4TWOA

Human epha3 kinase domain in complex with compound 164
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
278
Chain Sequence
VHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITPSNLLLDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 3
publication title Structural Analysis of the Binding of Type I, I1/2, and II Inhibitors to Eph Tyrosine Kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 278
sequence length 298
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4twoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4twoA01
4IWPA 3THBA 2J50A 5BUEA 2C0OA 5TKDA 3FKLA 5FEQA 1WFCA 5AV0A 5GIPE 3QD4A 2AUHA 4BCGA 2GFCA 3HAVA 4XOZA 2VN9A 4JBPA 3EQBA 5BVFA 2CGVA 5ANOA 3C4CA 4KD1A 3R7IA 2YIRA 5AR2A 2C4GA 2PUIA 3DCVA 1J1CA 2OG8A 2XYUA 3BU5A 2WTDA 3R21A 4NWMA 3VJNA 1IAJA 1BMKA 2BAJA 5HIBA 5HICA 2ITZA 2QO7A 2OU7A 3UIBA 3F82A 2YM8A 3CPBA 4V04A 2W1FA 3KXGA 3QTUA 3VQUA 3BIZA 1DI8A 3FY0A 4FIEA 5AP1A 3OVVA 4HVGA 3FMEA 3GU4A 4I0TA 5FUTA 4Q2AA 3DNDA 4V0GB 3SG8A 4NM0A 3NYXA 3UVQA 4ERKA 4CTCA 2WHBA 3VS3A 1PF8A 2ZV9A 1LEZA 4HPUE 4M69B 3NYNA 4O0SA 5GHVA 4WBOA 1OKVA 4WNOA 2VAGA 1UNGA 2IO6A 2X9EA 3A7IA 4FSRA 4JIAA 3PTGA 3O2MA 4JR3A 4DYMA 5IZFA 3GNIB 5ANJA 2Q0NA 4BDDA 5HG7A 4YJRA 4HW7A 2GHLA 3I0QA 5C27A 5H8EA 2QO9A 4HCTA 2KTYA 3LFNA 4F70A 5EDPA 2DYLA 5EHLA 3N4UA 5CQUA 3HDNA 2VTJA 3KULA 3LLTA 4J97A 3OZ6A 1OKZA 2QR7A 1M7NA 4CRSA 5LMKA 3QRUA 3R73A 2IN6A 3TV4A 5I9UA 5DRBA 4TYHA 2X7OA 1CM8A 2WMAA 1QPJA 2BDJA 4W9WA 3QGYA 3PVBA 3UP2A 4IEBA 4LRMA 1SYKA 4C4IA 5JQ8A 4O1PA 4PMMA 3OS3A 1JSVA 5IUGA 1V1KA 3TACA 4NYEA 3IW4A 4UZHA 1CKPA 2EUFB 2QOLA 3FMDA 1YRPA 3ZOSA 4I4FA 5K5XA 2OSCA 2XH5A 4S33A 3SD0A 5HLWA 4ITIA 4U6RA 2YDIA 3BE9A 4IM3A 4RPVA 2PWLA 5I0BA 4FEQA 5KKRB 2HZ0A 1QPEA 4MWIA 4YJUA 5JZJA 3GCVA 3NPCA 3A2CA 3A62A 3GC8A 1T45A 3E8NA 5HE0A 5ITAA 3MJ2A 2R3IA 4OT5A 4HVIA 4YTCA 2OXXA 4FIJA 1H0VA 3NMUF 4AFEA 3TDWA 4HZRA 3ZC5A 5LMBA 3HGKA 3AMAA 4PNKA 5KUPA 3RI1A 2F4JA 2J6MA 2G2HA 3G0EA 2JBOA 2OWBA 5M4FA 3FI3A 2ITVA 4TL0A 4BKYA 1ZRZA 2GS6A 5L2IA 4C2VA 4MEDA 1CKIA 4NJ3A 2C6MA 4I23A 3BGQA 4Q5HA 4JX3A 2PL0A 3IONA 2C6OA 4IHPA 3PPJA 4FTKA 4J71A 4L00A 3BV2A 3RAHA 2W5HA 4L44A 3I4BA 4D28A 3H9FA 5HLPA 2WFYA 3QYZA 3FZTA 4PMSA 1K3AA 4AT5A 3UQCA 4G6NA 2OIBA 3MB7A 4OBQA 2JDTA 5KMIA 4WG5A 2OJIA 3D5WA 4MYGA 4NTSA 3PYYA 4L01A 2VWIA 2YWVA 2VTTA 1Q8UA 2DUVA 3ZZWA 3AD4A 5J7HA 4FODA 5K4IA 3BQCA 3T9TA 5IQCA 1PY5A 4FTJA 4YGAA 4H39A 4KIQA 4UMPA 1OL6A 3PXZA 4BDAA 4CCBA 3VWAA 4FGBA 3GVUA 3ODYX 3T3UA 1K9AA 1L8TA 3QCQA 3P1AA 4GYIA 2PVMA 5LQFA 1XH4A 3GGFA 4UZDA 1XH8A 5J8IA 5DMZA 2B55A 4MWHA 4X2FA 4Z7GA 1F0QA 2WB8A 1OKYA 2FYSA 3LJ1A 4MD7E 3ZEWA 2PZIA 3GI3A 1YXVA 1V0OA 4IW0A 3PXKA 4GK4A 4XLIA 3FKNA 1ZYSA 1W82A 3OUNB 3A8WA 2OZAA 3VS0A 4L9IA 4CLIA 3MFUA 3KEXA 4PTGA 3GC0A 3MBLA 3OEFX 4LL5A 1YHWA 5LVOA 3AG9A 4QYHA 4O1OA 2WNTA 3VS2A 2BDFA 5L6OA 3MTLA 4DBXA 4BYIA 3DBCA 4UN0C 2FUMA 2GS7A 3PG3A 4S31A 2UV2A 4DCEA 3F3TA 3DB6A 4W8EA 4EC8A 4C02A 1H4LA 2HYYA 4HGLA 4ZSLA 4BZDA 4JG6A 1IR3A 3LCDA 4RBLA 4DGMA 4EH6A 5CANA 4JX7A 3TV7A 4GT5A 3FLYA 4UWCA 3R7GA 1TQIA 3TG1A 2V7AA 1Q99A 3A61A 3CJFA 5CXHA 4BTJA 3LCKA 3U51A 5IA0A 5K4JA 3UVRA 4ACMA 1JSTA 1FMKA 4ANQA 5DLSA 3P0MA 2A27A 4QNAA 3IGGA 2W7XA 3FDNA 3JPVA 4H36A 4F0GA 3PXQA 4IAFA 3FAAA 4AZFA 5J95A 4FVRA 4YU2A 2CMWA 4IM2A 1IG1A 3V5JA 3EQFA 4AZVA 3ZBFA 4D0WA 4NSTA 5HBJA 3KMUA 3AMYA 4CSVA 1OB3A 1MQBA 1K2PA 2HXLA 2V7OA 1UU8A 2WPAA 4O7YA 4NZWB 4FBXA 4HJOA 1KE5A 1WBPA 3TNHA 5JGBA 4LMUA 1BL6A 2FSTX 3NCGA 3DDPA 3VHKA 2QOQA 2W4KA 3VBWA 5JGDA 2J0IA 2OZOA 2X0GA 4TYJA 1MRVA 2F49A 3B8QA 2C6KA 2HK5A 3LQ5A 3ORMA 4RIWB 1PMEA 4GS6A 4TPTA 4DGNA 3Q53A 4D5HA 5CASA 4AGUA 2CN5A 4QMXA 5ACKA 3RAKA 3FLWA 3UO4A 3G9NA 5JSMA 3BBTB 3HRBA 4BBMA 4WSQA 4DG2E 4U0IA 5KX8A 2CKEA 4E93A 4FSUA 3IW7A 3RKBA 4JBOA 2H6DA 4MBIA 2QOKA 3I7CA 3F3VA 4G1WA 4IAKA 5D11A 4YSJA 3HRFA 4GJ3A 1Q24A 4DF3A 4I5CA 3U9NA 3MI9A 4J98A 4EORA 4A9UA 4DG0E 4YPSA 2WEVA 3AT3A 3K5UA 4QMTA 3W8LA 4FEWA 4ANOA 3NW7A 4FICA 2ZMCA 4EWQA 4RWLA 3U4WA 2X7GA 4GKIA 5C8KA 2VX0A 2YCRA 4WUNA 3Q6WA 3WIGA 2ITQA 4R6VA 3PY1A 4BHNA 2XNGA 5KMOA 2V0DA 3NR9A 4IAYA 3PVWA 3MW1A 5EDQA 5HVJA 4G5PA 1J1BA 4CFXA 5IDNA 2WU7A 3ALOA 5EHYA 4J8NA 3D94A 3QD0A 5AR5A 3KXZA 2UW6A 3LMGA 3ZLSA 2HY81 5CZHA 2JEDA 2UW7A 1YXUA 3G9LX 4L42A 5EDRA 3VRYA 2CJMA 3NVMB 2ZB0A 4FEUA 1P14A 3MH2A 3QQJA 4RIXB 4Z9LA 4RC2A 5C26A 5LWMA 3PJ3A 5IEVA 2X8IA 3IW5A 4FZAB 4LUDA 3A4PA 2W9FB 3I5ZA 3L8SA 1BUHA 2EB3A 5IQEA 4C36A 4RA5A 1UVRA 4ALVA 4P5QA 2ITXA 2C5XA 5CZIA 5D10A 3ORKA 2VRXA 4U9AA 3QRJA 4R3RA 4GFMA 4FV8A 4C34A 3GC9A 2PE0A 4O0XA 1UNLA 2JKOA 4IMYA 1PKDA 2BCJA 3DB8A 4NT4A 4DFLA 1PXPA 3BEAA 3R71A 5EYKA 4IANA 5KCVA 2PUPA 3C13A 4BDFA 2Y6OA 2XRWA 1R1WA 5CX9A 3UP7A 4NM7A 4F7SA 4PDSA 3AOXA 4DCAA 4EHVA 1H1QA 4Y83A 4ZZNA 2VV9A 1YDSE 2BZKB 3KC3A 4G17A 5IEXA 3D7TA 5EM7A 5DEWA 5AMNA 2R0UA 2OJJA 3GFEA 2ZDTA 3LFCA 3UG2A 2XIYA 3I6UA 2PSQA 3FQHA 5KE0A 2IW8A 1HOWA 3EZRA 4DEDA 1GZ8A 1JKKA 3GCQA 5C4KA 4GU9A 4ARKA 5A14A 3BHUA 2W1ZA 4BCKA 5CVHA 1LPUA 2QOFA 1NT2A 2WMWA 2XKEA 2B9HA 5AP0A 4ZXTA 3K5VA 4G2FA 4IACA 4Y85A 2WXVA 3U6HA 4E7WA 3TT0A 2CN8A 4DA5A 1JWHA 4Y5QA 4XLVA 1XJDA 3SW4A 4RFZA 4A07A 5M09A 3TZ8A 2VWVA 3O17A 3U8WA 3TZ9A 2RL5A 3BLQA 1YWVA 5DT0A 1W0XC 4C35A 2BFYA 2PULA 2OH4A 2HIWA 2IVTA 3WF8A 4NM5A 4QMPA 2RKUA 4XP2A 3EN5A 4QNYA 4MXCA 5F4NA 1VYWA 3PA3A 3IKAA 4MH7A 1HCLA 2GSFA 5HG9A 3ZFYA 3PLAE 4NTTA 4IIRA 4IADA 3ZFMA 4AZSA 3DZOA 2JIUA 2OXDA 3PSCA 4U43A 3UG1A 2BZJA 4KABA 5DWRA 4FKUA 3DKOA 4AN9A 4MNFA 4O0WA 2IVVA 3OF0A 5J79A 3LFSA 4FL2A 2C1BA 2RFSA 4M67A 1ZMUA 5GZ9A 1H00A 3Q2MA 5CXZA 3ZUVA 3NAYA 4TWPA 5ETAA 4L7FA 2BILB 3PE2A 2NP8A 2WTWA 4IX3A 3SQQA 4AA4A 4FA2A 1JAMA 3EWHA 3KRXA 4GUBA 5AR3A 3OWLA 1KE6A 4FKWA 3D5XA 4ALWA 3IK3A 4DFUA 1WBWA 4D2RA 5DFPA 2Z8CA 4KSPA 5ANDA 4R7IA 3AQVA 4R8QA 1JKLA 4FEXA 5I3OA 4ZJJA 3ZC6A 4WNKA 2QI8A 4FZFB 4CMTA 4QP8A 3FHRA 4RIYA 3QTIA 5AUYA 1BX6A 4NL0A 1U54A 1OKWA 1ZYLA 4BTMA 2VTNA 2UZNA 5BX0A 4I6FA 4FTQA 3AT2A 4JDHA 3LCOA 4OW8A 3R8ZA 4U80A 2O65A 3NAXA 3EQGA 3CP9A 3OXZA 2HCKA 2NRUA 1PXKA 3U9CA 3EIDA 2O2UA 1YWRA 1OZ1A 1YI4A 3QQGA 3UDBA 1WBSA 2QOHA 3ZHPC 5AFVA 3EN7A 4DEEA 3MFSA 5B2KA 3SXRA 4D1SA 2BVAA 2F2CB 4XBRA 4YZDA 3ZYAA 5ICPA 4J95A 4EEVA 1A48A 2OKRA 3I1AA 4ZSJA 4EKKA 1CSNA 4TNDA 4YC3A 5EM5A 1F3MC 3CE3A 4X6RA 4QP7A 1SM2A 1PXIA 4QP4A 2IW9A 5FEDA 4BGHA 2J51A 5LVPA 4BVUA 2OJ9A 4MHAA 3EN6A 1H0WA 4FIHA 4IX4A 3RP9A 3S4QA 3DKFA 3R01A 4K11A 3G6HA 1S9JA 3JYAA 1PXNA 4WOVA 3TV6A 3VIDA 4BTKA 4F6SA 4F9AA 5LVNA 3CKWA 2W4OA 1XBAA 4G34A 5KBRA 5L8LA 4AG8A 2Y9QA 4O0UA 5CEIA 4FEVA 4TTHB 4HVSA 3IQ7A 3OCBA 4KKHA 3TCPA 2W06A 4DTKA 2JGZA 5L8KA 2R3MA 2ZAZA 1PXLA 2J90A 1R3CA 4FYOA 5GJDA 5E8SA 4RT7A 5E1EA 5ACBC 4J1RA 3SX9A 5KMLA 5C03A 2J5FA 3BCEA 2QVSE 4OLIA 2WQNA 4K18A 2R3HA 2R64A 2YWPA 4Y8DA 2QURA 2PVRA 3UOKA 4EUUA 5J1WA 5AM7A 2G15A 3NZ0A 3KB7A 3HZTA 4DBNA 2J2IB 3QKLA 4ASZA 4FIFA 3W2QA 3QTXA 3IPHA 4S2ZA 4FKLA 3LHJA 3TNIA 1Z57A 2PVYA 1PJKA 5FP5A 3WF9A 1B6CB 4JRVA 2VNWA 1A06A 3ZH8A 1TKIA 3FZRA 1CKJA 3EKKA 3F7WA 3HEGA 1FMOE 3ORZA 3SRVA 2JFMA 3CD8A 4ZLOA 5E9EA 4DN5A 4MXXA 3VULA 1Q8YA 4QYGA 3DPKA 4FKQA 3R7UA 3T9IA 2VTPA 4DFYA 1BI8A 2AYPA 4L3LA 1OECA 4I92A 1L3RE 4YJTA 5IF1A 3TL8A 3VW8A 2R3RA 4WO5A 4CKIA 4M12A 3WARA 2F2UA 4IZYA 3KXHA 1OL2A 4KIKB 2GPHA 1PKGA 1CDKA 5K5NA 4GFGA 3I0OA 1YHSA 3FE3A 4QMUA 2ITNA 5HGIA 4O38A 3G90X 4FV6A 4ERWA 3QGWA 4BDKA 4FL3A 4BCJA 4AOJA 4LV5A 2X6EA 4MBLA 4DFNA 2AC5A 2XMYA 3OD6X 3DK3A 4GT4A 4MNEB 2G01A 2WTKB 2YEXA 4JIKA 3TKIA 2XK3A 2QOBA 4JDKA 3W18A 1GZOA 4CGAA 1DS5A 5K0KA 4BC6A 3R8PA 5IQFA 3QL8A 4R5SA 4MAOA 5L4QA 3FXWA 3L9LA 4YR8A 1R0EA 4MXZA 3BWJA 3W2RA 5CY3A 3QZGA 4YJOA 1ZAOA 4TKSA 3OCTA 4RQVA 2XYNA 2OJGA 2YABA 4QP2A 4ITHA 4QOXA 4RWJA 5CYIA 2BALA 4PDOA 4H1JA 3E7VA 4YLKA 2XBAA 5EYCA 3Q3BA 4ZTRA 4F1TA 4FGRA 4ORKA 3R9RA 4FVQA 1JVPP 5FBOA 2GNFA 3C5IA 1U5QA 2B1PA 2CCHA 3ZDUA 1Q62A 5M51A 1ZMWA 5J9LA 4AS0A 3KXNA 4IWDA 2W5BA 2XK6A 3QAME 5CAPA 4IH8A 3Q6UA 2QKWB 3R7OA 2BZIB 5JN2A 5A3XA 4N6YA 1KOBA 2UW4A 1SVEA 3BGZA 3DLZA 5AP2A 3Q9YA 3F2NA 4TN6A 4ZTMA 2DWBA 5L2WA 2XJ0A 2EXMA 2ZMDA 3VW6A 3HMOA 4GMYA 3ZXTA 5HD4A 4FTMA 4XNEA 5L2QA 3V8SA 4AGDA 4O81A 2B53A 3DFCB 2IW6A 4X3FB 2P0CA 4MBJA 2R4BA 3NVKI 4WD5A 2ZJWA 4ZSEA 3DJ7A 1XH5A 3TXOA 4AT3A 2J4ZA 4EH3A 3A7GA 2C0TA 5CQWA 5HE3A 3R83A 4WRSA 5IQHA 4NIFB 5ANKA 4EJ7A 3SG9A 1PXJA 3Q5IA 4E6CA 1J7LA 4RMZA 3PJ2A 4J99A 5CS6A 3DKCA 3PSDA 3ZRMA 3QLFA 5DT4A 3UMWA 3JS2A 3M11A 5LCKA 1QL6A 3G15A 3GU5A 4FKOA 5FM2A 5HTCA 2WZJA 4O7VA 3A99A 4AF3A 3FSKA 5JMSA 5AR8A 3BHVA 2VX1A 3UMXA 5DNRA 3BU6A 3C5UA 3LPBA 4UMQA 3ZFXA 2WD1A 3OTUA 4DGGA 3E63A 2C1AA 3EQDA 1NW1A 3QA0A 4TYIA 3GUBA 3WZEA 1GZNA 2WIHA 2I0HA 1W7HA 4PL3A 5DG5A 3UC4A 5L2SA 1U59A 3W2SA 3V5LA 5C8NA 5FEEA 3ZO4A 4HYHA 3BWFA 1WMKA 1PXOA 3GOPA 4YSMA 3DBQA 4M8TA 3VS5A 4BDGA 4PP7A 2IG7A 3W10A 3V01A 4DEGA 4DFXE 3GQLA 3DAJA 5TO8A 3QA8A 3U54A 3PXRA 2LGCA 3OTVA 1OPLA 4O7SA 4QRCA 3ZXZA 3OFMA 4E4XA 4LM5A 3OBJA 5ANIA 2W96B 1PHKA 4UV0A 3WZJA 4DINA 4ANBA 2OW3A 5E8YA 3V6RA 1OL1A 4BDEA 5CI7A 2GQSA 4A7CA 4GU6A 2Y8OA 1M2QA 2QHNA 5LMAA 3QXOA 3RGFA 4E5WA 4EQUA 2QG7A 4GKHA 1E9HA 1YOLA 2YDKA 2R3LA 4FV0A 4UYAA 4GJ2A 4L45A 4WHZA 4DH1A 4QMLA 3C7QA 3VHEA 4I24A 4B9DA 2P55A 4CV9A 3BLHA 3MGYA 3DKGA 3HMPA 3TWJA 3C4WA 4JOAA 1SVGA 3O96A 5E92A 4KBKA 3R8VA 1OIYA 4YZCA 3ZSIA 3RM7A 2NNWB 2X8EA 4XV2A 5DA3A 1Q4LA 2PMIA 3NEWA 3RAIA 5HCZA 5FBNC 3B2WA 2H8HA 3VS1A 4AACA 2VO0A 4ZS0A 4AGWA 4R5YA 1OI9A 2RG6A 4BIDA 4ZP5A 1IRKA 3PIYA 3QD2B 3DTCA 2Z7SA 4IZ7A 4CFUA 1NVSA 4FIGA 5LWNA 3UIMA 3ERKA 4FV5A 3NS9A 3QTZA 4GRBA 2XVDA 2WMXA 3DK7A 4D2SA 2GDOA 4G6LA 2JKQA 5HESA 4QMOA 3P7AA 4PMPA 2ITTA 1Q41A 4XP0A 4F9CA 1SZMA 2UZEA 4RVMA 3LLAA 5G1XA 5C4LA 4XH6A 2HAKA 4EH5A 3ZU7A 1XBCA 2R9SA 1KV2A 3HMMA 3KGAA 3NYOA 4GH2A 2UVZA 3N4VA 1QPCA 2R3JA 3JY0A 4YZMA 5FM3A 2WOUA 2YA9A 4J52A 3ZBXA 3BZ3A 4ZMFA 2VTLA 4EBVA 5HNBA 3H4JA 2I7QA 4NUSA 3QC9A 4XG7A 3SW7A 4G5JA 3ZM4A 3KN5A 5CLPA 4CFNA 5AP4A 3JXWA 2FA2A 3SOAA 5CU6A 4YTIA 1Y6AA 4OTWA 3RTPA 1IASA 1LP4A 5IH6A 2Z02A 4CFWA 2QU6A 4WT6A 5JZNA 4FSTA 4OTPA 3OWJA 4GSBA 4LGDA 5AAEA 2C6EA 1R0PA 2RFNA 4I5PA 5FTQA 4CFMA 4I94A 2HWPA 2XZSA 4FOBA 4RIOA 4QTAA 4TWNA 2ACXA 2P2IA 4GFOA 3V51A 4C37A 4EOLA 4QP1A 3G51A 4FMQA 2ZV7A 3SA0A 2YERA 5M56A 1MRYA 4PL4A 2BRBA 1FGKA 4ZTLA 3LFEA 4AFJA 4CYJA 2CGXA 3CY3A 3TZ7A 1PXMA 4DEBA 5HX8A 4BZNA 4O83A 2X7FA 4I5MA 3ZEPA 3EJ1A 2WAJA 3ORXA 4MKCA 4F64A 3D5VA 3S00A 2OFUA 2PK9A 4O82A 4H1MA 4ZAUA 5CEOA 4RGJA 4CD0A 1RE8A 4RLKA 4AW5A 1R39A 4IC7A 4C38A 3PWDA 3FUPA 5T6KA 5G6VA 5M57A 3HUCA 5HTBA 4U45A 2VWYA 4MQ2A 1YW2A 3AC3A 5HI2A 1GIJA 2XIZA 4F0FA 4G3CA 5FXQA 4WSYA 5DYJA 3ORLA 3MY0A 2PVFA 2YJSA 2NPQA 4EYMA 4GVJA 2RF9A 4E73A 4RWIA 4E6DA 4JBQA 1VYZA 1WBNA 3NYVA 3CQWA 5AV4A 3BQRA 4K33A 2ZV2A 2C0IA 2HXQA 4ZK5A 4BWKA 3ATTA 4FKIA 3NNWA 1SNUA 3QRKA 4M68A 3FI8A 5C01A 5AUUA 3R6XA 4HYUA 3ALNA 4OGRA 3BGPA 4IC8A 2H96A 4FKJA 2F7ZE 4XX9A 4EOMA 2PPQA 3OP5A 3LE6A 5CALA 1H28A 5LMKC 4QQTA 4IVCA 5HZNA 4FNYA 3CGOA 4Q9SA 3VUMA 4BDJA 3RVGA 4WNPA 2R3FA 5KZ0A 3CTQA 4D2VA 4EK4A 3DAEA 4BDHA 4I1ZA 3R02A 4LRJA 3TTIA 2BROA 4KRCA 2CKOA 1P5EA 2HZNA 3N9XA 1UU9A 4YP8A 3R0TA 2XCKA 1ZZLA 3HP5A 3KU2A 3MY5A 3FMNA 5BQ0A 4XJ0A 5HX6A 5I9WA 4G31A 4RSSA 2P33A 4L3JA 5HIEA 2PU8A 4BFMA 2ITUA 2QHMA 2GNLA 5CSXA 5E1SA 3MVMA 1PW2A 3VUGA 3MPMA 3R30A 2C6LA 1VEBA 3F3ZA 3QTWA 3DJ5A 4O6EA 4R7HA 4YBKA 3U4UA 4AGCA 4YC6A 3UPZA 3FZOA 3PXYA 4D58A 4V0GA 4LFIA 4YJPA 2JC6A 3HV3A 2VO3A 5HE2A 3WBLA 1OL7A 1ZZ2A 3FZSA 4OTRA 4TYGA 3F88A 3HP2A 1VZOA 5D7AA 5HG8A 3UYTA 4ZTQA 4DGLC 2ZYBA 2OK1A 2IZSA 4FTRA 3RPYA 4XG8A 3FMMA 4GEOA 1IA9A 1H27A 3BX5A 1U46A 3M2WA 5D41A 2YM7A 3BYVA 2WMTA 3TNWA 3DA6A 4R3CA 2Z7RA 3C4FA 4LOOA 3LFQA 1A9UA 4EOJA 5JK3A 4APPA 3AD5A 3EFWA 1OBGA 4FUYA 5JFVA 4YHJA 2ZDUA 3ZLYA 1SMHA 4EYJA 4EZ7A 5HEZA 5J1VA 4D1XA 2WEIA 4HNIA 3NUAA 2CLQA 5JRQA 3EQIA 1J91A 4C4GA 1RW8A 1QCFA 4FG7A 5TOZA 4CMUA 2BAKA 3IS5A 3DFAA 5M53A 2QOCA 3WYYA 4W4YA 3WE4A 3Q9WA 5DOSA 3R8UA 4B0GA 4EZ3A 3I6WA 3NRMA 2QQ7A 4QQ5A 4BB4A 3WF7A 5EQPA 5A4TA 4MD8E 3UIUA 5DPVA 4DTBA 3DNEA 4D1ZA 4KUJA 2KULA 5KMJA 2PE1A 4C4HA 4M0YA 3EQCA 3S0OA 1PRYA 4GV1A 3ROCA 2UW9A 4O7NA 1ZLTA 2YISA 5GINE 2VTIA 2VTMA 3E87A 3LFDA 4J8MA 5IUIA 3V8WA 3OHTA 2X1NA 4I5HA 4C61A 5F20A 2XM8A 1BYGA 2PVLA 3AXWA 1WVYA 2A1AB 2E9PA 4JJRA 3OROA 5BMMA 3V5TA 5IA1A 3U55A 3DXQA 4O2ZA 5CVGA 3EN4A 1DAWA 2ITWA 4O96A 1IAHA 2EWAA 4HYSA 3TNPC 4U3YA 4A9SA 4XRLA 3CSVA 3MH0A 4I41A 4QQCA 4FR4A 1YOJA 3I81A 4BCQA 4EK5A 4Z7HA 5J7BA 3RM6A 2VNYA 2PVKA 2C69A 5E7RA 3TN8A 4DLJA 3GCSA 4P5ZA 5IA3A 3RCDA 2FVDA 5JH6A 2GCDA 3ZUUA 4MCVA 2UZBA 2V62A 5DR9A 4OAVB 2W0JA 5KO1A 1YVJA 5AUTA 1H24A 2YZAA 1P2AA 5IU2A 1OPJA 4RFYA 3Q4TA 1AD5A 3UNJA 1H01A 4IFGA 1FOTA 4IM0A 4O0YA 5HBEA 2XM9A 5E8WA 4BI2A 3MFTA 3QTQA 4DEAA 4KAOA 3R63A 5HNGA 1OUYA 3JY9A 2VWXA 2YCFA 2V5QA 2R3QA 3IDCA 4EQCA 4JNWA 4LOPA 2YM4A 3FI4A 4Q5EA 4DT9A 2C5YA 2RSVA 3BYMA 4AT4A 1BL7A 5DH3A 2X9FA 3RMFA 3C0HA 4K2RA 1O6LA 3L9NA 4F4PA 3UODA 3ELJA 3REPA 5I9XA 5M4CA 4L67A 3EYGA 5KNJA 3HV6A 4A9TA 3R7VA 4RC4A 4X7QA 2Y4IC 5KMKA 3DOGA 3CQEA 3TJCA 4E4MA 4JQ7A 5EYMA 3NCZA 3PRIA 3VJOA 3TI1A 4HGEA 3QYWA 4JXFA 4RX9A 3FQSA 1OMWA 4CEGA 5FDPA 5KKRC 2XK4A 4F9WA 4PPBA 1NXKA 4L3PA 5A6NA 4X2JA 3UE4A 4AUAA 3FV8A 4FTUA 4IJ9A 4OTFA 3VQHA 4PL5A 1Z9XA 3NSZA 1HCKA 3Q4CA 3AD6A 3CD3A 3JVRA 4C4EA 5FTGA 1PMVA 4M7IA 1Q8ZA 1T46A 4NKAA 3OOMA 3N51A 5KHXA 3E8DA 4A4XA 4TXCA 5BYZA 3RK7A 3MTFA 3D0EA 2Y7JA 2CSNA 3KK9A 4O7RA 3EZVA 3QTSA 3O7LD 3PJ8A 3NUPA 3GEQA 3IGOA 3IDPA 5CF5A 1G8AA 4Z16A 2G1TA 5CSHA 3B2TA 5B0XA 2PZ5A 2LAVA 4XG2A 2J9MA 2GS2A 4QMYA 4XUFA 4E1ZA 5EG3A 3OC1A 3V04A 4RIYB 3MESA 2OLCA 3RHXA 4CKRA 5BVKA 4RVTA 2C5OA 4J96A 3VBXA 1W8CA 3L1SA 4RJ6A 1H1WA 4K77A 5H3QA 4GVAA 5KMMA 4MF1A 1XH7A 3FI2A 4ZLYA 2RFDA 2XNNA 1M14A 1DM2A 1M7QA 2UW0A 5F9EA 2P4IA 4YURA 3DJ6A 2R3KA 5JT2A 4WBBB 3AGMA 5DR6A 3AC4A 5EM6A 3A7FA 4KIPA 3VN9A 4FZ6A 4AZTA 5IISA 2EXEA 1AGWA 4PRJA 3L8PA 3QF9A 4NJDA 5EOBA 5H8GA 4F9YA 5CAUA 4KS7A 2OICA 2R3NA 3UOLA 3MPTA 4FG8A 5CVFA 1V0PA 4D2TA 1OVEA 4PX6A 3MDYA 4ACGA 3ET7A 3TKUA 4C33A 5J5SA 4H05A 3G33A 3S1HA 4IX5A 4C4FA 4EL9A 3DY7A 3G2FA 4BGGA 1KUTA 3TZMA 3BYUA 5IA5A 4QTBA 4I6BA 5DBXA 5GJFA 2B9FA 4RIWA 2X4ZA 3F7ZA 2VWBA 4FSWA 4M66A 4YJSA 4E6QA 4K1BA 1H1SA 4X6QC 5C1QB 1UU7A 2YAKA 1Q3WA 1OBDA 4ASXA 1ZOEA 4FK3A 3LAUA 1O6KA 3HV5A 3NNVA 3CGFA 5M4UA 2I40A 3ODZX 1XHAA 3A4OX 5F1ZA 3LJ2A 5EH0A 5LVMA 5I9ZA 3H0ZA 3HECA 4FT9A 4I4EA 2C3KA 5IQDA 1YXSA 2Q83A 4NFMA 4XHKB 2GTMA 4QPSA 4R1VA 4OTGA 3H30A 5E91A 1REKA 4CT1A 4LGHA 4FT7A 3N4TA 3EB0A 5FXRA 4Y46A 3CKXA 4DH5A 4DLIA 3TUCA 5HVYA 3IOPA 5F95A 3ZUTA 2YLEA 3Q5ZA 2XP2A 4P90A 4KS8A 5D9HA 4DHFA 4IBMA 4DEHA 4EUTA 4USEA 2WGJA 4L8MA 3E3PA 3RINA 2BRHA 3ZTXA 4CZUA 4FKVA 3DS6A 1QMZA 4IB3A 4AOTA 2R3OA 1TVOA 3WE8A 4Y95A 5KZIA 3OT3A 2DS1A 2F7EE 4RIXA 2UW8A 2OF2A 2GNJA 2W5AA 3RZFA 1Q97A 1YI3A 2W99B 4R1YA 1PMUA 2AC3A 2QU5A 5KBQA 4DH8A 4CG8A 4V01A 2WQMA 3GB2A 5B2MA 4XV9A 1XR1A 4BDBA 3LQ3A 3P7CA 3CR0A 3F6XA 4DT8A 2C6DA 2J5EA 4GUEA 5TF9A 3V5QA 3ATSA 4O7LA 4U97A 4FG9A 2JLDA 5CAOA 4RFMA 5T68A 4FNXA 4AE6A 2OI4X 2CKQA 5IG1A 4LI5A 3UGCA 2YACA 3P79A 4GK3A 3SGCA 4ALUA 4I21A 4EC9A 4EH4A 3D5UA 4FVPA 1KE9A 1E1XA 1GNGA 4IAZA 3C50A 4EK8A 4WIHA 2R3PA 3KXMA 2UW3A 3EQPA 5LCJA 3KRLA 2O5KA 4AN2A 3QWKA 2QOOA 2RFEA 3LZBA 3D7ZA 4QYYA 3C1XA 5CAQA 4LRKA 3Q52A 3ULZA 5IH4A 4D4SA 4USDA 3R1SA 3FL5A 5E8XA 3AC2A 3UOHA 2VTHA 4ZTNA 4GIIA 3O23A 3C0GA 1ZOHA 3DT1A 3NW6A 2R7BA 2XKFA 5EKOA 4CT2A 4RJ5A 3NNUA 2W1EA 4RX7A 5EW9A 4N4SA 4TWOA 4XOYA 4APCA 4AW1A 5CSWA 2YZLA 3CJGA 3I5NA 4WG3A 2RG5A 3QCXA 2I0VA 4W4XA 4YTFA 2WMBA 3G6GA 3GU7A 3KREA 3VRZA 2RIOA 3CS9A 1W98A 4PUZA 5CWZA 4EKLA 3IOKA 1OIRA 2B52A 3KL8A 5KHWA 4N57A 3I60A 2XS0A 3DBFA 3FYKX 4QMZA 5TR6A 3ZDIA 4AU8A 4QTDA 4WRGA 3PP0A 5DEYA 5M44A 3HV4A 4BKJA 2YFXA 2B0QA 4IB5A 3BPRA 1B39A 3DXNA 4AX8A 3MJ1A 4YZNA 3DAKA 4NK9A 4AWIA 2CGUA 1PYXA 3GU8A 4BZOA 4QQJA 4U7ZA 2UW5A 4G9CA 2PVJA 2IZUA 4FV7A 4M15A 4BL1A 4C59A 3LMHA 2REIA 4M13A 3P86A 3EL7A 3FQEA 1XH6A 4LMNA 4RQKA 2UZUE 4C8BA 1MRUA 4EJNA 4B6LA 5M07A 3DBDA 3WZUA 4KIOA 1SVHA 4FL1A 4G6OA 4QTCA 5B7VA 3Q4ZA 3PDTA 3ZO2A 2WIPA 3B8RA 4CQEA 4D55A 3ORIA 3SAYA 4EOQA 4H3QA 3V6SA 4TZRA 3Q60A 2Y4PA 3F5PA 3CBLA 2YCSA 4PDPA 3H9RA 2QLQA 4Q9ZA 4F08A 4IZ5A 4QPMA 5HO8A 4F7NA 1OL5A 4RX5A 4XG9A 4FSQA 3WF6A 4BBFA 1H8FA 1URCA 4W8DA 2PZYA 3OUKA 3W2OA 4MXOA 4RWKA 4PDYA 1O6YA 4HPTE 2VZ6A 5IQBA 4D5KA 2CGWA 2V22A 3ORNA 3ZRLA 3QQKA 4ZEGA 4DFBA 3OEZA 2VGOA 3BEGA 4HNFA 3QCSA 3KXXA 5DIAA 4DEIA 4ZJIA 2O0UA 1Y91A 3NUSA 5JFSA 4K6ZA 2OF4A 2UZTA 5HKMA 3SC1A 2WTCA 4UXQA 2O64A 1GIHA 5DI1A 4PF4A 4C7TA 4YMJA 2BKKA 1F5QA 4JVGA 2OJFE 3NLBA 3KKVA 1JBPE 2YIWA 4XCUA 5EFQA 3SLSA 5EQYA 3KFAA 4UX9A 3ENMA 4PP9A 4X2NA 1TQPA 4JLCA 3FMHA 3CC6A 3QHRA 4KB8A 4KWPA 1W83A 2Z2WA 3SV0A 5JGAA 1M2RA 4ITJA 4W9XA 5A4CA 5J5TA 4BCHA 2UZWE 3P78A 2BRMA 2NO3A 3TNQB 5L3AA 2YM3A 3PG1A 3P7BA 3AMBA 4BTFA 2ETMA 3R04A 2HY0A 3Q9ZA 4N0SA 2UUEA 3NUUA 4UB7A 3POZA 1RDQE 1BKXA 3D83A 4M0ZA 4MQ1A 4UYNA 4GL9A 2H34A 3C9WA 4EOSA 5AV2A 2FB8A 3ZS5A 2P2HA 2UZLA 2WMRA 3K3JA 4JG7A 4UY9A 5ETIA 1JQHA 3CTJA 4IJPA 3K3IA 2GMXA 4U79A 5K0XA 3VAPA 2B9IA 3HUBA 2O8YA 3ZCLA 4U3ZA 2CHLA 3GU6A 4MXYA 2FH9A 3RBWA 1GIIA 1UA2A 5ETFA 2XA4A 4KKGA 4ANLA 3CTHA 2ZVAA 3QQLA 3E8EA 4U40A 3V5WA 4UMRA 3IO7A 1LUFA 3K54A 4XEYA 3NNXA 1ZYDA 2FO0A 3RPRA 1FVRA 4UMTA 3SHEA 2YIXA 4GK2A 2BR1A 2CDZA 2PY3A 3F2AA 3O50A 3O8PA 4RX8A 3C4ZA 5HBHA 5CF6A 3LXNA 5EKNA 4MK0A 5EI6A 5BVNA 3TM0A 5IMXA 1DI9A 4C58A 1FBNA 3TKHA 3NWWA 4KKEA 3EKNA 5L6WL 5AA8A 3T8OA 3JUHA 1XBBA 5HE1A 1WBVA 4QP3A 3P08A 5A6OA 4YPDA 4ZZMA 4WG4A 4AZWA 4JBVA 3FPMA 3KULB 5GZAA 3RNIA 4RJ7A 5CEPA 2FGIA 4EH2A 3BBWA 4CYIA 4FTAA 4YC8A 3D2KA 4W4VA 1GZKA 5FXSA 2WELA 4MNEA 4BWPA 3FWQA 4TYHB 3ANRA 2YIQA 4EK6A 3V5PA 5I9YA 5AP3A 2CKPA 2W05A 2XCHA 3PZEA 3VUDA 4O0TA 2UZDA 4FT3A 2JDVA 2HWOA 4BCMA 5BVOA 3DTWA 3OW3A 3SOCA 3PJCA 3VUTA 5IQGA 2BRNA 3RPSA 3QQUA 5HORA 5A4LA 4N6ZA 3Q2JA 2OIQA 5BMSA 2E9VA 4UBAA 1GAGA 3R1YA 3R1NA 3UZTA 3LM5A 4FV4A 4IDTA 4F0IA 3DDQA 3QZHA 1WAKA 4C57A 4EWHA 3QU0A 4JI9A 4IVBA 5GJGA 4A06A 4ASEA 2PZPA 3R22A 3OY1A 4II5A 2GTNA 2WMUA 3PPZA 5AM6A 1LEWA 2CLXA 3PY3A 3BU3A 3MVJA 4Z3VA 3A7HA 3BKBA 4QP6A 4FZ7A 3S3IA 3LJ0A 1ATPE 4O0RA 3OMVA 2A0CX 2C30A 3VUHA 5AP5A 2J0LA 3EFKA 5AX9A 2IJMA 5HNIX 3W32A 3VO3A 4FE2A 4IQ6A 5TT7A 3P23A 3H3CA 3UYSA 2VX3A 3D9VA 4YHTA 3FMKA 3TJDA 3VUIA 3ACKA 2GHGA 4I3ZA 2WTKC 3AC8A 3II5A 4X3FA 5IKWA 1UKIA 3EQHA 1H1RA 4FKSA 1RJBA 2BZHB 2J7TA 4H3PA 3SXSA 2V55A 4XRJA 3WYXA 3UIXA 4NIFA 3LXKA 1JSUA 4G3FA 4MVFA 4ZY4A 3PA4A 4FSMA 1Q3DA 4FI1A 4YZBA 1H08A 4LQMA 3H9OA 5J9ZA 4D2PA 5EI8A 3F66A 3L8XA 3FLQA 5HU9A 3R2YA 4IVDA 4OUCA 4QP9A 2VTOA 3LFBA 4QMVA 3RK9A 2PE2A 2JDOA 3VC4A 1U4DA 1Q5KA 2BFXA 5FQDC 5CSPA 3UNZA 4M97A 4ZLZA 3S95A 1H26A 3FC1X 3BV3A 5KMNA 3NUYA 2JDSA 2W1DA 3ZMMA 5CAVA 2PMOX 2XRUA 3Q4UA 4TRLA 3HMIA 3C0IA 4QT1A 4HGTA 1Q8WA 3BLRA 3MSSA 5EK7A 3P5KA 2YLFA 2WMSA 2X2MA 4OR5A 1YHVA 3BELA 3V8TA 3VUKA 3AT4A 2BDWA 4PMTA 3MN3A 3UOJA 2GU8A 3CY2A 1Y57A 3R9DA 4RZWA 4D2WA 4FTLA 5AWMA 5CEKA 4KRDA 2R0IA 4XG4A 2OZAB 4RC3A 3DK6A 5H2UA 5HTIA 3KY2A 3NDMA 3TDVA 3QUEA 3E3BX 5AP7A 2Q0BA 5FDXA 1FQ1B 1NVRA 3DQXA 5AUZA 4C62A 4X3FC 1JKSA 3QC4A 4BR3A 4MD9E 4CQGA 4CXAA 4IB1A 4RA4A 4EHGA 4XP3A 2Y6MA 1H07A 5A54A 3ID6C 1P4OA 3LOKA 4L7SA 2VTRA 3FJQE 2ETKA 3BI6A 4OBPA 2QD9A 3EHAA 2EB2A 2IVSA 4FKGA 3UBDA 5HU3A 4AOIA 2PZRA 3F9NA 3OWKA 1ZY4A 3EQRA 3MIAA 2YAAA 4YHFA 5E4HA 4TYEA 1OM1A 3RPOA 2W17A 3E7OA 2BHEA 4KINA 4OBOA 4Y5HA 4YNOA 5CF8A 5JFWA 4F1MA 5M06A 5T3QA 3FBVA 1Q8TA 1H25A 2X8DA 3BYOA 3D14A 3FLSA 3GBZA 3PWYA 4YJQA 3VS7A 4OTIA 3OY3A 4FKRA 2Y4IB 1GY3A 4TWCA 4IFCA 5LOHA 1RQQA 5CEQA 5J9YA 1LR4A 2JITA 5CF4A 1KV1A 1V0BA 1XO2B 2XK9A 3FMLA 4ENYA 3CLYA 3L9MA 3EFJA 4FOCA 4FK6A 4RRVA 5AA9A 4CKJA 4BKZA 5IH5A 2QONA 5IPJA 4XYFA 1GJOA 2QC6A 2ETRA 4UWBA 4FT5A 4F7JA 4P2KA 3TIYA 2JDRA 2YCQA 3HDMA 4QMSA 3MVHA 2W1IA 3KCKA 5AAGA 4ZIMA 3F5XA 3LKMA 4ZZOA 3VVHA 3BRBA 1KOAA 3AC1A 5FGKA 3T3VA 2B4SB 3ZSGA 4PWNA 3F69A 1X8BA 3VBQA 3QZFA 5FWKK 4G16A 4O7ZA 4EBWA 2R3GA 3RCJA 3KCFA 5AADA 4JS8A 3MH1A 4MTAA 4DG3E 3CQUA 2FSMX 3QCYA 3TTJA 1DAYA 4FTTA 3VS6A 1YXTA 3MV5A 3C4EA 2E9OA 4LV8A 2QNJA 2YN8A 4M69A 4O6LA 4CNHA 3VBTA 3DV3A 3UQFA 4C3FA 4USFA 3CIKA 2JIVA 5I3RA 1ZXEA 3ZONA 4AW2A 4D4VA 1JKTA 3AGLA 4I6QA 5FP6A 5DR2A 4NFNA 3TIZA 2UVXA 1S9IA 3MY1A 5ANGA 4E5AX 1WBOA 2IZTA 4JT3A 2UZVA 5EW8A 3PA5A 4EZ5A 3R9NA 4C2WA 4EK3A 4NCTA 4D4RA 3QTRA 4EHZA 3HRCA 2VTSA 3LXPA 1Y8YA 1IEPA 2QODA 3LFAA 3FC2A 2DQ7X 5BVWA 3PRFA 4FKTA 4FSYA 5CI6A 3DU8A 3E8CA 3Q32A 3R9OA 2WKMA 4X0MA 5JEBA 4YBJA 4ZY5A 4BDIA 3PP1A 2FSOX 3QKKA 3UZRA 3GOKA 4KA3A 2YITA 4LOQA 4BBEA 4I0RA 5CNOA 5DHJA 2Z60A 4JR7A 5AAFA 4M84A 2XJ1A 4A4LA 4EH8A 2A2AA 1YKRA 3EH9A 2J0MB 2ZM4A 4HOKA 3COMA 3KQ7A 4GYGA 3LIJA 2JAMA 4B4LA 3D15A 5AX3A 3FYJX 3MVLA 3ZLWA 3FXXA 4FSNA 2XK7A 2BKZA 3FHIA 1IA8A 4S34A 1REJA 4O0VA 4J53A 3WZKA 4ACHA 3QHWA 4D0XA 4LG4A 2PMNX 4JL9A 5AV1A 3WILA 2VWUA 1ZYJA 3G0FA 4ACCA 2XNBA 5FRIA 3FXZA 4YJVA 3FZPA 1ND4A 3D7TB 3ITZA 4BRXA 2ZM1A 5IA4A 4PNIA 4BDCA 4AAAA 4EH9A 3I7BA 3QUDA 3EMGA 5A9UA 5I4NA 1KE7A 4NCTC 5E8VA 2ONLA 1M52A 3R00A 4NKSA 4BCIA 2ITYA 4DH7A 3QLGA 4E4NA 2WMQA 4FTIA 4ANMA 5FG8A 5HO6A 3WIKA 4YO4A 1FGIA 1VR2A 5EQEA 2F57A 4FYNA 4QPAA 3RHKA 3ORTA 5FLFA 2PTKA 3MFRA 5E8TA 3KMWA 4EHEA 5M55A 5TE0A 4QTEA 3R1QA 1AQ1A 3O71A 3PIXA 4RJ3A 5HLNA 2HOGA 3UPXA 3R8MA 4Y73A 4EOIA 3E62A 3KVXA 2ZV8A 2GHMA 3HYHA 1WVWA 2X6DA 3MIYA 4CV8A 4CLJA 4BHZA 4G3GA 3JR1A 3PXFA 4ENXA 2G2FA 2VGPA 2W9ZB 3QRTA 4DFZE 1WVXA 3ACJA 4JRNA 3E88A 2I6LA 4XG3A 4FT0A 3HA8A 2R2PA 1CTPE 3NUNA 1OITA 2ZM3A 4DE4A 1I44A 4BY9E 4R7BA 3MA3A 4X2KA 2F9GA 3QQFA 1U5RA 4HCUA 5C8MA 4CFFA 5JKGA 5BVDA 4CG9A 5M4IA 2B54A 5AEPA 4O86A 4O7TA 2HELA 4H3BA 3R8LA 3RWPA 3UZPA 4YO6A 3W33A 1J7IA 1UU3A 4AE9A 5IEYA 1G3NA 3AC5A 3S2PA 2ONLC 3GCPA 4S30A 3PSBA 3KF4A 4HGSA 4QYEA 5I5ZA 3IW8A 2VO7A 3GXLA 2HENA 3OCGA 4IXPA 3QQHA 5EOLA 1APME 3WOWA 1FINA 2C68A 3GCUA 4ZTHA 4DH3A 4ACDA 3NUXA 2GQGA 4OT6A 4BCFA 5BNJA 4DC2A 3M42A 4K8AA 5AR7A 3FEGA 2E9NA 3VNTA 4FNZA 4PV0A 4WNMA 2OH0E 5DGZA 3EOCA 1UNHA 2IPXA 5LJJA 3VF8A 2OGVA 2BTSA 1U54B 3TUDA 3PE1A 1PMNA 5CU2A 5AIKA 3LXLA 2WOTA 1YXXA 4O22A 2JBPA 4XS2A 5L8JA 4YJNA 4PQNA 2ZOQA 3I79A 5A4EA 2XEZA 4B99A 5IUHA 2PYWA 2Y0AA 2BHHA 2SRCA 2WQBA 5JFXA 1WZYA 3W1FA 4X3JA 4ZTSA 2IZRA 1ZYCA 4RG0A 1M17A 2ITOA 2BIYA 3C51A 2A19B 3GT8A 4EOPA 5J87A 4BGQA 2VTAA 4FSZA 3NIEA 1MUOA 4BN1A 3RAWA 3NW5A 3R9HA 3W55A 3CPCA 1BI7A 3BYSA 5H8BA 4E20A 4CCUA 4GT3A 5BUJA 2W1CA 4RLLA 3NIZA 2UVYA 4L6QA 5AV3A 2VTQA 5DN3A 4KBAA 4O84A 3U6IA 2OBJA 2QLUA 3KRJA 4BYJA 4ASDA 3E93A 3SDJA 4JG8A 4R78A 5HIDA 4IB0A 1UWJA 3ZSHA 1WCCA 4F1OA 4YLLA 4IWQA 2W1GA 3TEIA 4RJ8A 1OUKA 2BMCA 3UJGA 3QX4A 4QO9A 3V3VA 4BCOA 1NY3A 3QKMA 4CRLA 3GQIA 3F3WA 3MYGA 4JDJA 4A4OA 3COKA 2QOIA 3HKOA 4G3DA 2ERKA 2OXYA 2WU6A 2C3JA 3U6JA 2C6IA 2QO2A 4S32A 4A9RA 3QUPA 4FTNA 2PVNA 3MPAA 3RPVA 3UO6A 4XV1A 4PTEA 3O0GA 4BF2A 4RVKA 4IWOA 4IZAA 1G5SA 5FTOA 3VF9A 2HW7A 1OPKA 1XKKA 2BRGA 5EHOA 5BYLA 3F5GA 4HVDA 3LCSA 4I22A 3QFVA 4OTQA 3FY2A 1YI6A 5LXMA 4KBCA 2VU3A 5BUIA 1J7UA 4AZEA 2GNGA 2WQEA 2XKCA 2PMLX 4YZ9A 4I93A 2W1HA 2J0KA 4FF8A 4CMOA 2VWWA 4X2GA 4IDVA 4BI1A 5IQAA 3U87A 4KSQA 3SRVB 2XK8A 5HCYA 4FV1A 3BHHA 3IG7A 4O27B 2WTIA 4QYFA 4PPAA 3NX8A 3C4XA 4M3QA 3RALA 5LARA 4TW9A 3OT8A 3FL4A 4V05A 2GNIA 3F2RA 2WO6A 3EFLA 4C3RA 2CCIA 2PUUA 2ESMA 5DVRA 3CEKA 4AA0A 3QRIA 4GW8A 3QZIA 1JPAA 4ZJVA 2XNPA 3MS9A 5EI2A 4K9YA 3SVVA 4K0YA 1ZY5A 1CMKE 4AXAA 3PUPA 4I20A 2XNOA 2PUNA 4NW5A 4E26A 4ONAA 5EYDA 1YWNA 4MXAA 1XH9A 3WI6A 4OAUC 4KNBA 4EOKA 4LUEA 4F65A 3ZM9A 4H58A 4YNEA 1GOLA 3E5AA 2B7AA 3RZBA 1JLUE 3P4KA 2GFSA 5M08A 2XUUA 2YHVA 2CNUA 5E8UA 5ETCA 4N70A 5DRDA 4HCVA 4RZVA 2XIRA 1YQJA 2YM6A 1I09A 3R2BA 3UQGA 4NW6A 4C0TA 2WTJA 4NEUA 3BHTA 2XKDA 5GZ8A 2A4LA 4EI4A 2WQOA 4HZSA 1R78A 4CTBA 2XNMA 3GENA 1UKHA 1KSWA 3MWUA 4E6AA 3HX4A 2ERZE 2WMVA 3O8TA 5CU3A 2C47A 3LW0A 4B8MA 1BLXA 3FMJA 1XQZA 3D4QA 4B8LA 3PVUA 5BYYA 1TQMA 3HLLA 4PY1A 2PVHA 2YIYA 4TNBA 1J3HA 3O8UA 3DQWA 1XWSA 5IDPA 2X39A 3O51A 5GIOE 2C5VA 2UZOA 3HL7A 2HW6A 3ROYA 1UV5A 4ZS4A 1M2PA 5L6PA 2O63A 4WA9A 4E8AA 1JNKA 2BUJA 3PZHA 5IQIA 2B9JA 4ZSAA 2I0YA 2R7IA 3H0YA 4TT7A 3SXFA 1STCE 3UNKA 4BICA 3HNGA 1NVQA 1W84A 2BAQA 4FV3A 5AR4A 3O7LB 4XBUA 5EM8A 3HA6A 3A7JA 4R77A 2JKKA 3R28A 3L8VA 3ULIA 4DGOA 3DZQA 5CEMA 3DGKA 4FKPA 5HHWA 4F63A 2JIIA 3QWJA 3FLZA 5CENA 4FNWA 5DE2A 3VBVA 3HV7A 3OBGA 4AP7A 1Y6BA 2XBJA 4BCPA 4E4LA 4ANSA 5LVLA 1YDRE 1YOMA 1UWHA 4UXLA 2XEYA 3PPKA 4FC0A 4U44A 4E5BA 4NH1A 4UMUA 4U42A 4U5JA 5JQ5A 4U81A 2VWZA 4XG6A 3TUBA 3VS4A 4XV3A 4M14A 3FPQA 4EONA 2I1MA 2C6TA 1Z5MA 2X81A 1KWPA 4GG5A 4JQEA 4U41A 4D9UA 2RGPA 1ZARA 3FSFA 5HOAA 5EW3A 3VBYA 2JD5A 4JAJA 2BTRA 3LM0A 4WKQA 4QMWA 5HD7A 4HYIA 3PIZA 2E9UA 3SKCA 3KVWA 4AQCA 3G5DA 5D12A 3K2LA 4MF0A 5AUXA 4B7TA 2XF0A 1OIUA 5AUVA 2EVAA 2QG5A 4O7WA 2Z7LA 4IVAA 2QKRA 2YM5A 1ZOGA 4ZOGA 2J0JA 2HZ4A 3ETAA 3KRWA 4JAIA 4PTCA 1OGUA 3FLNC 4E3CA 4F7LA 3PFQA 3FZ1A 4FIIA 3DLSA 1FVTA 3HMNA 3OG7A 3IDBA 3FKOA 5BPYA 4R3PA 1O9UA 3KK8A 3P9JA 3RWQA 3MB6A 1NA7A 3PLSA 5A4QA 4DAWA 4F09A 4DTAA 4X21A 5E90A 4FX3A 5K3YA 3DXPA 4ZSGA 4LYNA 5CU4A 2OFVA 4Y72A 3UC3A 1MQ4A 1B38A 3EN9A 3KA0A 5CTPA 4AN3A 4ANNA 2OO8X 4FZDB 5DT3A 2YDJA 4JQ8A 3PVGA 1YDTE 4UALA 1JOWB 1PYEA 2E2BA 3IECA 4FTCA 4NU1A 4YLJA 4LGGA 4AW0A 3QALE 5CSVA 2C3LA 3LMIA 2H9VA 5CT7A 3NGAA 3ZLXA 4IAIA 2YJRA 5CU0A 5HG5A 2PHKA 3QBNA 2QR8A 4ZY6A 3F61A 3R7YA 4OTDA 2JAVA 2QCSA 3W16A 3KRRA 2VD5A 3GC7A 3LFFA 4RJ4A 4UWYA 3OW4A 4O2PA 1Q61A 3ZRKA 1H1PA 2WTVA 3ZO3A 1FVVA 4BWXA 2O3PA 3RJCA 3W8QA 4YUQA 4F99A 4BI0A 2JFLA 3PJ1A 1P4FA 3COHA 5D1JA 4L68A 3EL8A 3QXPA 3W2PA 4NM3A 2EXCX 3E64A 3UVPA 3MA6A 2GQRA 2P3GX 3A60A 3KF7A 5AUWA 3M1SA 2XIKA 4WUAA 4CVAA 5IMEA 4P4CA 1ERKA 2W4JA 4CFVA 2IWIA 5IA2A 3GFWA 3OWPA 4GG7A 5L2TA 4I0SA 4F6WA 3OOGA 4F9BA 2G9XA 3ZO1A 5B2LA 3RK5A 3DBEA 2FSLX 3L9PA 3Q96A 4QD6A 3GP0A 5C9CA 4AA5A 5F94A 4CZYB 4J7BA 3KMMA 4L43A 4CZTA 2G2IA 2IVUA 4OTHA 4EOOA 1SNXA 5HO7A 5AP6A 2CPKE 2EU9A 4QMQA 3W2CA 5K9IA 3OCSA 3F3UA 1MP8A 3D2IA 5E8ZA 4BCNA 1G8SA 2X4FA 3LCTA 2R5TA 4PPCA 1OIQA 4A9YA 2BIKB 4L52A 1EH4A 5HVKA 4JDIA 3COIA 2X2LA 3EYHA 4KIKA 4EQMA 4HVHA 2OIDA 2XNEA 1ZMVA 3ZZEA 4L53A 2ZB1A 4BIEA 4GCJA 5A46A 4C3PA 1ZWSA 2NRYA 2XB7A 4IX6A 1KE8A 5CNNA 1WBTA 2C3IB 3ANQA 2F7XE 3CXWA 2ITPA 2VUWA 3H10A 4G9RA 4U8ZA 4W4WA 5CT0A 4QMMA 5ANEA 4LL0A 2X2KA 4FV2A 3WF5A 5I9VA 3ORPA 4F6UA 3POOA 3UTOA 5JRSA 3MH3A 3Q04A 2Z7QA 2BPMA 1E1VA 1Y8GA 4IAAA 4MX9A 4Z55A 2GNHA 1VJYA 1FPUA 5FD2A 2HZIA 1URWA 3A8XA 3OXIA 4DITA 4FTOA 3QX2A 5HCXA 4EH7A 5H9BA 4XMOA 3RNYA 5GNKA 3HVCA 5BVEA 4O21A 3QD3A 2C5NA 4QMNA 4ID7A 5HQ0A 3ENHA 4D4YA 3UO5A 3LQ8A 2XJ2A 3F5UA 4I6HA 3WZDA 4TY1A 3BHYA 2I0EA 3OXTA 4O91A 1QPDA 4L46A 5D7VA 4FUXA 4D9TA 4IE9A 4ZMEA 3LVPA 3Q9XA 4FV9A 2JKMA 3CCNA 3PY0A 4UEUA 4BIBA 2CNQA 5AJQA 3HAMA 4RVLA 3KN6A 3E92A 3JVSA 2XIXA 3IW6A 4YTHA 3BE2A 4GIHA 5AIRA 2CNVA 4P7EA 4G3EA 3R7EA 4C4JA 2VO6A
chains in the Genus database with same CATH superfamily
4IWPA 3THBA 2J50A 5BUEA 2C0OA 5TKDA 3FKLA 5FEQA 1WFCA 5AV0A 5GIPE 3QD4A 2AUHA 4BCGA 2GFCA 3HAVA 4XOZA 3BLAA 2VN9A 4JBPA 3EQBA 5BVFA 2CGVA 5ANOA 3C4CA 4KD1A 3R7IA 2YIRA 5AR2A 2C4GA 2PUIA 3DCVA 1J1CA 2OG8A 2XYUA 3BU5A 2WTDA 3R21A 4NWMA 3VJNA 1IAJA 1BMKA 2BAJA 5HIBA 3VONA 5HICA 2ITZA 2QO7A 2OU7A 3UIBA 3F82A 2YM8A 3CPBA 4V04A 2W1FA 3KXGA 3QTUA 3VQUA 3BIZA 1DI8A 3FY0A 4FIEA 5AP1A 3OVVA 4HVGA 3FMEA 3GU4A 4I0TA 5FUTA 3NFGB 4Q2AA 3DNDA 4V0GB 3SG8A 4NM0A 3NYXA 3UVQA 4ERKA 4CTCA 2WHBA 3VS3A 1PF8A 2ZV9A 1LEZA 4HPUE 4M69B 3NYNA 4O0SA 5GHVA 4WBOA 1OKVA 4WNOA 2VAGA 1UNGA 2IO6A 2X9EA 3A7IA 4FSRA 4JIAA 3PTGA 3O2MA 4JR3A 4DYMA 5IZFA 3GNIB 5ANJA 2Q0NA 4BDDA 5HG7A 4YJRA 4HW7A 2GHLA 3I0QA 5C27A 5H8EA 2QO9A 4HCTA 2KTYA 3LFNA 4F70A 5EDPA 2DYLA 5EHLA 3N4UA 5CQUA 3HDNA 2VTJA 3KULA 3LLTA 4J97A 3OZ6A 1OKZA 3NFFB 2QR7A 1M7NA 4CRSA 5LMKA 3QRUA 3R73A 2IN6A 3TV4A 5I9UA 5DRBA 4TYHA 2X7OA 1CM8A 2WMAA 1QPJA 2BDJA 4W9WA 3QGYA 3PVBA 3UP2A 4IEBA 4LRMA 1SYKA 4C4IA 5JQ8A 4O1PA 4PMMA 3OS3A 1JSVA 5IUGA 1V1KA 3TACA 4NYEA 3IW4A 4UZHA 1CKPA 2EUFB 2QOLA 3FMDA 1YRPA 3ZOSA 4I4FA 5K5XA 2OSCA 2XH5A 4S33A 3SD0A 5HLWA 4ITIA 4U6RA 2YDIA 3BE9A 4IM3A 4RPVA 2PWLA 5I0BA 4FEQA 5KKRB 2HZ0A 3W0MA 1QPEA 4MWIA 4YJUA 5JZJA 3GCVA 3NPCA 3A2CA 3A62A 3GC8A 1T45A 3E8NA 5HE0A 5ITAA 3MJ2A 2R3IA 3UDZA 4OT5A 4HVIA 4YTCA 2OXXA 4FIJA 1H0VA 3NMUF 4AFEA 1G8JA 4HZRA 3ZC5A 5LMBA 3HGKA 3TDWA 3AMAA 4PNKA 5KUPA 3RI1A 4JMQA 2F4JA 2J6MA 2G2HA 3G0EA 2JBOA 2OWBA 5M4FA 3FI3A 2ITVA 4TL0A 4BKYA 1ZRZA 2GS6A 5L2IA 4C2VA 4MEDA 1CKIA 4NJ3A 2C6MA 4I23A 3BGQA 4Q5HA 4JX3A 2PL0A 3IONA 2C6OA 4IHPA 3PPJA 4FTKA 4J71A 4L00A 3BV2A 3RAHA 2W5HA 4L44A 3I4BA 4D28A 4DHIB 3H9FA 5HLPA 2WFYA 3QYZA 3FZTA 4PMSA 1K3AA 4AT5A 3UQCA 4G6NA 2OIBA 3MB7A 4OBQA 2JDTA 5KMIA 4WG5A 2OJIA 3D5WA 4MYGA 4NTSA 2XAMA 3PYYA 4L01A 2VWIA 2YWVA 2VTTA 1Q8UA 2DUVA 3ZZWA 3AD4A 5J7HA 4FODA 5K4IA 3BQCA 3T9TA 5IQCA 1PY5A 4FTJA 4YGAA 4H39A 4KIQA 4UMPA 1OL6A 3PXZA 4BDAA 4CCBA 3VWAA 4FGBA 3GVUA 3ODYX 3T3UA 1K9AA 1L8TA 3QCQA 3P1AA 4GYIA 2PVMA 5LQFA 1XH4A 3GGFA 4UZDA 1XH8A 5J8IA 5DMZA 2B55A 4MWHA 4X2FA 4Z7GA 1F0QA 2WB8A 1OKYA 2FYSA 3LJ1A 4MD7E 3ZEWA 2PZIA 3GI3A 1YXVA 1V0OA 4IW0A 3PXKA 4GK4A 4XLIA 3FKNA 1ZYSA 1W82A 3OUNB 3A8WA 2OZAA 3VS0A 4L9IA 4CLIA 3MFUA 3KEXA 4PTGA 3GC0A 3MBLA 3OEFX 4LL5A 1YHWA 5LVOA 3AG9A 4QYHA 4O1OA 2WNTA 3VS2A 2BDFA 5L6OA 3MTLA 4DBXA 4BYIA 3DBCA 4UN0C 2FUMA 2GS7A 3PG3A 4S31A 2UV2A 4DCEA 3F3TA 3DB6A 4W8EA 4EC8A 4C02A 1H4LA 2HYYA 4HGLA 4ZSLA 4BZDA 4JG6A 1IR3A 3LCDA 4RBLA 4DGMA 4EH6A 5CANA 4JX7A 3TV7A 4GT5A 3FLYA 4UWCA 3R7GA 1TQIA 3TG1A 2V7AA 1Q99A 3A61A 3CJFA 5CXHA 4BTJA 3LCKA 3U51A 5IA0A 5K4JA 3UVRA 4ACMA 1JSTA 1FMKA 4ANQA 5DLSA 3P0MA 2A27A 4QNAA 3IGGA 2W7XA 3FDNA 3JPVA 4H36A 4F0GA 3PXQA 4IAFA 3FAAA 4AZFA 5J95A 4FVRA 4YU2A 2CMWA 4IM2A 1IG1A 3V5JA 1TZDA 3EQFA 3ZBFA 4AZVA 4NSTA 4D0WA 3KMUA 3AMYA 4CSVA 1OB3A 1MQBA 1K2PA 2HXLA 2V7OA 1UU8A 2WPAA 4O7YA 4NZWB 4FBXA 4HJOA 1KE5A 1WBPA 3TNHA 5JGBA 4LMUA 1BL6A 2FSTX 3NCGA 3DDPA 3VHKA 2QOQA 2W4KA 3VBWA 5JGDA 2J0IA 2OZOA 2X0GA 4TYJA 1MRVA 2F49A 3B8QA 2C6KA 2HK5A 3LQ5A 3ORMA 4RIWB 1PMEA 4GS6A 4TPTA 4DGNA 3Q53A 4D5HA 5CASA 4AGUA 2CN5A 4QMXA 5ACKA 3RAKA 3FLWA 3UO4A 3G9NA 5JSMA 3BBTB 3HRBA 4BBMA 4WSQA 4DG2E 4U0IA 5KX8A 2CKEA 4E93A 4FSUA 3IW7A 3RKBA 4JBOA 2H6DA 4MBIA 2QOKA 3I7CA 3F3VA 4G1WA 4IAKA 5D11A 4YSJA 3HRFA 4GJ3A 1Q24A 4DF3A 4I5CA 3U9NA 3MI9A 4J98A 4EORA 4A9UA 4DG0E 4YPSA 2WEVA 3AT3A 3K5UA 4QMTA 3W8LA 4FEWA 4ANOA 3NW7A 4FICA 2ZMCA 4EWQA 4RWLA 3U4WA 2X7GA 4GKIA 5C8KA 2VX0A 2YCRA 4WUNA 3Q6WA 3WIGA 2ITQA 4R6VA 3PY1A 4BHNA 2XNGA 5KMOA 2V0DA 3NR9A 4IAYA 3PVWA 3MW1A 5EDQA 5HVJA 4G5PA 1J1BA 4CFXA 5IDNA 2WU7A 3ALOA 5EHYA 4J8NA 3D94A 3QD0A 5AR5A 3KXZA 2UW6A 3LMGA 3ZLSA 2HY81 5CZHA 2JEDA 2UW7A 1YXUA 3G9LX 4L42A 5EDRA 3VRYA 2CJMA 3NVMB 2ZB0A 4FEUA 1P14A 3MH2A 3QQJA 4RIXB 4Z9LA 4RC2A 5C26A 5LWMA 3PJ3A 5IEVA 2X8IA 3IW5A 4FZAB 4LUDA 3A4PA 2W9FB 3I5ZA 3L8SA 1BUHA 2EB3A 5IQEA 4C36A 4RA5A 1UVRA 4ALVA 4P5QA 2ITXA 2C5XA 5CZIA 5D10A 3ORKA 2VRXA 4U9AA 3QRJA 4R3RA 4GFMA 4FV8A 4C34A 3GC9A 2PE0A 4O0XA 1UNLA 2JKOA 4IMYA 1PKDA 2BCJA 3DB8A 4NT4A 4DFLA 1PXPA 3BEAA 3R71A 5EYKA 4IANA 5KCVA 2PUPA 3C13A 4BDFA 2Y6OA 2XRWA 1R1WA 5CX9A 3UP7A 4NM7A 4F7SA 4PDSA 3AOXA 4DCAA 4EHVA 1H1QA 4Y83A 4ZZNA 2VV9A 1YDSE 2BZKB 3KC3A 4G17A 5IEXA 3D7TA 5EM7A 5DEWA 5AMNA 2R0UA 2OJJA 3GFEA 2ZDTA 3LFCA 3UG2A 2XIYA 3I6UA 2PSQA 3FQHA 5KE0A 2IW8A 1HOWA 3EZRA 4DEDA 1GZ8A 1JKKA 3GCQA 5C4KA 4GU9A 4ARKA 5A14A 3BHUA 2W1ZA 4BCKA 5CVHA 1LPUA 2QOFA 1NT2A 2WMWA 2XKEA 2B9HA 5AP0A 4ZXTA 3K5VA 4G2FA 4IACA 4Y85A 2WXVA 3U6HA 4E7WA 3TT0A 2CN8A 2X0OA 4DA5A 1JWHA 4Y5QA 4XLVA 1XJDA 3SW4A 4RFZA 4A07A 5M09A 3TZ8A 2VWVA 3O17A 3U8WA 3TZ9A 2RL5A 3BLQA 1YWVA 5DT0A 1W0XC 4C35A 2BFYA 3BL9A 2PULA 2OH4A 2HIWA 2IVTA 3WF8A 4NM5A 4QMPA 2RKUA 4XP2A 3EN5A 4QNYA 4MXCA 5F4NA 1VYWA 3PA3A 3IKAA 4MH7A 1HCLA 2GSFA 5HG9A 3ZFYA 3PLAE 4NTTA 4IIRA 4IADA 3ZFMA 4AZSA 3PFYA 3DZOA 2JIUA 2OXDA 3PSCA 4U43A 3UG1A 2BZJA 4KABA 5DWRA 4FKUA 3DKOA 4AN9A 4MNFA 4O0WA 2IVVA 3OF0A 5J79A 3LFSA 4FL2A 2C1BA 2RFSA 4M67A 1ZMUA 5GZ9A 1H00A 3Q2MA 5CXZA 4QDVA 3ZUVA 3NAYA 4TWPA 5ETAA 4L7FA 2BILB 3PE2A 2NP8A 2WTWA 4IX3A 3SQQA 4AA4A 5BV3A 4FA2A 1JAMA 3EWHA 3KRXA 4GUBA 5AR3A 3OWLA 1KE6A 4FKWA 3D5XA 4ALWA 3IK3A 4DFUA 1WBWA 4D2RA 5DFPA 2Z8CA 4KSPA 5ANDA 4R7IA 3AQVA 4R8QA 1JKLA 4FEXA 5I3OA 4ZJJA 3ZC6A 4WNKA 2QI8A 4FZFB 4CMTA 4QP8A 3FHRA 4RIYA 3QTIA 5AUYA 1BX6A 4NL0A 1U54A 1OKWA 1ZYLA 4BTMA 2VTNA 2UZNA 5BX0A 4I6FA 4FTQA 3AT2A 4JDHA 3LCOA 4OW8A 3R8ZA 4U80A 2O65A 3NAXA 3EQGA 3CP9A 3OXZA 2HCKA 2NRUA 1PXKA 3U9CA 3EIDA 2O2UA 4DHJA 1YWRA 1OZ1A 1YI4A 3QQGA 3UDBA 1WBSA 2QOHA 3ZHPC 5AFVA 3EN7A 4DEEA 3MFSA 5B2KA 3SXRA 4D1SA 2BVAA 2F2CB 4XBRA 4YZDA 3ZYAA 5ICPA 4J95A 4EEVA 1A48A 2OKRA 3I1AA 4ZSJA 4EKKA 1CSNA 4TNDA 4YC3A 5EM5A 1F3MC 3CE3A 4X6RA 4O4EA 4QP7A 1SM2A 1PXIA 4QP4A 2IW9A 5FEDA 4BGHA 2J51A 5LVPA 4BVUA 2OJ9A 4MHAA 3EN6A 1H0WA 4FIHA 4IX4A 3RP9A 3S4QA 3DKFA 3R01A 4K11A 3G6HA 1S9JA 3JYAA 1PXNA 4WOVA 3TV6A 3VIDA 4BTKA 4F6SA 4F9AA 5LVNA 3CKWA 2W4OA 1XBAA 4G34A 5KBRA 5L8LA 4AG8A 2Y9QA 4O0UA 5CEIA 4FEVA 4TTHB 4HVSA 3IQ7A 3OCBA 4KKHA 3TCPA 2W06A 4DTKA 2JGZA 5L8KA 2R3MA 2ZAZA 1PXLA 2J90A 1R3CA 4FYOA 5GJDA 5E8SA 4RT7A 5E1EA 5ACBC 4J1RA 3SX9A 5KMLA 5C03A 2J5FA 3BCEA 2QVSE 4OLIA 2WQNA 4K18A 2R3HA 2R64A 2YWPA 4Y8DA 2QURA 2PVRA 3UOKA 4EUUA 5J1WA 5AM7A 2G15A 3NZ0A 3KB7A 3HZTA 4DBNA 2J2IB 3QKLA 4ASZA 4FIFA 3W2QA 3QTXA 3IPHA 4S2ZA 4FKLA 3LHJA 3TNIA 1Z57A 2PVYA 1PJKA 5FP5A 3WF9A 1B6CB 4JRVA 2VNWA 1A06A 3ZH8A 1TKIA 3FZRA 1CKJA 3EKKA 3F7WA 3HEGA 1FMOE 3ORZA 3SRVA 2JFMA 1VLRA 3CD8A 4ZLOA 5E9EA 4DN5A 4MXXA 3VULA 1Q8YA 4QYGA 3DPKA 4FKQA 3R7UA 3T9IA 2VTPA 4DFYA 1BI8A 2AYPA 4L3LA 1OECA 4I92A 1L3RE 4YJTA 5IF1A 3TL8A 3VW8A 2R3RA 4WO5A 4CKIA 4M12A 3WARA 2F2UA 4IZYA 3KXHA 1OL2A 4KIKB 2GPHA 1PKGA 1CDKA 5K5NA 4GFGA 3I0OA 1YHSA 3FE3A 4QMUA 2ITNA 5HGIA 4O38A 3G90X 4FV6A 4ERWA 3QGWA 4BDKA 4FL3A 4BCJA 4AOJA 4LV5A 2X6EA 4MBLA 4DFNA 2AC5A 2XMYA 3OD6X 3DK3A 4GT4A 4MNEB 2G01A 2WTKB 2YEXA 4JIKA 3TKIA 2XK3A 2QOBA 4JDKA 3W18A 1GZOA 4CGAA 1DS5A 5K0KA 4BC6A 3R8PA 5IQFA 3QL8A 4R5SA 4MAOA 5L4QA 3FXWA 3L9LA 2X0PA 1R0EA 4MXZA 3BWJA 4YR8A 3W2RA 5CY3A 3QZGA 4YJOA 1ZAOA 4TKSA 3OCTA 4RQVA 2XYNA 2OJGA 2YABA 4QP2A 4ITHA 4QOXA 4RWJA 5CYIA 2BALA 3P5JC 4PDOA 4H1JA 3E7VA 4YLKA 2XBAA 5EYCA 3Q3BA 4ZTRA 4F1TA 4FGRA 4ORKA 3R9RA 4FVQA 1JVPP 5FBOA 2GNFA 3C5IA 1U5QA 2B1PA 2CCHA 3ZDUA 1Q62A 5M51A 1ZMWA 5J9LA 4AS0A 3KXNA 4IWDA 2W5BA 2XK6A 3QAME 5CAPA 4IH8A 3Q6UA 2QKWB 3R7OA 2BZIB 5JN2A 5A3XA 4N6YA 1KOBA 2UW4A 1SVEA 3BGZA 3DLZA 5AP2A 3Q9YA 3F2NA 4TN6A 4ZTMA 2DWBA 5L2WA 2XJ0A 2EXMA 2ZMDA 3VW6A 3HMOA 4GMYA 3ZXTA 5HD4A 4FTMA 4XNEA 5L2QA 3V8SA 4AGDA 4O81A 2B53A 3DFCB 2IW6A 4X3FB 2P0CA 4MBJA 2R4BA 3NVKI 4WD5A 2ZJWA 4ZSEA 3DJ7A 4O4BB 1XH5A 3TXOA 4AT3A 2J4ZA 4EH3A 3A7GA 2C0TA 5CQWA 5HE3A 3R83A 4WRSA 5IQHA 4NIFB 5ANKA 4EJ7A 3SG9A 1PXJA 3Q5IA 4E6CA 1J7LA 4RMZA 3PJ2A 4J99A 5CS6A 3DKCA 3PSDA 3ZRMA 3QLFA 5DT4A 3UMWA 3JS2A 3M11A 5LCKA 1QL6A 3G15A 3GU5A 4FKOA 5FM2A 5HTCA 2WZJA 4O7VA 3A99A 4AF3A 3FSKA 5JMSA 5AR8A 3BHVA 2VX1A 3UMXA 5DNRA 3BU6A 3C5UA 3LPBA 4UMQA 3ZFXA 2WD1A 3OTUA 4DGGA 4AAYA 3E63A 2C1AA 3EQDA 1NW1A 3QA0A 4TYIA 3GUBA 3WZEA 1GZNA 2WIHA 2I0HA 1W7HA 4PL3A 5DG5A 3UC4A 5L2SA 1U59A 3W2SA 3V5LA 5C8NA 5FEEA 3ZO4A 4HYHA 3BWFA 1WMKA 1PXOA 3GOPA 4YSMA 3DBQA 4M8TA 3VS5A 4BDGA 4PP7A 2IG7A 3W10A 3V01A 4DEGA 4DFXE 3GQLA 3DAJA 5TO8A 3QA8A 3U54A 3PXRA 2LGCA 3OTVA 1OPLA 4O7SA 4QRCA 3ZXZA 3OFMA 4E4XA 4LM5A 3OBJA 5ANIA 2W96B 1PHKA 4UV0A 3WZJA 4DINA 4ANBA 2OW3A 5E8YA 3V6RA 1OL1A 4BDEA 5CI7A 2GQSA 4A7CA 4GU6A 2Y8OA 1M2QA 2QHNA 5LMAA 3QXOA 3RGFA 4E5WA 4EQUA 2QG7A 4GKHA 1E9HA 1YOLA 2YDKA 2R3LA 4FV0A 4UYAA 4GJ2A 4L45A 4WHZA 4DH1A 2ZFYA 4QMLA 3C7QA 3VHEA 4I24A 4B9DA 2P55A 4CV9A 3BLHA 3MGYA 3DKGA 3HMPA 3TWJA 3C4WA 4JOAA 1SVGA 3O96A 5E92A 4KBKA 3R8VA 1OIYA 4YZCA 3ZSIA 3RM7A 2NNWB 2X8EA 4XV2A 5DA3A 1Q4LA 2PMIA 3NEWA 3RAIA 4QEBA 5HCZA 5FBNC 3B2WA 2H8HA 3VS1A 4AACA 2VO0A 4ZS0A 4AGWA 4R5YA 1OI9A 2RG6A 4BIDA 4ZP5A 1IRKA 3PIYA 3QD2B 3DTCA 2Z7SA 4IZ7A 4CFUA 1NVSA 4FIGA 5LWNA 3UIMA 3ERKA 4FV5A 3NS9A 3QTZA 4GRBA 2XVDA 2WMXA 4AXFA 3DK7A 4D2SA 2GDOA 4G6LA 2JKQA 5HESA 4QMOA 3P7AA 4PMPA 2ITTA 1Q41A 4XP0A 4F9CA 1SZMA 2UZEA 4RVMA 3LLAA 5G1XA 5C4LA 4XH6A 2HAKA 4EH5A 3ZU7A 1XBCA 2R9SA 1KV2A 3HMMA 3KGAA 3NYOA 4GH2A 2UVZA 3N4VA 1QPCA 2R3JA 2XAOA 3JY0A 3W0RA 4YZMA 5FM3A 2WOUA 2YA9A 4J52A 3ZBXA 3BZ3A 4ZMFA 2VTLA 4EBVA 5HNBA 3H4JA 2I7QA 4NUSA 3QC9A 4XG7A 3SW7A 4G5JA 3ZM4A 3KN5A 5CLPA 4CFNA 5AP4A 3JXWA 2FA2A 3SOAA 5CU6A 4YTIA 1Y6AA 4OTWA 3RTPA 1IASA 1LP4A 5IH6A 2Z02A 4CFWA 2QU6A 4WT6A 5JZNA 4FSTA 4OTPA 3OWJA 4GSBA 4LGDA 5AAEA 2C6EA 1R0PA 2RFNA 2X0QA 4I5PA 5FTQA 4CFMA 4I94A 2HWPA 2XZSA 4FOBA 4RIOA 4QTAA 4TWNA 2ACXA 2P2IA 3W0PA 4GFOA 3V51A 4C37A 4EOLA 4QP1A 3G51A 4FMQA 2ZV7A 3SA0A 2YERA 5M56A 1MRYA 4PL4A 2BRBA 1FGKA 4ZTLA 3LFEA 4AFJA 4CYJA 2CGXA 3CY3A 3TZ7A 1PXMA 4DEBA 5HX8A 4BZNA 4O83A 2X7FA 4I5MA 3ZEPA 3EJ1A 2WAJA 3ORXA 4MKCA 4F64A 3D5VA 3S00A 2OFUA 2PK9A 4O82A 4H1MA 4ZAUA 5CEOA 4RGJA 4CD0A 1RE8A 4RLKA 4AW5A 1R39A 4IC7A 4C38A 3PWDA 3FUPA 5T6KA 5G6VA 5M57A 3HUCA 5HTBA 4U45A 2VWYA 4MQ2A 1YW2A 3AC3A 5HI2A 1GIJA 2XIZA 4F0FA 4G3CA 5FXQA 4WSYA 5DYJA 3ORLA 3MY0A 2PVFA 2YJSA 2NPQA 4EYMA 4GVJA 1ST0A 2RF9A 4E73A 4RWIA 4E6DA 4JBQA 1VYZA 1WBNA 3NYVA 3CQWA 5AV4A 3BQRA 4K33A 2ZV2A 2C0IA 2HXQA 4ZK5A 4BWKA 3ATTA 4FKIA 3NNWA 1SNUA 3QRKA 4M68A 3FI8A 5C01A 5AUUA 3R6XA 4HYUA 3ALNA 4OGRA 3BGPA 4IC8A 2H96A 4FKJA 2F7ZE 4XX9A 4EOMA 2PPQA 3OP5A 3LE6A 5CALA 1H28A 5LMKC 4QQTA 4IVCA 5HZNA 4FNYA 3CGOA 4Q9SA 3VUMA 4BDJA 3RVGA 4WNPA 2R3FA 5KZ0A 3CTQA 4D2VA 4EK4A 3DAEA 4BDHA 4I1ZA 3R02A 4LRJA 3TTIA 2BROA 4KRCA 4QDEA 2CKOA 1P5EA 2HZNA 3N9XA 1UU9A 4YP8A 3R0TA 2XCKA 1ZZLA 3HP5A 3KU2A 3MY5A 3FMNA 5BQ0A 4XJ0A 5HX6A 5I9WA 4G31A 4RSSA 2P33A 4L3JA 5HIEA 2PU8A 4BFMA 2ITUA 2QHMA 2GNLA 5CSXA 5E1SA 3MVMA 1PW2A 3VUGA 3MPMA 3R30A 2C6LA 1VEBA 3F3ZA 3QTWA 3DJ5A 4O6EA 4R7HA 4YBKA 3U4UA 4AGCA 4YC6A 3UPZA 3FZOA 3PXYA 4D58A 4V0GA 4LFIA 4YJPA 2JC6A 3HV3A 2VO3A 5HE2A 3WBLA 1OL7A 1ZZ2A 3FZSA 4OTRA 4TYGA 3F88A 3HP2A 1VZOA 5D7AA 5HG8A 3UYTA 4ZTQA 4DGLC 2ZYBA 2OK1A 2IZSA 4FTRA 3RPYA 4XG8A 3FMMA 4GEOA 1IA9A 4FJVA 1H27A 3BX5A 1U46A 3M2WA 5D41A 2YM7A 3BYVA 2WMTA 3TNWA 3DA6A 4R3CA 2Z7RA 3C4FA 4LOOA 3LFQA 1A9UA 4EOJA 5JK3A 4APPA 3AD5A 3EFWA 1OBGA 4FUYA 5JFVA 4YHJA 2ZDUA 3ZLYA 1SMHA 4EYJA 4EZ7A 5HEZA 5J1VA 4D1XA 2WEIA 4HNIA 3NUAA 2CLQA 5JRQA 3EQIA 1J91A 4C4GA 1RW8A 1QCFA 4FG7A 5TOZA 4CMUA 2BAKA 3IS5A 3DFAA 5M53A 2QOCA 3WYYA 4W4YA 3WE4A 3Q9WA 5DOSA 3R8UA 4B0GA 4AQKA 4EZ3A 3I6WA 3NRMA 2QQ7A 4QQ5A 4BB4A 3WF7A 5EQPA 5A4TA 4MD8E 3UIUA 5DPVA 4DTBA 3DNEA 4D1ZA 4KUJA 2KULA 5KMJA 2PE1A 4C4HA 4M0YA 3EQCA 3S0OA 1PRYA 4GV1A 3ROCA 2UW9A 4O7NA 1ZLTA 2YISA 5GINE 2VTIA 2VTMA 3E87A 3LFDA 4J8MA 5IUIA 3V8WA 3OHTA 2X1NA 4I5HA 4C61A 5F20A 2XM8A 1BYGA 2PVLA 3AXWA 1WVYA 2A1AB 2E9PA 4JJRA 3OROA 5BMMA 3V5TA 5IA1A 4MUQA 3U55A 3DXQA 4O2ZA 5CVGA 3EN4A 1DAWA 2ITWA 4O96A 1IAHA 2EWAA 4HYSA 3TNPC 4U3YA 4A9SA 4XRLA 3CSVA 3MH0A 4I41A 4QQCA 4FR4A 1YOJA 3I81A 4BCQA 4EK5A 4Z7HA 5J7BA 3RM6A 2VNYA 2PVKA 2C69A 5E7RA 3TN8A 4DLJA 3GCSA 4P5ZA 5IA3A 3RCDA 2FVDA 5JH6A 2GCDA 3ZUUA 4MCVA 2UZBA 2V62A 5DR9A 4OAVB 2W0JA 5KO1A 1YVJA 5AUTA 1H24A 2YZAA 1P2AA 5IU2A 1OPJA 4RFYA 3Q4TA 1AD5A 3UNJA 1H01A 4IFGA 1FOTA 4IM0A 4O0YA 5HBEA 2XM9A 5E8WA 4BI2A 1TFFA 3MFTA 3QTQA 4DEAA 4KAOA 3R63A 5HNGA 1OUYA 3JY9A 2VWXA 2YCFA 2V5QA 2R3QA 3IDCA 1XMLA 4EQCA 4JNWA 4LOPA 2YM4A 3FI4A 4Q5EA 4DT9A 2C5YA 2RSVA 3BYMA 4AT4A 1BL7A 5DH3A 2X9FA 3RMFA 3C0HA 4K2RA 1O6LA 3L9NA 4F4PA 2XALA 3UODA 3ELJA 3REPA 5I9XA 5M4CA 4L67A 3EYGA 5KNJA 3HV6A 4A9TA 3R7VA 4RC4A 4X7QA 2Y4IC 5KMKA 3DOGA 3CQEA 3TJCA 4E4MA 4JQ7A 5EYMA 3NCZA 3PRIA 3VJOA 3TI1A 4HGEA 3QYWA 4JXFA 4RX9A 3FQSA 1OMWA 4O4FA 4CEGA 5FDPA 5KKRC 2XK4A 4F9WA 4PPBA 1NXKA 4L3PA 5A6NA 4X2JA 3UE4A 4AUAA 3FV8A 4FTUA 4IJ9A 4OTFA 3VQHA 4PL5A 1Z9XA 3NSZA 1HCKA 3Q4CA 3AD6A 3CD3A 3JVRA 4C4EA 5FTGA 1PMVA 4M7IA 1Q8ZA 1T46A 4NKAA 3OOMA 3N51A 5KHXA 3E8DA 4A4XA 4TXCA 5BYZA 3RK7A 3MTFA 3D0EA 2Y7JA 2CSNA 3KK9A 4O7RA 3EZVA 3QTSA 3O7LD 3PJ8A 3NUPA 3GEQA 3IGOA 3IDPA 5CF5A 1G8AA 4Z16A 2G1TA 5CSHA 4BJJA 3B2TA 5B0XA 2PZ5A 2LAVA 4XG2A 2J9MA 2GS2A 4QMYA 4XUFA 4E1ZA 5EG3A 3OC1A 3V04A 4RIYB 3MESA 2OLCA 3RHXA 4CKRA 1XMMA 5BVKA 4RVTA 2C5OA 4J96A 3VBXA 1W2DA 1W8CA 3L1SA 4RJ6A 1H1WA 4K77A 5H3QA 4GVAA 5KMMA 4MF1A 1XH7A 3FI2A 4ZLYA 2RFDA 2XNNA 1M14A 1DM2A 1M7QA 2UW0A 5F9EA 2P4IA 4YURA 3DJ6A 2R3KA 5JT2A 4I6LA 4WBBB 3AGMA 5DR6A 3AC4A 5EM6A 3A7FA 4KIPA 3VN9A 4FZ6A 4AZTA 5IISA 2EXEA 1AGWA 4PRJA 3L8PA 3QF9A 4NJDA 5EOBA 5H8GA 4F9YA 5CAUA 4KS7A 2OICA 2R3NA 3UOLA 3MPTA 4FG8A 5CVFA 1V0PA 4D2TA 1OVEA 4PX6A 3MDYA 4ACGA 3ET7A 3TKUA 4C33A 5J5SA 4H05A 3G33A 3S1HA