2JDRA

Structure of pkb-beta (akt2) complexed with the inhibitor a-443654
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
Knots found
sequence length
337
structure length
316
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITQEMFEDFDYIADW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RAC-BETA SERINE/THREONINE-PROTEIN KINASE
publication title A Structural Comparison of Inhibitor Binding to Pkb, Pka and Pka-Pkb Chimera
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 316
sequence length 337
other databases KnotProt 2.0: Artifct K 41 41
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jdrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jdrA01
2CSNA 3PIZA 4I94A 4NKAA 4HGSA 3UP7A 4MWIA 4GKHA 3LXLA 4M66A 3S00A 1NA7A 4DFNA 5DEYA 4X2FA 2ITUA 2VO0A 3RGFA 3SOCA 4I0TA 2Y6MA 2LAVA 4MVFA 2OJGA 4FYOA 3TDWA 2JBOA 4BCJA 4DFZE 4RIXB 2Z2WA 4J71A 4S32A 5AUXA 3AMBA 4F1OA 3U51A 4I5MA 2SRCA 3W33A 2RKUA 4FTUA 5GJFA 1MRUA 3FMDA 4J95A 3AQVA 2J9MA 2JIIA 3IONA 2VWUA 4CXAA 5L2SA 2XRWA 4C4IA 3MYGA 4CNHA 4P7EA 3ZH8A 3VQHA 3QTWA 4QQCA 3M42A 3OXTA 1XBBA 3F7WA 2VTMA 3LXPA 2F2UA 4FKOA 3W8QA 2IJMA 3C9WA 5IQGA 2A0CX 4R7HA 4TT7A 3PG1A 4GUBA 3DBCA 3LE6A 4PP9A 3GOKA 2VD5A 4TL0A 3GCUA 5K4IA 1IR3A 1ZMWA 3A7IA 3BLHA 2WHBA 2WQOA 4HNIA 3P9JA 4ALUA 3DBDA 4DG3E 4AP7A 2W4KA 4FEVA 2OIQA 3MH0A 4ITIA 4ONAA 5AJQA 5FP5A 4EOJA 3GQLA 2ACXA 1R78A 5CAQA 4J99A 4XG7A 3FE3A 1J1BA 3RNYA 1WZYA 3FI2A 3VVHA 3FWQA 2XB7A 3FHIA 4JQEA 4QQ5A 2VX3A 2BRMA 4MXYA 4I20A 5L2TA 4CKJA 4MF1A 1BMKA 2C0IA 3PRFA 5LARA 4NFNA 4LGGA 2UZVA 3LFEA 4OR5A 3VHKA 4A9RA 5FTGA 3HL7A 2YDJA 2O8YA 3A7JA 2FO0A 4HPUE 4P2KA 4N6ZA 4YJSA 5HCZA 4UX9A 4C37A 5CY3A 4EBVA 4EONA 4RLKA 5EH0A 4YPDA 2R5TA 3DDQA 3OS3A 1LEWA 1T46A 5HHWA 3O2MA 1PMUA 3RPRA 4DGMA 4ANMA 3FJQE 3LQ8A 3E3PA 4FSUA 3DXQA 3DXPA 4BIEA 3T3VA 2O3PA 1U4DA 3MPAA 3SRVB 4AGUA 3QWKA 4HZSA 3EZVA 1YI4A 3NYOA 4L44A 5IKWA 2JFLA 5CLPA 3D83A 3EH9A 1ZYDA 5FXSA 5FBNC 4PF4A 4LM5A 2R4BA 4NM7A 5AP1A 1FPUA 1Q8YA 3DS6A 2G2FA 2A27A 5A54A 5BVWA 3W2SA 1IA9A 2YEXA 2CN5A 2YWPA 4CV9A 5CENA 3UC4A 2JBPA 5KMKA 2ZYBA 3BKBA 3IW6A 4PPCA 4TW9A 3F5GA 1YWVA 4R1YA 2ZV8A 1OECA 3PY1A 5EOLA 4PL3A 2ERZE 4P5QA 2WTIA 4Z3VA 2BUJA 2WO6A 3KA0A 1PRYA 3BLQA 1SNUA 5IA1A 3DTWA 2BHHA 4D2SA 3O8TA 5HKMA 3DJ5A 3QRIA 1OPLA 3ATSA 5J8IA 5TT7A 4IMYA 3L9PA 3COHA 4J96A 4LGHA 4LYNA 5L6PA 3WF9A 4EH6A 2XMYA 3JY9A 4X2NA 4FKVA 2C0TA 2H34A 3I7BA 2Q0NA 3R8UA 3UNKA 1BL6A 3SX9A 1U59A 4QMQA 2XIZA 2R3LA 4NM0A 4YJTA 3TNPC 4O2PA 3T9IA 3ENHA 3OEZA 4R77A 2DS1A 4GVAA 2W1EA 2YM3A 3RPSA 3G51A 3PP0A 2IN6A 2CGVA 2QONA 2R3OA 2WEVA 5E1EA 1PXJA 3Q5IA 5A6OA 3O7LB 4ZSEA 1KOAA 3ZCLA 4YO4A 2E9PA 2W06A 3BHYA 3WF8A 1I44A 5ETIA 2QU5A 4UN0C 2YERA 2R7BA 4PTEA 2HENA 4APCA 2EWAA 5DYJA 3PVGA 3IS5A 3UJGA 3WF5A 5KMMA 1BUHA 3EQBA 3V5WA 1Y6BA 3UYTA 1GZNA 1DAYA 1W0XC 4KAOA 3BIZA 3QLGA 5EHOA 3UC3A 1K2PA 2XNNA 3QTRA 5JMSA 4A9YA 5ACBC 4Q5EA 3TN8A 2P0CA 2YAKA 2B9JA 3ZXTA 4HYIA 3W32A 2NO3A 4X7QA 5DT0A 3U9CA 3I1AA 1UVRA 4FIJA 4EWQA 1KV2A 4IB1A 4BFMA 3G33A 3VS7A 3HRBA 4L7FA 5E8SA 3FKOA 4WRSA 3QRJA 4G5PA 4RWJA 4ZJJA 4O7WA 1YI6A 3E87A 2QODA 3GC9A 4Q9SA 3ANQA 4JQ8A 2QKWB 3ORKA 4H1MA 4TZRA 5AP3A 5FWKK 1OL2A 4O82A 3BGPA 1H1SA 2GNJA 4WUNA 1WBVA 3PPJA 3BU3A 4E73A 1XH9A 2B0QA 2IVSA 5JGDA 3VS0A 4JIKA 5DT4A 4FA2A 3VJOA 1JPAA 4BCOA 3ZO2A 4QMSA 4KRCA 2B9FA 4ZS4A 1OIUA 5HVYA 4WOVA 5HQ0A 5AP4A 3KEXA 2FVDA 3KF4A 5FEDA 5AFVA 5BYZA 2GDOA 2PK9A 4GYGA 4N57A 1CSNA 4GH2A 4EOSA 3IK3A 4L7SA 2R9SA 2W05A 3ROYA 4ALWA 2VV9A 4BDEA 4YTIA 4NM3A 2Y4PA 4V05A 5FEQA 4CCUA 1OUKA 1W8CA 3KRWA 2ZB0A 5JK3A 1O9UA 2JDSA 5CSPA 3R30A 5JZJA 4FTQA 4G6LA 1PYXA 2PSQA 1UA2A 2R3QA 1YOJA 2F49A 2OJJA 3C1XA 4TYGA 3REPA 3DKOA 2QC6A 3BPRA 3PLAE 2C69A 3LMHA 4TYHA 4AOJA 3KFAA 4GVJA 3AG9A 4CZUA 4XLVA 1W7HA 2VGPA 3ODYX 3QD3A 2UW4A 2UZBA 4IB3A 4WIHA 3EFWA 3ZC6A 4ACHA 4ASXA 1PF8A 4GFMA 3UPXA 1UV5A 4FTCA 4YJQA 4CKIA 4QP3A 5CEQA 3QRTA 5C8MA 2BTSA 4RC2A 4Z16A 4A07A 1AD5A 5FDPA 3OTVA 5IQFA 4JX3A 3TKHA 5A4TA 4K33A 3G5DA 2DWBA 5L8JA 1JKKA 4E26A 1CM8A 2JKKA 2CNVA 3RPVA 2XNMA 5HO6A 4DA5A 3DNDA 1WMKA 4IZ5A 2I0EA 5E8UA 2ITTA 4DBNA 3VUGA 2UV2A 3NCZA 4QYFA 2QLQA 3QZIA 3D2IA 5AADA 4PPAA 2RL5A 1GNGA 5AR5A 3WF6A 5ANJA 3OW4A 4BDAA 2OK1A 4D2TA 4YBKA 4EK8A 3LCDA 2OXYA 4I23A 3PLSA 4LV8A 3WILA 3F2AA 1Y8YA 4EH5A 4Y73A 4KRDA 3TV7A 3R02A 4F70A 3KMMA 3RJCA 3ZBXA 4FODA 3R7IA 2NP8A 2YHVA 1RDQE 4NL0A 2BRGA 4L00A 4E4MA 4EUTA 4ZOGA 4CTBA 4DINA 4UMRA 4G3DA 3BQRA 4CMUA 1QPEA 5AR2A 4BL1A 4YTHA 4U42A 3R8MA 4FICA 5J5SA 1Q8ZA 3OMVA 4ZP5A 2RGPA 4MWHA 4IWPA 5KZ0A 1QCFA 4HVDA 3GC0A 4WG5A 5J5TA 1KE9A 3ZFYA 1ZMUA 1OMWA 3DJ7A 4O1OA 3GU6A 4FTIA 4PTGA 4U80A 2I1MA 2J0JA 2YJSA 1FINA 1Q4LA 3GEQA 5CSVA 3OWKA 4FKGA 4EQMA 3NSZA 2LGCA 5DN3A 5IH4A 4YSJA 1QPJA 4MYGA 4V0GA 4D1ZA 5KBRA 2GNFA 2R64A 1KE5A 3MY1A 3VS2A 2W0JA 5KNJA 2EXMA 5DFPA 1R39A 3SG8A 5DRBA 2B9HA 4LRKA 1BI8A 1PXMA 4MBLA 4FKJA 4CVAA 5KMLA 3R1SA 4DG0E 4DCAA 3BV2A 4J98A 4YNOA 2WU7A 4L53A 3EQIA 3BZ3A 4DTBA 1UU8A 5HG9A 4YR8A 4YZCA 2X0GA 4NFMA 4EOOA 4NYEA 3KRJA 5CSWA 5KZIA 5IEYA 3OUNB 2JDTA 3E8CA 3LJ2A 5FRIA 3AGMA 3QALE 2W1FA 2GCDA 4M69A 4EQUA 4M8TA 4EYMA 4BN1A 2BIKB 5AAFA 1OVEA 4AF3A 4EL9A 4ID7A 3ZSGA 3AD4A 3R9OA 4CMTA 5EM7A 4QMXA 1R1WA 5A6NA 3W2PA 3UE4A 1OUYA 2C4GA 3UNZA 2PY3A 4U97A 4Y8DA 3C4FA 1FVTA 3EFJA 2WMXA 3D5WA 2C5OA 3MA3A 3MVMA 4FKLA 4G5JA 4XLIA 3U6HA 3FQHA 5E1SA 2PMLX 5IUIA 2GHLA 1MP8A 3K5VA 2C5VA 5DNRA 4EOLA 5IA2A 1FBNA 4DT8A 4F0IA 3EIDA 4L3LA 3Q4CA 5DI1A 2V7AA 1LPUA 3PFQA 4W8EA 2E9UA 4BWKA 4UXLA 3R1NA 4JL9A 3N9XA 4I92A 2WTCA 4YZBA 4AUAA 3PTGA 5IH5A 3MGYA 2BPMA 1P4FA 3A61A 5HESA 4FTMA 4APPA 2R3IA 1OKZA 2HY0A 5G6VA 4E4XA 1G8AA 3VO3A 1H01A 4KBAA 3BBWA 5DVRA 4C57A 4CZYB 5HU9A 3VJNA 3WE4A 3OUKA 4KS7A 3CY3A 4YTCA 1Q61A 3K3JA 4DEDA 3LMIA 2UW9A 5L6WL 2YCFA 3D7TA 3WBLA 4IX6A 1ATPE 5CTPA 4DH3A 1VEBA 1JKSA 2CLQA 3EMGA 2R3KA 4F1TA 4O27B 4O6LA 2H6DA 4RQKA 4D9UA 5L3AA 5E8ZA 2X81A 3ZLWA 2PE2A 3TKIA 1OIYA 3NUUA 4UB7A 2HOGA 1YWNA 3NUSA 3GU8A 3H10A 4YBJA 5FGKA 4J7BA 3DPKA 3D5XA 3HP5A 4R6VA 2OGVA 3ORIA 2Y7JA 4N4SA 3NUNA 3OWPA 4LG4A 4DFBA 3PXFA 2QOOA 3NUAA 1PY5A 2RFDA 3A2CA 3ODZX 4RJ8A 2BKKA 3V5LA 1G3NA 4CFFA 4ZY6A 2CHLA 3G6HA 3FMJA 3H30A 1X8BA 3ZHPC 4C4JA 5JFXA 1CMKE 4IAZA 4L67A 3HA6A 3II5A 4M15A 3FY2A 4B0GA 1OPJA 2FB8A 2J51A 3HMNA 4I21A 2ITOA 4IWQA 3UIXA 2PUUA 5HD4A 4NTTA 3FSFA 1KSWA 3FC1X 2QOHA 4RVTA 4LI5A 3RINA 4BHZA 4KD1A 4D1SA 5IA0A 5C4KA 3MJ2A 1URCA 4QT1A 3TZ9A 1CKPA 4UYNA 2J4ZA 1OL6A 3UDBA 5D12A 3UIBA 4CLJA 4M13A 3BHTA 3ID6C 1P14A 2I0VA 2Y9QA 3CS9A 4R8QA 5A14A 5AMNA 4DG2E 3ZRMA 3ORNA 4I22A 4ITJA 3OHTA 3LFDA 3QTXA 5IQAA 4CFWA 4RRVA 3GCPA 3IW4A 3V6RA 2VTTA 3ZMMA 4O84A 4WBBB 3WE8A 2YCSA 4KSQA 4IW0A 3ULIA 1UNHA 3PPKA 3R28A 2BRBA 2GQGA 2OSCA 3O0GA 4WT6A 5EYDA 4ZZNA 4USFA 4PX6A 2GTMA 2QR8A 3Q4ZA 4FNZA 4BDCA 1IRKA 1NY3A 2GPHA 4JVGA 4NJ3A 3SLSA 3TWJA 1XKKA 2JDOA 3FYJX 3KB7A 1GIJA 3OCSA 4FOCA 4FZDB 4RX7A 4XG4A 4ZTQA 4IEBA 4DEIA 1PXNA 4IANA 5ETCA 2YM8A 4O7RA 3OXIA 5CQUA 2KULA 3DA6A 2QR7A 4FV8A 1NT2A 4O81A 5BVKA 1MQBA 3TI1A 3EFKA 3RALA 4GW8A 2WTWA 4LQMA 4FTOA 1HOWA 1GZKA 1E1VA 2ERKA 3I4BA 5CNOA 4O7LA 3OD6X 4CFVA 4AT4A 4EK6A 2BTRA 2VTQA 2VTRA 4DFUA 5CEOA 4FSQA 2XM8A 2WMSA 3N4TA 3BQCA 5JGBA 5I9ZA 2PVJA 4JG7A 3G6GA 3GENA 1B6CB 3RWPA 4IHPA 5DMZA 4JDIA 2UZUE 4EC9A 2DUVA 3RZFA 3HX4A 5CWZA 5E8YA 3EB0A 4MD9E 4IZ7A 2QKRA 3ZZEA 5A3XA 3IQ7A 4X6RA 3CR0A 4FKSA 4GUEA 4QYEA 3FEGA 2WPAA 3TZ7A 4PV0A 3OROA 4PRJA 1ZARA 3MBLA 5CEKA 3U55A 4AN9A 1QL6A 2FSOX 3FLQA 3LLAA 3C0IA 4BKZA 4EJ7A 3CD3A 1WFCA 1MQ4A 2PULA 5FBOA 2UW5A 5LCJA 3PY3A 3TKUA 4JQ7A 5D41A 5EM8A 3E64A 1Y91A 2X4ZA 5I9UA 4QD6A 3C0GA 5AA9A 1M2RA 5LVLA 4UEUA 4D4YA 4EI4A 5A4LA 2WQMA 4MXXA 3QTSA 4DEGA 5IDPA 3SVVA 2BILB 1WVXA 4ZSAA 4JDHA 2W96B 3F2RA 4W9XA 5ANDA 5EQEA 2WNTA 3FKNA 2QOKA 2Q83A 4O7NA 4EHZA 3A7HA 3A60A 3BHHA 3FI4A 2ITPA 2ITZA 3OT8A 3FQEA 3R73A 2C68A 2JDRA 2VWBA 2XNGA 5E90A 4FT5A 3RPOA 4RJ5A 4CZTA 3TCPA 3FPQA 2R3FA 4KIKB 3GB2A 4KINA 4RJ6A 4FVQA 5CI7A 4QRCA 4BVUA 3MS9A 4C4EA 5IDNA 3QRUA 5BVOA 4ZTNA 2Z7QA 3AC1A 3OF0A 4IACA 4B6LA 4HW7A 3Q4UA 2IPXA 1Q3WA 5AM7A 3NW6A 3FMMA 2WMAA 4YO6A 4BI2A 5GJGA 2C6TA 3IOKA 4GFGA 3MFUA 5I3RA 4RIWA 3IKAA 4GU6A 1BYGA 3P7CA 2VU3A 3NVMB 3K3IA 2ZV2A 4U3ZA 3PA3A 3EN4A 4G2FA 4O96A 3CBLA 2A1AB 2WIPA 4IVAA 4BYJA 3VWAA 4GK2A 4XP2A 3KVWA 4QTAA 1KV1A 4TYHB 4HGLA 3PSCA 1RE8A 3OVVA 3ORPA 4V04A 1A9UA 4GRBA 3R9DA 3R8ZA 4QMTA 4YLLA 1DAWA 5BVFA 4UMQA 3OCTA 2YFXA 2OW3A 3R2YA 4AT3A 4BBEA 4S30A 2CKPA 4EHEA 4IM2A 2XK8A 5CAOA 4C38A 2QCSA 3C5UA 2JD5A 3TG1A 2V22A 3QGWA 3ORTA 5CAVA 1JSVA 2VZ6A 3QAME 1GOLA 4DTKA 3EN6A 5J9YA 3CQUA 4NH1A 4TWNA 2I0YA 4MKCA 2OJFE 2YDKA 3C7QA 3IOPA 4R7IA 5EQPA 4WKQA 4WBOA 1H28A 4O21A 4WSYA 2WTJA 3NX8A 5DH3A 5AR3A 3VBQA 3NVKI 1IAHA 3P7BA 4ZTRA 3QRKA 3I7CA 5HE0A 2XA4A 2J0KA 3V5PA 3VIDA 5T6KA 4Q9ZA 3A8XA 1RJBA 3LCKA 1ZOHA 3GVUA 5BPYA 2HWOA 4AZSA 3HV5A 4DITA 1O6YA 5BYYA 2PPQA 4F7LA 2X1NA 5HU3A 4I24A 3I81A 3PA5A 2IZRA 2UW7A 5EI8A 3VRZA 3A62A 2GNIA 1OL1A 4L01A 4YC8A 3U6IA 3C0HA 4EEVA 2X6EA 3EQGA 3PA4A 5CEPA 4ENYA 4DLIA 5M4FA 1Z57A 3DB8A 4R5SA 4EWHA 3CGFA 5CZIA 4EH4A 3Q53A 2WMBA 4ZAUA 3DAJA 2BDWA 2C3IB 2HXQA 3EN7A 3HV6A 3KMWA 1IEPA 4I5CA 2OJ9A 3G2FA 2QU6A 4OTGA 4QPSA 3QQHA 2X8DA 5CVFA 4KIPA 2X8EA 3VUHA 4CV8A 3PWDA 4G6NA 4N6YA 5AA8A 4IM0A 2YWVA 2UZDA 2UZEA 4IAFA 1V0PA 4M3QA 4PDYA 4NJDA 5AAGA 3HMOA 4O91A 4YTFA 3LFCA 4G31A 4X6QC 5JFSA 2RFNA 5CEIA 4JS8A 4DCEA 5HX6A 3HEGA 3LLTA 4IFGA 4IX3A 5IA5A 5CAPA 4V0GB 4GK3A 1FGIA 5CF6A 4U3YA 2X2LA 2PZIA 3IECA 3QQJA 3R21A 3U54A 4WNPA 1VR2A 3KN6A 4MD8E 3L9NA 4FTKA 4M12A 2JITA 3LFNA 5CASA 1BI7A 2HZIA 2C6MA 4BZOA 5AR4A 5EW3A 2PVNA 2YDIA 3FL4A 3R00A 4E7WA 4CFXA 1SVHA 4I6HA 2R3JA 4QMMA 3FKLA 3ACJA 3FV8A 3PZEA 5GZAA 5AX3A 3FXWA 1OIRA 3QHRA 1XBCA 5F94A 2WTKB 1J7IA 4M69B 4DFLA 4AQCA 2UZTA 1F0QA 5L4QA 2WOUA 3UMXA 4IWDA 4FV4A 2VTOA 2VN9A 2P2HA 4P5ZA 3FYKX 5C26A 4IZAA 4AOTA 2Y0AA 5HEZA 3THBA 1M14A 1SNXA 2GMXA 2JGZA 4H1JA 3UOKA 4WNMA 2PUIA 2DQ7X 3S4QA 3NW7A 2A4LA 4O38A 3HMMA 3CJFA 3WYYA 3IDBA 2FA2A 5H9BA 3WI6A 4KABA 3ZO3A 4FGBA 2ITQA 3BEGA 5HORA 4LOPA 3HGKA 1ZYCA 3KXXA 5M09A 4D4SA 3ZOSA 2ZOQA 1HCKA 2E9OA 3ZONA 2BZIB 2HYYA 5CS6A 4O0UA 3HA8A 2XCKA 5J1WA 1BLXA 5AUWA 5D11A 2QOFA 3GP0A 4FSRA 4OTPA 1OPKA 2BROA 2JAVA 4U43A 2UW8A 3G0EA 4UY9A 3MFTA 4FX3A 2XIKA 2RG5A 3NW5A 3BU5A 1R3CA 3CKWA 1LR4A 5KMNA 4DFYA 1TQMA 1KOBA 4IAAA 3OY1A 4FV2A 3LFSA 3AC5A 3ZO4A 4AN2A 2OKRA 3BEAA 4XRJA 3OP5A 3VC4A 2X7GA 5K0XA 5HTCA 3BRBA 3D7TB 3KVXA 4JJRA 1GY3A 4C3RA 3L8SA 4QP1A 4AXAA 4BCMA 4NCTA 3R7UA 3NCGA 3ZS5A 5HICA 4MNEB 3MSSA 3Q2JA 4IDVA 3PWYA 3ZC5A 5AP7A 5J7HA 4C7TA 4O83A 2XIXA 3RZBA 5LXMA 2J5EA 2GQSA 5DE2A 5M4UA 2XYNA 4E20A 5CEMA 3NNVA 5JGAA 5HLNA 4IADA 2CGXA 2ZDTA 3VBYA 4C62A 5L8KA 5E9EA 2O64A 3G9LX 5AX9A 3R7OA 3LXNA 4QMWA 4XMOA 4NZWB 2PVMA 3BHUA 4S2ZA 3ORLA 1PW2A 4U0IA 4KUJA 3ZBFA 3BHVA 2JLDA 5EKOA 2ITVA 5GIPE 3P0MA 3GC8A 3OC1A 4TPTA 3FMKA 5H3QA 3AT2A 4KIOA 3TNIA 2J50A 2WMUA 1OKVA 4Z9LA 2ITWA 3KRRA 4I0RA 1OB3A 1XJDA 3V5QA 3OWLA 1H24A 3RP9A 3TUCA 3UO5A 3QD0A 5BX0A 2BHEA 3MFSA 4I6BA 1XBAA 3AC2A 5H2UA 1OIQA 4K0YA 3CD8A 4USDA 4WA9A 5M06A 3QWJA 4AT5A 3MH2A 1URWA 1LP4A 3R7EA 4QMYA 4MXZA 3F7ZA 1ZYJA 1TQIA 1E1XA 4QNAA 4ZY4A 2OIDA 4AA0A 5TKDA 4QYYA 4B9DA 1S9IA 4RZWA 3TV6A 4G17A 5LMAA 1UWHA 3ZDIA 4AGWA 2G2HA 4KKHA 5FD2A 2XJ0A 3TT0A 3AGLA 3WZUA 4C4GA 3UZTA 3PYYA 1YHSA 5AIRA 3ERKA 4CTCA 4C35A 3KCFA 5M4CA 1T45A 1YXSA 3MVJA 4EHVA 1OITA 3F61A 4MQ2A 3P4KA 2WMQA 3KREA 5A4EA 4O0SA 2WGJA 3KK9A 4YZDA 4NU1A 5E8TA 3PE1A 3UMWA 4XNEA 4E5BA 2IZTA 4MF0A 3TXOA 4ZTLA 3FSKA 5DHJA 4WUAA 4O7TA 3CY2A 3EQHA 4BI0A 4QMZA 5B2KA 1ZMVA 4CRLA 4OTRA 5EDQA 1PYEA 4BDGA 2OICA 5BYLA 1JBPE 4UZDA 1YW2A 4X3FA 4BB4A 2QHMA 2YZAA 4FV9A 5F20A 5DG5A 3AT4A 2QOQA 1V0BA 2IWIA 3CPBA 2CMWA 2QI8A 5CF4A 4CYJA 3CEKA 4EH9A 3U4UA 5IQEA 5I4NA 4I4EA 3VW6A 3QC9A 2QO2A 3BV3A 3BYUA 4G3EA 4TWCA 4MX9A 4EZ3A 5HZNA 3PRIA 4FT3A 4KBCA 1UKHA 4H3PA 3Q5ZA 1H08A 4NK9A 3SXFA 5CU3A 2J0IA 4OUCA 5KHWA 2XRUA 4I5PA 4FSWA 5J87A 3Q9ZA 3IGOA 4HNFA 2B55A 4YZNA 2R3RA 3EOCA 4C8BA 2V55A 4UALA 2B53A 2E9NA 4FE2A 3FZRA 5AP5A 4FV7A 5F1ZA 5HO8A 4ANSA 5HGIA 3MY5A 3HV4A 4YURA 1H26A 4HVIA 2OIBA 2C6OA 5CVHA 5IISA 2HIWA 3W1FA 5LMKA 4XV2A 5DIAA 4HZRA 3IO7A 4OAUC 4ITHA 5C4LA 3FZSA 4YJNA 3A8WA 2NRYA 2QO9A 5AAEA 3O17A 5LVOA 2WMWA 2XH5A 3D2KA 5CSXA 3UZPA 2VWIA 4O2ZA 3CTHA 4G16A 3WZEA 3VUDA 3DFAA 4A4OA 5EW9A 4A4XA 4A9UA 4BTMA 2JIUA 2PVHA 4OTDA 1JSUA 1YHWA 2VTLA 3DJ6A 3FZOA 4YC6A 2VNWA 1QPDA 4ZJIA 2VX1A 2ZMCA 4FNWA 4RG0A 5HCXA 3L1SA 1EH4A 1UNLA 4IH8A 3E8NA 4V01A 1Z5MA 3LOKA 4I41A 5ETFA 4B99A 2FSTX 2OU7A 4LMNA 5EG3A 3WIKA 3PVUA 4QTDA 3QFVA 3AMYA 3GFWA 3H0YA 3ZRKA 3D15A 2G9XA 4XP3A 2C5NA 2XZSA 4Y5HA 4F0GA 3OCGA 4IAKA 3QX4A 1SM2A 4FSTA 4I5HA 2WQBA 4AW1A 3Q32A 2IZSA 3E3BX 3KULB 4YJRA 4USEA 4EBWA 2BDJA 1GIHA 3D4QA 5ANKA 4HOKA 3E88A 2GNLA 4S34A 4B4LA 2H96A 4CT1A 2BR1A 3COKA 3QTIA 4L9IA 4RIWB 1Q99A 4JDKA 4JX7A 4QQTA 5JFWA 5GINE 3FPMA 2Y4IB 4EUUA 1DI8A 4ARKA 4WG3A 3EQPA 1GIIA 1REKA 3S3IA 5CQWA 2J7TA 2W1IA 3QLFA 2QD9A 1J1CA 3DQXA 4RVMA 5BMSA 1BL7A 4P4CA 3EN5A 4IWOA 3RNIA 1IG1A 4XUFA 3ALNA 3R04A 2Q0BA 4E5WA 3TACA 5CVGA 2UW3A 5IUHA 3ROCA 4L46A 1H07A 4FEXA 1HCLA 3HV7A 3C51A 3PIXA 2C6IA 4I93A 4A9SA 1J7UA 2F9GA 3P5KA 4FZ6A 2F7XE 2XJ2A 4GFOA 4XS2A 3R0TA 2FSLX 3OXZA 3BI6A 3TIYA 2OFVA 1H25A 4KNBA 4JOAA 5TO8A 3F3VA 4IM3A 2CDZA 4NIFB 4CSVA 4E6DA 4EH7A 4FV5A 2PUNA 3HDNA 4CGAA 4XBUA 2YA9A 2OBJA 5HIBA 4ANBA 1OKYA 1WBPA 4QOXA 3FL5A 4RX8A 4XX9A 3MWUA 1XO2B 4KS8A 3W2CA 1KUTA 5C01A 3ORMA 2UZWE 3SAYA 3QUEA 3NYXA 2ZVAA 4HVSA 5EK7A 4LUEA 1R0EA 2ETKA 3L8XA 4AA4A 5HCYA 4WSQA 2IVVA 2XK6A 4UWCA 5G1XA 4JLCA 2GS2A 2XYUA 4C0TA 2VTPA 3AC3A 3KRXA 1JSTA 4GMYA 5ANGA 3VUKA 3CSVA 3JXWA 4K8AA 4JBQA 1PXOA 3GUBA 3HV3A 1YDTE 5E8VA 3GU7A 2QNJA 4YU2A 2PVFA 5EDPA 4QMOA 4RA5A 3LM5A 3CTQA 3DY7A 1H8FA 1ZWSA 2W5BA 4RIXA 2YCQA 2CNUA 3BYVA 3QTUA 5J7BA 1JQHA 3VS5A 4MXCA 4MD7E 4FR4A 3I6UA 1S9JA 4BTKA 4BCQA 4FI1A 5B7VA 2CLXA 3ZUVA 5BNJA 3S0OA 2YIWA 3O8UA 4D28A 5C27A 5JZNA 1LEZA 2YIRA 2VO6A 3CGOA 3LFAA 3MIYA 2ZDUA 1MRYA 4OBQA 3DNEA 5IQIA 3ZLYA 2I0HA 3NIZA 4D5KA 2Y8OA 4RGJA 5M44A 2X39A 4XHKB 5FLFA 1H00A 1M7NA 4FVPA 1L3RE 2PVYA 4FBXA 3DK6A 4E6CA 3UOJA 4L68A 3B2TA 1XH7A 3OZ6A 1YHVA 3LFQA 4ZZOA 1WCCA 4BICA 1Q8WA 5M53A 2EUFB 4O0TA 4FL2A 3TUDA 4B7TA 4ACCA 4ZMEA 4GG7A 2W4JA 2O0UA 3SXRA 4CT2A 3KQ7A 1WBOA 4IJPA 4OT5A 4FIFA 4GL9A 3HUBA 3C50A 3M1SA 3NUXA 4LRMA 5ACKA 1IAJA 3EWHA 4C36A 4UV0A 5EYKA 4IC7A 2PZ5A 4ZLOA 5C8KA 1G8SA 3ATTA 3JS2A 5FUTA 4F9WA 4AWIA 1FGKA 3JPVA 4UZHA 4XG6A 5B0XA 4PMSA 1YXUA 3BELA 4XG2A 3RM6A 1ZY5A 4KKGA 4G9RA 4QP6A 1R0PA 5FXRA 3EFLA 3FAAA 5AUYA 4D4VA 1U46A 1OL5A 4XBRA 3C4EA 5AV2A 3ACKA 4E8AA 1E9HA 4BIDA 4RQVA 3O8PA 3UNJA 1SYKA 4BDIA 3MH1A 4I0SA 1WBTA 2PZYA 1GZ8A 3FLWA 3PJ1A 3VW8A 3NAYA 1FOTA 4U45A 4C4FA 2ITYA 2WQEA 4H58A 3SA0A 4AN3A 4WRGA 3EKNA 4I6QA 2HK5A 3P79A 3SRVA 4CQEA 1H0WA 4F6UA 1YVJA 2B54A 4R1VA 3RTPA 5JQ5A 3T8OA 4GEOA 3EZRA 4UXQA 3UG1A 5HBHA 4QTCA 3SOAA 5I9WA 3NNWA 3U9NA 3VN9A 3ANRA 4Z55A 3GU5A 2PL0A 3EYGA 3QXPA 3QX2A 4D58A 3R8PA 3K54A 4C3FA 3KGAA 5AR7A 3EKKA 2VTJA 2W1ZA 4FUXA 5I9YA 4BWXA 2ONLA 5KMJA 3Q60A 2PWLA 4BBFA 4O7ZA 4GIHA 1B39A 3PE2A 4FIEA 2YISA 5ANOA 4RC4A 3LW0A 5AUUA 5AP0A 1A48A 4AE6A 2W4OA 4GYIA 2W17A 2OWBA 2GS7A 3OEFX 2XKCA 3PPZA 3ZEWA 4JIAA 3TM0A 2C6LA 4QMLA 5HLWA 4FF8A 2I7QA 3DLSA 4LUDA 3LCTA 2W99B 4PMMA 4AZTA 2WTKC 4QMNA 3SDJA 4FNXA 4PWNA 4C3PA 4YLKA 3MY0A 3FDNA 3W16A 3KXNA 4FV3A 3OY3A 4LL5A 4O7SA 1NXKA 2JIVA 2XVDA 3B2WA 4O7YA 3VUTA 5HTBA 4IB0A 2XIRA 4DF3A 1SMHA 1XWSA 3EJ1A 2PVLA 4RMZA 2Z7RA 4TWPA 3C4ZA 5AR8A 1P5EA 1VZOA 4CFMA 4F9AA 2QOIA 4YMJA 2F57A 2KTYA 3BWJA 1O6KA 3F82A 4HYUA 4U7ZA 4C2WA 1ZYSA 3ZM9A 2X2KA 1K9AA 2FH9A 1PXPA 1RW8A 2JAMA 2YITA 4QMPA 3ZSHA 4F9CA 2J2IB 3SHEA 3PJ8A 3QCSA 3MTFA 4TN6A 1G5SA 3V5JA 3ORXA 3VULA 5DPVA 3EQDA 2VO3A 4FYNA 3CJGA 4FEWA 1U54A 3QXOA 4D0WA 4GCJA 4J97A 5EHYA 3R8LA 2BMCA 3HMPA 2BALA 3FMNA 3R8VA 3VUIA 3COIA 5EHLA 3FXZA 4ZZMA 4JT3A 4O7VA 4A7CA 3HNGA 3MV5A 4ORKA 4QP8A 3PP1A 4EOMA 3KN5A 2VWWA 4K18A 4PP7A 5CF5A 3L8PA 3F5UA 4IVBA 2IG7A 3MDYA 4JG8A 3NS9A 5A46A 3ULZA 3DQWA 3QCXA 4GS6A 5L6OA 4PL4A 1M52A 4JG6A 1UNGA 4BKYA 5E7RA 4G34A 5LCKA 1ZRZA 2ETRA 2XM9A 3KF7A 5D10A 3U87A 3JR1A 3LQ3A 4IAIA 3UYSA 3WARA 2RG6A 3MN3A 4O6EA 3KK8A 5BMMA 1P2AA 2E2BA 2QURA 2UVXA 3MB6A 4O0VA 3UVRA 4LRJA 4TNBA 4IZYA 1H1WA 5IA3A 5IUGA 2UW0A 3VF9A 5E8WA 3QD4A 5EDRA 3EHAA 1PJKA 2DYLA 4CKRA 2VO7A 4X3FB 4U41A 2XNOA 1J91A 3TUBA 4FV0A 4YHJA 3LZBA 5FM3A 3UGCA 5TOZA 5IF1A 4Y5QA 3OFMA 4W4WA 2W1GA 3GXLA 5CU6A 3N4VA 3CLYA 3JVRA 3K5UA 1Y57A 2F7EE 3FLZA 4NW5A 5FQDC 4NUSA 2FSMX 2ZM1A 4O0YA 5ANEA 5IG1A 4X2GA 1OKWA 4X2KA 3ENMA 2R3MA 2X8IA 2X4FA 4FSYA 4S31A 2W1HA 4DH1A 3KXZA 1UWJA 5CU2A 3ZLSA 4CEGA 1V1KA 4BTJA 4YPSA 4AW5A 2P3GX 1NVSA 3G0FA 2V0DA 2VTHA 1JKTA 3GC7A 1W84A 4DH7A 3O7LD 5HIEA 1MRVA 1OGUA 3AC8A 3O50A 4EOKA 5HG8A 5FM2A 4EZ7A 4G3GA 4F99A 4E4LA 5L2QA 4GJ3A 4O22A 2QOLA 1BX6A 4QMUA 4IJ9A 4DGGA 5CZHA 1W98A 3E8DA 4B8LA 5F4NA 3PG3A 4KIQA 3BWFA 3FUPA 3DK7A 2W1CA 3TNWA 3A7GA 3SD0A 4FMQA 4BHNA 4ENXA 3ZRLA 2AUHA 4RVKA 2AC3A 2VNYA 4GSBA 4LFIA 2J90A 4MAOA 2R0IA 3LVPA 3P78A 3UO6A 1JLUE 3NNXA 3B8RA 2A19B 3HKOA 4AG8A 4H3QA 2YIYA 4K11A 4M97A 4IQ6A 5TF9A 1U5QA 3SQQA 5ETAA 3V3VA 3A4PA 4IIRA 2C6EA 4QO9A 5FG8A 2YIXA 5CSHA 3V51A 2HAKA 1Y6AA 3QF9A 4LOQA 2XNBA 3OBJA 2C47A 4JRVA 4I6FA 4BCHA 4J1RA 5HG5A 4OTFA 2IW9A 4BZNA 4EK4A 5AWMA 4FL3A 5HE2A 4DEBA 2RIOA 4FK6A 4OLIA 2VGOA 3R01A 3QC4A 4ANNA 1H1RA 4R5YA 2WIHA 2UZLA 2WEIA 3QUPA 2C3KA 5JQ8A 2BAKA 2BAJA 2X9EA 3EYHA 2GHGA 4X0MA 3FBVA 2YM7A 5IQCA 5I0BA 5I9XA 4KB8A 4XOZA 3FHRA 3NUYA 1FMOE 3FMHA 3IW7A 1PKDA 4G6OA 2H8HA 3NZ0A 2IW8A 4ERKA 4F09A 3O96A 1H0VA 3RCDA 3L9LA 4IC8A 5J95A 3NMUF 4OTWA 3WF7A 3QZFA 2XUUA 3RPYA 4PPBA 4YP8A 3W18A 4ACMA 3EL7A 2O63A 3OG7A 2JKOA 5I3OA 3RK9A 4DEHA 2B7AA 3H4JA 3TV4A 5M55A 2YZLA 2W7XA 3NAXA 4BZDA 2GU8A 3D7ZA 4CCBA 3VBXA 3WZKA 3I5NA 3MJ1A 4XV3A 3FY0A 5JRSA 4CFNA 2UVYA 4D2RA 1FQ1B 3TDVA 3Q3BA 3U6JA 2PMNX 4RSSA 4ANOA 3DTCA 3WZDA 2J6MA 3ZUTA 3MA6A 5F95A 5M08A 4DEEA 3JVSA 5C8NA 2HW6A 2WQNA 4XP0A 3V8TA 3CKXA 3PSDA 3QKMA 5K4JA 5DA3A 3KU2A 3RK5A 4WG4A 2X7FA 3ZSIA 4FKQA 3HVCA 2YN8A 2QVSE 3EQFA 4N0SA 3ZYAA 5DBXA 1YRPA 5CU0A 2VX0A 5K9IA 2GS6A 3R2BA 3S2PA 4C02A 3DCVA 4EH3A 4X21A 5J1VA 2IZUA 3F9NA 5AUVA 3ET7A 5FP6A 4ZSLA 5DOSA 2W5AA 4FZAB 4MXAA 3KXHA 4PUZA 4RJ3A 4PNKA 1JKLA 1QMZA 3DU8A 5LQFA 5M07A 1PXKA 4FTAA 3E7VA 3QKLA 4KBKA 5HVKA 4O1PA 4EHGA 3LIJA 3R71A 3W8LA 4LMUA 4GK4A 5KKRC 4DT9A 1YI3A 3CP9A 4AW2A 1WBWA 3QYWA 2BCJA 4FTLA 2VWVA 1Z9XA 2WELA 4RWLA 1OL7A 2JFMA 4QMVA 1UKIA 2Y4IC 2ITNA 3MVHA 2J5FA 2WOTA 3KCKA 5L2WA 3QA8A 2Y6OA 3BLRA 4DGLC 5K5NA 4LL0A 2CKEA 4M67A 4UWBA 2WMRA 3RWQA 3P1AA 4K6ZA 2XKDA 2V7OA 2B4SB 3IG7A 4L45A 4ZSGA 2PVKA 2VTAA 5DT3A 4IXPA 4AZEA 4RC3A 5IA4A 3I0OA 3RMFA 1WVWA 2XF0A 2C1BA 2NRUA 4UMTA 4HGTA 4Z7HA 4M14A 4FIIA 4F9YA 1TKIA 2W1DA 3UBDA 5CF8A 5LWMA 4M7IA 3QCYA 3FZ1A 3GNIB 3C4XA 3LCOA 3KY2A 1ND4A 5KE0A 5E4HA 4FT7A 3Q6WA 4Y46A 4C59A 3UVPA 3VRYA 4NWMA 5D7VA 4RFZA 3FI8A 3DFCB 3SV0A 4GIIA 4FSNA 1VYWA 1ZZLA 3R22A 5CXHA 3RI1A 3P08A 3LFBA 4Q5HA 4D4RA 2VTIA 3LQ5A 3TNQB 1W82A 5IMEA 2XIYA 4YZMA 3BX5A 4MBIA 4ZTHA 2G2IA 4Q2AA 1Q8UA 4DEAA 4DBXA 3CTJA 4BDDA 2HXLA 2V5QA 4JNWA 5TR6A 2PZPA 5DR2A 5HG7A 4F4PA 3A7FA 3R9NA 3WOWA 2CCHA 5IPJA 3PDTA 5EYMA 1JAMA 1H4LA 2F4JA 1XH4A 5EYCA 2ZJWA 3TNHA 2ITXA 4QYGA 3VQUA 4AGDA 3DT1A 3VHEA 4FGRA 3MPMA 5I5ZA 3HYHA 3MW1A 4FKPA 4EH2A 4F6SA 2ZB1A 4F6WA 2HW7A 4TXCA 2YJRA 4E6AA 4NTSA 5IQHA 4LGDA 1NW1A 3DKGA 3HLLA 4I1ZA 1ZZ2A 2C5YA 4D1XA 3IGGA 4W4YA 5M51A 4Y83A 2R2PA 3Q04A 2PVRA 3CCNA 1CTPE 4XV9A 3QZHA 3V01A 5LVPA 2UZOA 2ZAZA 3G90X 4FV6A 3V8WA 2OF2A 4FC0A 3TJDA 3FZTA 4HYHA 4HYSA 2YM5A 1YKRA 3QGYA 1LUFA 2VAGA 3DV3A 3SKCA 2XBAA 2R3HA 5HO7A 5M57A 4MK0A 3COMA 4BCPA 4L42A 2P4IA 2BVAA 5J9LA 2HZ0A 2HY81 3PIYA 4FEUA 2WZJA 3LPBA 3LHJA 4B8MA 4A9TA 1PMNA 5B2LA 4DAWA 4Y72A 2GFCA 4AS0A 4EJNA 1A06A 4EOQA 2E9VA 3DAEA 4FTNA 2YM6A 5GZ8A 5AV3A 2X7OA 5AP6A 3ORZA 4PDSA 2PE1A 3F6XA 3N51A 2CGWA 4WO5A 1OZ1A 4U40A 1GAGA 2OH4A 3HECA 3NDMA 3I6WA 3MVLA 1KE8A 2WTVA 3LAUA 4EKLA 1XR1A 4G3CA 3F3WA 3IDCA 4GKIA 2FYSA 2QG5A 3ALOA 4F7JA 3ZEPA 2RFEA 3QBNA 4BGGA 3ZDUA 3E92A 5I9VA 4H36A 4OBOA 4BDJA 4UWYA 1J3HA 1WBSA 3KC3A 4PY1A 4TNDA 2QG7A 3BCEA 5CANA 5M4IA 3I0QA 3F3TA 2EXCX 2OLCA 5AV4A 3DBEA 2R3GA 4FVRA 3NGAA 4F1MA 4OTHA 2C30A 3UO4A 5JKGA 1F3MC 2GFSA 4MH7A 3FLSA 2XK7A 2QOBA 3UQCA 4FT9A 2QO7A 3OBGA 1OBDA 3VS1A 4AX8A 3VAPA 1VYZA 3EQRA 1U54B 3FMLA 4RJ4A 3UG2A 4FG9A 4D55A 5B2MA 3C5IA 4DTAA 4KWPA 2UUEA 3NYNA 5LWNA 3WZJA 2O5KA 2YCRA 3PUPA 3QYZA 1AGWA 4K77A 4YSMA 4FKIA 3S95A 5ICPA 5CYIA 2GTNA 4H39A 4PDPA 5IH6A 4OBPA 3DBFA 1XQZA 3KL8A 4XG8A 4RVLA 4L6QA 3H9RA 3R7GA 4W9WA 4YJVA 4C61A 4D5HA 4ZTMA 3ZUUA 4KIKA 3QKKA 4IVCA 5AP2A 4RIOA 3PJ2A 4NCTC 1TQPA 1F5QA 2C5XA 2QLUA 3OCBA 4UYAA 5AIKA 4DGOA 3CQEA 3W2QA 2CCIA 3QQUA 3R1YA 4BDFA 3CXWA 3I79A 3TZ8A 3GT8A 4C33A 4RZVA 4JRNA 3F2NA 4DE4A 2GSFA 3GU4A 4FL1A 4NKSA 4CMOA 5KMOA 5LMBA 5HI2A 1SZMA 2A2AA 4L3JA 1JNKA 5DLSA 5BVEA 4OW8A 4ANQA 4II5A 5JT2A 4E3CA 4BDHA 2QOCA 3JYAA 4G9CA 3GCSA 3LCSA 2P33A 3EN9A 1H27A 1V0OA 4FNYA 5ITAA 3V5TA 4AOIA 4D2PA 1Q41A 3AMAA 4IAYA 3JUHA 1ERKA 5CNNA 1PMVA 2R3PA 2HZNA 3D94A 3H0ZA 4J53A 5K3YA 1ZAOA 4ERWA 4FKTA 3GFEA 4L8MA 5H8EA 3SC1A 5CAUA 1VJYA 2C6DA 3H9FA 5KO1A 3Q9XA 4O86A 2PMIA 4BCGA 4OT6A 5GIOE 1JVPP 2HELA 4KA3A 2UW6A 4RT7A 4M0ZA 3F69A 5AV1A 3RKBA 1M2QA 4EKKA 5C1QB 4AE9A 3F3ZA 3PXQA 3ETAA 4FT0A 4MEDA 2EU9A 4PNIA 3HP2A 5BUJA 4U6RA 3R83A 3A4OX 4QQJA 3OTUA 2CJMA 1CKJA 3C4WA 5KKRB 2CKOA 2XK3A 3Q52A 3NRMA 2ZMDA 4PDOA 3TIZA 4JBPA 2C6KA 3O71A 3DGKA 3HRFA 3QL8A 2G1TA 4YUQA 4EZ5A 3DXNA 3BU6A 3DLZA 4BGHA 3NPCA 4JBVA 3MIAA 4RA4A 3SW7A 2ESMA 2RFSA 4K1BA 3RHKA 1KE7A 3RVGA 4X2JA 4ASDA 4Z7GA 2R7IA 4D9TA 2BIYA 4QTEA 4TWOA 2WD1A 2JEDA 4QNYA 2JDVA 5HNIX 5L8LA 2G01A 4O0XA 4RWIA 3PXYA 5EOBA 3QUDA 1OBGA 4QP4A 5DRDA 2CNQA 2AYPA 5AEPA 2OZAA 5IZFA 5EKNA 2G15A 3F5XA 1XHAA 3RHXA 1MUOA 3MI9A 3Q9WA 4WNKA 4DYMA 4YJPA 3DAKA 5DEWA 2Z7SA 3IW8A 1STCE 3B8QA 3QD2B 1Q97A 3DOGA 4WHZA 4IX4A 2JC6A 5HE3A 3ZM4A 2O65A 4F64A 2WMTA 4C4HA 2OFUA 4BTFA 4BIBA 4ANLA 3FZPA 4AACA 2CN8A 2JKQA 3R9RA 3IPHA 4J8MA 4IX5A 3AD5A 4X3FC 1YWRA 2BKZA 4HCTA 4AZVA 3QA0A 1PHKA 2W9FB 4RIYA 3R7YA 1FVRA 3Q6UA 4XOYA 3LJ0A 3D9VA 3U4WA 3BGQA 1J7LA 2OXDA 2EB2A 4QP2A 4XV1A 4JAIA 2OH0E 2XBJA 5HBJA 2BRHA 3ZFMA 2RF9A 4FSZA 4FUYA 1WAKA 1U5RA 2V62A 4MQ1A 2XNEA 4PTCA 3TTJA 2YACA 3F5PA 3FLYA 3HRCA 2PZRA 3DKFA 4FEQA 1WBNA 4EH8A 1XH8A 4GV1A 2OXXA 3PXRA 4ZLZA 1DS5A 4TRLA 1AQ1A 4Y85A 2F7ZE 5CX9A 4A06A 4K2RA 2REIA 4F7NA 1ZOEA 3LXKA 4ASEA 4F9BA 1ZLTA 4P90A 3MH3A 4BCKA 5IEVA 4BBMA 3HZTA 1M7QA 2OI4X 1KWPA 3V8SA 5BVDA 2B9IA 3GI3A 3BE2A 4ACDA 2W9ZB 3QTZA 4BWPA 3R6XA 4W4XA 4EK5A 3UOHA 2IVTA 2UZNA 3E62A 4QP9A 5LMKC 3Q9YA 1PMEA 4F65A 2JKMA 2Z8CA 3W2OA 5DWRA 2O2UA 5ANIA 4GU9A 4ZTSA 1GJOA 3PXZA 5HVJA 4HCVA 5CXZA 1YXVA 3RAKA 3ELJA 3MFRA 4O0RA 5LJJA 4DH8A 2H9VA 2XEZA 1M17A 3KXGA 4NW6A 3M2WA 3DDPA 5T68A 5K0KA 2ZV9A 5FTOA 4CG9A 2ZV7A 3P7AA 2VUWA 5FEEA 3ZXZA 2Z60A 3VS4A 3NYVA 2OG8A 5JSMA 4LOOA 1Q3DA 1L8TA 2FUMA 4WNOA 1RQQA 5DR6A 4QPMA 3TZMA 2AC5A 4E6QA 1YXTA 5JN2A 2FGIA 3E7OA 4RBLA 5KUPA 5AM6A 4ZIMA 1YQJA 4DH5A 4TYJA 4U5JA 5HX8A 5IU2A 3HAMA 4R7BA 3PVBA 4E93A 3HDMA 4ZLYA 4QP7A 3AT3A 1JWHA 3F3UA 4R3RA 5KHXA 5EM5A 3BYSA 5AUZA 4MCVA 4C34A 4I4FA 3BYMA 3QTQA 3DK3A 5AV0A 2X6DA 4NSTA 3VS3A 4F0FA 1H1QA 4EYJA 1I09A 3QCQA 3UTOA 4YHFA 4CD0A 3CPCA 2BZKB 3ITZA 4YZ9A 4BRXA 5K5XA 2PMOX 2NNWB 4CRSA 4YC3A 4W8DA 4A4LA 3E93A 4GJ2A 3VBVA 4HJOA 3MPTA 3WIGA 1DM2A 1TVOA 4R78A 2BFYA 4E4NA 3FQSA 1O6LA 2EVAA 4FK3A 4H05A 3N4UA 2J0LA 4F08A 2WU6A 1NVRA 3RBWA 2XK4A 4RFYA 5HD7A 5LVMA 5LVNA 3GQIA 4J8NA 2X2MA 5LOHA 5JFVA 2CKQA 4BCIA 5HLPA 4U44A 5EFQA 5GZ9A 4JR3A 3OT3A 1FVVA 4MNEA 3VBTA 4PQNA 3G9NA 3P86A 4N70A 5EM6A 2ZM3A 5KCVA 4XYFA 2GQRA 3PJ3A 3PVWA 3W2RA 2NPQA 4X3JA 3RAIA 3SXSA 3ZFXA 4BF2A 4BR3A 1K3AA 1XH5A 2XK9A 1OI9A 2YM4A 3VF8A 3QQGA 4JI9A 4GG5A 4XEYA 4IVDA 4MTAA 4CQGA 3UQGA 5J9ZA 2EXEA 5C9CA 4RX9A 3G15A 4U8ZA 4K9YA 3WYXA 5IQDA 3O23A 3H9OA 4BCFA 2ETMA 3RCJA 1YDRE 3VS6A 4ZEGA 3TTIA 3ZLXA 1YXXA 3GOPA 4DC2A 1Q24A 5E8XA 5FTQA 2WTDA 3UIMA 3LM0A 4JDJA 3POZA 5JRQA 3EQCA 3UOLA 4YLJA 1Q5KA 2PTKA 3QU0A 5CT0A 4EORA 5M56A 3UPZA 1UU3A 3DBQA 4FTRA 2ZM4A 1APME 4FTJA 2R0UA 3DB6A 3OW3A 3JY0A 5A9UA 4OTQA 5IQBA 4XG3A 4FKWA 1REJA 1M2PA 2GHMA 2YLFA 5HNGA 2XJ1A 3GCVA 4FV1A 3W10A 4DHFA 4XRLA 3FMEA 4AU8A 4XG9A 3T3UA 3GGFA 4BKJA 4IFCA 3KMUA 3NWWA 1OM1A 3NNUA 1PKGA 2CPKE 2OO8X 3Q2MA 2C3JA 1CDKA 3R63A 5KX8A 3ZU7A 3I60A 2EB3A 3DZQA 3QHWA 3QQFA 5GHVA 4C2VA 3E63A 4AFEA 4GT5A 3Q96A 3SGCA 4BC6A 5HE1A 5H8GA 3UP2A 2PUPA 4RFMA 2GNGA 2BDFA 3DKCA 4M84A 5DR9A 2GNHA 2XNPA 4AAAA 4CG8A 3HAVA 4FG8A 2WXVA 4KKEA 2Z7LA 2BFXA 3H3CA 2IVUA 1Q8TA 3V6SA 2WFYA 2XKEA 4IB5A 3AC4A 3QQLA 4BCNA 3AOXA 4W4VA 3L8VA 3D14A 1NVQA 3ZTXA 3NLBA 3R1QA 4TYIA 5E91A 4M0YA 3W55A 4FIHA 4C58A 3C4CA 3UVQA 3CC6A 2HCKA 4FSMA 4NM5A 4U9AA 2C1AA 3GCQA 4YGAA 4DGNA 4J52A 3R9HA 4G3FA 4AGCA 4ZK5A 3TEIA 4TY1A 3MB7A 3CE3A 5D1JA 5EW8A 5D7AA 3LMGA 1Q62A 5CI6A 3BE9A 3NR9A 5HIDA 5JEBA 1UU7A 2YIQA 4ASZA 3O51A 2RSVA 2OF4A 4ACGA 3MTLA 2BRNA 4ZJVA 4BDKA 2HZ4A 2YAAA 4O0WA 4RWKA 4AA5A 4OGRA 4ZY5A 4FOBA 5H8BA 2W5HA 1IASA 4GT4A 5T3QA 4QYHA 3ZZWA 4BI1A 4DFXE 3TJCA 4MHAA 1QPCA 3OOGA 3POOA 5A4CA 4H3BA 4AFJA 3BYOA 3OOMA 2PYWA 2CGUA 3A99A 3KRLA 5EQYA 5CU4A 4EK3A 2XS0A 3FLNC 4IDTA 3E8EA 2PU8A 1ZXEA 3UZRA 3SG9A 5E92A 3UIUA 3FC2A 3TL8A 2J0MB 5GJDA 1WVYA 2X9FA 2YLEA 3UQFA 2B1PA 3KXMA 4TKSA 4JXFA 1H1PA 4NEUA 2C0OA 4G1WA 3D5VA 3PSBA 4XH6A 1Y8GA 4UMPA 2ONLC 4R3CA 4YNEA 1ZOGA 4PMPA 4HGEA 3M11A 4ZMFA 4D2VA 2OZOA 2R3NA 5CT7A 4Y95A 1YOLA 4HVHA 2PHKA 4FKRA 4U79A 4FG7A 3RM7A 4F63A 4AZFA 4BDBA 4AZWA 2F2CB 2VRXA 3PZHA 2BZJA 2WKMA 3QQKA 2VWXA 3CQWA 4U81A 4OAVB 3V04A 5BUIA 2IW6A 3OWJA 2XKFA 5D9HA 1YDSE 5JH6A 1ZY4A 5HTIA 5BVNA 5GNKA 2BZHB 1SVGA 4M68A 3LKMA 2WB8A 4TTHB 3ZO1A 3VNTA 3KULA 3PJCA 4L43A 5HOAA 5IMXA 3UODA 3HMIA 4CLIA 3BBTB 3QZGA 3IDPA 5TE0A 3LJ1A 3VBWA 5CALA 5EI6A 5IEXA 3FXXA 2PE0A 4AW0A 2UVZA 4EOIA 3BGZA 4RPVA 4FIGA 4ZS0A 4EOPA 2VTSA 3S1HA 4JBOA 3PXKA 5DGZA 2P2IA 1JOWB 3VUMA 4FKUA 2VWZA 1FMKA 2VTNA 3NUPA 4DN5A 4BGQA 1IA8A 2I40A 3E5AA 4IBMA 4CYIA 4RLLA 4R3PA 3PY0A 4UMUA 5A4QA 4RX5A 1BKXA 4RJ7A 3IW5A 5HBEA 3NIEA 4DLJA 3KKVA 2YABA 1PXIA 3GBZA 4IE9A 4L52A 3AD6A 5L2IA 2XEYA 1DI9A 3DZOA 3AXWA 4YJOA 2I6LA 2WMVA 4NIFA 4HVGA 5AUTA 3T9TA 2P55A 4I3ZA 4D2WA 4FZFB 3D0EA 2IO6A 4FZ7A 3RAHA 4TYEA 4KSPA 5F9EA 4S33A 1YOMA 3F66A 4WD5A 5FXQA 3R7VA 4QPAA 4MBJA 4E1ZA 5KBQA 4E5AX 4EC8A 3U8WA 2OJIA 2B52A 4JR7A 4UBAA 3LFFA 2C3LA 4MNFA 3I5ZA 4YHTA 2QQ7A 4ZXTA 4HCUA 4BY9E 1PXLA 2HWPA 2XP2A 3RAWA 3RK7A 4EQCA 4YJUA 4JAJA 1UU9A 5KMIA 5C03A 2OZAB 1GZOA 3L9MA 4GT3A 4QTBA 4XCUA 5HNBA 1XH6A 2WAJA 3HUCA 4D0XA 3C13A 3P23A 4NT4A 3NEWA 4ALVA 4L3PA 2XCHA 3EL8A 3MESA 4PMTA 3D5UA 5BUEA 2BAQA 3CIKA 4MXOA 4PL5A 4CFUA 4F7SA 1SVEA 4OTIA 5BQ0A 4HPTE 3F88A 3SW4A 1P4OA 2VWYA 3FI3A 4FTTA 2QHNA 5EI2A 4ZSJA 4BYIA 1KE6A 4XJ0A 3Q4TA 1W83A 4RIYB 1ZYLA 4LV5A 3K2LA 1CKIA 2Z02A 5FDXA 5J79A 1B38A
chains in the Genus database with same CATH superfamily
2CSNA 3PIZA 4I94A 4NKAA 4HGSA 3UP7A 1XMMA 4MWIA 4GKHA 3LXLA 4M66A 3S00A 1NA7A 4DFNA 5DEYA 4X2FA 2ITUA 2VO0A 3RGFA 3SOCA 4I0TA 2Y6MA 2LAVA 4MVFA 2OJGA 4FYOA 3TDWA 2JBOA 4BCJA 4DFZE 4RIXB 2Z2WA 4FRFA 4J71A 4S32A 5AUXA 3AMBA 4F1OA 3U51A 4I5MA 2SRCA 3W33A 2RKUA 4FTUA 5GJFA 4QDEA 1MRUA 3FMDA 4J95A 3AQVA 2J9MA 2JIIA 3IONA 1VLRA 2VWUA 4CXAA 5L2SA 2XRWA 4C4IA 3MYGA 4CNHA 4P7EA 3ZH8A 3VQHA 3QTWA 4QQCA 3M42A 3OXTA 1XBBA 3F7WA 2VTMA 3LXPA 2F2UA 4FKOA 3W8QA 2IJMA 2A98A 3C9WA 5IQGA 2A0CX 4R7HA 4TT7A 3PG1A 4GUBA 3DBCA 3LE6A 4PP9A 3GOKA 2VD5A 4TL0A 3GCUA 5K4IA 1IR3A 3PUFC 1ZMWA 3A7IA 3BLHA 2WHBA 2WQOA 4HNIA 3P9JA 4ALUA 3DBDA 4DG3E 4AP7A 2W4KA 4FEVA 2OIQA 3MH0A 4ITIA 4ONAA 4DHJA 5AJQA 5FP5A 4EOJA 3GQLA 2ACXA 1R78A 5CAQA 4J99A 4XG7A 3FE3A 1J1BA 3RNYA 1WZYA 3FI2A 3VVHA 3FWQA 2XB7A 3FHIA 4JQEA 2IF8A 2VX3A 2BRMA 4MXYA 4I20A 4QQ5A 4CKJA 4MF1A 5L2TA 1BMKA 2C0IA 3PRFA 5LARA 4NFNA 4LGGA 2UZVA 3LFEA 4OR5A 3VHKA 4A9RA 5FTGA 3HL7A 2YDJA 2O8YA 3A7JA 2FO0A 4HPUE 4P2KA 4N6ZA 4YJSA 5HCZA 4UX9A 4C37A 5CY3A 4EBVA 4EONA 4RLKA 5EH0A 4YPDA 2R5TA 3DDQA 3OS3A 1LEWA 1T46A 5HHWA 3O2MA 1PMUA 3RPRA 3BLAA 4DGMA 4ANMA 3FJQE 3LQ8A 3E3PA 4FSUA 3DXQA 3DXPA 4BIEA 3T3VA 2O3PA 1U4DA 3MPAA 3SRVB 4AGUA 3QWKA 4HZSA 3EZVA 1YI4A 3NYOA 4L44A 5IKWA 2JFLA 5CLPA 3D83A 3UDZA 3EH9A 1ZYDA 5FXSA 5FBNC 4PF4A 4LM5A 2R4BA 4NM7A 5AP1A 1FPUA 1Q8YA 3DS6A 2G2FA 2A27A 5A54A 5BVWA 3W2SA 1IA9A 2YEXA 2CN5A 2YWPA 4CV9A 5CENA 3UC4A 2JBPA 5KMKA 2ZYBA 3BKBA 3IW6A 4PPCA 4TW9A 3F5GA 2XANA 1YWVA 4R1YA 2ZV8A 1OECA 3PY1A 5EOLA 4PL3A 2ERZE 4P5QA 2WTIA 4Z3VA 2BUJA 2WO6A 3KA0A 1PRYA 3BLQA 1SNUA 5IA1A 3DTWA 2BHHA 4D2SA 3O8TA 5HKMA 3DJ5A 3QRIA 1OPLA 3ATSA 5J8IA 5TT7A 4IMYA 3L9PA 3COHA 4J96A 4LGHA 4LYNA 5L6PA 3WF9A 4EH6A 2XMYA 3JY9A 4X2NA 4FKVA 2C0TA 2H34A 3I7BA 2Q0NA 3R8UA 3UNKA 1BL6A 3SX9A 1U59A 4QMQA 2XIZA 2R3LA 4NM0A 4YJTA 3TNPC 4O2PA 3T9IA 3ENHA 3OEZA 4R77A 2DS1A 4GVAA 2W1EA 2YM3A 3RPSA 3G51A 3PP0A 2IN6A 2CGVA 2QONA 2R3OA 2WEVA 5E1EA 1PXJA 3Q5IA 5A6OA 3O7LB 4ZSEA 1KOAA 3ZCLA 4YO4A 2E9PA 2W06A 3BHYA 3WF8A 1I44A 5ETIA 2QU5A 4UN0C 2YERA 2R7BA 4PTEA 2HENA 4APCA 2EWAA 5DYJA 3PVGA 3IS5A 3UJGA 3WF5A 5KMMA 1BUHA 3EQBA 3V5WA 1Y6BA 3UYTA 1GZNA 1DAYA 1W0XC 4KAOA 3BIZA 3QLGA 5EHOA 3UC3A 1K2PA 2XNNA 3QTRA 5JMSA 4A9YA 5ACBC 4Q5EA 3TN8A 2P0CA 2YAKA 2B9JA 4O4DA 4HYIA 3W32A 3ZXTA 2NO3A 4X7QA 5DT0A 3U9CA 3I1AA 1UVRA 4FIJA 4EWQA 1KV2A 4IB1A 4BFMA 3G33A 3VS7A 3HRBA 4L7FA 5E8SA 3FKOA 4WRSA 3QRJA 4G5PA 4RWJA 4ZJJA 4O7WA 1YI6A 3E87A 2QODA 3GC9A 4Q9SA 3ANQA 1ST4A 4JQ8A 2QKWB 3ORKA 4H1MA 4TZRA 5AP3A 5FWKK 1OL2A 4O82A 3BGPA 1H1SA 2GNJA 4WUNA 1WBVA 3PPJA 3BU3A 4E73A 1XH9A 2B0QA 2IVSA 5JGDA 3VS0A 4JIKA 5DT4A 4FA2A 3VJOA 1JPAA 4BCOA 3ZO2A 4QMSA 4KRCA 2B9FA 4ZS4A 1OIUA 5HVYA 4WOVA 5HQ0A 5AP4A 3KEXA 2FVDA 3KF4A 5FEDA 5AFVA 5BYZA 2GDOA 2PK9A 4GYGA 4N57A 1CSNA 4GH2A 4EOSA 3IK3A 4L7SA 1XMLA 2R9SA 2W05A 3ROYA 4ALWA 2VV9A 4BDEA 4YTIA 4NM3A 2Y4PA 4V05A 5FEQA 2AEGA 4CCUA 1OUKA 1W8CA 3KRWA 2ZB0A 5JK3A 1O9UA 2JDSA 5CSPA 3R30A 5JZJA 4FTQA 4G6LA 1PYXA 2PSQA 1UA2A 2R3QA 1YOJA 2F49A 2OJJA 3C1XA 4TYGA 3REPA 3DKOA 2QC6A 3BPRA 3PLAE 2C69A 3LMHA 4AXEA 4TYHA 4AOJA 3KFAA 4GVJA 3AG9A 4CZUA 4XLVA 1W7HA 2VGPA 3ODYX 3QD3A 2UW4A 2UZBA 4IB3A 4WIHA 3EFWA 3ZC6A 4ACHA 4ASXA 1PF8A 4GFMA 3UPXA 1UV5A 4FTCA 4YJQA 4CKIA 4QP3A 5CEQA 3QRTA 5C8MA 2BTSA 4RC2A 4Z16A 4A07A 1AD5A 5FDPA 3OTVA 5IQFA 4JX3A 3TKHA 5A4TA 4K33A 3G5DA 2DWBA 5L8JA 1JKKA 4E26A 1CM8A 2JKKA 2CNVA 3RPVA 2XNMA 5HO6A 4DA5A 3DNDA 1WMKA 4IZ5A 2I0EA 5E8UA 2ITTA 4DBNA 4O4EA 3VUGA 2UV2A 3NCZA 4QYFA 2QLQA 3QZIA 3D2IA 5AADA 4PPAA 2RL5A 1GNGA 5AR5A 3WF6A 5ANJA 3OW4A 4BDAA 2OK1A 4D2TA 4YBKA 4EK8A 3LCDA 2OXYA 4I23A 3PLSA 4LV8A 3WILA 3F2AA 1Y8YA 4EH5A 4Y73A 4KRDA 3TV7A 3R02A 4F70A 3KMMA 3RJCA 3ZBXA 4FODA 3R7IA 2NP8A 2YHVA 1RDQE 4NL0A 2BRGA 4L00A 4E4MA 4EUTA 4ZOGA 4CTBA 4DINA 4UMRA 4G3DA 3BQRA 4CMUA 1QPEA 5AR2A 4BL1A 4YTHA 4U42A 3R8MA 4FICA 5J5SA 1Q8ZA 3OMVA 4ZP5A 2RGPA 4MWHA 4IWPA 5KZ0A 1QCFA 4HVDA 3GC0A 4WG5A 1G8JA 5J5TA 1KE9A 3ZFYA 1ZMUA 1OMWA 3DJ7A 4O1OA 3GU6A 4FTIA 4PTGA 4U80A 2I1MA 2J0JA 2YJSA 1FINA 1Q4LA 3GEQA 5CSVA 3OWKA 4FKGA 4EQMA 3NSZA 2LGCA 5DN3A 5IH4A 4YSJA 1QPJA 4MYGA 4V0GA 4D1ZA 5KBRA 2GNFA 2R64A 1KE5A 3MY1A 3VS2A 2W0JA 5KNJA 2EXMA 5DFPA 1R39A 3SG8A 5DRBA 2B9HA 4LRKA 1BI8A 1PXMA 4MBLA 4FKJA 4CVAA 5KMLA 3R1SA 4DG0E 4DCAA 3BV2A 4J98A 4YNOA 2WU7A 4L53A 3EQIA 3BZ3A 4DTBA 1UU8A 5HG9A 4YR8A 4YZCA 2X0GA 4NFMA 4EOOA 4NYEA 3KRJA 5CSWA 5KZIA 5IEYA 3OUNB 2JDTA 3E8CA 3LJ2A 5FRIA 3AGMA 3QALE 2W1FA 2GCDA 4M69A 4EQUA 4M8TA 4EYMA 4BN1A 2BIKB 5AAFA 1OVEA 4AF3A 4EL9A 4ID7A 3ZSGA 3AD4A 3R9OA 4CMTA 5EM7A 3UDTA 4QMXA 1R1WA 5A6NA 3W2PA 3UE4A 1OUYA 2C4GA 3UNZA 2PY3A 4U97A 4Y8DA 3C4FA 1FVTA 3EFJA 2WMXA 3D5WA 2C5OA 3MA3A 3MVMA 4FKLA 4G5JA 4XLIA 3U6HA 3FQHA 5E1SA 2PMLX 5IUIA 2GHLA 1MP8A 3K5VA 2C5VA 5DNRA 4EOLA 5IA2A 1FBNA 4DT8A 4F0IA 3EIDA 4L3LA 3Q4CA 5DI1A 2V7AA 1LPUA 3PFQA 4W8EA 2E9UA 4BWKA 4UXLA 3R1NA 4JL9A 3N9XA 4I92A 2WTCA 4YZBA 4AUAA 3PTGA 5IH5A 3MGYA 2BPMA 1P4FA 3A61A 5HESA 4FTMA 4APPA 2R3IA 1OKZA 2HY0A 5G6VA 4E4XA 1G8AA 3VO3A 1H01A 4KBAA 3BBWA 5DVRA 4C57A 4CZYB 5HU9A 3VJNA 3WE4A 3OUKA 4KS7A 3CY3A 4YTCA 1Q61A 3K3JA 4DEDA 3LMIA 2UW9A 5L6WL 2YCFA 3D7TA 3WBLA 4IX6A 1ATPE 5CTPA 4DH3A 1VEBA 1W2FA 1JKSA 2CLQA 3EMGA 2R3KA 4F1TA 4O27B 4O6LA 2H6DA 4RQKA 4D9UA 5L3AA 5E8ZA 2X81A 3ZLWA 2PE2A 3TKIA 1OIYA 3NUUA 4UB7A 2HOGA 1YWNA 3NUSA 3GU8A 3H10A 4YBJA 5FGKA 4J7BA 3DPKA 3D5XA 3HP5A 4R6VA 2OGVA 3ORIA 2Y7JA 4O4FA 4N4SA 3NUNA 3OWPA 4LG4A 4DFBA 3PXFA 2QOOA 3NUAA 1PY5A 2RFDA 3A2CA 3ODZX 4RJ8A 2BKKA 3V5LA 1G3NA 4CFFA 4ZY6A 2CHLA 3G6HA 3FMJA 3H30A 1X8BA 3ZHPC 4C4JA 5JFXA 1CMKE 4IAZA 4L67A 3HA6A 3II5A 4M15A 3FY2A 4B0GA 1OPJA 2FB8A 2J51A 3HMNA 4I21A 2ITOA 4IWQA 3UIXA 2PUUA 5HD4A 4NTTA 3UDSA 3FSFA 1KSWA 3FC1X 2QOHA 4RVTA 4LI5A 3RINA 4BHZA 4KD1A 4D1SA 5IA0A 5C4KA 3MJ2A 1URCA 4QT1A 3TZ9A 1CKPA 4UYNA 2J4ZA 1OL6A 3UDBA 5D12A 3UIBA 4FJVA 4CLJA 4M13A 3BHTA 3ID6C 1P14A 2I0VA 2Y9QA 3CS9A 4R8QA 5A14A 5AMNA 4DG2E 3ZRMA 3ORNA 4I22A 4ITJA 3OHTA 3LFDA 3QTXA 5IQAA 4CFWA 4RRVA 3GCPA 3IW4A 3V6RA 2VTTA 3ZMMA 4O84A 4WBBB 3WE8A 2YCSA 4KSQA 4IW0A 2X0OA 1UNHA 3ULIA 3PPKA 2XARA 3R28A 2BRBA 2GQGA 2OSCA 3O0GA 4WT6A 5EYDA 4ZZNA 4USFA 4PX6A 2GTMA 2QR8A 3Q4ZA 4FNZA 4BDCA 1IRKA 1NY3A 2GPHA 4JVGA 4NJ3A 3SLSA 3TWJA 1XKKA 2JDOA 3FYJX 3KB7A 1GIJA 3OCSA 4FOCA 4FZDB 4RX7A 4XG4A 4ZTQA 4IEBA 3O5AA 4DEIA 1PXNA 4IANA 3AKLA 5ETCA 2YM8A 4O7RA 3OXIA 5CQUA 2KULA 3DA6A 2QR7A 4FV8A 1NT2A 4O81A 5BVKA 1MQBA 3TI1A 3EFKA 3RALA 4GW8A 2WTWA 4LQMA 4FTOA 1HOWA 1GZKA 1E1VA 2ERKA 3I4BA 5CNOA 4O7LA 3OD6X 4CFVA 4AT4A 4EK6A 2BTRA 2VTQA 3W0MA 2VTRA 4DFUA 5CEOA 4FSQA 2XM8A 2WMSA 3N4TA 3BQCA 5JGBA 5I9ZA 2PVJA 4JG7A 3G6GA 3GENA 1B6CB 3RWPA 4IHPA 5DMZA 4JDIA 2UZUE 4EC9A 2DUVA 3RZFA 3HX4A 5CWZA 5E8YA 3EB0A 4MD9E 4IZ7A 2QKRA 3ZZEA 5A3XA 3IQ7A 4X6RA 3CR0A 4FKSA 4GUEA 4QYEA 3FEGA 2WPAA 3TZ7A 4PV0A 3OROA 4PRJA 1ZARA 3MBLA 5CEKA 3U55A 4AN9A 1QL6A 2FSOX 3FLQA 3LLAA 3C0IA 4BKZA 4EJ7A 3CD3A 1WFCA 1MQ4A 2PULA 5FBOA 2UW5A 5LCJA 3PY3A 3TKUA 4JQ7A 5D41A 5EM8A 3E64A 1Y91A 2X4ZA 5I9UA 4QD6A 3C0GA 5AA9A 1M2RA 5LVLA 4UEUA 4D4YA 4EI4A 5A4LA 2WQMA 4MXXA 3QTSA 4DEGA 5IDPA 3SVVA 2BILB 1WVXA 4ZSAA 4JDHA 2W96B 3F2RA 4W9XA 5ANDA 2ZFYA 5EQEA 2WNTA 3FKNA 2QOKA 2Q83A 4O7NA 4EHZA 3A7HA 3A60A 3BHHA 3FI4A 2ITPA 2ITZA 3OT8A 3FQEA 3R73A 2C68A 2JDRA 2VWBA 2XNGA 5E90A 4FT5A 3RPOA 4RJ5A 4CZTA 3TCPA 3FPQA 2R3FA 4KIKB 3GB2A 4KINA 4RJ6A 4MUQA 4FVQA 5CI7A 4QRCA 4BVUA 3MS9A 4C4EA 5IDNA 3QRUA 5BVOA 4ZTNA 2XAOA 2Z7QA 3AC1A 1W2CA 3OF0A 4IACA 4B6LA 4HW7A 3Q4UA 2IPXA 1Q3WA 5AM7A 3NW6A 3FMMA 2WMAA 4YO6A 4BI2A 4JMQA 5GJGA 2C6TA 3IOKA 4GFGA 3MFUA 5I3RA 4RIWA 3IKAA 4GU6A 1BYGA 3P7CA 2VU3A 3NVMB 3K3IA 2ZV2A 4U3ZA 3PA3A 3EN4A 4G2FA 4O96A 3CBLA 2A1AB 2WIPA 4IVAA 4BYJA 3TMOA 3VWAA 4GK2A 4XP2A 3KVWA 4QTAA 1KV1A 4TYHB 4HGLA 3PSCA 1RE8A 3OVVA 3ORPA 4V04A 1A9UA 4GRBA 3R9DA 3R8ZA 4QMTA 4YLLA 1DAWA 5BVFA 4UMQA 3OCTA 2YFXA 2OW3A 3R2YA 4AT3A 4BBEA 4S30A 2CKPA 4EHEA 4IM2A 2XK8A 5CAOA 4C38A 2QCSA 3C5UA 2JD5A 3TG1A 2V22A 3QGWA 3ORTA 5CAVA 1JSVA 2VZ6A 3QAME 1GOLA 4DTKA 3EN6A 5J9YA 3CQUA 4NH1A 4TWNA 2I0YA 4MKCA 2OJFE 2YDKA 3C7QA 3IOPA 4R7IA 5EQPA 3W0OA 4WKQA 4WBOA 1H28A 4O21A 4WSYA 2WTJA 3NX8A 5DH3A 5AR3A 3VBQA 3NVKI 1IAHA 3P7BA 4ZTRA 3QRKA 3I7CA 5HE0A 2XA4A 2J0KA 3V5PA 3VIDA 5T6KA 4Q9ZA 3A8XA 1RJBA 3LCKA 1ZOHA 3GVUA 5BPYA 1TZDA 2HWOA 4AZSA 3HV5A 4DITA 1O6YA 5BYYA 3AKJA 2PPQA 4F7LA 2X1NA 5HU3A 4I24A 3I81A 3PA5A 2IZRA 2UW7A 5EI8A 3VRZA 3A62A 2GNIA 1OL1A 4L01A 4YC8A 3U6IA 3C0HA 4EEVA 2X6EA 3EQGA 3PA4A 5CEPA 4ENYA 4DLIA 5M4FA 1Z57A 3DB8A 4R5SA 4EWHA 3CGFA 5CZIA 4EH4A 3Q53A 2WMBA 4ZAUA 3DAJA 2BDWA 2C3IB 2HXQA 3EN7A 3HV6A 3KMWA 1IEPA 4I5CA 4LV7A 2OJ9A 3G2FA 2QU6A 4LDTA 4OTGA 4QPSA 3QQHA 2X8DA 5CVFA 4KIPA 2X8EA 3VUHA 4CV8A 3PWDA 4G6NA 4N6YA 5AA8A 4IM0A 2YWVA 2UZDA 2UZEA 4IAFA 1V0PA 4M3QA 4PDYA 4NJDA 5AAGA 3HMOA 4O91A 4YTFA 3LFCA 4G31A 4X6QC 5JFSA 2RFNA 5CEIA 4JS8A 4DCEA 5HX6A 3HEGA 3LLTA 4IFGA 4IX3A 5IA5A 5CAPA 4V0GB 4GK3A 1FGIA 5CF6A 4U3YA 2X2LA 1OGYA 2PZIA 3IECA 3QQJA 3R21A 3U54A 4WNPA 1VR2A 3KN6A 4MD8E 3L9NA 4FTKA 4M12A 2JITA 3LFNA 5CASA 1BI7A 2HZIA 2C6MA 4BZOA 5AR4A 5EW3A 2PVNA 2YDIA 3FL4A 3R00A 4E7WA 4CFXA 1SVHA 4I6HA 2R3JA 4QMMA 3FKLA 3ACJA 3FV8A 3PZEA 5GZAA 5AX3A 3FXWA 1OIRA 3QHRA 1XBCA 5F94A 2WTKB 1J7IA 4M69B 4DFLA 4AQCA 2UZTA 1F0QA 3W0SA 5L4QA 2WOUA 3UMXA 4IWDA 4FV4A 2VTOA 2VN9A 2P2HA 4P5ZA 3FYKX 5C26A 4IZAA 4AOTA 4AXFA 2Y0AA 5HEZA 3THBA 1M14A 1SNXA 2GMXA 2JGZA 4H1JA 3UOKA 4WNMA 2PUIA 2DQ7X 3S4QA 3NW7A 4AQKA 2A4LA 4O38A 3HMMA 3CJFA 3WYYA 3IDBA 2FA2A 5H9BA 3WI6A 4KABA 3ZO3A 4FGBA 3NFGB 2ITQA 3BEGA 5HORA 4LOPA 3HGKA 1ZYCA 3KXXA 5M09A 4D4SA 3ZOSA 2ZOQA 2XAMA 1HCKA 2E9OA 3ZONA 2BZIB 2HYYA 5CS6A 4O0UA 3HA8A 2XCKA 5J1WA 1BLXA 5AUWA 5D11A 2QOFA 3GP0A 4FSRA 4OTPA 3W0NA 1OPKA 2BROA 2JAVA 4U43A 2UW8A 3G0EA 4UY9A 3MFTA 4FX3A 2XIKA 2RG5A 3NW5A 3BU5A 1R3CA 3CKWA 1LR4A 5KMNA 4DFYA 1TQMA 1KOBA 4IAAA 3OY1A 4FV2A 3LFSA 3AC5A 3ZO4A 4AN2A 2OKRA 3BEAA 4XRJA 3OP5A 4AXDA 3VC4A 2X7GA 5K0XA 5HTCA 3BRBA 3D7TB 3KVXA 4JJRA 1GY3A 4C3RA 3L8SA 4QP1A 4AXAA 4BCMA 4NCTA 3R7UA 3NCGA 3ZS5A 5HICA 4MNEB 3MSSA 3Q2JA 4IDVA 3PWYA 3ZC5A 5AP7A 5J7HA 4C7TA 4O83A 2XIXA 3RZBA 5LXMA 2J5EA 2GQSA 5DE2A 5M4UA 2XYNA 4E20A 5CEMA 3NNVA 5JGAA 5HLNA 4IADA 2CGXA 2ZDTA 3VBYA 4C62A 5L8KA 5E9EA 2O64A 3G9LX 3P5JC 5AX9A 3R7OA 3LXNA 4QMWA 4XMOA 4NZWB 2PVMA 3BHUA 4S2ZA 3ORLA 1PW2A 4U0IA 4KUJA 3ZBFA 3BHVA 2JLDA 5EKOA 2ITVA 5GIPE 3P0MA 3GC8A 3OC1A 4TPTA 3FMKA 5H3QA 3AT2A 4KIOA 3TNIA 2J50A 2WMUA 1OKVA 4Z9LA 2ITWA 3KRRA 4I0RA 1OB3A 1XJDA 3V5QA 3OWLA 1H24A 3RP9A 3TUCA 3UO5A 3QD0A 5BX0A 2BHEA 3MFSA 4I6BA 1XBAA 3AC2A 5H2UA 1OIQA 4K0YA 3CD8A 4USDA 4WA9A 5M06A 3QWJA 4AT5A 3MH2A 1URWA 1LP4A 3R7EA 4QMYA 4MXZA 3F7ZA 1ZYJA 1TQIA 1E1XA 4QNAA 4ZY4A 2OIDA 4AA0A 4DDGA 5TKDA 4QYYA 4B9DA 1S9IA 4RZWA 3TV6A 4G17A 5LMAA 1UWHA 3ZDIA 4AGWA 2G2HA 4KKHA 5FD2A 2XJ0A 3TT0A 3AGLA 3WZUA 4C4GA 3UZTA 3PYYA 1YHSA 5AIRA 3ERKA 4CTCA 4C35A 3KCFA 5M4CA 1T45A 1YXSA 3MVJA 4EHVA 1OITA 3F61A 4MQ2A 3P4KA 2WMQA 3KREA 5A4EA 4O0SA 2WGJA 3KK9A 4YZDA 4NU1A 5E8TA 3PE1A 3UMWA 4XNEA 4E5BA 2IZTA 4MF0A 3TXOA 4ZTLA 3FSKA 5DHJA 4WUAA 4O7TA 3CY2A 3EQHA 4BI0A 4QMZA 5B2KA 1ZMVA 4CRLA 4OTRA 5EDQA 1PYEA 4BDGA 2OICA 5BYLA 1JBPE 4UZDA 1YW2A 4X3FA 4BB4A 2QHMA 2YZAA 4FV9A 5F20A 5DG5A 3AT4A 2QOQA 1V0BA 2IWIA 3CPBA 2CMWA 2QI8A 5CF4A 4CYJA 3CEKA 4EH9A 3U4UA 5IQEA 5I4NA 4I4EA 3VW6A 3QC9A 2QO2A 3BV3A 3BYUA 4G3EA 4TWCA 4MX9A 4EZ3A 5HZNA 3PRIA 4FT3A 4KBCA 1UKHA 4H3PA 3Q5ZA 1H08A 4NK9A 3SXFA 5CU3A 2J0IA 4OUCA 5KHWA 2XRUA 4I5PA 4FSWA 5J87A 3Q9ZA 3IGOA 4HNFA 2B55A 4YZNA 2R3RA 3EOCA 4C8BA 2V55A 4UALA 2B53A 2E9NA 4FE2A 3FZRA 5AP5A 4FV7A 5F1ZA 5HO8A 4ANSA 5HGIA 3MY5A 3HV4A 4YURA 1H26A 4HVIA 2OIBA 2C6OA 5CVHA 5IISA 2HIWA 3W1FA 5LMKA 4XV2A 5DIAA 4HZRA 3IO7A 4OAUC 4ITHA 5C4LA 3FZSA 4YJNA 3A8WA 2NRYA 2QO9A 5AAEA 3O17A 5LVOA 2WMWA 2XH5A 3D2KA 5CSXA 3UZPA 2VWIA 4O2ZA 3CTHA 4G16A 3WZEA 3VUDA 3DFAA 4A4OA 5EW9A 4A4XA 4A9UA 4BTMA 2JIUA 2PVHA 4OTDA 1JSUA 1YHWA 2IEWA 2VTLA 3DJ6A 3FZOA 4YC6A 2VNWA 1QPDA 4ZJIA 2VX1A 2ZMCA 4FNWA 4RG0A 5HCXA 3L1SA 1EH4A 1UNLA 4IH8A 3E8NA 4V01A 1Z5MA 3LOKA 4I41A 5ETFA 4B99A 2FSTX 2OU7A 4LMNA 5EG3A 3WIKA 3PVUA 4QTDA 3QFVA 3AMYA 3GFWA 3H0YA 3ZRKA 3D15A 2G9XA 4XP3A 2C5NA 2XZSA 4Y5HA 4F0GA 3OCGA 4IAKA 3QX4A 1SM2A 4FSTA 4I5HA 2WQBA 4AW1A 3Q32A 2IZSA 3E3BX 3KULB 4YJRA 4USEA 4EBWA 2BDJA 1GIHA 3D4QA 5ANKA 4HOKA 3E88A 2GNLA 4S34A 4B4LA 2H96A 4CT1A 2BR1A 3COKA 3QTIA 4L9IA 4RIWB 1Q99A 4JDKA 4JX7A 4QQTA 5JFWA 5GINE 3FPMA 2Y4IB 4EUUA 1DI8A 4ARKA 4WG3A 3EQPA 1GIIA 1REKA 3S3IA 5CQWA 2J7TA 2W1IA 3QLFA 2QD9A 1J1CA 3DQXA 4RVMA 5BMSA 1BL7A 4P4CA 3EN5A 4IWOA 3RNIA 1IG1A 4XUFA 3ALNA 3R04A 2Q0BA 4E5WA 3TACA 5CVGA 2UW3A 5IUHA 3ROCA 4L46A 1H07A 4FEXA 1HCLA 3HV7A 3C51A 3PIXA 2C6IA 4I93A 4A9SA 1J7UA 2F9GA 3P5KA 4FZ6A 2F7XE 2XJ2A 4GFOA 4XS2A 3R0TA 2FSLX 3OXZA 3BI6A 3TIYA 2OFVA 1H25A 4KNBA 4JOAA 5TO8A 3F3VA 4IM3A 2CDZA 4NIFB 4CSVA 4E6DA 4EH7A 4FV5A 2PUNA 3HDNA 1W2DA 4CGAA 4XBUA 2YA9A 2OBJA 5HIBA 4ANBA 1OKYA 1WBPA 4QOXA 3FL5A 4RX8A 4XX9A 3MWUA 1XO2B 4KS8A 3W2CA 1KUTA 5C01A 3ORMA 2UZWE 3SAYA 3QUEA 3NYXA 2ZVAA 4HVSA 5EK7A 4LUEA 1R0EA 2ETKA 3L8XA 4AA4A 5HCYA 4WSQA 2IVVA 2XK6A 4UWCA 5G1XA 4JLCA 2GS2A 2XYUA 4C0TA 2VTPA 3AC3A 3KRXA 1JSTA 4GMYA 5ANGA 3VUKA 3CSVA 3JXWA 4K8AA 4JBQA 1PXOA 3GUBA 1G8KA 3HV3A 1YDTE 5E8VA 3GU7A 2QNJA 4YU2A 2PVFA 5EDPA 4QMOA 4RA5A 3LM5A 3CTQA 3DY7A 1H8FA 3W0QA 1ZWSA 2W5BA 4RIXA 2YCQA 2CNUA 3BYVA 3QTUA 5J7BA 1JQHA 3VS5A 4MXCA 4MD7E 4FR4A 3I6UA 1S9JA 4BTKA 1TFFA 4BCQA 3BL7A 4FI1A 5B7VA 2CLXA 3ZUVA 5BNJA 3S0OA 2YIWA 3O8UA