 1DAYA 2E9UA 1ERKA 2NRUA 4F99A 2BDFA 3RNIA 4G5JA 3L9LA 3T9TA 5IH5A 2ITWA 3TDWA 3U9CA 3PLAE 3DCVA 1W82A 3HX4A 4AA4A 4RA5A 2ZB1A 3F3ZA 3FPQA 3EKNA 5IEVA 5IQCA 3TJCA 3COIA 2VX1A 2F2CB 4FZFB 3V5QA 3FI8A 2UW4A 4Y46A 4ONAA 5EQPA 2YABA 2JGZA 2VO6A 3QALE 1IAJA 1Z9XA 2IW8A 3VJOA 4FVRA 4AGCA 3NUNA 2BRNA 3JUHA 1HCLA 4RWLA 4ZS4A 4HVDA 5IA0A 1SM2A 1J3HA 4ASZA 2V7OA 4DG0E 4J95A 3KMUA 5DG5A 3PJ2A 4XV2A 2JKQA 4C0TA 3GFWA 5AM6A 5KMIA 5LVLA 2BAQA 2NO3A 4ENXA 4ACCA 3BEAA 3ZEWA 4F7LA 2WQEA 3B2TA 3VJNA 2XBJA 3ET7A 3IDPA 4FOBA 4JR3A 3H30A 4CV8A 3PIXA 4YHFA 3RHKA 4KIQA 2XK6A 3T3VA 2NRYA 2VAGA 3GC9A 3ORPA 1QPEA 4FV2A 2PZIA 2DYLA 5ANIA 4DBXA 2XEZA 3ITZA 4C58A 4CEGA 5CVHA 3DB8A 2C5NA 4C7TA 2W5HA 4PP7A 4IDTA 3QA8A 3JS2A 3A7FA 3QC4A 3KXMA 4FV9A 4ASEA 3QFVA 4OT6A 4IC7A 2HOGA 2R7BA 4NW6A 5IDNA 3QCXA 3V5LA 4NCTC 2UUEA 4PMMA 1DAWA 1APME 3QD2B 4ZTRA 5KMMA 2XNGA 3ORIA 3ZUUA 4DG3E 3U87A 2Z7QA 3B2WA 3CQEA 4TT7A 4L7SA 5ANDA 2YM6A 3HDMA 3JVRA 3L9MA 1OIUA 3BU3A 3LVPA 5FDPA 5M06A 1KOAA 3DKGA 2XNBA 3CXWA 4AA0A 3M2WA 3FMKA 3I7CA 4DCAA 2C5YA 3QQKA 2GQGA 4NM0A 3FAAA 4GFMA 5HO8A 5IMXA 2QOHA 2W1HA 4PDSA 3FZTA 4Q9ZA 3SX9A 2WTDA 3ZM9A 1EH4A 2W96B 2VWXA 3F7WA 3TNPC 4MK0A 3KC3A 3KU2A 2GNHA 3GC7A 3TT0A 4C4HA 4K8AA 3WF6A 2O0UA 1Z5MA 4JBPA 5JFVA 1YHSA 3KY2A 5ETCA 2ONLC 3A7GA 4L42A 5DE2A 5HEZA 2BTSA 4Y5HA 4NEUA 2UZBA 2QHMA 3PJ3A 4O0UA 3QQLA 4U81A 5BUIA 1PXNA 5KX8A 3U6IA 2C6LA 4C3FA 2GCDA 3FLSA 5DEYA 4XRJA 5AR2A 3SXRA 1NA7A 2O8YA 1JSVA 4HNIA 4L3JA 3PSDA 3TL8A 4D5KA 3HAMA 2Z02A 4DF3A 4IW0A 2CNVA 4BDGA 2EB3A 1FBNA 3AGMA 3R8ZA 5DT4A 4BZNA 5AFVA 4G34A 4N70A 1ZLTA 1YWRA 3VF9A 4BCFA 3HYHA 3GC8A 2JLDA 2XIZA 3I0OA 4LRMA 2H34A 5HI2A 3TUBA 4D1ZA 3OXZA 3Q52A 5ETIA 5AUTA 4XMOA 2EB2A 4BDDA 5A3XA 1SVHA 4AS0A 4DBNA 3JVSA 5CEMA 3MFRA 4MNFA 4FTMA 4YZ9A 1OMWA 2XKFA 5JK3A 4AQCA 4EBVA 1MQBA 3PY3A 3RZBA 1FPUA 2E9PA 3VN9A 5E8ZA 4APPA 2GNFA 4F08A 4U3YA 2AUHA 3K3JA 1H1QA 2FYSA 2VUWA 4G16A 4GT5A 3BYOA 4EQUA 2PPQA 4G3EA 3PIZA 2BHHA 3MTFA 3PY0A 3AD4A 4E73A 4ZSEA 4ACDA 4AU8A 2GMXA 4XV3A 3FJQE 1JNKA 1YHWA 3AG9A 4BDFA 3R2BA 4AN2A 5L2SA 4AOTA 2A2AA 3RBWA 2CKQA 3L8XA 1PHKA 1UNLA 4NIFB 3WI6A 4Z55A 2BRHA 3EJ1A 4I21A 4WSQA 3BYMA 3TNQB 1BX6A 3H0YA 4HGSA 4TW9A 5HG8A 5CENA 4J8NA 3QXPA 3QQGA 3GCPA 4AT5A 5AJQA 5HNBA 3MDYA 1VJYA 2ZVAA 3QYZA 3OP5A 5D7VA 4BBFA 4XV1A 3ID6C 4ZTNA 5FEEA 4G3FA 4UYNA 4F1MA 4XNEA 3C9WA 3V6SA 3O50A 3KXHA 4GH2A 4KBCA 4LL0A 4ERWA 3WZJA 5DA3A 1B6CB 3LMIA 2YJSA 4HCUA 2CCHA 2IZTA 4QP4A 4LI5A 2W9ZB 1FMOE 4IDVA 5EKOA 3E7OA 1VR2A 5HO6A 5J8IA 2J0IA 4DAWA 2PZ5A 2VWWA 4TNDA 4ERKA 3OXIA 3LCKA 3R7VA 3KVWA 3QKMA 5IDPA 1SNUA 5BYZA 4YPDA 5JT2A 2EVAA 2ITPA 3ZSGA 4YP8A 2PMNX 3IW6A 2RL5A 4EC9A 4HYHA 4G3GA 3BHTA 1MRUA 3S95A 3QX4A 5C27A 3RPRA 3HKOA 5FUTA 4QMLA 2WOTA 2OIQA 2BKZA 1UVRA 4E7WA 5IMEA 3F5GA 3R9DA 3R7IA 2WFYA 3F5UA 5BVOA 4FZDB 2R3NA 3FI4A 5M53A 4DA5A 4X3FC 1U54B 4E93A 2ZM4A 3NIEA 2JAMA 4YBJA 4YUQA 4AOIA 3E64A 3UPZA 3IONA 2OFVA 5AP1A 3PRFA 4B7TA 1GZOA 4EH5A 4FR4A 5AAGA 3C4WA 3ENHA 2PVRA 3LXPA 2X7GA 3EN4A 4AX8A 3KVXA 3P9JA 5F95A 1WBWA 2VTTA 5CZHA 3KMWA 2W9FB 5CU6A 3EQGA 4P7EA 5H8GA 3KK8A 5BMMA 5J1WA 2VWVA 4L67A 3TDVA 2JKOA 5GZ8A 4FSTA 4BCIA 4UWYA 2Q0NA 4S31A 3DPKA 4XG6A 3EFJA 5AV1A 2ZB0A 2CKEA 1JWHA 1I44A 3IPHA 4RJ5A 3PVWA 1Y57A 2PVJA 5IUIA 4S30A 5CAVA 5HORA 3MW1A 3I5NA 1SYKA 4QPSA 1CKJA 4KKGA 1YOLA 4DITA 3HA6A 1PXOA 4D2PA 2WTJA 5ANGA 2ACXA 2VGPA 4ORKA 1UV5A 1VZOA 2V22A 1FOTA 1ZOEA 3Q53A 4LOOA 3NMUF 2RKUA 2X8DA 4IAYA 2BZHB 5AV4A 2W4KA 3HV7A 4ZMEA 1RDQE 4DLJA 3JPVA 3C1XA 4PL4A 1W98A 2BAJA 4LMUA 4LRJA 4MD7E 2P33A 3G33A 4HCTA 4JS8A 4N6YA 4XBUA 2YWVA 3DXQA 2XK7A 5E4HA 3ZBFA 3UYTA 2OF2A 2P4IA 5ETAA 3QCSA 4CGAA 3PPJA 2VTJA 1M52A 3W16A 4I0TA 4RA4A 3ORLA 4AZEA 5KZ0A 3LMHA 3AOXA 4Y8DA 5JGDA 5AUWA 3GOKA 2JDVA 4AZWA 2O2UA 3MYGA 2C1AA 2GTMA 2WMSA 3A62A 4WO5A 3ULIA 3TUCA 3F7ZA 3R9HA 3A7IA 3UO5A 3UIMA 1GOLA 4W4VA 2IVSA 5HO7A 4FTRA 2OZAB 1YDRE 4H1MA 4QTDA 2QKWB 3PE2A 4EHZA 4R7BA 2XUUA 1JKSA 5LQFA 2B9HA 2I0VA 4NK9A 2V0DA 5EHYA 3IW4A 4IQ6A 4EORA 5CU3A 4IB0A 3LCOA 4MTAA 3Q9XA 1E1XA 4OTHA 2C69A 3CJGA 4CFFA 4OLIA 5A6OA 3AT2A 2J51A 2O3PA 2FVDA 4YJTA 3NCGA 3VBWA 2UZDA 4GFGA 4U97A 2W5AA 1F3MC 1XJDA 2YIXA 4DGLC 4YHTA 3RWPA 3WOWA 1CMKE 3EN7A 3F82A 3UIXA 4LUEA 4O7WA 4O96A 2UW6A 4PQNA 4QYHA 2UVXA 2JEDA 4OGRA 5AR8A 2I0HA 2XVDA 4J7BA 4E8AA 2Y7JA 3D7TA 4MF1A 4V0GB 3WF7A 3IKAA 4M66A 3MH3A 3C5IA 1YOJA 3OWKA 1OL7A 4EOQA 3MIYA 4FEXA 4GYGA 4CRLA 3E3BX 3PG1A 1GY3A 3FMHA 5DR6A 4I41A 2G2HA 3FYJX 1OI9A 2JDTA 2YCQA 5HTIA 4BL1A 5F20A 2CNQA 1QPJA 4L8MA 4BFMA 2CN8A 2JITA 1NVRA 3BRBA 5M55A 3RGFA 4Q2AA 3CPBA 3EN9A 5AUVA 4U8ZA 2BFYA 2UZOA 3LM5A 2OJIA 5IPJA 2UW8A 2AYPA 3NNXA 4Z7HA 4LGHA 4CKRA 1WFCA 3N4VA 1IEPA 3GBZA 2X2MA 3IS5A 5M56A 1NY3A 2R3PA 3UQCA 1Q99A 4FTTA 3MJ2A 2PYWA 4R5SA 2CDZA 4EUUA 3C0GA 4GG5A 5EI6A 2PUNA 1LUFA 4EUTA 4BYJA 3AMYA 4FSWA 3OROA 4QYYA 3UOKA 2BDWA 2RSVA 4FTOA 4NTTA 3HDNA 5GJDA 4L7FA 2PVNA 4O84A 3P08A 2A4LA 4DFNA 4U5JA 3PVUA 4IWQA 2RFNA 4G31A 4PPAA 2WU7A 2YERA 2OWBA 4PF4A 2YM7A 5CX9A 2ESMA 2X2LA 4FODA 3SOCA 3UOJA 3UQFA 2XNNA 4PNKA 4JOAA 4BCHA 3E5AA 3LIJA 4RGJA 2ZOQA 1Q61A 4W9WA 4YO6A 1V0BA 2RGPA 3NW6A 4ANQA 2UW3A 2ZM3A 2UZUE 4I94A 3W10A 4O91A 1PXLA 4IANA 3TWJA 3C4FA 3H4JA 4QQCA 3I7BA 5M4FA 5HE3A 2HXLA 4FKRA 2WMAA 1PF8A 4CFVA 3S1HA 5JEBA 2X8EA 2ZV8A 4QMWA 5HICA 3TKUA 3OZ6A 5E8XA 1J7UA 5DEWA 3SG8A 3TXOA 3UTOA 5EM8A 5CAQA 2C5VA 2QONA 3M11A 2VTQA 4FT0A 3U4WA 2CGXA 4NT4A 5EW8A 4A07A 4JBVA 5HU9A 5GIOE 1Q62A 4I92A 4NM5A 1WCCA 3EL7A 4O2PA 3PXQA 2UZWE 4C3RA 4K11A 1R39A 3WF9A 4FEUA 5LMKC 3QQJA 2R3GA 4IVCA 3U54A 3VBVA 5GIPE 4UALA 2ITTA 4RPVA 2YCSA 5I9UA 4PL3A 5D41A 4BDCA 3OT3A 3FMEA 2E9VA 2UZTA 2J0MB 4TYHB 3I4BA 5EHLA 2IW6A 4PP9A 3MGYA 2XIXA 4M67A 3Q2MA 4NKAA 4EQCA 3UNZA 1YI4A 4QMVA 4U0IA 2YAKA 4GG7A 3R7EA 4ZXTA 3TIZA 3PXRA 4PDOA 1XH5A 3RM6A 2QCSA 4RSSA 5CTPA 2OZOA 4CMUA 2QO7A 1E1VA 1L8TA 4G9RA 3D15A 2CLXA 2ETMA 2GHLA 2C3LA 4GUBA 4RRVA 2OIBA 2W5BA 4BCOA 3DFAA 4C61A 3DQWA 5AA9A 4GT3A 2WHBA 3LCSA 2W7XA 3PJ1A 3DLZA 2F9GA 3DBDA 3RM7A 5IU2A 2HWPA 2UW7A 5HBEA 2RG6A 2R4BA 4BI1A 5HG7A 3D9VA 4R3CA 5AP7A 3OVVA 3FV8A 4Y85A 3ZLWA 2HZIA 4A06A 4F1TA 1PW2A 2RIOA 3GQLA 4B6LA 5C8NA 4R6VA 4U6RA 3EB0A 3QTUA 3GP0A 3LFCA 2PY3A 3QLGA 3QWKA 4I4EA 2ZV9A 5E91A 2C3KA 4Q5EA 3UZRA 2J4ZA 4YU2A 5AX3A 4FSMA 2WEIA 3C0IA 4XG7A 5ANEA 3O0GA 4O7ZA 3EQHA 5KCVA 4YJRA 1OUYA 1PXMA 4RVKA 3ZFYA 3ZHPC 3ZO2A 5IH6A 3TG1A 4DFUA 3I0QA 3BYVA 3A2CA 3NDMA 4EHVA 4FNXA 4BWXA
chains in the Genus database with same CATH superfamily
3FDNA 2YLFA 4FKIA 1G8JA 3R8PA 3L9PA 4S2ZA 4D4RA 4FTCA 4H36A 4ZTMA 3D4QA 4ZY6A 3HV3A 3VONA 4AQKA 4J98A 4C62A 4F7SA 2HW7A 4X0MA 4IB5A 2QG5A 1M7QA 3FLQA 2EXCX 4V05A 3LFSA 3R8LA 3SHEA 2F57A 3W32A 3LFAA 5CEOA 5CLPA 3C13A 4GU9A 2IZRA 3C4EA 3GCSA 3QD4A 4FT9A 4F6WA 1H28A 1FINA 3KF7A 5BVEA 3D7TB 3UIUA 3R71A 3D5XA 4DGGA 3R63A 4E5BA 4F0IA 3E92A 4YJSA 5FBOA 3HV6A 4MHAA 2JBPA 3BBTB 3I6UA 4WRSA 4BDEA 2Z7LA 1ZMWA 3MSSA 5KMKA 2W1FA 3ROCA 4EEVA 2ZJWA 3BGQA 3ENMA 3HUBA 4RJ4A 4BI2A 4IVAA 4BBEA 3P5KA 4DFXE 4RWKA 3UDTA 4LOPA 3QQUA 5J87A 2R3FA 4HGLA 1R1WA 3ERKA 1KSWA 3U4UA 3D83A 4AZVA 2BRGA 5HESA 1W0XC 4JDHA 3GC0A 5BVKA 1XKKA 4L3LA 3THBA 5C03A 1Y8GA 2PZRA 3NZ0A 4OTDA 3UIBA 3DBEA 3F3UA 2P0CA 3F2RA 3W2PA 4IWPA 4QMYA 4WNKA 4S32A 1WZYA 2OH4A 3GU4A 5EDRA 3EQRA 1JPAA 4PPCA 1AQ1A 4EQMA 2NP8A 4BCJA 4DINA 4C37A 2JKMA 2J6MA 3PIYA 5CQWA 5CSWA 2PMIA 4UN0C 5M4UA 1JOWB 5E8YA 1SZMA 3BEGA 5BUEA 5M44A 4AXDA 3RALA 4JXFA 1YVJA 1UKIA 2OK1A 4BDBA 3PUFC 2EXMA 5A4CA 4FV5A 4ALWA 1YW2A 5BVWA 5JSMA 2BZIB 4U3ZA 4FV7A 3KF4A 2I0EA 2ERZE 2JFMA 5JRSA 2BKKA 3HMIA 4MH7A 3S2PA 5FP5A 3TCPA 2FUMA 1H1WA 2YIQA 3CS9A 5ACKA 3ZUTA 4QQTA 1WBSA 3FI3A 3HV4A 2VTAA 4DEGA 1WAKA 2B55A 3CKWA 4RC2A 5FXQA 3VUMA 3LW0A 4FTAA 3BIZA 1BI8A 3UNJA 4EKKA 4ZZNA 3PXKA 2SRCA 3LPBA 4AXAA 4CMOA 3MH2A 1CKPA 4A9YA 4OAUC 4DHZA 2RFEA 3OUKA 5CALA 2B53A 3BE9A 3GENA 5CEKA 1P4OA 1WBTA 4R8QA 1S9IA 3CGOA 3NYNA 3PUPA 4MNEA 3QZHA 4I93A 4IB1A 4AAYA 3S00A 4J52A 1JAMA 5GZ9A 4KRDA 1OKZA 5JFXA 1NVQA 3LFQA 2XNPA 4B8MA 5EFQA 2X2KA 4WT6A 5E8UA 4DEIA 4TYIA 4MWHA 4ANOA 2XK3A 2WMWA 2YM5A 4D4YA 2XK9A 3KRWA 4EL9A 4FV3A 5CANA 4HNFA 4Q5HA 2RG5A 2O64A 3ANRA 3UE4A 4O7RA 2A1AB 3RP9A 5FGKA 3QU0A 5IQDA 4AG8A 4FTJA 4GSBA 4DFYA 4IZ7A 4L52A 2YCFA 4S33A 5TKDA 3HMNA 4ZSJA 3CPCA 4FKJA 1NT2A 4YO4A 2R3LA 5AAEA 4OBPA 1IASA 3EIDA 4D55A 4FGRA 2PVLA 3POZA 5CYIA 4LV5A 5BYYA 5F1ZA 5HD4A 4O7NA 3ORNA 3KXZA 3GU7A 3CC6A 4FF8A 3WZUA 5AP5A 3AC8A 4WHZA 1RW8A 2GNIA 4XG9A 3VBXA 3KXNA 5LOHA 5EOBA 4F6SA 2UW9A 4O0TA 2X9EA 4UWBA 3FKOA 4DH8A 1OIQA 4AGUA 4H1JA 2R3QA 3TKHA 2WTIA 3QL8A 5IUGA 3W2OA 3MVMA 4RT7A 5A4LA 2IG7A 3DJ5A 4RG0A 4N57A 3ANQA 4JIKA 2YIWA 4I6FA 3ZSHA 3SLSA 3PA4A 2IO6A 2WD1A 3EN6A 3TZ7A 4IM0A 4M69A 3DAKA 3TIYA 2ERKA 3COMA 4YJVA 5FTQA 3U8WA 3DFCB 4FA2A 2R7IA 5IEXA 3FHIA 1OIRA 2R3RA 2PVKA 2PE0A 3DOGA 4KSPA 4NIFA 4ZZMA 5E92A 4JBOA 3D5UA 2C4GA 5HD7A 4AZSA 3QX2A 4P2KA 3G6GA 3G90X 1AD5A 3Q4CA 4PTGA 4QQ5A 3FQEA 4EONA 4CG8A 2XM9A 4BIBA 2WTKB 3PXYA 4OTQA 2FA2A 4EI4A 4GS6A 3UC4A 2XAOA 4IFGA 4CFMA 3PXZA 2UZEA 3CKXA 2ZFYA 4GRBA 4BJJA 5IG1A 2VWYA 4A9UA 4LRKA 3NAXA 5FEQA 3GCVA 4FV4A 2Z7SA 4II5A 3ACKA 4FL1A 1LPUA 4C3PA 3MPTA 2R3HA 5CF4A 3FSFA 3WF5A 2VTLA 3TNHA 5L8LA 4NYEA 5C9CA 2J2IB 4I23A 4BCPA 3CD3A 5BUJA 4BWKA 5HIBA 2GNLA 3VUIA 4AA5A 2VO3A 5A6NA 5HVKA 2I40A 2DWBA 4FTUA 3VBTA 5IH4A 3MH1A 1R0EA 5JFSA 2GHMA 2FGIA 2ZAZA 4NWMA 4QTAA 2ETKA 1ZXEA 3P7CA 5TOZA 4C36A 2VTPA 3PE1A 4FV1A 4V04A 2LAVA 3WZDA 3FUPA 3AC3A 4AOJA 4CG9A 4IHPA 4I22A 4Y5QA 3IW7A 3GCUA 3E8CA 3QWJA 3UGCA 4RX8A 4ZY4A 3FC2A 3VW6A 1QPDA 4A4OA 3QGYA 3QTRA 3ZFXA 1J7LA 5HE0A 5IUHA 1U54A 3PVGA 1O6YA 1YRPA 2VTNA 3E8NA 4E4XA 1OGUA 3LZBA 4RWIA 1W8CA 4AZTA 4H3PA 3NYVA 4FI1A 3MA6A 3SW4A 2GNGA 3QLFA 5HLWA 3VF8A 2B1PA 3VQHA 1F5QA 3FC1X 3G2FA 4BC6A 4I5HA 2ZMCA 4BDKA 5DFPA 1R78A 4GL9A 4DEAA 5TT7A 2P55A 2JIIA 1NXKA 1OZ1A 4IBMA 3ZU7A 1PXIA 1XQZA 4M3QA 4KUJA 5EOLA 2WKMA 4L43A 1W2FA 2VD5A 3R6XA 3PG3A 4J53A 4NFMA 3PPKA 4PWNA 3CP9A 4AACA 3MIAA 3LJ2A 2QC6A 3TUDA 3OFMA 4I5PA 5CF8A 4RIXA 3ZO4A 2WMUA 3EQDA 2XKDA 3T3UA 4APCA 3DBFA 2BRBA 3K5VA 4NU1A 4L45A 2IZSA 2VNYA 3LE6A 5DRDA 1GZ8A 5J9ZA 2GHGA 4NM3A 4IZYA 3P7BA 2H8HA 4PX6A 4D0WA 1Q8UA 3ZO3A 2XJ2A 2GS6A 2WZJA 3FL5A 2XK8A 4GYIA 5D12A 3EFWA 4OBOA 4UB7A 1H24A 1OM1A 5CZIA 5ANOA 4MNEB 1UU7A 3C4CA 5D10A 3TN8A 3VS2A 3AKJA 2C0OA 4YSMA 2VTMA 3UZTA 2E9OA 5C26A 3DJ7A 4NL0A 3F88A 4O4EA 4UMPA 3FI2A 2EXEA 3GXLA 2YDIA 1FVVA 4O7TA 2OSCA 2B9IA 4WNPA 2C1BA 2WPAA 4Y73A 3FXZA 3GUBA 3NW7A 2HK5A 4FV0A 4PL5A 1XBBA 4U40A 5I9YA 3BL9A 3PY1A 4K77A 4KKEA 5D9HA 4C35A 3BX5A 3EZVA 3LMGA 4ZSGA 2YLEA 3CIKA 4R77A 1H27A 4XOZA 1IRKA 4HGTA 5AUXA 3T8OA 4ZJVA 3Q60A 5HTCA 2GS7A 4FSZA 3AMAA 4EJ7A 5FM3A 4MBIA 5J9LA 3W2RA 4W4WA 2OZAA 5K9IA 1CTPE 1ZYCA 3PSBA 5EYCA 3ULZA 4Z7GA 4IAIA 3F9NA 3DT1A 4MX9A 3VS6A 2HZNA 2OKRA 4F65A 1VEBA 3RCJA 2BILB 1URCA 3L1SA 4FYNA 5FM2A 2PVFA 4JBQA 2QOCA 5K4JA 4O7LA 5EQYA 3AT4A 5I9WA 5KKRC 4ZK5A 2HELA 4EOSA 2WMQA 3REPA 2BZKB 2Y4IC 4XP2A 4Z9LA 3V8TA 4I1ZA 5M4CA 3PFYA 4ZIMA 1FMKA 2Y8OA 4Y72A 4ANLA 3ZH8A 1G8KA 5CNNA 5AUUA 2OJ9A 3D14A 2C5XA 2ITYA 3MBLA 1PJKA 3A60A 2IF8A 4GK4A 2B9FA 4OTGA 2CGUA 4V0GA 4DEHA 5TR6A 4EZ5A 3ETAA 2YN8A 3UNKA 3IG7A 1WVWA 4UBAA 4M69B 4C59A 2AEGA 4O22A 4MCVA 3V5TA 4PTEA 1UU9A 3GI3A 3K3IA 3OS3A 4UYAA 2FSMX 2PZPA 4JI9A 5A14A 3VUGA 4FE2A 2OJJA 2X7OA 2A27A 2WQNA 3PVBA 4QMMA 1O6KA 2QG7A 4BZDA 3G9LX 1H08A 4TNBA 3V8WA 4B4LA 4IJ9A 5C4LA 1OITA 4FTQA 4NM7A 1P14A 3F3WA 3G5DA 4CSVA 4WBOA 2C30A 3Q32A 3KIOC 4BJJB 5AX9A 3QKKA 4DDIA 4OAVB 5DMZA 4WNOA 4BR3A 5C8KA 5AV3A 3O7LB 2QD9A 3ZONA 4CZTA 3UP2A 5LXMA 1LR4A 4FSNA 5CNOA 3KCFA 3UO6A 3CTQA 4RQVA 3QHRA 4ZJIA 5EI2A 3QUPA 5K0KA 5J95A 3ACJA 4H39A 3KRRA 4EOOA 3ZFMA 3OY1A 2OIDA 4ID7A 2P2IA 2EU9A 1U59A 3QAME 2JDRA 4QMPA 4AGDA 4K18A 3EYHA 3H3CA 3ORZA 4JMQA 4N6ZA 5HE1A 3RK5A 1XWSA 5FTGA 3P79A 3QZFA 3R02A 2YDKA 4BI0A 4DDGA 4JVGA 2QKRA 3BBWA 2C6DA 3TEIA 3GT8A 5HIEA 3LCDA 5EM6A 3KKVA 2OGVA 3FMMA 3ELJA 1KE7A 3PJCA 5AP2A 1YXVA 3W33A 4DEDA 4C2WA 4EOIA 4C4GA 3C5UA 3H9RA 1OB3A 3G51A 4ITJA 4LYNA 3RZFA 2CGWA 5CF6A 3QRKA 4M14A 4PPBA 2X0PA 3VRZA 4JNWA 3UVQA 4HW7A 1NW1A 1XBCA 4LGDA 2RFSA 5LARA 3HECA 5I9ZA 3OCTA 4IM3A 4S34A 3H9FA 4YLKA 4D28A 5J5TA 3FZSA 1YWNA 5I4NA 1OL2A 1H1RA 4JX7A 4DG2E 2WEVA 3LLAA 3OEZA 2FSOX 4RX5A 1Q24A 4O0XA 4E26A 2WNTA 4E6DA 4K33A 3E87A 5CSHA 3FMJA 4TYHA 1BMKA 4O86A 1XH6A 4RIXB 5CU0A 4EH9A 1FVTA 3A8WA 3SXFA 2I0YA 5L2WA 4M12A 4KBAA 4EOMA 1F0QA 4E5WA 3U6HA 3WIGA 3QUEA 3KMMA 5JFWA 3FE3A 2O63A 3VS4A 1PRYA 2OFUA 4TYEA 4AFEA 4E4MA 3CE3A 5IQAA 5FXRA 4KIKB 2YM8A 2AC5A 1J91A 3GCQA 3R28A 4ZLYA 4FT5A 4MWIA 4I5MA 1ZZ2A 4YGAA 4XYFA 1IAHA 3AC1A 3DK7A 2FO0A 3PA5A 5TE0A 4R3RA 4D1SA 2IJMA 2F4JA 2OH0E 2X7FA 5H3QA 4IH8A 2PHKA 3QHWA 2XRUA 3SRVB 3Q3BA 3QTXA 4F1OA 1UA2A 2QHNA 1K9AA 5HBHA 1KV2A 3BI6A 4O0YA 4ZSAA 3COHA 3MB6A 2HZ4A 3I81A 3RAWA 3L8SA 3KXGA 3FQHA 3TZ9A 5CT0A 3HGKA 3LQ8A 3QRTA 4IACA 4HGEA 2CGVA 3R9RA 2VX3A 2P2HA 2XK4A 4BKJA 2V55A 2OICA 5H8EA 3EL8A 1UU3A 2QOKA 2XYNA 3GU6A 1JLUE 4GVJA 4X3JA 4IAKA 3JXWA 4ASXA 1QPCA 3Q6UA 4D2TA 2ETRA 3LAUA 4WG5A 2X8IA 3NSZA 4TPTA 3Q9YA 5EYKA 3GOPA 2G2FA 1YXXA 5L6WL 4K9YA 3HVCA 3TNIA 4GCJA 3EOCA 4EK8A 1OECA 1T45A 3LFNA 3OD6X 4RC3A 3B8QA 3T9IA 4HVGA 3L8PA 1QCFA 3SA0A 4L01A 1H0WA 3EQPA 4QQJA 4ZZOA 4KINA 4JR7A 5B2KA 2XF0A 1YDSE 3QRIA 2PZYA 2YITA 4GIHA 4BTKA 5BMSA 3ATSA 4O38A 1OUKA 4AW5A 3ORMA 4HCVA 4YNEA 2H6DA 4MYGA 2G1TA 3FXWA 5JGBA 3O8TA 2Y0AA 5ACBC 3O17A 1ZOHA 5LVOA 3MFSA 3R9OA 4EYJA 3NNWA 2PL0A 5CVFA 4FTNA 1Y8YA 3BWFA 4F63A 4GKIA 5HBJA 4FEQA 4JAJA 3BQRA 4I0SA 4Y83A 4QOXA 4DGMA 4WNMA 4LDTA 3E93A 2NNWB 2Y6OA 4HPUE 1K3AA 4O0SA 1W83A 5I5ZA 5FP6A 1JSUA 5CSPA 2G9XA 2J9MA 2PU8A 2H9VA 1SVGA 4W8DA 5A4QA 4DT9A 2H96A 1ZYSA 4GEOA 4QP6A 2NPQA 4DE4A 4USFA 5LJJA 1GIJA 3SW7A 2IVVA 4HVHA 3BGZA 2IVTA 3CJFA 2CCIA 3FMLA 4NFNA 1WVXA 4R5YA 3RKBA 3CEKA 4DH1A 2JD5A 1H25A 4C4IA 2YM4A 3VBQA 5LCKA 4WKQA 1W2CA 2XYUA 2J0KA 3LFEA 4L46A 5JMSA 1KUTA 2C68A 3QUDA 5EDQA 3V04A 4HZRA 2X0GA 2IEWA 3KRJA 2ITNA 3D7ZA 5HHWA 5EK7A 3NR9A 3W1FA 2OU7A 5AR5A 3MV5A 3PJ8A 3W8QA 4XG3A 3BHVA 3EZRA 5BVFA 3CY2A 3SXSA 3RK7A 4XP3A 4A4XA 3FZRA 1A48A 3NNUA 4BRXA 2FB8A 3QTQA 4GKHA 3MI9A 2PVYA 4KABA 2J0LA 5AEPA 2LGCA 4IMYA 4G6LA 2BTRA 1I09A 3H10A 4O4BB 4KWPA 4LV8A 3R01A 3KA0A 3WF8A 4NJ3A 2XRWA 2YWPA 1H07A 2WELA 3BLQA 5IISA 3RPVA 4NTSA 1BLXA 3MY0A 2JDOA 2QLUA 4KD1A 2C6IA 3VULA 4EKLA 4KKHA 4HZSA 3VS3A 1X8BA 3A7HA 1PKGA 2Z60A 3EFKA 4D2RA 1MRVA 2YHVA 4GV1A 4OBQA 5GNKA 2FH9A 1URWA 3CGFA 2G01A 4FBXA 4KSQA 2YAAA 3HMPA 3IGOA 4XBRA 5IKWA 3WE4A 4C33A 5DLSA 4EOPA 4QDVA 3B8RA 4UEUA 4RFMA 3UDBA 1QMZA 2ONLA 3TZMA 5G6VA 4G3DA 4ALVA 2XM8A 3BU6A 4IADA 5A4EA 3SAYA 4KIPA 2PE1A 3P23A 4HOKA 4XEYA 3DS6A 3LQ5A 4BDJA 2GFCA 4UXQA 5AADA 5BX0A 4CCBA 3MA3A 4I6HA 3KXXA 3VQUA 3JY9A 2WMRA 1Q5KA 3NYXA 5K5XA 3FLYA 3G0FA 4YTIA 5K4IA 2JC6A 4O82A 4PUZA 5DN3A 5E8VA 3ZMMA 3Q9ZA 3CBLA 3AGLA 4ACGA 5DBXA 2Y4PA 4PY1A 3I6WA 5L2TA 5HX8A 3AD5A 4AUAA 2HY81 2JFLA 1KV1A 3F2NA 5HE2A 1IA9A 4IFCA 4YPSA 4ITHA 2QO2A 5CY3A 3UQGA 3FZPA 4RMZA 4JDKA 4RFYA 2E2BA 3ORKA 4RX9A 4IIRA 5HGIA 3R7GA 3K2LA 4FG9A 2V62A 3H9OA 4RVLA 5E8SA 2QU5A 2R3IA 1CSNA 3ZRLA 5KMNA 3P5JC 4WOVA 4PMPA 3NUAA 5DNRA 3WILA 4CFUA 1JQHA 3TMOA 4CFWA 1B39A 3NYOA 5K0XA 5GJFA 4AW2A 2KTYA 3R2YA 4FG7A 4ZTQA 4D9UA 2J7TA 4UWCA 3W18A 4K1BA 4U42A 2WTVA 4FNWA 1XO2B 3HRFA 3ORXA 2PTKA 3WYYA 2R0UA 4D4VA 4O81A 4MQ2A 5CAUA 1ZWSA 5LCJA 4XG2A 1H01A 4IX3A 4FYOA 3DGKA 2V7AA 1ND4A 3DBQA 2W05A 4FUYA 4OTRA 2XB7A 3UYSA 3O8UA 3RTPA 3FWQA 4JRVA 4ZEGA 4XLIA 2YM3A 4YBKA 4DEEA 4FL3A 4YZDA 3EWHA 3PPZA 3VHKA 4BZOA 4YJOA 4Z3VA 4U80A 4RJ3A 1J1CA 4HYSA 3NVKI 4GFOA 3V6RA 3GEQA 5HTBA 4I6BA 4F6UA 2GSFA 4FZ7A 3UG2A 2HENA 3NRMA 4XHKB 2XALA 4CCUA 3RPOA 3BV2A 4IAFA 2X0QA 4M13A 3ZXZA 3Q4ZA 4DTAA 1M17A 4U9AA 2AC3A 3UOHA 4E20A 2BR1A 2PVMA 3QZGA 4WUNA 3QRUA 5CI6A 4H3BA 3F3VA 4KNBA 3JYAA 2FSLX 4YC6A 5BNJA 2ITXA 5ICPA 3DK3A 1KE5A 1ZAOA 2W1EA 3N51A 4YC3A 5T6KA 3LXLA 3O71A 2PWLA 2CKOA 2UZVA 4PMSA 4DHJA 3LQ3A 5HIDA 3R30A 1H4LA 3EKKA 3DA6A 5A9UA 4I20A 4KS8A 4MUQA 2I1MA 5CSVA 3HMMA 2WMBA 4YNOA 4RQKA 1GZKA 4TTHB 4CQGA 5JZNA 4IX5A 5IA1A 5ITAA 4CLIA 4NZWB 2X4ZA 4FIJA 3FYKX 4TWPA 4OTFA 5JRQA 1PYEA 3L9NA 4FUXA 4J8MA 1TKIA 3VVHA 4A9SA 4BBMA 5L2IA 3D5WA 1CDKA 1GZNA 1PXKA 3C4ZA 3QGWA 4XG4A 4D58A 5HNIX 1R3CA 2WQOA 4QMNA 4ANSA 4FIHA 4ZOGA 4AW1A 5L8KA 1KOBA 4USDA 3R0TA 5A46A 4YJQA 4P90A 4G6NA 1Y6AA 1XH7A 3A7JA 3P0MA 3VIDA 4ALUA 4YR8A 4MXYA 3D2KA 4WUAA 4FC0A 3BHYA 3S0OA 2W1CA 4PRJA 3I79A 4DFLA 3QTWA 2B7AA 3F2AA 4MQ1A 4QD6A 1O9UA 2VTIA 4RWJA 3NUXA 1Q3WA 3FLWA 4IZ5A 4G5PA 4HYIA 3K5UA 4TN6A 1CM8A 4ACHA 4YTCA 3BLAA 3CQUA 3R7UA 2ITUA 3ZTXA 3ZUVA 3HZTA 1U4DA 3LJ0A 3QBNA 4AT3A 4MEDA 4MXXA 4HVSA 5KUPA 4E3CA 3CCNA 3K54A 2YIRA 3EQBA 3OW4A 5D7AA 2VTSA 4O6EA 5KMOA 1OPLA 1PXJA 2REIA 1JVPP 1WBPA 4BB4A 1UNGA 2QLQA 4BKYA 2XH5A 4QPAA 4FKWA 3G9NA 3ALOA 5AUZA 3DLSA 2GQRA 1YDTE 2HIWA 3ZRKA 5F4NA 4C38A 1BL6A 3TNWA 3EMGA 4BYIA 1Q41A 2QOQA 4EH7A 1FQ1B 1XH4A 3W0MA 2XANA 2HWOA 2XAMA 3RHXA 1FGKA 5DOSA 5JN2A 1WVYA 3KCKA 2OBJA 4XJ0A 1OL1A 2VV9A 3IQ7A 3FMDA 4X6QC 4D1XA 3CTJA 3D94A 2CLQA 2B52A 4JLCA 3PZHA 3RAKA 4AW0A 3EHAA 2XNMA 3FLZA 2XMYA 5DT3A 5B0XA 3V5JA 5IQFA 4KAOA 3TYKA 1BL7A 3HRCA 4C57A 1OVEA 1W7HA 2BFXA 2JIVA 2NYAA 3IW8A 4B99A 2QQ7A 3QQHA 1IA8A 4CTBA 1PKDA 5M4IA 4DT8A 2WQBA 4N4SA 4NJDA 3C0HA 5AM7A 3QF9A 4G3CA 4ZS0A 4A4LA 5HVJA 3ZS5A 3EQIA 3I1AA 1ZY5A 2KULA 4AFJA 3MVHA 4UMQA 5KKRB 3HLLA 2OF4A 3FQSA 2AQXA 3R21A 3LJ1A 4L6QA 2W1DA 3P1AA 3CSVA 1WBNA 1YOMA 2XIYA 4ENYA 2HZ0A 3PWYA 4EH8A 3VS7A 3DNDA 2IVUA 3TI1A 4YMJA 1XH8A 4FSUA 4BVUA 3E88A 5AMNA 3UC3A 3FKNA 4F78A 1ZOGA 2OO8X 2BIKB 1XHAA 4CRSA 5L3AA 4ZTHA 1H1SA 3NNVA 3UPXA 4O83A 4RJ7A 4O2ZA 5CASA 4GMYA 3P4KA 3KGAA 4EOJA 4K2RA 5IQHA 5TF9A 3NS9A 4UZHA 4IAAA 2C0TA 4LOQA 4DGNA 4IXPA 1ZRZA 2RF9A 4DEBA 3N4UA 1J7IA 1V0PA 2VRXA 3DY7A 3R1YA 3W0PA 4AT4A 4YHJA 5E7RA 2GFSA 1H00A 2OW3A 4XUFA 4IVDA 2QOBA 4DYMA 3BHUA 2JIUA 1MQ4A 5DHJA 4EK3A 2JAVA 1B38A 5IQIA 1YXSA 4X21A 5KE0A 3ZM4A 3FSKA 4E5AX 1U5RA 2YACA 3U51A 3O23A 2XIRA 4FKGA 4M97A 4DFZE 3POOA 3Q9WA 4JDJA 1HCKA 4NW5A 2BDJA 3PLSA 3QYWA 4QT1A 2JKKA 4CYIA 1V0OA 2W4JA 1MUOA 2ZMDA 3O96A 1PMEA 2JDSA 2VTHA 3BPRA 4GUEA 4MXAA 3WZKA 4BICA 4F9BA 1BI7A 1J1BA 4QO9A 4C8BA 3FHRA 4M84A 1ATPE 4IEBA 4YTHA 4F70A 2OLCA 4FEWA 5IQEA 2ITOA 4NUSA 3TV7A 4KRCA 4DH3A 3HV5A 1Q8TA 2WOUA 4QYGA 4B8LA 4BGGA 4M68A 2CKPA 4LL5A 5F9EA 2OJFE 3RJCA 2BROA 2CHLA 2XARA 5FG8A 3QRJA 2GS2A 4QP3A 1OL6A 2OXDA 4JDIA 4QTBA 4E6AA 1UNHA 3M1SA 1R0PA 2J5EA 3RCDA 4AZFA 5FEDA 2VX0A 5T68A 3NCZA 3VO3A 3CLYA 3HP2A 1FGIA 2R2PA 5J79A 3R8UA 5BVNA 5L4QA 1TFFA 1XBAA 5DI1A 2XNEA 3MPAA 2PVHA 5AIRA 3TKIA 1GJOA 4FRFA 4H05A 4PDYA 2CPKE 4X3FB 5EH0A 3Q4UA 3MH0A 3TTIA 4O0RA 2QODA 5JZJA 3PRIA 5DR2A 5B2MA 3WARA 3R83A 3OWJA 3QZIA 4G1WA 2G2IA 3ZZWA 4ZLZA 1BKXA 3OHTA 2ZYBA 1H0VA 2J50A 2UVZA 4X2FA 2WGJA 3LHJA 4ANMA 2ZDTA 2VO7A 4JG7A 3UVRA 3VWAA 4EC8A 4OW8A 2Z7RA 4FIIA 3BHHA 3OOMA 2B9JA 3FPMA 4LGGA 3CQWA 3MTLA 3KN5A 1IR3A 3PP1A 5LMKA 4KIKA 3MVJA 4J97A 1WMKA 3ODZX 3GFEA 4YURA 4FTIA 4K6ZA 4MKCA 2PUIA 3KULB 2WAJA 1P5EA 4MBJA 5CAPA 3EN5A 2VTRA 2WXVA 2O65A 3ORTA 4QP1A 3SRVA 2QR7A 4WBBB 2YZLA 2W99B 4TXCA 5AR4A 3HNGA 3KN6A 2WTCA 2BCJA 3G15A 2WQMA 2HAKA 4DN5A 1Q8YA 4GIIA 4UX9A 2X39A 3OF0A 3EH9A 3TJDA 4JJRA 1A9UA 2UZNA 3UMXA 5LWMA 1JKLA 5DH3A 4BIEA 4XH6A 3NGAA 4QYFA 2IZUA 2W4OA 4LG4A 5AV2A 5IZFA 3V5PA 4MBLA 4UMTA 4WIHA 5AR3A 4M0YA 3U9NA 4UY9A 2R9SA 2VO0A 2HY0A 5A54A 4OR5A 4AXCA 5AP4A 5C4KA 4RIYB 3SVVA 5LWNA 3BYSA 3CY3A 1OKWA 2XEYA 3EYGA 3R73A 3O2MA 3E62A 4V01A 4HVIA 2PULA 4L3PA 3ZO1A 4JRNA 4U45A 1SNXA 4H58A 1YI3A 3NUYA 2F49A 3DU8A 4MXOA 2JBOA 5LMAA 3VRYA 5JQ8A 4E1ZA 3IOPA 1YKRA 5BV3A 3AC2A 3AC4A 3PTGA 4J71A 4ANNA 1OPJA 1ZYDA 4CYJA 3WIKA 5JGAA 4RIOA 4LMNA 4FT7A 2GNJA 3PSCA 4FMQA 4BGQA 3D5VA 2VWBA 3ALNA 4CVAA 5M51A 4IWDA 1YXTA 2X0OA 1UU8A 5HOAA 5HQ0A 4E4LA 1ZMVA 3AT3A 4O21A 4BDIA 4XRLA 4BGHA 4NSTA 5M08A 3Q04A 3LXNA 4QMTA 4FGBA 5AIKA 3A4OX 3II5A 2QNJA 3DAJA 4WD5A 3FZOA 4L00A 5HCZA 2UV2A 2Q0BA 3OCSA 3G0EA 3MFUA 1BYGA 4IE9A 4OTIA 3W55A 4EZ7A 3RI1A 3F66A 3SV0A 1LP4A 3PA3A 2WTKC 5AUYA 3NUPA 3VUKA 2J0JA 3VHEA 3BZ3A 3OMVA 3MJ1A 1KE6A 5AAFA 3SG9A 3UDSA 4F9WA 4EOLA 5J9YA