3FLYA

P38 kinase crystal structure in complex with 6-(2,4-difluoro-phenoxy)-2-isopropylamino-8-methyl-8h-pyrido[2,3-d]pyrimidin-7-one
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
349
structure length
347
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title The Discovery of Pamapimod, R1503 and R1487 as Orally Bioavailable and Highly Selective Inhibitors of p38 Map Kinase
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 111
structure length 347
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3flyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3flyA01
4RIXB 4AE9A 4U44A 2WNTA 5E8WA 2IJMA 4AACA 3C50A 4NWMA 3TKHA 5IDNA 2A27A 2W1ZA 3L8XA 4JR3A 4QPMA 5AUZA 4R5SA 2YA9A 3DGKA 3IOPA 3KL8A 4FZDB 4XOZA 5HCZA 3GC9A 3MI9A 1P14A 1SYKA 5AP6A 3PJ3A 4WIHA 3C1XA 3FMKA 4FL3A 4BGGA 1JNKA 1M17A 4E4XA 3KVWA 3LVPA 4IAIA 4OTQA 3ORLA 4X0MA 2E9VA 4U9AA 4CFFA 3QQKA 1CDKA 2VD5A 4I4EA 4OW8A 4LGGA 3LJ0A 4L7SA 4QMXA 3P4KA 2YDKA 1ZY5A 4W8EA 4CYIA 5FEEA 1WBPA 2YFXA 2FGIA 2W4KA 1ND4A 3PIXA 4AGCA 1YRPA 2JAMA 5FLFA 4D28A 4PMPA 4XG8A 4JX7A 2XKEA 4XV2A 1FVVA 4QPSA 2Z7RA 2XYUA 4FZAB 2LAVA 5CF6A 1H26A 4I22A 4EC8A 3QCQA 4XUFA 3TG1A 4FG8A 3TKUA 2W0JA 3W1FA 3H3CA 3VNTA 2XF0A 1Q8WA 5D11A 4FKRA 3LKMA 2VWUA 2YAAA 1H0WA 2BROA 2DS1A 4GSBA 1H28A 4KABA 2WMBA 4LQMA 4ZTHA 3JPVA 4DG0E 2W1FA 3CSVA 4RQKA 2PL0A 4CZTA 3R71A 5DFPA 4ALWA 4O0RA 1XWSA 3OCSA 5AV1A 3HEGA 3SKCA 2CKPA 1Q5KA 3GC8A 3NEWA 4GRBA 4WKQA 2BZJA 4I1ZA 4WD5A 5CI6A 5J9LA 4HGEA 3F5UA 3DTCA 2PE2A 3NAXA 3IKAA 3ORZA 2XK7A 1OPJA 4IWOA 4Y8DA 4ACDA 3K5UA 1OL6A 5H9BA 2PUIA 2BALA 1YKRA 2VO6A 5FP5A 2BIKB 4RRVA 3HMNA 2WB8A 4BDEA 5GIPE 2ERZE 3QYWA 4FSTA 3ZUVA 1J7LA 5EQEA 3IECA 2C5YA 4MD8E 3FJQE 1FGIA 1AQ1A 1PW2A 4H39A 4JT3A 2PVNA 4O7LA 2C6EA 2OK1A 2BRBA 2Z7SA 1J1BA 1OKZA 3R73A 4LRJA 4V04A 5DOSA 5HVJA 3O2MA 3FMLA 5LCKA 5TOZA 2X81A 2QOCA 3G2FA 4MQ1A 1Q8UA 4GW8A 4DE4A 4OUCA 2OGVA 2VX3A 4BDBA 3PJ1A 4IM0A 3MGYA 5G1XA 4MXAA 1UV5A 4LRKA 4RX7A 4A9SA 2UZNA 1OUKA 5FM3A 5L8KA 4F4PA 1CKIA 1E1XA 1W8CA 2GFSA 3CR0A 5FBOA 4V0GA 3ZO3A 4AFEA 4UV0A 2OFUA 3FL4A 2PYWA 1XQZA 4FOCA 4XG6A 4D4SA 4G3EA 4EH7A 3NCGA 5CVHA 3RAWA 4ERKA 4AN9A 4W9XA 1NA7A 3WF7A 4J95A 2VTTA 3FSKA 4O38A 3WE8A 4BTKA 3VUMA 5ANKA 2F49A 2ITYA 4Q5EA 4XJ0A 2VAGA 5M57A 5GINE 2E9OA 1JKSA 4EKKA 5D41A 5HQ0A 2EWAA 4GFGA 4O83A 1B39A 4C37A 5I3OA 1KOAA 3FLYA 5KZIA 3RI1A 1IG1A 5CEMA 4FV2A 5DR9A 3UVPA 5CU3A 4A9UA 4L68A 4OTDA 3BX5A 1XO2B 4ASDA 4FGRA 4BZOA 4J71A 2I0HA 3L8PA 5T6KA 3M1SA 2XK3A 3ZONA 1V1KA 2HWPA 4QYGA 2X9EA 3IW5A 3PG1A 3RWQA 4TL0A 5I0BA 3GCVA 4EKLA 3QL8A 3QKMA 4DGMA 2VGOA 4BCNA 4EQMA 4G3DA 1OMWA 2G2HA 2G15A 1UA2A 4FBXA 4U80A 3GU8A 4GIIA 3LJ1A 3VF9A 4CEGA 4JS8A 4EUTA 4RIYA 5FEQA 1SVGA 3R8PA 3WYXA 1WCCA 5A54A 2OZAB 3DS6A 4IIRA 4M68A 2RSVA 5LJJA 3WIKA 1F3MC 3IW6A 2BTSA 3Q4TA 3DBDA 3V6SA 2PZYA 1GY3A 5CEKA 3ZEWA 3U54A 3RZBA 4L3JA 1CSNA 1M7NA 4CV8A 2W1IA 2QOHA 5KBRA 3ZFXA 3EHAA 3CY2A 4D2WA 2XIRA 4FA2A 3ZO1A 1ZY4A 3D7ZA 5HLNA 4JRVA 2W5AA 2OFVA 5TF9A 1UKIA 4FV4A 3PXRA 3G9NA 4G1WA 4FIGA 4ZEGA 4QP1A 2X6DA 4RVMA 4MTAA 4TYJA 3KK9A 3WI6A 3DPKA 3HGKA 5CANA 3WF8A 2YCRA 2R3HA 3LOKA 2OZOA 4Q5HA 4C38A 5AP1A 4HCVA 4PQNA 1J1CA 2WQOA 3AD4A 2B0QA 2HCKA 3AD6A 2XM8A 3DNDA 2A0CX 4O1OA 5JFSA 2R7IA 2UW9A 2C3JA 4PPBA 2ETRA 5HLPA 5K3YA 4PUZA 3OS3A 4W9WA 5EI6A 2HAKA 5IDPA 3R7OA 5TKDA 4FT5A 3BBWA 3SVVA 3Q2JA 5J1WA 5BYYA 3SG9A 3U87A 3T9IA 3ZLSA 1JPAA 1ZZ2A 3FI2A 1VR2A 3R04A 4GG7A 4CT2A 2HY0A 2WQEA 5EDQA 4UZHA 4PPCA 4CQGA 4TWCA 3R9OA 4I6HA 5DR6A 4O7VA 3V8SA 4XEYA 4RWJA 3VQHA 3U4WA 3QHRA 4F65A 3KXGA 2W1CA 2WELA 3BYOA 4D2SA 5IQDA 5G6VA 4LGHA 1IEPA 2XEZA 2R2PA 3BCEA 5E7RA 4O81A 3AC1A 2PVRA 2QONA 4ACGA 5FG8A 5AP0A 2B9HA 3VW6A 1Q3DA 2HK5A 3NUAA 1K3AA 2F4JA 4GU6A 3WZJA 4E4MA 2JITA 3QQFA 1F0QA 4PDPA 3ALNA 3AD5A 2JAVA 2WEIA 4ZMFA 5DHJA 1LPUA 3V01A 4ANQA 4UALA 4QRCA 4YHTA 4JR7A 4M15A 4RX8A 4U8ZA 5ETIA 2W1GA 4NFNA 3CY3A 2H96A 3CPBA 3LFAA 3EL8A 2R3QA 4EZ5A 4NUSA 4OAVB 3D83A 3BGQA 4FYOA 4O0VA 2RF9A 3G33A 2CNUA 4NU1A 3HA8A 4FK3A 4IH8A 4YNOA 4GK2A 5AJQA 3R9HA 4A9YA 3LFDA 5CTPA 3VWAA 1UU3A 3FWQA 4YBKA 4JI9A 5BVOA 3QLGA 1BI8A 4Y85A 2PUUA 4PTGA 2WTWA 4LL0A 4D2VA 5EHYA 3RVGA 2B9FA 4AS0A 4M3QA 3W33A 4YSMA 3FBVA 4EOOA 2CCHA 3FKNA 2VNYA 4YZCA 3G0EA 4DGNA 4FZ6A 3QRKA 4AX8A 3HAMA 4P90A 4GMYA 1G8AA 2VWYA 3NMUF 4EORA 3NS9A 2WMSA 3R28A 4O0WA 1UNLA 4JG7A 3U51A 3BV3A 3DU8A 4B99A 1FGKA 5FDPA 4JJRA 3PLAE 3WZUA 1PF8A 4D0XA 3CD3A 4R3RA 1SZMA 3II5A 3FLWA 4ZP5A 1T46A 3GFEA 3JYAA 4NFMA 5AIRA 4UWYA 4ANSA 2P0CA 4BYIA 4W4WA 2BAKA 5EM7A 4J96A 4WNOA 1XH6A 4K18A 5ETFA 2OU7A 1MRUA 4EBVA 3QGWA 5H8EA 5JH6A 1BLXA 4MVFA 3FDNA 4S2ZA 4USFA 4OAUC 3VVHA 2X7FA 2C30A 2H8HA 1YOLA 1Q8YA 2XNPA 1Q24A 4Y83A 1PXIA 4IB5A 4BCQA 4ZK5A 5E1EA 3TACA 1H27A 2C3LA 2B52A 3DKGA 4PP7A 5EOLA 1KUTA 5J7HA 2VTQA 1OPKA 5J79A 1FQ1B 2PTKA 3TM0A 1BYGA 3ZDUA 1E9HA 4O22A 3EFJA 4QP6A 5C03A 3O51A 4GYIA 3DFAA 4CFNA 4EOLA 2VO3A 5K0XA 3AMYA 4YJVA 1M7QA 3LIJA 4ZSJA 5GJFA 4DH8A 1Q3WA 4X3FC 3ZHPC 5HE0A 4ZTNA 3TJDA 2PK9A 4ITHA 3FE3A 4BF2A 4R1YA 3I79A 3M42A 1DS5A 3KEXA 2QOOA 3R21A 5ANOA 1UNGA 1Y8YA 4I20A 3CS9A 4IDVA 5HTBA 5IA4A 3NVMB 3OXZA 5M08A 2YZAA 3QQGA 4FL1A 3COIA 2GNHA 4XRJA 3ZYAA 4OBPA 4D2TA 4O1PA 1U54B 4AF3A 4LG4A 4LOPA 1PRYA 2HXQA 3QA0A 4AU8A 2YJRA 3MIYA 3Q6WA 5E91A 4UXQA 2UW0A 4TN6A 5IQIA 3UJGA 3WF9A 4HOKA 4ZY6A 5M4FA 3OROA 3G5DA 2YM8A 2W06A 3FMJA 2LGCA 4Y5QA 3I1AA 3Q2MA 4UMTA 4GKHA 1CTPE 3MV5A 4BBMA 4FYNA 4OBOA 4QMQA 2RFSA 4AN3A 4O7WA 5AV0A 4I6BA 3R2BA 4XP2A 2WIPA 3UOLA 1KE5A 5JRSA 4B8LA 4EZ7A 4PRJA 5HGIA 2YDJA 4IBMA 3KCFA 4RVLA 2REIA 4RFZA 5FXQA 3DXNA 5HESA 3A7GA 3E7VA 2C3KA 4WSQA 1MQBA 4L8MA 4LMNA 4QTCA 4XH6A 5E8SA 4D1ZA 2YDIA 4WSYA 4IAZA 4BBFA 2WQBA 4LRMA 1ERKA 5F9EA 3D2IA 4A4LA 4EHEA 2GS6A 4QYEA 3GU6A 1H1QA 4QMUA 5TR6A 4CTCA 4AOTA 4CV9A 4C4HA 1AGWA 3BHUA 1HCKA 4DAWA 3HV6A 1ZOEA 2GHGA 4IAKA 3RJCA 2QVSE 5KMIA 3VBXA 4IAYA 1IA9A 4CT1A 4YZ9A 3PUPA 2ZB1A 3QRUA 4FKVA 4G17A 4GS6A 4OGRA 4R5YA 1ZLTA 1YI3A 1PXPA 2XIXA 4HNIA 1OIRA 5CAOA 4PTEA 3PFQA 3R1NA 4DEAA 3REPA 4E20A 2YABA 4JRNA 3NVKI 1YDRE 4GKIA 1M2RA 3MWUA 3LMGA 4E26A 3I6WA 3SC1A 3O7LB 5AUYA 4BZNA 4G6OA 4FEXA 3R30A 2DQ7X 2WTCA 4DLIA 3PPKA 1QPJA 4JBPA 2NP8A 3PSCA 4G3CA 2HWOA 5LVLA 2C6TA 4O7TA 4MWHA 4RC4A 4ZXTA 2XCHA 3UG2A 2Z2WA 4GEOA 4NEUA 3V5QA 4BZDA 5I9UA 4AA0A 5IEYA 3P79A 2ACXA 3TXOA 3ZFMA 3QTIA 5BVEA 5AV4A 3F66A 3QZFA 2PHKA 2WTKC 3LQ8A 3HDNA 3HVCA 4BTJA 1YWRA 2FVDA 3DDPA 3OCGA 4YTCA 2OKRA 2OW3A 5BVDA 3PSDA 3A4OX 4ID7A 4YUQA 4KINA 3VJNA 3F3WA 3ZLXA 4G6LA 5IH6A 4C4GA 4TPTA 2ITVA 3RBWA 5KUPA 5KKRC 3EYHA 3EN4A 3P9JA 2JEDA 3NUUA 4U81A 5GZ9A 2J90A 1YXUA 5CAPA 5CEPA 4N57A 5DIAA 2H34A 4NK9A 4BRXA 1PMUA 3BU6A 3MB7A 5I9VA 2RG5A 4JBOA 3AQVA 4D9UA 2C5NA 2VX0A 2PVLA 3BELA 4XG4A 3TIZA 1YDTE 4ZIMA 3EQGA 3KXZA 3PVGA 2CMWA 3BU5A 4HCTA 2HW6A 4JDKA 5EW9A 3E3BX 5E8ZA 3G6GA 3DZOA 3SOAA 5LOHA 4EH3A 3W16A 3QZGA 4EOJA 3VBQA 2QURA 3SA0A 4MHAA 3UNJA 5HG9A 2CGVA 4EHVA 4W4YA 2R4BA 3PVUA 5HICA 5LARA 3PXYA 1H24A 1JSVA 2BAQA 3KB7A 5IA5A 1YVJA 5EHOA 4MNEA 2YIWA 2GNGA 4L01A 3LQ5A 3Q52A 3SX9A 3ZMMA 4I94A 5ETCA 3A60A 1IR3A 2W5HA 3R02A 1JSUA 4YC6A 3ODYX 3NRMA 4KBCA 4F6UA 5K4IA 1OIUA 4BI0A 4DN5A 3ENHA 5F4NA 4QTDA 1KE6A 2GNLA 3OCTA 3RNIA 4MKCA 3ELJA 3HA6A 3PA5A 1WZYA 2XUUA 2R3MA 2ZDTA 3DB8A 3PIZA 3ZLWA 1ZAOA 2VO7A 2ZMCA 4JBVA 2YEXA 4JLCA 4RJ6A 4EOSA 4KIOA 5BMMA 5M07A 2QO2A 5CQUA 4XG2A 3HZTA 3F3VA 2R3OA 3E62A 4FTCA 4GVAA 3L8VA 1J7UA 1CKJA 3AGMA 2J4ZA 1K9AA 3F69A 3HDMA 4H58A 3UIUA 5J9ZA 4BWPA 3F3TA 1A48A 4FT3A 2R3GA 1VYWA 3VS6A 3NR9A 4BGQA 3NUSA 3DLSA 4BHNA 2WTDA 2QOBA 4GVJA 4YJPA 5CXHA 3WF5A 2OG8A 3TI1A 4RX9A 4DH1A 4J98A 2B1PA 3UOHA 3R00A 4KD1A 3E63A 2Y6OA 4XNEA 2HELA 5DEWA 5EI2A 4ZSLA 2QR8A 1PXKA 3V5TA 3NDMA 3CJFA 4AZEA 3P5KA 4IHPA 2FO0A 2BCJA 4P5ZA 4X2FA 3QXPA 5ANGA 4J8NA 3DCVA 3V5JA 5FBNC 4BKZA 3LCKA 2X2MA 2J50A 4X2JA 1PXMA 3PP0A 1SNUA 3AG9A 2FSOX 3PE2A 5E8YA 3S2PA 3R8LA 5FTOA 4F0IA 3JY9A 3LFCA 4HVHA 4O6EA 2I40A 2Y4IC 2ZV2A 4H3BA 4L43A 4WT6A 3AOXA 4KS8A 4M97A 4NIFB 3FKLA 4TYHA 5EHLA 4C3PA 4F99A 4F7SA 5BUJA 5DH3A 2G2FA 1XH8A 5ICPA 3AMBA 5ANJA 3CTJA 3LFBA 4U42A 3ZUUA 4MWIA 4FV9A 4IZAA 4NT4A 3CE3A 2WU6A 4BWXA 5HORA 4I24A 2J9MA 3DAEA 5KMKA 4OBQA 4RA5A 3IONA 4U7ZA 4F9YA 2F7ZE 2C69A 2CGXA 4A4OA 2W7XA 1YWVA 5HI2A 3NNXA 3ORIA 4RIOA 3NIEA 2X6EA 2XJ2A 2CGWA 2YM4A 5IF1A 5HOAA 3NPCA 4AFJA 5CAVA 1Y6BA 4GUBA 3EIDA 5IUGA 3FY2A 5FXRA 3LM0A 3E8DA 5FEDA 3L9MA 3R7EA 4UWCA 4MX9A 4O6LA 3HUBA 1VEBA 3HP5A 3RTPA 4CFXA 5I9WA 2HXLA 3ERKA 3R22A 4G3FA 4DFZE 3DDQA 3OZ6A 1KV2A 3ZO2A 2YCFA 3CTHA 3CGFA 3UTOA 1DAWA 4YTFA 4DH5A 3PA4A 2IZSA 3QCXA 5JEBA 3IG7A 4G31A 3PA3A 3D7TA 3UMXA 2I6LA 4CLIA 4DG3E 4CFWA 3OXIA 4RWLA 4HZSA 3GCQA 4I4FA 4C62A 5LMKA 3LCTA 4HGSA 4Z16A 3EQCA 4OTGA 3R8ZA 4J7BA 4I92A 2R5TA 1YI6A 2UVZA 3Q4ZA 3QZIA 2ITZA 4PPAA 5CVGA 4YGAA 5AX9A 2JFMA 2PMOX 4QMZA 4I6FA 5F20A 3SD0A 3W55A 2PWLA 4BCFA 1TQPA 5CF8A 4USEA 5LQFA 1W0XC 4RSSA 1YXVA 4GG5A 4EH9A 2X39A 5M56A 1GJOA 5A4EA 1LR4A 1WAKA 2KULA 3M11A 2J7TA 3NNVA 3R9NA 3VS7A 4D4RA 5KE0A 2KTYA 4BC6A 3NSZA 5EK7A 2FUMA 2I0VA 4QMLA 2XVDA 5DN3A 3OHTA 4X3FA 4IM3A 4R77A 4ZSAA 2YM5A 4WO5A 3RHXA 3F82A 5GZAA 4ZMEA 3ZLYA 3MJ2A 1XJDA 3R1QA 4LGDA 2WU7A 4MCVA 1MRVA 2PU8A 2O64A 4L7FA 3UO6A 5H3QA 4RX5A 2CPKE 2BRGA 5AWMA 1Z5MA 1UKHA 3TWJA 3UG1A 3HV5A 3TCPA 3RMFA 3FHRA 3PVWA 4XHKB 2GQRA 4NZWB 3GBZA 4FSZA 3FEGA 5HE2A 3EN7A 3ZM9A 3W8QA 5A4QA 4LL5A 3BIZA 5AR3A 2FYSA 2WAJA 4FODA 3DBEA 4NW5A 2A19B 2G01A 2OH4A 3PP1A 5AUVA 1TQIA 5HO8A 3C5UA 4KWPA 4U3ZA 5CT7A 5DGZA 5LVPA 2PVFA 3A62A 5AUXA 2XKFA 4AT5A 3C4EA 5BX0A 1NT2A 5CWZA 5AUWA 3ZXTA 2AC3A 3MVMA 4GV1A 3DOGA 4GIHA 3ZRKA 4Z7HA 3LXNA 2X2KA 3TV4A 4FX3A 3A8XA 4FSWA 4PMMA 3SRVA 5L3AA 1YOMA 4CRLA 1GIJA 1B38A 4TZRA 4XBRA 2WOTA 3VQUA 4FV8A 3GQIA 2UZWE 2A1AB 4IVAA 2UZVA 5CF5A 2B4SB 4WG4A 4M69A 4QYFA 5IU2A 5KBQA 5HBJA 5C1QB 2W5BA 2XIZA 2X8IA 5EM5A 4FEQA 3NYVA 2C6IA 4ACHA 3RM7A 2Z60A 4M84A 4CFMA 2PPQA 4AQCA 4J97A 3QHWA 3CC6A 2OIQA 1YXTA 3OC1A 1O9UA 1S9JA 4QMWA 3QQHA 4DINA 5CASA 3CXWA 4YJRA 3RPYA 3ORTA 4O0UA 4KIKB 3ULZA 4FT0A 1AD5A 4PDSA 3QUPA 4U40A 4YSJA 5CEOA 3RWPA 5CNNA 3OBGA 3Q60A 3KULA 5CZIA 3MESA 1U5QA 3BEAA 3QC9A 3QC4A 3TTIA 2ESMA 1OL7A 3BGPA 2XK9A 4NH1A 5C8KA 2B55A 3UQFA 4RZWA 1R39A 1BL6A 1YQJA 3R01A 3DZQA 4W8DA 5AP3A 2C0OA 4AGDA 1FMOE 2QHNA 3E88A 5K4JA 4FV6A 1Q4LA 3PWDA 4ASZA 5E92A 4KIPA 1BX6A 3QKKA 3TT0A 2OJ9A 3IPHA 3RK7A 2QKRA 4TTHB 3BLHA 1A9UA 2AYPA 2UZEA 4BDAA 2C6DA 2VWBA 5E9EA 1LP4A 2C4GA 2YAKA 3R7GA 4JDJA 2NPQA 3F3ZA 4ZTSA 3I0OA 4FKPA 3I4BA 2W1EA 2EB3A 4RJ5A 2UZBA 3PZHA 3CD8A 1JSTA 3PIYA 4QOXA 4R3CA 2PZRA 3GT8A 4H1MA 3VBWA 3BHHA 3TV6A 3MYGA 1WBTA 3MY1A 2XCKA 3KF7A 5HE1A 3K3IA 4M7IA 4AZTA 5M51A 2B7AA 4K77A 4LOOA 4YLLA 5EQPA 2ITTA 2BUJA 4U6RA 1OPLA 4YZMA 4O7RA 1XHAA 2IO6A 1UU9A 5L6WL 1KE9A 3JVRA 3FPQA 4YTIA 5ANIA 3LFEA 1YXSA 5AP7A 3OEFX 2CCIA 4FGBA 4I93A 5CSHA 5IQGA 1SVHA 2CLXA 2IVTA 3C0GA 3AXWA 3C51A 3LMHA 3VRZA 1H01A 1R0EA 4IMYA 4AG8A 2IPXA 4O7YA 2J51A 3EFLA 2BR1A 4HYHA 4QP7A 3ZZWA 3MB6A 3RALA 4S34A 2VNWA 5E8VA 1MQ4A 4QMPA 4FKQA 1Q41A 4FTNA 3T9TA 3GNIB 5HD4A 4JNWA 4MYGA 4BR3A 1G5SA 3NAYA 2P2HA 4MH7A 4I3ZA 1W82A 1UWJA 2W05A 1GZ8A 1H4LA 3E87A 1V0BA 1XBBA 2PE1A 3QKLA 5EH0A 4KUJA 4MF0A 3SQQA 3EYGA 4C35A 3RINA 3E64A 4D5HA 4DYMA 3NUYA 4IQ6A 5E1SA 5AAFA 3FZ1A 4EOKA 2X8DA 3KMUA 3E5AA 3FXWA 4E4NA 1BKXA 3OVVA 4IEBA 2QC6A 5KKRB 4C59A 3R2YA 4EHGA 4C57A 2VRXA 3HX4A 2XBAA 3KC3A 4BL1A 1VZOA 2EXCX 2WQNA 3ZSGA 4BIEA 4ZSEA 3KY2A 2G9XA 3BBTB 3S3IA 2JC6A 4ANLA 4YLKA 3FZRA 3MVLA 4BKYA 1ATPE 1ZMWA 4FOBA 4L67A 4QP2A 2F57A 3SV0A 3Q4UA 3D5WA 5JMSA 4E93A 2OJJA 1PYXA 2IWIA 2JDOA 3D4QA 3KQ7A 1GZOA 2ZOQA 4IZ5A 4C4JA 4TRLA 4EUUA 4E6QA 2HZ4A 4QNAA 3DT1A 4I5CA 4L52A 4KKHA 5M06A 2ITPA 2XEYA 2C6KA 3C7QA 3TUCA 5DG5A 3HMIA 3ZBXA 5BYZA 2GHLA 2J0IA 5GNKA 5IA1A 4RJ4A 3A99A 2EB2A 3HL7A 5JGBA 3SDJA 5KMJA 2P4IA 2VZ6A 4CXAA 2V7OA 4V0GB 3VS5A 5K5NA 3V5LA 2WXVA 2XNGA 3LXKA 5A6NA 1W84A 2UW5A 3ITZA 3NX8A 4QMMA 2CHLA 3QXOA 4W4XA 4E4LA 2WGJA 5ITAA 3BI6A 5HU3A 4FVQA 2PZ5A 5AM7A 5LWNA 4N4SA 2V22A 3DK6A 1A06A 5C27A 2R3JA 3I81A 5GJDA 2F9GA 2IW8A 5IQAA 4QQ5A 3VUKA 4PTCA 2ITNA 3ANRA 5AR5A 3IDBA 3F5PA 4GYGA 4JL9A 2GNIA 5CU6A 5LVMA 3CBLA 4QPAA 4AT3A 4QQTA 3HRFA 4G6NA 4BCHA 3C4CA 1KV1A 2Q0NA 2WKMA 4FIHA 3IW4A 4EK6A 5DVRA 1OZ1A 1BMKA 2FSMX 4J53A 3N9XA 5HEZA 3QRIA 5AA9A 5M44A 4PDYA 3I6UA 1DI9A 2GQSA 5D1JA 2PY3A 4XV1A 5JK3A 3FMMA 3PXKA 4XP0A 5GJGA 2I7QA 2QHMA 1W98A 3KU2A 4RIYB 4KAOA 4F64A 4ZJJA 4DF3A 4H05A 1PXNA 2VU3A 3JXWA 4HGLA 4BDHA 4N70A 4HVGA 1W7HA 4O0YA 4E6AA 1YHWA 4FKWA 5AX3A 3EQIA 2X4FA 2Z7LA 4FKGA 5LXMA 4DFLA 5AFVA 3H10A 4FG9A 3BYSA 3VUIA 3EOCA 1NVRA 4CSVA 4FKJA 4IJ9A 5HNGA 3ATTA 3C13A 2BDWA 3UVRA 4HYUA 3UZRA 2QODA 2CSNA 4L44A 5LVNA 3S1HA 1PJKA 4IFGA 1ZMUA 3NIZA 3OCBA 3JR1A 1MP8A 4BI2A 4FTAA 3FXZA 3KXXA 2RFNA 3TJCA 2UZTA 3ROCA 4XYFA 4NCTC 3MS9A 4K1BA 2NNWB 2WO6A 3DFCB 4F7LA 2RFDA 2Y4IB 3HV3A 3QTZA 4UX9A 4JG8A 1H8FA 4QT1A 2WTJA 3BWJA 4O0XA 5DRBA 5IG1A 1U4DA 3QRTA 5FM2A 4L45A 3O8TA 4FF8A 2ETMA 5HE3A 1ZYDA 4EYJA 3Q96A 5B2MA 1RDQE 3MN3A 4JQEA 4FT9A 3GC0A 3N4VA 5CQWA 2FB8A 2X1NA 2ZMDA 3ORPA 4GL9A 4AUAA 5L2IA 1CKPA 1Q97A 3Q9WA 5DE2A 3NUNA 4GU9A 3P23A 3TIYA 4FSYA 4P2KA 2J0LA 4ZOGA 1ZYLA 3TZ7A 2XNOA 2JKMA 4EQCA 3ZEPA 3ZRMA 5FTQA 1I09A 2BILB 3OT3A 5IISA 3OUNB 4ORKA 2RKUA 3ZOSA 1H1PA 2XNBA 3F7ZA 1REKA 3R0TA 4JIAA 4DEBA 5KO1A 4U41A 4M14A 3H30A 2ZM4A 2CN8A 2O8YA 3OP5A 5EW3A 5LMKC 4EEVA 3H9FA 4FV0A 4BIBA 4Y46A 4CMTA 3FI8A 3UC4A 4DFNA 3TL8A 4BDDA 5HD7A 3VJOA 4MXOA 5M4IA 3BPRA 5A6OA 1YDSE 2VWIA 3BGZA 3QWJA 3N4UA 1M2PA 2BHEA 2C0TA 3GC7A 4AAAA 4EH2A 5B0XA 4FVRA 4M12A 4C3RA 2VWWA 3EQRA 5DA3A 2RG6A 1B6CB 5EYKA 2X0GA 5KX8A 3FAAA 2BRNA 1EH4A 3FI4A 4M13A 2J6MA 3AT3A 3W8LA 3RHKA 4WRGA 4FR4A 4E1ZA 2W4JA 4E3CA 1R1WA 1WVYA 2OF4A 4AW2A 4AA5A 2R3FA 5M4CA 2QOKA 3QTRA 4IWQA 1OIQA 3FZTA 4RFMA 3WYYA 2O2UA 3GP0A 4LI5A 4M66A 2OBJA 3UO5A 5LMBA 2X7OA 5CSVA 5A14A 2PMLX 3E3PA 3HRCA 3UGCA 4FK6A 5HX8A 4KRDA 1NVSA 4V05A 4X6RA 3R63A 4QYYA 4F6WA 1PXJA 3NYNA 4N6ZA 4FTLA 1ZYSA 3RM6A 4ZLYA 4BY9E 2VX1A 5FRIA 5JQ8A 3QD4A 2ZJWA 3CLYA 4D5KA 3EQBA 4RPVA 2PUNA 3OTVA 3UZTA 4K9YA 3VN9A 2Y0AA 3GU7A 3MH1A 4OT6A 2GNJA 3ODZX 4CG9A 1NXKA 5AP2A 2OSCA 2YIRA 3E93A 3BHVA 3MY0A 4GUEA 3RAKA 1Q8ZA 5IQBA 2GDOA 5HHWA 1OIYA 5BUEA 4EONA 4IWDA 2YERA 3POZA 4I23A 5BVWA 3Q9YA 4EK3A 3FXXA 4FTIA 3QLFA 4DITA 3KRRA 4IFCA 3W2QA 4CKRA 1GZKA 3LQ3A 3CQUA 4DLJA 2PZIA 3EFWA 4MD9E 2UZDA 4BKJA 4BBEA 1SMHA 5CAQA 3I7BA 2F7EE 4RG0A 5IA3A 3IDCA 5ACBC 2ZM1A 5CLPA 4C0TA 3KXNA 3QBNA 4QP8A 4QNYA 5EW8A 4TYIA 4GJ2A 3QQUA 4M8TA 4ZTQA 4BDGA 4DFBA 2GHMA 3FQHA 4JOAA 4Y5HA 3GCPA 3PPZA 5EYDA 1JKKA 5AR4A 2JLDA 5DRDA 5ANEA 3O8PA 4C34A 4R7BA 4OTRA 4FNXA 1NY3A 5AUTA 1FINA 3OWKA 5M4UA 2XB7A 2OXYA 4CCBA 4OTHA 4YLJA 4FTJA 1ZYCA 3F7WA 3FMDA 5C01A 3FC1X 3NLBA 4LM5A 5HU9A 3ZXZA 5JFWA 5JT2A 5C4KA 4JXFA 4UB7A 2YISA 4BTMA 2XNMA 5J7BA 3UPXA 4F1TA 3LCDA 4O2ZA 4CCUA 4MQ2A 4RJ3A 3VUGA 3BE2A 4Y95A 5CX9A 4RBLA 2Y6MA 1STCE 1WVXA 2UW6A 4FSQA 1P5EA 4Q9ZA 4HZRA 4QP4A 4BTFA 4KBKA 1GIIA 4RA4A 5IH5A 2SRCA 2I1MA 4FTMA 4QO9A 5J5TA 3EJ1A 3PZEA 3ACJA 4YZBA 4BYJA 2FH9A 3PTGA 2YM6A 2HZ0A 4YJOA 5IA2A 1OBGA 3ENMA 4RWIA 4MEDA 3BLRA 1M14A 5LWMA 2BAJA 4K8AA 3KRLA 1OECA 4E5BA 1JQHA 4J1RA 2Y4PA 4BCGA 3BU3A 4N0SA 4KA3A 4O91A 4FSRA 3QTSA 2QO7A 4FC0A 4NSTA 4ITIA 2UZLA 3RGFA 2R3PA 4FICA 4PMSA 4ANBA 5EYMA 3EQDA 3DA6A 4TKSA 4C8BA 4E7WA 2VTHA 3EQPA 2VGPA 3DNEA 4X7QA 3VULA 1REJA 2P55A 4PNIA 3ZSIA 4QYHA 2XNEA 4MBJA 1FVRA 2Y9QA 2XH5A 4BHZA 5AP4A 2O65A 3AC4A 4IX5A 3AC3A 3AC5A 5C9CA 2QOIA 4K11A 3O96A 3VAPA 5C8NA 4HW7A 4AOJA 1JKTA 3MFRA 2IN6A 3UE4A 3V8TA 2HOGA 1IRKA 3EMGA 3FYJX 2JD5A 3F5GA 4RIWA 4ZY4A 4ZJVA 3C4XA 3BYMA 3QD0A 3G51A 3HMMA 4WNPA 3C4WA 5TE0A 4G9CA 3FZSA 4ENYA 3FL5A 3DBQA 2I0EA 5EG3A 3OMVA 3FMEA 4X3JA 1U46A 1TVOA 4EI4A 2XKCA 4QTEA 1URWA 3BHTA 3IDPA 5A46A 1OL2A 5EOBA 2NRUA 3P86A 5AAEA 4U43A 5CF4A 3U6HA 3R7YA 3C4FA 2V5QA 1O6KA 5H2UA 2YWVA 4CNHA 3UYSA 3MPMA 1MUOA 4YR8A 3H0ZA 3EN9A 5KHWA 4ALUA 3AT2A 3RCJA 3N4TA 2ZAZA 4AZSA 3UPZA 4FSNA 4R8QA 3MSSA 2UW7A 1URCA 3LAUA 3S4QA 3GCUA 3OTUA 2QOFA 1OITA 3LFNA 4Z55A 4D4VA 1OUYA 3Q9ZA 3O50A 4ZTRA 3EFKA 4GFOA 3DY7A 3PJ8A 5HCYA 4G5PA 3LW0A 3LZBA 2UZOA 3PXFA 4ZTMA 5FDXA 2UV2A 2GMXA 2C1BA 4IC7A 4MNFA 4NKAA 3RPRA 4CLJA 4TT7A 2JDSA 3L9PA 4XV3A 4FNYA 2HZNA 3OXTA 1UU7A 3N51A 2YZLA 4H3QA 3C5IA 3CJGA 4O21A 4IADA 4MNEB 2Y7JA 5FQDC 4ERWA 3Q5IA 1XKKA 3H9RA 1S9IA 5JFXA 3BHYA 3R8MA 1H1RA 1DI8A 3PXQA 2GCDA 4O86A 4B6LA 5EQYA 1P4OA 3UIXA 3VW8A 3D5UA 2PVMA 2X8EA 4QMOA 1TQMA 4ZZOA 4DT8A 1QL6A 2P2IA 1UVRA 3D5XA 4HPUE 4PDOA 2CDZA 3KCKA 5KZ0A 2C6MA 4ZZMA 3E8NA 3IQ7A 2GNFA 5BNJA 3Q4CA 5BVNA 1W83A 1PMNA 2J5EA 3MJ1A 4ZS4A 2YIYA 4AOIA 4YJUA 3T8OA 1OBDA 2WMQA 4CQEA 3NYOA 4FKTA 4FE2A 4NCTA 4KSQA 2X9FA 3A2CA 4F9WA 5IQHA 3V5WA 5LMAA 4G5JA 3PRFA 3SOCA 4ITJA 3F6XA 5J87A 1H00A 3Q04A 2WHBA 4XS2A 3NWWA 1QPDA 2IW6A 3S00A 4PMTA 4YJSA 4RVTA 3BV2A 4BCIA 4AW5A 5AM6A 5GHVA 4RT7A 4F1OA 4IVDA 3SAYA 2UUEA 1G3NA 1WFCA 4O7NA 4PY1A 2E9UA 2RGPA 1PYEA 2VN9A 4B7TA 2XMYA 3TKIA 4FNZA 2UW4A 5HTCA 3RPSA 4PF4A 3E8EA 4WBOA 2DWBA 5L2SA 2UW8A 2ZV7A 3CPCA 2QCSA 2XRWA 4LMUA 2BHHA 2CNQA 5L2WA 4MXYA 3TEIA 2R3NA 4IB1A 2JGZA 4JX3A 3ZO4A 3BEGA 2DYLA 3P7AA 4GT4A 5CEQA 3CKWA 3WILA 5A9UA 3ID6C 2UZUE 2A2AA 4DGOA 3DAKA 3TN8A 3VHEA 4C4IA 2O3PA 2QG5A 4H36A 4EQUA 5D10A 4DC2A 2PUPA 4I0RA 3UC3A 2CKQA 2XIKA 3MDYA 3TUBA 1OM1A 4QMYA 2PVHA 3C4ZA 4W4VA 5T68A 4IVBA 4XV9A 2ONLA 4D1SA 1P2AA 4TYHB 2X7GA 5HO6A 4EK8A 4QP3A 3QTWA 4HYSA 1P4FA 3PG3A 4G16A 5IKWA 4GCJA 2XZSA 2XA4A 5DT3A 4AE6A 4L46A 2ERKA 2BKKA 5IEVA 5I9XA 1DM2A 2BZHB 3GVUA 2EUFB 2QI8A 3QUEA 3AC2A 2EU9A 3O7LD 4C36A 3WOWA 4JVGA 3V5PA 5C26A 3S95A 1H0VA 2ZM3A 3CKXA 3O23A 2JIIA 2CKOA 2OXXA 5B2KA 4BDJA 4RZVA 4IE9A 4D0WA 4RIXA 4O2PA 4AZWA 5DYJA 3ZM4A 3V3VA 2UW3A 2CLQA 1MRYA 3KN5A 3K5VA 2Z8CA 3ROYA 4L42A 3GU4A 1YWNA 3VHKA 4BCJA 1Y6AA 4X2GA 4BCPA 4HPTE 3WARA 3CGOA 3VRYA 1E1VA 3CIKA 4X2NA 3PY3A 4QTAA 5AA8A 4UY9A 4B9DA 5JSMA 3D7TB 3MA6A 3ZFYA 5L6OA 2OLCA 2R0IA 5FWKK 5T3QA 4AW1A 4O7ZA 3SXSA 5EKOA 2R3LA 4G9RA 4Q9SA 4XRLA 2GS2A 5EYCA 1GOLA 4MXXA 4RJ7A 2W99B 5M09A 3TV7A 4JQ7A 3DXPA 4C2WA 1OGUA 4FKUA 3MTLA 4C61A 3BKBA 4LV8A 3TNQB 4KBAA 3HV4A 3GENA 2IVUA 2QD9A 2XBJA 2WIHA 2YN8A 4LUEA 5HKMA 5JFVA 3QU0A 4FV7A 3P08A 4DTBA 2FSLX 3FLZA 5E4HA 2H6DA 3D9VA 3TZ8A 4X3FB 3VS3A 5KHXA 1G8SA 4J99A 5AADA 3FV8A 1L8TA 1Q61A 2YM3A 2W1DA 4XOYA 2ZB0A 3QTXA 5F1ZA 3SW7A 3MPAA 1QMZA 4WG5A 3PJ2A 5D9HA 2QOQA 5CAUA 5HIEA 2PVYA 3CP9A 3FPMA 2C5XA 3OBJA 1QCFA 2YCQA 4XG9A 4EWQA 1J7IA 3LPBA 4CKIA 2C0IA 4G3GA 3GOPA 5IMEA 3JVSA 3UQGA 3SGCA 5IMXA 1IASA 3D0EA 3OWPA 1ZOGA 3EWHA 3Q6UA 3K2LA 4JIKA 3ZC5A 4WUNA 3DQWA 4DBNA 5IZFA 4K0YA 3VS1A 3I60A 2QLQA 4EHZA 5L2QA 4G34A 3GU5A 3LE6A 4PX6A 3OY3A 4CG8A 4FEWA 5D7AA 2BFYA 3F2RA 2OIDA 4N6YA 3RZFA 3ZBFA 2C1AA 1XBCA 2EXEA 2WD1A 5HIDA 2BRHA 3A61A 4TNBA 3SRVB 4BN1A 4BDKA 4TW9A 4APPA 5M53A 4BDFA 1L3RE 5CU4A 5F94A 4C7TA 3R9DA 3W2PA 4EK4A 4YP8A 3THBA 4M69B 5KNJA 4NM0A 3ZTXA 2XJ0A 3DKFA 4G2FA 3VS4A 2VTJA 2NO3A 5IUIA 2X2LA 5EI8A 4FV3A 4CZUA 3IS5A 5L4QA 2J0JA 4O84A 3ZH8A 4IZ7A 5AUUA 3BWFA 4JDIA 4D2PA 4RVKA 3O8UA 4E73A 4R78A 2WMTA 4UMUA 3Q9XA 4NJDA 4WA9A 4ARKA 5CENA 3G9LX 5CEIA 2J2IB 5BPYA 5LCJA 4EOPA 2B54A 3PY0A 5D7VA 3W2OA 2WMUA 3GOKA 2J0KA 1NW1A 4GFMA 2OIBA 5FD2A 4JG6A 3W2CA 4CMUA 1WBSA 3OFMA 3KULB 3DV3A 2HENA 3FKOA 4Y72A 4BFMA 3GCSA 4LYNA 3WZEA 2W17A 3AGLA 4AW0A 3EKNA 5DNRA 1YW2A 2W4OA 2ITOA 1PMEA 1R78A 4LFIA 4IX4A 4PV0A 1WBOA 5AP5A 4DFUA 3NNWA 4H3PA 5BVFA 2QU5A 3I7CA 4Q2AA 4XLIA 2ITQA 5ETAA 3UP2A 3AT4A 4YMJA 4JBQA 3ANQA 3OT8A 1KSWA 5EM8A 4FKIA 4FSUA 3HAVA 3MA3A 4KRCA 5HLWA 3FZPA 4B8MA 4TNDA 2WTKB 2XK4A 4Z7GA 3U6JA 3R7VA 3T3UA 5CVFA 3DBCA 2GTMA 4LUDA 4ENXA 4BVUA 4NW6A 2WPAA 3U8WA 4EH4A 4TYGA 3HECA 2OZAA 3OWJA 3SW4A 3EQHA 4USDA 3PYYA 3RNYA 5HTIA 4E5WA 2A4LA 3LXLA 3P0MA 4DGGA 1H08A 4YC8A 3LMIA 1OB3A 3FSFA 4FTKA 4BGHA 3MH3A 5BUIA 4F9AA 1FPUA 3PPJA 5KMNA 4DGLC 3TDWA 3MPTA 3R8UA 3TNIA 1KE8A 3A7IA 2YACA 5CT0A 3VUTA 2WQMA 3UNZA 2E2BA 3U9CA 4I5HA 1YHSA 4MK0A 4M67A 4AWIA 5AAGA 2JDRA 3I0QA 4YURA 3W2RA 4C4EA 2IG7A 3A7JA 5CU2A 2XK8A 2Z02A 4F0FA 2OI4X 4DEIA 3OF0A 4FZ7A 4QQJA 5HCXA 3VBYA 2OH0E 3OWLA 3DAJA 4EYMA 2PE0A 2R7BA 5HIBA 3PJCA 3ZRLA 3Q5ZA 4UMPA 4RJ8A 5IUHA 3WZKA 4LV5A 5EKNA 3P7BA 1Q8TA 1Q62A 3H9OA 2QR7A 4NJ3A 4U79A 4OTWA 5L2TA 5E8UA 5J1VA 1J91A 1OKWA 1GZNA 4FIIA 5KMLA 3EL7A 1GIHA 3LLTA 3LJ2A 3O0GA 3T3VA 3KA0A 1KOBA 4U97A 1XH9A 2BZKB 2VTIA 2H9VA 3HMOA 4FTRA 1WVWA 4WG3A 3UODA 3TTJA 3QX4A 4UYNA 4DHFA 5BMSA 2QLUA 1JAMA 4FV1A 4C2VA 3DXQA 4AA4A 4ZTLA 4FIFA 2VO0A 4NTSA 1SNXA 5DEYA 3A7HA 3CCNA 3OW3A 1KE7A 5CZHA 4D55A 3W18A 4NKSA 2XKDA 4ANNA 4E8AA 4RC3A 2BPMA 4WHZA 4X2KA 2IVVA 3ETAA 4M0ZA 5CYIA 4PP9A 5IQCA 4F9BA 1TKIA 4F9CA 1X8BA 3GXLA 4K6ZA 4EH8A 4E6CA 3KK8A 5M55A 2VWZA 2BDFA 5E8XA 4FUYA 3BQCA 5DT4A 3A7FA 3PXZA 3UOKA 4TXCA 4ZSGA 4A9TA 4O0SA 5K9IA 2BZIB 4HNFA 5BYLA 4BICA 2J0MB 5EFQA 5CI7A 3WZDA 4FSMA 3UYTA 3FLQA 4YU2A 5DBXA 4IAAA 2YIXA 4ZJIA 4R7HA 5KMOA 1ZMVA 5CXZA 3M2WA 5CSPA 1JKLA 4OTFA 4QMSA 5CSWA 3LCOA 2OJIA 4RQVA 3VIDA 2WMVA 3UP7A 1ZZLA 4DEEA 4F0GA 5L8JA 2RL5A 2ZVAA 4QP9A 2HYYA 5HNBA 5J9YA 3MFUA 1O6LA 2IZTA 3ORXA 1XR1A 4XP3A 3V04A 3TUDA 1GNGA 1OKVA 3ORMA 4C4FA 4GT3A 3EZRA 4JQ8A 2FA2A 2XK6A 2HW7A 2C3IB 1QPCA 4EOMA 5HNIX 1XH7A 3RPVA 3VS0A 4R7IA 1RE8A 3GEQA 4CTBA 3S0OA 4DEDA 1YOJA 3PWYA 4I6QA 4U45A 4BIDA 3FZOA 3SHEA 2C6LA 3HNGA 1PXLA 4YPDA 4AXAA 5AV2A 5HG5A 3EH9A 4IZYA 5J8IA 3OD6X 4AZFA 2F7XE 3F9NA 1KWPA 3ZU7A 1LEWA 3MFTA 5DPVA 2OWBA 4ZLZA 4IANA 5HBHA 4EOIA 3PSBA 5JZNA 2QOLA 4C02A 3FMHA 2ZV8A 4Y73A 2G2IA 4M0YA 4OTPA 3FQSA 3L9NA 2PSQA 4YPSA 3R8VA 5IH4A 4J52A 4UMQA 2V55A 5HBEA 3RK9A 4JDHA 5DT0A 3VBVA 4JAIA 3LFQA 2HY81 3FQEA 4FVPA 5A4LA 1VJYA 2CJMA 4FIEA 3IO7A 3KRWA 1H07A 1LUFA 1Y91A 2E9NA 4BWKA 3QF9A 3EN6A 4TWNA 2CN5A 1I44A 1OL5A 3MBLA 4MXCA 2JBPA 1RW8A 4YC3A 2GTNA 3UBDA 4RWKA 1HCLA 1U54A 2NRYA 3DLZA 1Y8GA 1ZARA 3I5ZA 3JUHA 3MTFA 3KFAA 2RFEA 2V62A 3ULIA 5HX6A 2YCSA 4FEUA 2ONLC 4FKLA 3UMWA 2J5FA 2XNNA 3QALE 4FKSA 4JAJA 3TNPC 1UNHA 1GAGA 4IX6A 5JQ5A 2YLFA 3O71A 4KKGA 1BUHA 3TZ9A 2P3GX 4BCKA 4O96A 4EL9A 3B2TA 3QD3A 5J5SA 2JDTA 4EZ3A 2WOUA 4I5PA 4MBLA 5JKGA 2OICA 4EOQA 4EK5A 4F70A 1Z57A 4FKOA 4HCUA 3OOGA 3L1SA 3QRJA 2PZPA 2XM9A 3L9LA 4UMRA 3ZSHA 1JBPE 4XX9A 2JDVA 1JOWB 4IW0A 3NYXA 4MXZA 3E7OA 3KGAA 4IB3A 3HV7A 3OY1A 5AR8A 3QX2A 2W9ZB 3TNHA 4DEGA 2E9PA 2VWVA 5IA0A 4ZLOA 4FT7A 2PULA 4I41A 4IJPA 1T45A 5I9YA 4UWBA 4DH3A 2R3KA 2PVKA 4FTOA 1WBNA 3IOKA 3ZS5A 2Z7QA 5GIOE 4D4YA 5F95A 5L8LA 1OI9A 5I4NA 2XRUA 4CRSA 2PVJA 2R64A 3IGOA 2BTRA 3KXHA 2VWXA 3HMPA 2XYNA 3TDVA 4WOVA 5IQFA 4AN2A 2RIOA 4UEUA 2WMAA 4IX3A 5TO8A 3QTQA 1Q99A 2ITXA 3FLSA 4WUAA 3P1AA 1ZYJA 2GFCA 4D58A 1Y57A 4HVSA 2IZUA 3VBTA 3PLSA 3EQFA 4CGAA 3QWKA 2BDJA 2C47A 3HKOA 4L6QA 5FGKA 2JBOA 2V0DA 3AMAA 3QQLA 1M52A 5CSXA 4CFUA 1IAJA 3QQJA 5EDRA 3QCYA 3NCZA 4GH2A 4ONAA 3R9RA 4MD7E 5JGAA 3ET7A 3NW7A 5GZ8A 2PMNX 2B53A 5HG7A 1PHKA 5DR2A 5K0KA 5A4CA 3EKKA 4WRSA 4KSPA 4YNEA 3LCSA 3L8SA 3VUDA 4APCA 3UIMA 4BDCA 4XMOA 1HOWA 4FV5A 4IVCA 2HZIA 3V8WA 4NYEA 1R0PA 4QQCA 3DTWA 3LHJA 4EC9A 5CNOA 2GQGA 3V51A 2FSTX 3G0FA 2YITA 4IAFA 5HO7A 4ASXA 1BL7A 5AEPA 3OEZA 3B8QA 4CZYB 5FTGA 4YJQA 4DA5A 3E92A 4F09A 3IK3A 2GPHA 4R1VA 3NUPA 5HG8A 3D15A 4HVDA 5DMZA 1PKDA 2C5OA 4CMOA 3QFVA 4MBIA 4DCEA 3SXRA 2VTMA 4ACCA 5B2LA 4FG7A 3WE4A 2P33A 3P7CA 2BFXA 2VTLA 5CY3A 2JIUA 1PMVA 4HJOA 4D1XA 3FMNA 3QAME 3RPOA 3V6RA 5JN2A 3C0IA 3OG7A 5BVKA 2VTOA 4CKJA 2OF2A 2QKWB 4IWPA 4FL2A 3VF8A 3UNKA 4R6VA 2ZV9A 1CMKE 4CVAA 4UN0C 4IXPA 4YHJA 4GJ3A 3GI3A 3EN5A 3LXPA 5FUTA 4GT5A 3SXFA 4QTBA 3IGGA 1UWHA 4NTTA 3PDTA 5D12A 5C8MA 5CU0A 2C68A 3QTUA 3MY5A 5C4LA 3K3JA 2IW9A 3ZCLA 5H8GA 2BRMA 3RCDA 4F7JA 4NL0A 5EDPA 3G15A 5I5ZA 4WNMA 5L6PA 3DK3A 4KKEA 4ZS0A 4E6DA 1ZOHA 4L9IA 3WF6A 1VYZA 2R3IA 2Y8OA 4B0GA 1H1WA 3LFFA 4F7NA 3KRXA 3C0HA 3D5VA 3BYUA 3GQLA 3ALOA 2JFLA 4YZNA 4YTHA 4XCUA 1JLUE 4TY1A 5A3XA 5I3RA 1U59A 2G1TA 2O5KA 2VTPA 3K54A 1DAYA 3ACKA 4ASEA 3DKCA 3KVXA 4CD0A 3UVQA 3QCSA 5FP6A 4KIQA 1XBAA 3MH0A 1R3CA 3OUKA 2YJSA 4ACMA 2UVYA 4FTUA 4DG2E 2CNVA 3SG8A 1PKGA 1WMKA 2VTAA 4YO6A 2R0UA 2WMRA 4X6QC 3F2NA 1O6YA 4KB8A 4FI1A 4L3LA 3B8RA 4DBXA 1ZWSA 3R7UA 3TZMA 3U9NA 4DFXE 3BRBA 1QPEA 3POOA 4MF1A 4LOQA 3UDBA 3PRIA 3FYKX 4FTQA 3F5XA 5HVYA 3NW6A 2VTNA 3KMMA 1WBVA 5TT7A 4NM3A 3UO4A 4BI1A 1J3HA 3QZHA 2YHVA 1XH5A 4DH7A 2VUWA 4KS7A 2UVXA 4K33A 3COMA 3COHA 1OKYA 4F1MA 3FY0A 3QA8A 2ZYBA 3DK7A 3A4PA 2YIQA 3ZC6A 4S30A 1CM8A 4D9TA 2DUVA 2QNJA 2QU6A 4ZZNA 1YI4A 4QMNA 4RGJA 1U5RA 3COKA 4S32A 4AGWA 3FLNC 4AP7A 3U6IA 2WTIA 3VS2A 2CKEA 2WMWA 3DBFA 2OO8X 4DFYA 2YWPA 4S33A 1H1SA 3HUCA 3P78A 5AR7A 2V7AA 4EBWA 5LVOA 3EB0A 4I0TA 4U0IA 2GSFA 4IC8A 2IZRA 2C6OA 1WBWA 4NIFA 4H1JA 4TYEA 2WTVA 3JS2A 4BCOA 1F5QA 3DB6A 3RP9A 3GUBA 3OOMA 3KXMA 4A07A 4QMVA 3NUXA 3Q53A 5AR2A 3O17A 4RIWB 3WIGA 5A4TA 3HP2A 3RAIA 4I5MA 2XP2A 3UQCA 3F2AA 4FIJA 4YJTA 3PY1A 4ALVA 3CQEA 2F2CB 4GK3A 3A8WA 4TWPA 4YJNA 2WFYA 3ZDIA 2W9FB 4YHFA 3ZUTA 4B4LA 4YBJA 3QUDA 4DT9A 4PL3A 4RC2A 5ANDA 3QGYA 2B9IA 4J8MA 4I0SA 2CGUA 4OT5A 3FHIA 4AGUA 3KRJA 4EWHA 2AC5A 1RJBA 4FNWA 4EJNA 3IW8A 3R83A 4DEHA 3ATSA 3ORNA 4V01A 3VUHA 4XG7A 3MVHA 3RK5A 3CEKA 3GB2A 3GGFA 1SM2A 3Q32A 4YZDA 5HZNA 1OL1A 3I5NA 2WMXA 4DTAA 3MIAA 3BLQA 3VC4A 3JY0A 5J95A 3R1YA 2OJGA 4NM7A 2QO9A 4IB0A 2W1HA 3QD2B 3F88A 3KMWA 1M2QA 2WZJA 5HVKA 1RQQA 4IM2A 3KKVA 4U3YA 4F08A 5IQEA 1FOTA 2QQ7A 4XG3A 3FUPA 5CALA 5H8BA 3NZ0A 2EXMA 4NM5A 4PWNA 2BMCA 3F61A 3UIBA 3D2KA 2IVSA 2OJFE 2W96B 1FMKA 4RMZA 2JIVA 3MFSA 3MH2A 1LEZA 3HLLA 4BCMA 1SVEA 4UZDA 3AC8A 4A4XA 4A7CA 4UXLA 1YHVA 5E90A 5B7VA 3NNUA 3LFSA 3G6HA 4UBAA 3NGAA 4S31A 4QMTA 4RLLA 5AMNA 5AIKA 4PL4A 4D2RA 1XH4A 1YXXA 4HVIA 5I9ZA 4FEVA 1FBNA 4ANOA 1ZRZA 3H4JA 3FI3A 4O0TA 3TNWA 3UOJA 2WEVA 3ORKA 4IDTA 4TWOA 4FUXA 2ZDUA 3R6XA 2XS0A 3EZVA 4FTTA 2C5VA 3LM5A 4P5QA 2X4ZA 3W2SA 2QG7A 3BE9A 3DJ6A 3MVJA 3OW4A 4RLKA 4BB4A 3U55A 1ZXEA 3W10A 2R9SA 5KMMA 5IEXA 2Q0BA 3CQWA 4ZY5A 5JZJA 4DTKA 5EM6A 2R3RA 2EVAA 3SLSA 3D94A 1FVTA 3BYVA 4O7SA 4BDIA 3BQRA 2XJ1A 1BI7A 3DQXA 4DCAA 2VTRA 4C3FA 3E8CA 2GS7A 4O82A 2VV9A 2AUHA 4O27B 2JKOA 4EH6A 4Z3VA 5FXSA 2BVAA 4ANMA 3KREA 4F63A 3HRBA 1APME 4QD6A 3H0YA 5JRQA 1JVPP 2OXDA 3R1SA 4OLIA 2BKZA 3DKOA 1V0OA 3QYZA 4XLVA 3VO3A 1IAHA 3PE1A 2I0YA 4MAOA 2VTSA 2YM7A 3RAHA 2B9JA 3NW5A 4P7EA 4ZAUA 5K5XA 4L3PA 4CFVA 4II5A 4EJ7A 4A9RA 2XIYA 4Z9LA 1OVEA 2ITWA 4AT4A 4RFYA 3DJ5A 3R7IA 4A06A 3FC2A 4KIKA 4R3PA 1PXOA 4FZFB 2ITUA 4OTIA 3PVBA 3RKBA 4WBBB 3G90X 3C9WA 4U5JA 5ACKA 5CS6A 3HYHA 3DJ7A 1NVQA 4X21A 1Z9XA 2BIYA 2HIWA 4P4CA 1H25A 2F2UA 3KF4A 4K2RA 3Q3BA 4FMQA 3WBLA 4CYJA 3LLAA 4UYAA 3D14A 4I21A 2O63A 1IA8A 4HYIA 4PL5A 4OR5A 1K2PA 1JWHA 3F3UA 5E8TA 3GFWA 2JKKA 2O0UA 3U4UA 4YO4A 4XBUA 5DLSA 1UU8A 4KNBA 4AZVA 3W32A 3UZPA 4C33A 1PY5A 4HGTA 4IACA 2YLEA 5IPJA 3MW1A 5KCVA 3BZ3A 4F6SA 2Q83A 4EH5A 5BQ0A 1V0PA 3B2WA 2PMIA 5DWRA 4E5AX 2GU8A 2JKQA 4C58A 4L00A 4WNKA 3CTQA 4PNKA 3IW7A 3KN6A 2ETKA 4L53A 5DI1A 5AV3A 4GK4A 3ZZEA 5JGDA
chains in the Genus database with same CATH superfamily
4RIXB 4AE9A 4U44A 2WNTA 5E8WA 2IJMA 4AACA 3C50A 4NWMA 3TKHA 2ZFYA 5IDNA 2A27A 2W1ZA 3L8XA 4JR3A 4QPMA 5AUZA 4R5SA 2YA9A 3DGKA 3IOPA 3KL8A 4FZDB 4XOZA 5HCZA 3GC9A 3MI9A 1P14A 1SYKA 5AP6A 3PJ3A 3UDSA 4WIHA 3C1XA 3FMKA 4FL3A 4BGGA 1JNKA 1M17A 4E4XA 3KVWA 3LVPA 4IAIA 4OTQA 3ORLA 4X0MA 2E9VA 4U9AA 4CFFA 3QQKA 1CDKA 2VD5A 4I4EA 4OW8A 4LGGA 3LJ0A 4L7SA 4QMXA 3P4KA 2YDKA 1ZY5A 4W8EA 4CYIA 5FEEA 1WBPA 2YFXA 2FGIA 2W4KA 1ND4A 3PIXA 4AGCA 1YRPA 2JAMA 5FLFA 4D28A 4PMPA 4XG8A 4JX7A 2XKEA 4XV2A 1FVVA 4QPSA 2Z7RA 2XYUA 4FZAB 2LAVA 5CF6A 1H26A 4I22A 3W0SA 4EC8A 3QCQA 4XUFA 3TG1A 4FG8A 3TKUA 2W0JA 3W1FA 3H3CA 3VNTA 2XF0A 1Q8WA 5D11A 4FKRA 3LKMA 2VWUA 2YAAA 1H0WA 2BROA 2DS1A 4GSBA 1H28A 4KABA 2WMBA 4LQMA 4ZTHA 3JPVA 4DG0E 2W1FA 3CSVA 4RQKA 2PL0A 4CZTA 3R71A 5DFPA 4ALWA 4O0RA 1XWSA 3OCSA 5AV1A 3HEGA 3SKCA 2CKPA 1Q5KA 3GC8A 3NEWA 4GRBA 4WKQA 2BZJA 4I1ZA 4WD5A 5CI6A 5J9LA 4HGEA 3F5UA 3DTCA 2PE2A 3NAXA 4FRFA 3IKAA 3ORZA 2XK7A 1OPJA 4IWOA 4Y8DA 4ACDA 3K5UA 1OL6A 5H9BA 2PUIA 2BALA 2AEGA 1YKRA 2VO6A 5FP5A 2BIKB 4RRVA 3HMNA 2WB8A 4BDEA 5GIPE 2ERZE 3QYWA 4FSTA 3ZUVA 1J7LA 5EQEA 3IECA 2C5YA 4MD8E 3FJQE 1FGIA 1AQ1A 1PW2A 4H39A 4JT3A 2PVNA 4O7LA 2C6EA 2OK1A 2BRBA 2Z7SA 1J1BA 1OKZA 3R73A 4LRJA 4O4FA 4V04A 5DOSA 3O2MA 3FMLA 5HVJA 5LCKA 5TOZA 1W2CA 2X81A 2QOCA 3G2FA 4MQ1A 1Q8UA 4GW8A 4DE4A 4OUCA 2OGVA 2VX3A 4BDBA 3PJ1A 4IM0A 3MGYA 5G1XA 4MXAA 1UV5A 4LRKA 4RX7A 4A9SA 2UZNA 1OUKA 5FM3A 5L8KA 4F4PA 1CKIA 1E1XA 1W8CA 2GFSA 3CR0A 5FBOA 4V0GA 3ZO3A 4AFEA 4UV0A 2OFUA 3FL4A 2PYWA 1XQZA 4FOCA 4XG6A 4D4SA 4G3EA 4EH7A 3NCGA 5CVHA 3RAWA 4ERKA 4AN9A 4W9XA 1NA7A 3WF7A 4J95A 2VTTA 3FSKA 4O38A 3WE8A 4BTKA 3VUMA 5ANKA 2F49A 2ITYA 4O4DA 4Q5EA 2VAGA 4XJ0A 5M57A 2E9OA 1JKSA 4EKKA 5D41A 5HQ0A 2EWAA 4GFGA 4O83A 1B39A 4C37A 5I3OA 1KOAA 3FLYA 5KZIA 3RI1A 1IG1A 5CEMA 4FV2A 5DR9A 3UVPA 5CU3A 4A9UA 4L68A 4OTDA 3BX5A 1XO2B 4ASDA 4FGRA 4BZOA 4J71A 2I0HA 3L8PA 5T6KA 3M1SA 2XK3A 3ZONA 1V1KA 2HWPA 4QYGA 2X9EA 3IW5A 3PG1A 3RWQA 4TL0A 5I0BA 3GCVA 4EKLA 3QL8A 3QKMA 4DGMA 2VGOA 4BCNA 3UDZA 4EQMA 4G3DA 1OMWA 2G2HA 2G15A 1UA2A 4FBXA 4U80A 3GU8A 4GIIA 3LJ1A 3VF9A 4CEGA 4JS8A 4EUTA 2XANA 4RIYA 5FEQA 1SVGA 3R8PA 3WYXA 1WCCA 5A54A 2OZAB 3DS6A 4IIRA 4M68A 2RSVA 5LJJA 3WIKA 1F3MC 3IW6A 2BTSA 3Q4TA 3DBDA 3V6SA 2PZYA 1GY3A 5CEKA 3ZEWA 3U54A 3RZBA 4L3JA 1CSNA 1M7NA 4CV8A 2W1IA 2QOHA 5KBRA 3ZFXA 3EHAA 3CY2A 4D2WA 2XIRA 4FA2A 3ZO1A 1ZY4A 3D7ZA 5HLNA 4JRVA 2W5AA 2OFVA 5TF9A 1UKIA 4FV4A 3PXRA 3G9NA 4G1WA 4FIGA 4ZEGA 4QP1A 2X6DA 4RVMA 4MTAA 4TYJA 3KK9A 3WI6A 3DPKA 3HGKA 5CANA 3WF8A 2YCRA 2R3HA 3LOKA 2OZOA 4Q5HA 4C38A 5AP1A 4HCVA 4PQNA 1J1CA 2WQOA 3AD4A 2B0QA 2HCKA 3AD6A 2XM8A 3DNDA 2A0CX 4O1OA 5JFSA 2R7IA 2UW9A 2C3JA 4PPBA 2ETRA 5HLPA 5K3YA 4PUZA 3OS3A 4W9WA 5EI6A 2HAKA 5IDPA 3R7OA 5TKDA 4FT5A 3BBWA 3SVVA 3Q2JA 5J1WA 5BYYA 3SG9A 3U87A 3T9IA 3ZLSA 1JPAA 1ZZ2A 3FI2A 1VR2A 3R04A 4GG7A 4CT2A 2HY0A 2WQEA 5EDQA 4UZHA 4PPCA 4CQGA 4TWCA 3R9OA 4I6HA 5DR6A 4O7VA 3V8SA 4XEYA 4RWJA 3VQHA 3U4WA 3QHRA 4F65A 3KXGA 2W1CA 2WELA 3BYOA 4D2SA 5IQDA 5G6VA 4LGHA 1IEPA 2XEZA 2XALA 2R2PA 3BCEA 5E7RA 4O81A 3AC1A 2PVRA 2QONA 4ACGA 1VLRA 5FG8A 5AP0A 2B9HA 3VW6A 1Q3DA 2HK5A 3NUAA 1K3AA 2F4JA 4GU6A 3WZJA 4E4MA 2JITA 3QQFA 1F0QA 4PDPA 3ALNA 3AD5A 2JAVA 2WEIA 4ZMFA 5DHJA 1LPUA 3V01A 4ANQA 4UALA 4QRCA 4YHTA 4JR7A 4M15A 4RX8A 4U8ZA 5ETIA 2W1GA 4NFNA 3CY3A 2H96A 3CPBA 3LFAA 3EL8A 2R3QA 4EZ5A 4NUSA 4OAVB 3D83A 3BGQA 4FYOA 4O0VA 2RF9A 3G33A 2CNUA 4NU1A 3HA8A 4FK3A 4IH8A 4YNOA 4GK2A 5AJQA 3R9HA 4A9YA 3LFDA 5CTPA 3VWAA 1UU3A 3FWQA 4YBKA 4JI9A 5BVOA 3QLGA 1BI8A 4Y85A 2PUUA 4PTGA 2WTWA 4LL0A 4D2VA 5EHYA 3RVGA 2B9FA 4AS0A 4M3QA 3W33A 4YSMA 3FBVA 4EOOA 2CCHA 3FKNA 2VNYA 4YZCA 3G0EA 4DGNA 4FZ6A 3QRKA 4AX8A 1ST4A 4P90A 4GMYA 1G8AA 3HAMA 2VWYA 3NMUF 4EORA 3NS9A 2WMSA 3R28A 4O0WA 1UNLA 4JG7A 3U51A 3BV3A 3DU8A 4B99A 1FGKA 5FDPA 4JJRA 3PLAE 3WZUA 1PF8A 4D0XA 3CD3A 4R3RA 1SZMA 3II5A 3FLWA 4ZP5A 1T46A 3GFEA 3JYAA 4NFMA 5AIRA 4UWYA 4ANSA 2P0CA 4BYIA 4W4WA 2BAKA 5EM7A 4J96A 4WNOA 1XH6A 4K18A 5ETFA 2OU7A 1MRUA 4EBVA 3QGWA 5H8EA 5JH6A 1BLXA 4MVFA 3FDNA 4S2ZA 4USFA 4OAUC 3VVHA 2X7FA 2C30A 2H8HA 1YOLA 1Q8YA 2XNPA 1Q24A 4Y83A 1PXIA 4IB5A 4BCQA 4ZK5A 5E1EA 3TACA 1H27A 2C3LA 2B52A 3DKGA 4PP7A 5EOLA 1KUTA 5J7HA 2VTQA 1OPKA 5J79A 1FQ1B 2PTKA 3TM0A 1BYGA 3ZDUA 4AXCA 1E9HA 4O22A 3EFJA 4QP6A 5C03A 3O51A 4GYIA 3DFAA 4CFNA 4EOLA 2VO3A 5K0XA 3AMYA 4YJVA 1M7QA 3LIJA 4ZSJA 5GJFA 4DH8A 1Q3WA 4X3FC 3ZHPC 5HE0A 4ZTNA 3TJDA 2PK9A 4ITHA 3FE3A 4BF2A 4R1YA 3I79A 3M42A 1DS5A 3KEXA 2QOOA 3R21A 5ANOA 1UNGA 1Y8YA 4I20A 3CS9A 4IDVA 5HTBA 5IA4A 3NVMB 3OXZA 5M08A 2YZAA 3QQGA 4FL1A 3COIA 2GNHA 4XRJA 3ZYAA 4OBPA 4D2TA 4O1PA 1U54B 4AF3A 4LG4A 4LOPA 1PRYA 2HXQA 3QA0A 4AU8A 2YJRA 3MIYA 3Q6WA 5E91A 4UXQA 2UW0A 4TN6A 5IQIA 3UJGA 3WF9A 4HOKA 4ZY6A 5M4FA 3OROA 3G5DA 2YM8A 2W06A 3FMJA 2LGCA 4Y5QA 3I1AA 3Q2MA 4UMTA 4GKHA 1CTPE 3MV5A 4BBMA 4FYNA 4OBOA 4QMQA 2RFSA 4AN3A 4O7WA 5AV0A 4I6BA 3R2BA 4XP2A 2WIPA 3UOLA 1KE5A 5JRSA 4B8LA 4EZ7A 4PRJA 5HGIA 2YDJA 4IBMA 3KCFA 4RVLA 2REIA 4RFZA 5FXQA 3DXNA 5HESA 3A7GA 3E7VA 2C3KA 4WSQA 1MQBA 4L8MA 4LMNA 4QTCA 4XH6A 5E8SA 4D1ZA 2YDIA 4WSYA 4IAZA 4BBFA 2WQBA 4LRMA 1ERKA 5F9EA 3D2IA 4A4LA 4EHEA 2GS6A 4QYEA 3GU6A 1H1QA 4QMUA 5TR6A 4CTCA 4AOTA 4CV9A 4C4HA 1AGWA 3BHUA 1HCKA 4DAWA 3HV6A 1ZOEA 2GHGA 4IAKA 3RJCA 2QVSE 5KMIA 3VBXA 4IAYA 1IA9A 4CT1A 4YZ9A 3PUPA 2ZB1A 3QRUA 4FKVA 4G17A 4GS6A 4OGRA 4R5YA 1ZLTA 1YI3A 1PXPA 2XIXA 4HNIA 1OIRA 2AQXA 5CAOA 4PTEA 3PFQA 3R1NA 4DEAA 3REPA 4E20A 2YABA 4JRNA 3NVKI 1YDRE 4GKIA 1M2RA 3MWUA 3LMGA 4E26A 3I6WA 3SC1A 3O7LB 5AUYA 4BZNA 4G6OA 4FEXA 3R30A 2DQ7X 2WTCA 4DLIA 3PPKA 1QPJA 4JBPA 2NP8A 3PSCA 4G3CA 2HWOA 5LVLA 2C6TA 4O7TA 4MWHA 4RC4A 4ZXTA 2XCHA 3UG2A 2Z2WA 4GEOA 4NEUA 3V5QA 4BZDA 5I9UA 4AA0A 5IEYA 3P79A 2ACXA 3TXOA 3ZFMA 3QTIA 5BVEA 5AV4A 3F66A 3QZFA 2PHKA 2WTKC 3LQ8A 3HDNA 3HVCA 4BTJA 1YWRA 3BLAA 2FVDA 3DDPA 3OCGA 4YTCA 2OKRA 2OW3A 5BVDA 3PSDA 3A4OX 4ID7A 4YUQA 4KINA 3VJNA 3F3WA 3ZLXA 4G6LA 5IH6A 4C4GA 4TPTA 2ITVA 3RBWA 5KUPA 5KKRC 3EYHA 3EN4A 3P9JA 2JEDA 3NUUA 4U81A 5GZ9A 2J90A 1YXUA 5CAPA 5CEPA 4N57A 5DIAA 2H34A 4NK9A 4BRXA 1PMUA 3BU6A 3MB7A 5I9VA 2RG5A 4JBOA 3AQVA 4D9UA 2C5NA 2VX0A 2PVLA 3BELA 4XG4A 3TIZA 1YDTE 4ZIMA 2IF8A 3EQGA 3KXZA 3PVGA 2CMWA 3BU5A 4HCTA 2HW6A 4JDKA 5EW9A 3E3BX 5E8ZA 3G6GA 3DZOA 3SOAA 5LOHA 4EH3A 3W16A 3QZGA 4EOJA 3VBQA 2QURA 3SA0A 4MHAA 3UNJA 5HG9A 2CGVA 4EHVA 4W4YA 2R4BA 3PVUA 5HICA 5LARA 3PXYA 1H24A 1JSVA 2BAQA 3KB7A 5IA5A 1YVJA 5EHOA 4MNEA 2YIWA 2GNGA 4L01A 2XAMA 3LQ5A 3Q52A 3SX9A 3ZMMA 4I94A 5ETCA 3A60A 1IR3A 2W5HA 3R02A 1JSUA 4YC6A 3ODYX 3NRMA 4KBCA 4F6UA 5K4IA 1OIUA 4BI0A 4DN5A 3ENHA 5F4NA 4QTDA 1KE6A 2GNLA 3OCTA 3RNIA 4MKCA 3ELJA 3HA6A 3PA5A 1WZYA 2XUUA 2R3MA 2ZDTA 3DB8A 3PIZA 3ZLWA 1ZAOA 2VO7A 2ZMCA 4JBVA 2YEXA 4JLCA 4RJ6A 4EOSA 4KIOA 5BMMA 5M07A 2QO2A 5CQUA 4XG2A 3HZTA 3F3VA 2R3OA 3E62A 4FTCA 4GVAA 3L8VA 1J7UA 1CKJA 3AGMA 2J4ZA 1K9AA 3F69A 3HDMA 4H58A 3UIUA 5J9ZA 4BWPA 3F3TA 1A48A 4FT3A 2R3GA 1VYWA 3VS6A 3NR9A 4BGQA 3NUSA 3DLSA 4BHNA 2WTDA 2QOBA 4GVJA 4YJPA 5CXHA 2A98A 2OG8A 3TI1A 4RX9A 3WF5A 4DH1A 4J98A 2B1PA 3UOHA 3R00A 4KD1A 3E63A 2Y6OA 4XNEA 2HELA 5DEWA 5EI2A 4ZSLA 2QR8A 1PXKA 3V5TA 3NDMA 3CJFA 4AZEA 3P5KA 4IHPA 2FO0A 2BCJA 4P5ZA 4X2FA 3PFYA 3QXPA 5ANGA 4J8NA 3DCVA 3V5JA 5FBNC 4BKZA 3LCKA 2X2MA 2J50A 4X2JA 1PXMA 3PP0A 1SNUA 3AG9A 2FSOX 3PE2A 5E8YA 3S2PA 3R8LA 5FTOA 4F0IA 3JY9A 3LFCA 3ML1A 4HVHA 4O6EA 2I40A 2Y4IC 2ZV2A 4H3BA 4L43A 4WT6A 3AOXA 4KS8A 4M97A 4NIFB 3FKLA 4TYHA 5EHLA 4C3PA 4F99A 4F7SA 5BUJA 5DH3A 2G2FA 1XH8A 5ICPA 3AMBA 5ANJA 3CTJA 3LFBA 4U42A 3ZUUA 4MUQA 4MWIA 4FV9A 4IZAA 4NT4A 3CE3A 2WU6A 4BWXA 5HORA 4I24A 2J9MA 3DAEA 5KMKA 4OBQA 4RA5A 3IONA 4U7ZA 4F9YA 2F7ZE 2C69A 2CGXA 4A4OA 2W7XA 1YWVA 5HI2A 3NNXA 4AQKA 3ORIA 4RIOA 3NIEA 2X6EA 2XJ2A 2CGWA 2YM4A 5IF1A 5HOAA 3NPCA 4AFJA 5CAVA 1Y6BA 4GUBA 1G8KA 3EIDA 5IUGA 3FY2A 5FXRA 3LM0A 3E8DA 5FEDA 3L9MA 3R7EA 4UWCA 4MX9A 4O6LA 3HUBA 1VEBA 3HP5A 3RTPA 4CFXA 5I9WA 2HXLA 3ERKA 3R22A 4G3FA 4DFZE 3DDQA 3OZ6A 1KV2A 3ZO2A 2YCFA 3CTHA 3CGFA 3UTOA 1DAWA 4YTFA 4DH5A 3PA4A 2IZSA 3QCXA 5JEBA 3IG7A 4G31A 3PA3A 3D7TA 3UMXA 2I6LA 4CLIA 4DG3E 4CFWA 3OXIA 4RWLA 4HZSA 3GCQA 4I4FA 4C62A 5LMKA 3LCTA 4HGSA 4Z16A 3EQCA 4OTGA 3R8ZA 4J7BA 4I92A 2R5TA 1YI6A 2UVZA 3Q4ZA 3QZIA 2ITZA 4PPAA 5CVGA 4YGAA 5AX9A 2JFMA 2PMOX 4QMZA 4I6FA 5F20A 3SD0A 3W55A 2PWLA 4BCFA 1TQPA 5CF8A 4USEA 5LQFA 1W0XC 4RSSA 1YXVA 4GG5A 4EH9A 2X39A 5M56A 1GJOA 5A4EA 1LR4A 1WAKA 2KULA 3M11A 2J7TA 3NNVA 3R9NA 3VS7A 4D4RA 5KE0A 2KTYA 4BC6A 3NSZA 5EK7A 2FUMA 2I0VA 4QMLA 2XVDA 5DN3A 3OHTA 4X3FA 4IM3A 4R77A 4ZSAA 2YM5A 4WO5A 3RHXA 3F82A 5GZAA 4ZMEA 3ZLYA 3MJ2A 1XJDA 3R1QA 4LGDA 2WU7A 4MCVA 1MRVA 2PU8A 2O64A 4L7FA 3UO6A 5H3QA 4RX5A 2CPKE 2BRGA 5AWMA 1Z5MA 1UKHA 3TWJA 3UG1A 3HV5A 3TCPA 3RMFA 3FHRA 3PVWA 4XHKB 2GQRA 4NZWB 3GBZA 4FSZA 3FEGA 5HE2A 3EN7A 3ZM9A 3W8QA 5A4QA 4LL5A 3BIZA 5AR3A 2FYSA 2WAJA 4FODA 3DBEA 4NW5A 2A19B 2G01A 2OH4A 3PP1A 5AUVA 1TQIA 5HO8A 3C5UA 4KWPA 4U3ZA 5CT7A 5DGZA 5LVPA 2PVFA 3A62A 5AUXA 2XKFA 4AT5A 3C4EA 5BX0A 1NT2A 5CWZA 5AUWA 3ZXTA 2AC3A 3MVMA 4GV1A 3DOGA 4GIHA 3ZRKA 4Z7HA 3LXNA 2X2KA 3TV4A 4FX3A 3A8XA 4FSWA 4PMMA 3SRVA 5L3AA 1YOMA 4CRLA 1GIJA 1B38A 4TZRA 4XBRA 2WOTA 3VQUA 4FV8A 3GQIA 2UZWE 2A1AB 4IVAA 2UZVA 5CF5A 2B4SB 4WG4A 4M69A 4QYFA 5IU2A 5KBQA 5HBJA 4DHZA 5C1QB 2W5BA 2XIZA 2X8IA 5EM5A 4FEQA 3NYVA 2C6IA 4ACHA 3RM7A 2Z60A 4M84A 2X0OA 4CFMA 4AQCA 4J97A 2PPQA 3QHWA 3CC6A 2OIQA 1YXTA 3OC1A 1ST0A 1O9UA 1S9JA 4QMWA 3QQHA 4DINA 5CASA 3CXWA 4YJRA 3RPYA 3ORTA 4O0UA 4KIKB 3ULZA 4FT0A 1AD5A 4PDSA 3QUPA 4U40A 4YSJA 5CEOA 3RWPA 5CNNA 3OBGA 3Q60A 3KULA 5CZIA 3MESA 1U5QA 3BEAA 3QC9A 3QC4A 3TTIA 2ESMA 1OL7A 3BGPA 2XK9A 3W0NA 4NH1A 5C8KA 2B55A 3UQFA 4RZWA 1R39A 1BL6A 1YQJA 3R01A 3DZQA 4W8DA 5AP3A 2C0OA 4AGDA 1FMOE 2QHNA 3E88A 4AXFA 5K4JA 4FV6A 1Q4LA 3PWDA 4ASZA 5E92A 4KIPA 1BX6A 3QKKA 3TT0A 2OJ9A 3IPHA 3RK7A 2QKRA 4TTHB 3BLHA 1A9UA 2AYPA 2UZEA 4BDAA 3BL9A 2C6DA 2VWBA 5E9EA 1LP4A 2C4GA 2YAKA 3R7GA 4JDJA 2NPQA 3F3ZA 4ZTSA 3I0OA 4FKPA 3I4BA 2W1EA 2EB3A 4RJ5A 2UZBA 3PZHA 3CD8A 1JSTA 3PIYA 4QOXA 4R3CA 2PZRA 3GT8A 4H1MA 3VBWA 3BHHA 3TV6A 3MYGA 1WBTA 3MY1A 2XCKA 3KF7A 5HE1A 3K3IA 4M7IA 4AZTA 5M51A 2B7AA 4K77A 2X0PA 4LOOA 4YLLA 5EQPA 2ITTA 2BUJA 4U6RA 1OPLA 4YZMA 4O7RA 1XHAA 2IO6A 1UU9A 5L6WL 1KE9A 3JVRA 4O4CA 3FPQA 4YTIA 5ANIA 3LFEA 1YXSA 5AP7A 3OEFX 2CCIA 4FGBA 4I93A 5CSHA 5IQGA 1SVHA 2CLXA 2IVTA 3C0GA 3AXWA 3C51A 3LMHA 3VRZA 1H01A 1R0EA 4IMYA 4AG8A 2IPXA 4O7YA 2J51A 3EFLA 2BR1A 4HYHA 4QP7A 3ZZWA 3MB6A 3RALA 4S34A 2VNWA 5E8VA 1MQ4A 4QMPA 4FKQA 1Q41A 4FTNA 3T9TA 3GNIB 5HD4A 1W2FA 4JNWA 4MYGA 1G5SA 3NAYA 4BR3A 2P2HA 4MH7A 4I3ZA 1W82A 1UWJA 1G8JA 2W05A 1GZ8A 1H4LA 3E87A 1V0BA 1XBBA 2PE1A 3QKLA 5EH0A 4KUJA 4MF0A 3SQQA 3EYGA 4C35A 3RINA 3E64A 4D5HA 4DYMA 4DHIB 3NUYA 4IQ6A 5E1SA 5AAFA 3FZ1A 4EOKA 2X8DA 3KMUA 3E5AA 3FXWA 4E4NA 1BKXA 3OVVA 4IEBA 2QC6A 5KKRB 4DDGA 4C59A 3R2YA 4EHGA 4C57A 2VRXA 3HX4A 2XBAA 3KC3A 4BL1A 1VZOA 2EXCX 2WQNA 3ZSGA 4BIEA 4ZSEA 3KY2A 2G9XA 3BBTB 3S3IA 2JC6A 4ANLA 4YLKA 3FZRA 3MVLA 4BKYA 1ATPE 1ZMWA 4FOBA 4L67A 4QP2A 2F57A 3SV0A 3Q4UA 3D5WA 5JMSA 4E93A 2OJJA 1PYXA 2IWIA 2JDOA 3D4QA 3KQ7A 1GZOA 2ZOQA 4IZ5A 4C4JA 4TRLA 4EUUA 4E6QA 2HZ4A 4QNAA 3DT1A 4I5CA 4L52A 4KKHA 5M06A 2ITPA 2XEYA 2C6KA 3C7QA 3TUCA 5DG5A 3HMIA 3ZBXA 5BYZA 2GHLA 2J0IA 5GNKA 5IA1A 4RJ4A 3A99A 2EB2A 3HL7A 3W0QA 5JGBA 3SDJA 5KMJA 2P4IA 2VZ6A 4CXAA 2V7OA 4V0GB 3VS5A 5K5NA 3V5LA 2WXVA 2XNGA 3LXKA 5A6NA 1W84A 2UW5A 3ITZA 3NX8A 4QMMA 2CHLA 3QXOA 4W4XA 4E4LA 2WGJA 5ITAA 3BI6A 5HU3A 4FVQA 2PZ5A 5AM7A 5LWNA 4N4SA 2V22A 3DK6A 1A06A 5C27A 2R3JA 3I81A 5GJDA 2F9GA 2IW8A 5IQAA 4QQ5A 3VUKA 4PTCA 2ITNA 3ANRA 5AR5A 3IDBA 3F5PA 4GYGA 4JL9A 2GNIA 5CU6A 5LVMA 3CBLA 4QPAA 4AT3A 4QQTA 3HRFA 4G6NA 4BCHA 3C4CA 1KV1A 2Q0NA 2WKMA 4FIHA 3IW4A 4EK6A 5DVRA 1OZ1A 1BMKA 2FSMX 4J53A 3N9XA 5HEZA 3QRIA 5AA9A 5M44A 4PDYA 3I6UA 1DI9A 2GQSA 5D1JA 2PY3A 4XV1A 5JK3A 3FMMA 3PXKA 4XP0A 5GJGA 2I7QA 2QHMA 1W98A 3KU2A 4RIYB 4KAOA 4F64A 4ZJJA 4DF3A 4H05A 1PXNA 2VU3A 3JXWA 4HGLA 4BDHA 4N70A 4HVGA 1W7HA 4O0YA 4E6AA 1YHWA 4FKWA 5AX3A 3EQIA 2X4FA 2Z7LA 4FKGA 5LXMA 4DFLA 5AFVA 3H10A 4FG9A 3BYSA 3VUIA 3EOCA 1NVRA 1XMMA 4CSVA 4FKJA 4IJ9A 5HNGA 3ATTA 3C13A 2BDWA 3UVRA 4HYUA 3UZRA 2QODA 2CSNA 4L44A 5LVNA 3S1HA 1PJKA 4IFGA 1ZMUA 3NIZA 3OCBA 3JR1A 1MP8A 4BI2A 4FTAA 3FXZA 3KXXA 2RFNA 3TJCA 2UZTA 3ROCA 4XYFA 4NCTC 3MS9A 4K1BA 2NNWB 2WO6A 3DFCB 4F7LA 2RFDA 2Y4IB 3HV3A 3QTZA 4UX9A 4JG8A 1H8FA 4QT1A 2WTJA 3BWJA 4O0XA 5DRBA 5IG1A 1U4DA 3QRTA 5FM2A 4L45A 3O8TA 4FF8A 2ETMA 5HE3A 1ZYDA 4EYJA 3Q96A 5B2MA 1RDQE 3MN3A 4JQEA 4FT9A 3W0MA 3GC0A 3N4VA 5CQWA 2FB8A 2X1NA 2ZMDA 3ORPA 4GL9A 4AUAA 4LV7A 5L2IA 1CKPA 1Q97A 3Q9WA 5DE2A 3NUNA 4GU9A 3P23A 3TIYA 4FSYA 4P2KA 2J0LA 4ZOGA 1ZYLA 3TZ7A 2XNOA 2JKMA 4EQCA 2NYAA 3ZEPA 3ZRMA 5FTQA 1I09A 2BILB 3OT3A 5IISA 3OUNB 4ORKA 2RKUA 3ZOSA 1H1PA 2XNBA 3F7ZA 1REKA 3R0TA 4JIAA 4DEBA 5KO1A 4U41A 4M14A 3H30A 2ZM4A 2CN8A 2O8YA 3OP5A 5EW3A 5LMKC 4EEVA 3H9FA 4FV0A 4BIBA 4Y46A 4CMTA 3FI8A 3UC4A 3W0PA 4DFNA 3TL8A 4BDDA 5HD7A 3VJOA 4MXOA 5M4IA 3BPRA 5A6OA 1YDSE 2VWIA 3BGZA 3QWJA 3N4UA 1M2PA 2BHEA 2C0TA 3GC7A 4AAAA 4EH2A 5B0XA 4FVRA 4M12A 4C3RA 2VWWA 3EQRA 5DA3A 2RG6A 1B6CB 5EYKA 2X0GA 5KX8A 3FAAA 2BRNA 1EH4A 3FI4A 4M13A 2J6MA 3AT3A 3W8LA 3RHKA 4WRGA 4FR4A 4E1ZA 2W4JA 4E3CA 1R1WA 4JMQA 1WVYA 2OF4A 4AW2A 4AA5A 2R3FA 5M4CA 2QOKA 3QTRA 4IWQA 1OIQA 3FZTA 4RFMA 3WYYA 2O2UA 3GP0A 4LI5A 4M66A 2OBJA 3UO5A 5LMBA 2X7OA 5CSVA 5A14A 2PMLX 3E3PA 3HRCA 3UGCA 4FK6A 5HX8A 4KRDA 1NVSA 4V05A 4X6RA 3R63A 4QYYA 4F6WA 1PXJA 3NYNA 4N6ZA 4FTLA 1ZYSA 3RM6A 4ZLYA 4BY9E 2VX1A 5FRIA 5JQ8A