2JDRA

Structure of pkb-beta (akt2) complexed with the inhibitor a-443654
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
Knots found
sequence length
337
structure length
316
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITQEMFEDFDYIADW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-BETA SERINE/THREONINE-PROTEIN KINASE
publication title A Structural Comparison of Inhibitor Binding to Pkb, Pka and Pka-Pkb Chimera
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 316
sequence length 337
other databases KnotProt 2.0: Artifct K 41 41
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jdrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jdrA01
4HNIA 2BRGA 5K3YA 3DTCA 4O6EA 4I92A 5FXRA 3MBLA 1JNKA 3OY1A 3MTLA 4KKEA 3VUKA 2DWBA 3ELJA 3W2SA 2C3JA 4WRGA 3LFSA 1OKYA 2KTYA 2UZOA 2QVSE 3A2CA 4WBOA 4ZTSA 3ZLWA 2CKQA 2XYUA 1RE8A 5F95A 4J8MA 4EOIA 1KV2A 4LFIA 3NX8A 2HZ0A 3FLYA 4V0GA 3T3UA 4O7YA 4WNMA 2ERKA 1VJYA 1UKHA 4FC0A 3UE4A 2YJSA 1YWVA 4KWPA 3KRRA 2RKUA 3DGKA 3A8WA 4FIHA 3QXPA 2BHHA 3VS4A 3TIYA 3UPXA 1BKXA 2IO6A 1VEBA 4BCKA 4BVUA 4TPTA 3FL5A 1TQPA 3OCTA 2XIYA 4EHEA 2CKEA 3ACKA 4GK2A 4AW5A 2OGVA 5A4LA 4QMLA 2P0CA 4HVGA 3TKUA 3ZUTA 4RJ6A 2RF9A 1Z57A 5E7RA 3PJ8A 2RFEA 3OBGA 4F4PA 1OGUA 4E7WA 3BKBA 2CSNA 2R2PA 1CTPE 2XF0A 4BCJA 4YTHA 4D2SA 1HCLA 2UW4A 2YZAA 4QYHA 3VS2A 3IDPA 2VAGA 3V01A 4F08A 3DT1A 3OROA 2B52A 5CU0A 2BRNA 2PVNA 2IPXA 4YC6A 2YA9A 3KY2A 3BYMA 3OCGA 3BIZA 4QNYA 2YM8A 3LXKA 3QRTA 4YNEA 4DGOA 4DEEA 1CM8A 5BUIA 4BICA 3R9RA 4FIGA 4RA5A 4MTAA 3DY7A 3LZBA 1VZOA 5L6PA 2JFLA 3NYNA 1OL7A 4RWKA 4S33A 2Y4IB 4X3FB 3FXXA 4GK3A 3R7UA 3UIXA 4NCTA 4XV1A 1QPJA 4NH1A 1XH5A 3KQ7A 1V1KA 3P7BA 2W1IA 3A60A 4E4NA 4JJRA 2GNFA 3DNDA 3ALNA 4RJ4A 1IR3A 4EOPA 3U6JA 2IG7A 5E1EA 5HCZA 4KSQA 4PDYA 2F57A 5E8VA 3TN8A 3Q04A 3VHEA 5HNGA 3TL8A 4IM3A 3TWJA 1GIHA 5F1ZA 3Q9XA 4FK6A 2W4KA 5FM2A 3WZUA 1Q5KA 3FSKA 3K3JA 5FTOA 3RK9A 3MV5A 4MXZA 4BGQA 3HV5A 3IO7A 2HZ4A 4RJ5A 4CRSA 1YDTE 2OJJA 1OPJA 3OHTA 4D2VA 1XO2B 2BILB 4MKCA 1CSNA 3FWQA 3QHWA 4PMMA 5CVHA 2ITZA 4ZSGA 4HVSA 2B9IA 3KC3A 5I3RA 3FZPA 3QLFA 4BBEA 1J7LA 4FEVA 4O7RA 3DFCB 4ZJVA 2WXVA 3VW8A 3AD6A 3FXZA 3RCDA 3R28A 3A7IA 4S31A 1OPKA 3QALE 2PHKA 3TUBA 1G8AA 5KMIA 1LEZA 1YWRA 1XBAA 3QQKA 2HWPA 3R30A 5I9WA 1XJDA 3MGYA 4IX4A 2GHLA 5J8IA 4JDIA 5IF1A 2GS6A 4XCUA 2ITXA 3I60A 3BRBA 3LFAA 3CE3A 3DXNA 4GFGA 3TEIA 3QCXA 3ZLSA 4DFNA 2F2UA 3TM0A 5ANIA 3FMKA 4Y83A 4AW1A 1DAWA 2NP8A 4PWNA 4B0GA 4C2WA 4DG0E 3UOJA 1WVWA 3RTPA 4UBAA 3Q2JA 4LOQA 3QL8A 1XH6A 3C0HA 4J71A 4FL3A 3ROYA 3G6HA 4ZOGA 4XG9A 3W2RA 2FUMA 2X0GA 3RAKA 4DTBA 3BPRA 4RX9A 4BKYA 4FV0A 4GKHA 5J1WA 2UZLA 4FKWA 5LCJA 2XB7A 1SNUA 3TV7A 3PSDA 4G3DA 2W7XA 4IVBA 3GP0A 5AV3A 1QL6A 1JQHA 1VR2A 4LUDA 1XBBA 4GIIA 2HOGA 3BE2A 3NCGA 3CGFA 2WTJA 5KMNA 2QHMA 4S2ZA 1CDKA 4Z7GA 1OBGA 3QKLA 3MFTA 3KRJA 5JMSA 2R0UA 2IVUA 1AQ1A 2VUWA 4X21A 4BYJA 1JSVA 5IEYA 1PJKA 4DT9A 3F5XA 3AQVA 5AADA 5CALA 4C8BA 5EI8A 1Q24A 2J90A 5HIDA 3TT0A 3TNWA 1ZZ2A 3LM5A 4RPVA 4GFOA 4WG5A 3CPCA 4GUEA 3D83A 5AV1A 3COKA 5HQ0A 4CSVA 1URCA 4FV6A 3ITZA 2OJFE 2W5AA 3LCOA 4YHJA 5LJJA 4UWBA 2BUJA 2OZAA 5ETCA 2X7FA 3PJ1A 1H8FA 4MNEB 1XQZA 1E1XA 4A9TA 2ZM1A 4I0SA 2A19B 2Z02A 2VTIA 5CAUA 2QC6A 3GVUA 3DDQA 2XCKA 1W83A 2IN6A 3E8CA 3PRIA 4JBOA 4YUQA 2H96A 3BGZA 4ZZOA 4EK6A 5M08A 4WHZA 3LFFA 5EOLA 3OVVA 3K2LA 4FG9A 2R7IA 4RG0A 4NJDA 3SXRA 3FPMA 1FVVA 3HEGA 3F3WA 5A6OA 4MWHA 4GYIA 1YXTA 4FSTA 2VU3A 2VO3A 4YHTA 3N9XA 5I9UA 2X2MA 3R1NA 4G6LA 4QYEA 4FA2A 5AFVA 4RZVA 4XG2A 4IVDA 4ACMA 3KXNA 2ETRA 1PKDA 3UYTA 2X8IA 2UZVA 4E20A 3FBVA 2F7XE 5F9EA 3E8DA 2B9FA 3R1QA 5H3QA 3SG9A 1NA7A 5C26A 5IDPA 2BKKA 4U79A 3G5DA 5E8WA 5HKMA 1Y8YA 2IW8A 4ANNA 4BI1A 4D1XA 4EJ7A 3PPZA 4PRJA 4C61A 3Q6UA 3HMIA 5A6NA 5FRIA 4ZTHA 4NSTA 3Q5ZA 5K4IA 2XK4A 4HYSA 5E8ZA 3QTWA 4GYGA 1P2AA 4TNDA 4CCUA 5FGKA 3T8OA 3CS9A 4E6CA 4C4GA 1Y57A 1PXMA 5HNIX 4D2RA 2V22A 2WQOA 3ORNA 3LCKA 2PVMA 4QMMA 2R3JA 2ZDUA 3NUSA 4G9CA 1T45A 2ITTA 4MF0A 5E90A 4YZCA 3H9FA 2ZV8A 4TWPA 3RPVA 2PVFA 4H05A 2R5TA 4QPAA 3CIKA 4BN1A 2QURA 3FC1X 3PIYA 1M17A 4CTBA 2WNTA 4HVIA 3RGFA 4BRXA 2F9GA 5DG5A 2HY0A 4E6DA 3EN9A 4QQ5A 4USEA 4N6ZA 3OG7A 3VO3A 4EOSA 3G15A 3WARA 4WRSA 3T9IA 5DR6A 3UIUA 5AUTA 1FVTA 3D15A 3F2AA 4CZYB 3AC4A 5KHXA 4RQVA 2ETMA 4IIRA 3C1XA 3F5UA 3OTUA 5I0BA 4EK8A 1CKIA 1RW8A 2I6LA 4K2RA 5BVKA 4RJ3A 4Z55A 1B38A 1KWPA 4FKVA 2BTRA 3BYVA 2PVJA 4FKSA 4YNOA 4IFGA 2X7GA 3NZ0A 3R1YA 3FQHA 3KXXA 1T46A 5F20A 3RVGA 5C4LA 3QD2B 4A06A 4BBMA 3D7TA 2BAKA 3WIKA 1H01A 5CEKA 3PXFA 3SRVA 5HD4A 1Y6BA 1TVOA 2VD5A 1IASA 3H9OA 3ORPA 3E3PA 4JOAA 4P7EA 4BWKA 5AWMA 5A4TA 5CQWA 2XNOA 3K54A 3QU0A 2PVRA 2C3IB 5TKDA 2SRCA 2ZB0A 5GJGA 4EYMA 5KMLA 4GFMA 4ZTMA 4G2FA 2BDWA 3FZSA 3SW4A 4EHVA 2VZ6A 4QMQA 2C6KA 4EWHA 4ZMFA 5TOZA 4C3RA 5L6WL 4TWCA 4R3RA 2BZJA 4HZSA 3UGCA 3R7IA 1KE8A 4AN9A 3R9DA 1M7NA 4CGAA 4FL2A 5IA2A 4E8AA 2GQGA 4IX5A 4R6VA 3VS7A 5TF9A 4FTUA 1L3RE 1OI9A 3RAHA 4EOQA 5EM8A 5G1XA 3HAMA 4II5A 3DJ6A 3ATSA 2WTDA 1JLUE 3OWKA 5CYIA 4E4XA 2C6EA 4DFLA 3EQHA 3KU2A 4Q9SA 4R3PA 4FNWA 1Q8ZA 3B2WA 2OJGA 4OTDA 3LLTA 3TKHA 4O83A 3COMA 3I79A 3ZBXA 4GU9A 1X8BA 3IDBA 2QOIA 4FR4A 3PXZA 1B39A 5HD7A 2Y0AA 3KXHA 3C4FA 3EH9A 5HI2A 3P7AA 3MB7A 1YXSA 2XJ0A 1PY5A 3QZFA 2UVYA 2XKEA 3SLSA 5I9XA 3KRXA 3ORXA 1WBWA 3W18A 2VX0A 3DNEA 4AFEA 1WBPA 2J51A 2NRYA 4D0WA 5J95A 2ACXA 4NYEA 2OW3A 3W32A 4GK4A 4O7VA 3IW4A 4WNOA 3O50A 4KUJA 3DXPA 2YLFA 2B0QA 4FZ6A 5KZIA 3F61A 5JH6A 5IQIA 2JC6A 4BDEA 3HVCA 1GZKA 4DG2E 3H0YA 3L8XA 1PXJA 3ZXTA 3Q6WA 5HOAA 3GENA 4APCA 4IAIA 4IEBA 3ULIA 3U55A 5HICA 3KL8A 3P79A 2QG7A 4WSYA 3QKMA 4EQCA 3OC1A 1YOJA 2QONA 2ZVAA 4HPUE 4MNFA 3VW6A 3FL4A 2R3NA 2WMSA 5AA9A 1SYKA 2WU6A 4NM3A 3RI1A 3BEAA 3OT8A 1A9UA 4QD6A 1KOAA 3MFRA 4RX8A 3VS0A 2VWXA 4RLLA 4E5BA 2IZUA 5JRSA 3K3IA 1B6CB 3WBLA 2OKRA 2YFXA 1XH9A 1SZMA 2CN8A 3H10A 4LMUA 3PVBA 4C37A 3AGLA 3BBTB 3PIXA 3TKIA 2YACA 5KBQA 5HIBA 4FIJA 5TO8A 2CNVA 4CCBA 3UZTA 4G9RA 1REKA 4DLIA 2YAKA 3HRFA 2WQEA 4I5HA 4EBWA 2WTCA 5JSMA 3A7HA 3BE9A 4OTWA 4Q2AA 4XS2A 3LW0A 3LQ5A 4WKQA 5AR5A 1URWA 2OXXA 4JT3A 3L9PA 4JXFA 5HO6A 1G5SA 3R7GA 3UMXA 1V0BA 2HWOA 4RIYA 3D4QA 4CEGA 4GVJA 2XNNA 4BTMA 1XR1A 4RX7A 4ZY4A 3EMGA 1UU9A 3QTUA 2ZOQA 3ZZWA 3KULB 3QUPA 5IMXA 3U6HA 3CCNA 3Q60A 2VTAA 2JBPA 2W5HA 3OXZA 5D12A 2PMLX 5IU2A 2J0MB 4EZ3A 5FD2A 3SD0A 3DB6A 4ITJA 4GT3A 3TNQB 5DRBA 4YPSA 2UVXA 2FB8A 1GZ8A 2PMNX 4F7SA 5K0KA 2PVHA 2J5FA 4CT1A 3LLAA 5IQAA 2PZYA 4FX3A 2UW0A 2ZV9A 2QU5A 4YZBA 3ORTA 2UW6A 1O9UA 2C6DA 5FTQA 3CKWA 3NUYA 4DAWA 3OOMA 2P4IA 3F5PA 4R5SA 4YO6A 1H27A 1QCFA 3FI8A 2PY3A 2IJMA 4RRVA 4XMOA 3ZEWA 1SVHA 5AEPA 2XUUA 3D7ZA 5CNNA 4BHZA 4DFXE 4RFZA 1M2RA 4MBLA 1FGKA 3A4PA 1W7HA 5FUTA 3VUDA 2AC5A 4FNXA 3VIDA 4ERKA 4CLIA 5IG1A 4FTKA 1Y6AA 5CAPA 5JGBA 1JKLA 3HZTA 3GCQA 4FT9A 1UWJA 3P78A 4KBKA 4FYOA 2ZYBA 2HW6A 2GS2A 3LFQA 4IMYA 2LGCA 3ZSHA 2XNBA 1IRKA 3RM7A 5BUEA 3JY0A 4F7NA 4L01A 1BI8A 2YIYA 3Q96A 3ZU7A 3NLBA 3PPKA 4I4EA 3DBEA 5CF8A 1WFCA 3UOHA 4O21A 3WZJA 4BIDA 2VWWA 1OKZA 3I5NA 4X2NA 4L9IA 3EIDA 4CFMA 3RCJA 2JKMA 2OF4A 1IA9A 5JGDA 1YVJA 2VX1A 1WMKA 2G01A 3NUPA 4ACHA 3G9LX 2VX3A 1UVRA 2JIIA 2VTQA 4FSWA 4DN5A 1TQIA 2XIKA 4YLLA 5B7VA 3G33A 3MJ2A 3LMIA 2J6MA 2YDIA 3OOGA 5FEEA 1SVEA 2R3PA 4CZTA 5HO7A 3QRIA 4OT5A 4X7QA 5L8JA 5JKGA 1GNGA 5HE0A 3OT3A 4O1OA 4KS8A 2A27A 3A7JA 4BIBA 4LUEA 4UYNA 2W9FB 2WMWA 1K3AA 4YO4A 4HW7A 3P1AA 2GFSA 1ZY4A 2OFUA 4E4LA 4F9YA 5AP6A 5IEXA 3QA8A 3O8TA 4QTAA 1U54B 2VWVA 1OKWA 5KO1A 4WG4A 4A9RA 4H1MA 3GQLA 3ZM4A 4R5YA 2G2HA 2PZ5A 1PXPA 5A3XA 3FHIA 3ANQA 4G34A 1YHWA 4D4YA 4NL0A 3DKGA 3UQCA 3NIEA 4USDA 4CYJA 3ALOA 2XK7A 3VJOA 3QQLA 2PVKA 4D5KA 5EW3A 3DAJA 3EQCA 3I6UA 4D1SA 4H39A 4HJOA 4NM5A 5JZJA 5TR6A 3FMMA 3ZOSA 4AOIA 5AIKA 4TY1A 4YP8A 3SC1A 4MVFA 3DDPA 3UPZA 4M68A 4JG6A 4JG8A 4QP1A 4KS7A 1R3CA 3O17A 1XH8A 3QGYA 4LOOA 3RWQA 4P5ZA 2B54A 3F88A 3IQ7A 3V5TA 4J53A 2WEIA 4LGGA 1V0PA 2P2HA 3KK8A 3FPQA 3MESA 4R7BA 2R64A 4OT6A 3QCSA 5IQBA 4BCFA 4PMTA 5D9HA 3TNPC 3JR1A 3L8PA 3IONA 3VN9A 4A9YA 4J1RA 3ZONA 5KKRC 4I6FA 5LVLA 2CNUA 4RVLA 4FUYA 5DVRA 2VTMA 2E2BA 3O23A 4QMSA 4R3CA 5M57A 4ZZNA 4WIHA 4JIKA 3HGKA 3RPYA 4YSMA 3VQUA 3UO6A 3SOCA 4ZMEA 4M7IA 2DS1A 2G15A 3TI1A 3PA5A 3E93A 4D28A 4W8EA 4JQ8A 2JDTA 3PA4A 4OR5A 4DTAA 3DK6A 2YM7A 3R2YA 5D10A 4BWXA 1LEWA 3QWJA 4CFNA 5FLFA 3DKOA 5CI7A 4DGGA 4I23A 3IW5A 3PZEA 4BDDA 1WZYA 1CKJA 4BWPA 4MD9E 3U87A 4RMZA 2CLXA 3RJCA 2XK6A 4XRLA 2QKWB 2X7OA 4C35A 2GSFA 5CVFA 4MCVA 4ACCA 2C6LA 3C4ZA 4HGTA 4CKIA 4X3JA 3EL7A 4IDTA 2EB3A 3PG3A 2XM8A 3FI4A 3QC4A 4IC8A 4K1BA 4NKSA 3QHRA 4CKJA 4EH8A 2PUPA 1QPEA 3MVMA 2C5VA 3O51A 5CF6A 3EYGA 3TNHA 3VF9A 3C9WA 2JDVA 4KRDA 4RVKA 5ACBC 3EFWA 4R8QA 5ANEA 3PWDA 4JDJA 3ZFYA 5J9ZA 2XNMA 3MTFA 1LR4A 5FDXA 4F1TA 3RNIA 2WZJA 2QQ7A 2C5NA 4EOMA 3S1HA 1H4LA 4OTPA 3OW4A 3OXIA 2WEVA 2JBOA 4J99A 5AP0A 2GNHA 3RHXA 3SXSA 3RZFA 4O1PA 2DQ7X 4IANA 1Q8TA 3GBZA 4IH8A 3BWFA 2X4ZA 2XKCA 3CD8A 3G51A 3R8UA 2QOKA 3ZUVA 4XX9A 3H4JA 4C62A 3DBQA 5HIEA 2OWBA 3SDJA 5CSVA 4ACDA 2XA4A 4EBVA 4UMRA 4PTCA 2NRUA 4XLIA 3TUDA 4CFXA 1R1WA 2WTIA 2V55A 4G1WA 4XH6A 3V51A 3V5JA 3Q32A 4ASZA 2FA2A 4FBXA 3P5KA 3VHKA 3BYSA 4GH2A 3PA3A 3EQFA 4NEUA 4WUAA 2IW6A 4FTQA 4GKIA 2DUVA 1FINA 4I3ZA 1YHSA 1P14A 4FT3A 5BYZA 3AMBA 4NFNA 3PVGA 3TUCA 4JL9A 4HGEA 4MXAA 5T6KA 5CAQA 4QOXA 5FXSA 4NK9A 2CGVA 3QZGA 1PMEA 3W16A 3GXLA 1PXOA 2QR7A 3A8XA 5CANA 4AW2A 2WO6A 1XH7A 4I94A 5LXMA 5AP3A 4NKAA 4ALVA 5HZNA 3KXGA 4Y85A 4CYIA 2UW7A 3KREA 2XEYA 3VUIA 1H00A 3GU6A 2RFNA 3LCSA 4LRJA 4QYGA 3MY5A 4RZWA 2FSTX 4C2VA 2YCRA 4EOJA 2EWAA 4AS0A 1GY3A 2WTKB 2HW7A 2I40A 4IB3A 2C5OA 1W0XC 3MJ1A 4M3QA 5L2QA 4C59A 3U4WA 2B4SB 3KMWA 2BROA 4BYIA 3OUKA 4RIWA 4YURA 4PV0A 5CXZA 4J97A 2PZPA 2RG6A 2B1PA 2XJ2A 4IJ9A 4LRKA 4BDIA 3CQUA 2OF2A 2EUFB 4N4SA 1Q8UA 2YIXA 3BGQA 3HL7A 3R22A 5IA3A 3KMMA 3PIZA 2O8YA 2ZAZA 3DKCA 5C8NA 5AP5A 5DR2A 3PDTA 2CGWA 4TYIA 3FLWA 4BDBA 2XM9A 5DA3A 5CWZA 3KFAA 4YJOA 2WMVA 4C57A 3VWAA 3GU5A 4JBQA 2YIRA 4YZ9A 4FGRA 4AGDA 4BC6A 2OXDA 3M11A 2F49A 4HCUA 2GDOA 5CSWA 5GNKA 3CY3A 5ANKA 4AGUA 3ORIA 5FBNC 1M7QA 4WNKA 2YDKA 2C30A 3HA6A 3PTGA 4LM5A 5CSXA 3WF7A 3ZUUA 1IAJA 4V0GB 5GINE 2YJRA 5JQ8A 3BHUA 4DFZE 5C4KA 4CLJA 5F4NA 4APPA 4QPSA 1ZYSA 3QD0A 2PUUA 3DLZA 3NWWA 3O96A 3OWLA 4QMVA 3BYUA 2VWZA 3C7QA 4EOKA 4F6WA 4HOKA 5EK7A 3FLNC 3VAPA 1ERKA 1XHAA 2VWBA 5AX3A 3UNZA 4IM2A 5JRQA 4AZFA 3C5UA 4FK3A 4FOBA 4F63A 3QGWA 4I1ZA 4OLIA 3VUGA 5BVNA 2REIA 3CBLA 3G0EA 4YJQA 3R7VA 2XKDA 3COIA 4G5PA 4IWQA 2ITQA 4QP7A 4YZNA 3QF9A 4KIQA 4H36A 4JX3A 3MA6A 4DCEA 2CKPA 5BYLA 4WG3A 5J9LA 3SAYA 4D2WA 2WHBA 2O65A 1SVGA 4UZDA 4K11A 3BX5A 1OVEA 3E3BX 3MY1A 5AIRA 3DAEA 3GU7A 1OITA 5LMKC 4IHPA 2VWUA 5IQHA 3BWJA 4TXCA 5EM6A 4FV8A 2QU6A 3UVPA 2GU8A 4DCAA 1PHKA 1PW2A 4BCIA 1UKIA 4H3PA 3VQHA 3LKMA 4DH7A 5JQ5A 3OBJA 2BFXA 5LARA 3EQGA 2PK9A 3NMUF 1YWNA 2EVAA 2O63A 1JAMA 4G6NA 3NVKI 4MBIA 3W2OA 4GJ3A 3LMHA 1YQJA 4AUAA 4CV8A 5CVGA 3A99A 3HDMA 3RPOA 2LAVA 3D14A 3BLQA 4QQTA 5L2SA 4I21A 3D5XA 3HA8A 4C02A 2J0JA 4CQEA 4G6OA 3NUAA 4HPTE 3JPVA 1JKTA 3BQCA 1QPDA 2BRHA 1NVRA 4ANOA 4KKGA 4EH6A 4MWIA 4O7ZA 4L42A 2R3OA 4CQGA 4DGMA 3BYOA 2BAQA 4Y5QA 3BGPA 1JBPE 2BKZA 3FLQA 4O96A 1FBNA 3ROCA 2GNLA 2VGPA 2CCHA 1Z9XA 1Q3DA 2VTLA 3N4TA 4HCTA 4DEAA 5A4CA 2FSOX 1K9AA 3DPKA 3TZMA 3F2RA 3F66A 3AT3A 4XUFA 2QOBA 1AD5A 1BX6A 2KULA 4PL5A 3ZXZA 4KB8A 1YDSE 5A54A 3PRFA 5L2WA 1JOWB 4DH8A 5H8EA 4HYHA 3V04A 3KB7A 2X2LA 1Y91A 4EH9A 2QOQA 2GQSA 5HU9A 3FLSA 4MF1A 1OL5A 2YCFA 3SXFA 1YW2A 2F7EE 3DQXA 3NAYA 4FSQA 1OL1A 4NTSA 5ICPA 1JSTA 1OKVA 4L3PA 4ZZMA 5GIOE 3UNJA 4AA0A 4L8MA 3E64A 4EYJA 5ETFA 4Y73A 4PUZA 4I4FA 4O2PA 4U41A 5HBEA 4LG4A 3POZA 2EXCX 4QTEA 2R9SA 4EC8A 4QMTA 3RHKA 5AV4A 4QYYA 1I44A 3LOKA 3I1AA 4FV1A 4I6QA 4MQ2A 5EW8A 2CCIA 1YOLA 3EQBA 2V5QA 2J0LA 4JLCA 4TKSA 2HAKA 1I09A 3OTVA 3WF6A 1NY3A 4R78A 4N57A 3G2FA 3I0OA 4YHFA 5A4EA 5HG9A 4FTLA 5HVKA 4ZTLA 3V6RA 2P33A 4L00A 4K18A 4WUNA 3FMLA 1YHVA 2GNGA 5AR4A 4JNWA 5AM7A 4FEUA 4BR3A 2C3KA 4EUUA 5IH5A 3ORMA 1OUYA 4O86A 4F1MA 4ZS4A 1UNGA 5DNRA 3FEGA 3P86A 4EZ7A 2VWYA 3H9RA 1UNLA 3PXRA 5HVJA 1GZNA 2JAMA 3BLRA 3EQPA 5HE1A 4ZJJA 2Q0NA 3HDNA 3DFAA 4L44A 4YU2A 4BKZA 3C4CA 5FG8A 3GFWA 3KCKA 4QMWA 4XEYA 5C8KA 1V0OA 3QZIA 4RJ7A 1CKPA 2GCDA 3EWHA 4X0MA 1JPAA 1EH4A 5AUZA 3L8VA 4QTCA 3AC1A 4EQUA 4O7WA 3C50A 5H8GA 1FQ1B 5CI6A 2BFYA 3R8MA 1FMOE 5LMKA 5EQYA 3MPTA 2BZKB 4WOVA 2VTNA 4KBAA 3KN6A 2O5KA 4KBCA 2XIXA 3PJ2A 1Y8GA 3QTSA 3KEXA 4MX9A 4QMYA 3U4UA 5A14A 2PVYA 5JFVA 2WQMA 4I6BA 4BCOA 4BZNA 2XZSA 3MA3A 4BBFA 5H9BA 4HVHA 5C1QB 4XG3A 2Y6MA 4GG7A 4EL9A 4G17A 3WYYA 2OSCA 3Q2MA 4FTAA 4XG8A 3WIGA 2W5BA 5J79A 5DRDA 4C36A 3D5UA 2FSMX 3ENMA 4P4CA 4UMQA 5EDQA 3W10A 2CHLA 5IDNA 4L43A 5HGIA 4B9DA 5FP5A 3TDWA 1LPUA 1ZZLA 4JR7A 5CEQA 3RK5A 2JDRA 4ITHA 2R3QA 4DBNA 5DT0A 4H1JA 4C4HA 5BVFA 4C4FA 4C4IA 5JEBA 4EUTA 2QNJA 4FV9A 3ZFMA 3DQWA 2W1ZA 1PXIA 3E62A 3KRWA 1M2PA 4MBJA 5CSHA 4AW0A 5HORA 3O8PA 3FMEA 5AP7A 1S9IA 3KXMA 3N4VA 5EOBA 2Q83A 4ZJIA 2YWPA 1OIQA 3TZ7A 4BKJA 3DA6A 4CMUA 2E9NA 3GOKA 5L6OA 3HUBA 4V05A 4TT7A 5L4QA 2BDJA 2PZIA 5HG5A 5CSPA 4FV5A 4LL0A 3MPMA 1BI7A 4LL5A 5J1VA 2C6MA 3LFNA 4TZRA 4C58A 3V5WA 3R7EA 3HX4A 3ZRKA 3V5PA 3A61A 5CXHA 3NEWA 3BU3A 5ANDA 5KMMA 5LVMA 4AAAA 4U3ZA 4X2GA 1WVYA 1XKKA 3KK9A 3U9NA 4FSZA 4IX6A 4UZHA 4XNEA 5IZFA 2WU7A 3BLHA 5HG8A 5AJQA 4QP9A 2Z8CA 3PY3A 3FMHA 3E92A 4GRBA 4FI1A 4ASXA 3M2WA 3L1SA 3BV3A 1J1BA 2C4GA 3QRUA 4R1YA 4RIXA 1H1RA 5AP1A 4E93A 3VBXA 3G90X 2C6IA 3OEFX 4X2FA 5HE2A 4TYJA 3ZMMA 3R21A 2C0OA 2UZTA 3Q3BA 3OY3A 2J0IA 4XP0A 2JKOA 4ENXA 3FKLA 2XBAA 4AZSA 3MWUA 1OIRA 3D7TB 5KMJA 1J3HA 2YCQA 2OIDA 2WMBA 2C6OA 1O6KA 3SW7A 2PVLA 5EQEA 3LQ8A 3N51A 4UMUA 2F2CB 5I9YA 4MQ1A 3E63A 2VTSA 4DEIA 5LVNA 3A4OX 3Q4TA 2ITOA 4Q5HA 3R02A 3FZ1A 3HV6A 4O0XA 4ZTRA 4M69A 2G9XA 2G2IA 2WTVA 4K8AA 1W82A 2ZM4A 3B2TA 4X2JA 5CAOA 2R3MA 4BDJA 3QYWA 3LQ3A 3ZLYA 3UVRA 1STCE 4RC4A 2P55A 4BDHA 2ONLC 5J9YA 4KIOA 5M06A 1F5QA 3FI2A 3VBYA 4NIFA 1NVQA 2XK8A 4O0YA 4QNAA 4U0IA 4DFYA 1E9HA 2G1TA 3Q4UA 3PJ3A 3EFKA 4O91A 3RP9A 2VO0A 1YXVA 3KRLA 3BU5A 4ASDA 4XV3A 2XS0A 3R9NA 1PXNA 3FZTA 3HRCA 3ZM9A 5AM6A 2J4ZA 4GSBA 4WBBB 5A9UA 3VBWA 4O0SA 1ND4A 3FYJX 5LMBA 3ACJA 4A9SA 2WGJA 4YMJA 4IB5A 3LJ0A 2H8HA 3EJ1A 3WE8A 4PL4A 1GAGA 4U42A 5L8KA 4M14A 2E9OA 3DK7A 3VUMA 4CMOA 4RC3A 4OGRA 4IB1A 4DFUA 5JZNA 4IAKA 5EKOA 4E26A 4UV0A 5J87A 4F0FA 1H1PA 5FXQA 3PP0A 3TXOA 5KBRA 2JDSA 3ZO3A 4MYGA 2QD9A 3GFEA 3AT2A 4ZXTA 3I6WA 3Q5IA 4H3BA 4RGJA 1UNHA 2RL5A 3I0QA 3FHRA 3E87A 5DBXA 4L46A 1H07A 4L67A 4YTIA 4ANBA 2XNEA 4N6YA 4ZIMA 4E73A 3MDYA 3DLSA 3TCPA 3N4UA 4FODA 4FT5A 5HTIA 2W1FA 3CLYA 3QFVA 3GI3A 4YZDA 3O7LD 4UMPA 3R71A 4XYFA 1UV5A 2I0EA 4CNHA 2CDZA 2YISA 3O7LB 3V8SA 4NZWB 4NW6A 4AF3A 5BUJA 1APME 2IW9A 3E8NA 5DI1A 1ZYJA 4CFWA 3SA0A 4JQEA 3V5LA 2XKFA 4PDSA 4HVDA 3H0ZA 4DGNA 5B2LA 4NFMA 4O0UA 4XBUA 3UNKA 5GZ9A 1PF8A 5LWMA 2WMXA 3E8EA 3QAME 4OUCA 1O6YA 1PYEA 4C38A 4DEBA 2PUNA 4M84A 1YOMA 5CS6A 4YJVA 4V04A 4MEDA 4UB7A 5HTBA 2JLDA 3TG1A 3VRZA 3QA0A 2QO7A 5HEZA 4JX7A 4BFMA 4MXCA 2HELA 5M4FA 2JAVA 1BL7A 4G3FA 4OTRA 2B7AA 4DG3E 3IECA 3QTXA 4IZ5A 4OAVB 5F94A 1P4OA 3BHTA 5BYYA 4A4XA 3MB6A 1TQMA 4X6QC 2W4OA 2GNIA 2OIQA 4RIYB 5LOHA 3QRKA 4U80A 5D41A 3ZLXA 4AXAA 3WILA 3ETAA 3R8PA 5I9VA 1KUTA 5H8BA 4R77A 3FLZA 3VC4A 3R9HA 3FXWA 4Z3VA 4ZLOA 1S9JA 3UDBA 5ETIA 5AP4A 5EHYA 1WVXA 3VUHA 3ZSIA 3UC3A 2WKMA 4GUBA 5AMNA 1ZOHA 2JIUA 2VN9A 4KRCA 5DT3A 3JY9A 3FC2A 4XV2A 3ZO2A 2YDJA 4CFUA 5DN3A 3EHAA 4GJ2A 4AT5A 2ITPA 4FV3A 4LRMA 2QODA 5CQUA 2ETKA 4GIHA 4I20A 4IQ6A 2ONLA 4J98A 4RVMA 4IC7A 1OL6A 3LJ2A 3UZPA 3L8SA 3OD6X 5K5XA 2ITWA 5KMKA 4CRLA 4F09A 3I4BA 5IQDA 1PXLA 4F0IA 3KN5A 1GZOA 4YJUA 4DLJA 3UVQA 2WAJA 4J52A 4B7TA 5M09A 3TJCA 4B8MA 1NXKA 4RX5A 4BZDA 2VO6A 5FEDA 3FKNA 2WOUA 2OJIA 2W17A 3PE2A 3SOAA 4OTGA 4DBXA 1MRYA 3CP9A 3EQIA 5HCXA 3QQGA 5HCYA 4PY1A 2CGXA 3LMGA 4QQJA 3SQQA 3IK3A 3ATTA 2YAAA 2QOLA 2XRWA 4IW0A 4BCGA 4FTRA 4RIOA 4YBKA 3HP2A 2GFCA 3ZDUA 1XBCA 3CGOA 2OJ9A 4B8LA 5M44A 1BYGA 4DT8A 2GPHA 3UG2A 3F82A 2P2IA 4FZ7A 4KIKA 5HLWA 4L68A 5AUYA 5H2UA 1OM1A 3ODYX 5EYKA 3QCYA 3MH3A 2OBJA 4DC2A 4HGLA 4J96A 3THBA 1OBDA 3FZRA 3UG1A 5JFWA 1ZMWA 2VTRA 2AUHA 3UODA 4DINA 4FV2A 3LIJA 1UU3A 1W8CA 2BDFA 3AG9A 1ZAOA 3TDVA 4FVPA 1M14A 1H1QA 4ZSLA 4BTFA 3KVWA 5IISA 3C4XA 2CLQA 2PE0A 4A9UA 4HNFA 2PL0A 5KUPA 4QMOA 2YM5A 2JD5A 3FAAA 3TZ8A 4EHZA 3QTRA 2IZRA 3F69A 3REPA 3O8UA 2WFYA 3ORKA 4GT4A 4RQKA 3VVHA 5LVOA 5AV2A 4C4JA 5KCVA 3LFEA 4TWNA 5IUHA 5JFXA 2R3HA 3ZEPA 2ZB1A 4DFBA 3IKAA 2C68A 3GC8A 4CG9A 3R83A 4B4LA 3MFUA 3DTWA 3Q4CA 3FQEA 3Q4ZA 4L3JA 3NGAA 3B8QA 3UQGA 3ZSGA 4B99A 2C5YA 2RIOA 2VRXA 3PYYA 2QG5A 4M13A 3EFJA 3LFDA 3TZ9A 3NUNA 1WBVA 3NW6A 1PRYA 3R63A 2CPKE 3NUXA 3D0EA 3I7BA 3CJFA 4BTKA 3HMNA 2BR1A 3NW7A 3TTIA 3S00A 4FGBA 4FZFB 2XP2A 3RK7A 3W2PA 3LVPA 5L3AA 4F6SA 1TKIA 4D9UA 3I81A 1DI8A 1MP8A 1W84A 2EXMA 1H0WA 3P9JA 4ANLA 4JS8A 4FZAB 1WBOA 4PNKA 4O82A 1PMUA 2GMXA 4RWIA 1ZYLA 3C0IA 4NJ3A 5EH0A 1FMKA 2JIVA 4BCQA 5E8YA 3SG8A 3SV0A 3TV6A 3K5VA 1AGWA 2F4JA 1M2QA 2HZNA 4P2KA 3IDCA 2WB8A 3FUPA 2B9HA 4EWQA 4FMQA 4H58A 3ZTXA 5KHWA 1VYWA 3QC9A 4K9YA 1UWHA 3PJCA 5DE2A 4FKGA 2ERZE 4J95A 2XRUA 3U8WA 4AT3A 1PXKA 4XG7A 5CZHA 5HHWA 4C7TA 4EOOA 4X3FC 4TYHA 2UW8A 4PP7A 2Y4IC 4YTFA 3P7CA 3F3TA 3AOXA 3EZRA 5M55A 3GT8A 4GL9A 4KIPA 2VTOA 5EDPA 5TT7A 4EZ5A 5AUUA 4CXAA 4E6AA 5AUWA 4EC9A 2PUIA 2W4JA 4BDCA 4L7FA 4F1OA 3DK3A 3BQRA 1IEPA 3KCFA 4WD5A 4G3GA 2WELA 4IM0A 4I22A 3MYGA 2C6TA 2QOHA 2PZRA 3Q9ZA 1GIIA 4FVRA 4QTDA 3S95A 2O64A 3QD4A 3MY0A 5BMSA 1JSUA 4YLKA 4EH2A 3FKOA 4AE6A 5EYCA 4YJPA 2YABA 4KAOA 2RSVA 4Y46A 3OCBA 4EONA 4U44A 1XH4A 2X4FA 4OTQA 3PSCA 5B2KA 4DEDA 3RAWA 3WZEA 3SX9A 2VTTA 3DBCA 2C47A 1KE6A 3GC0A 4G3CA 4BGGA 1WBNA 3CQWA 3GUBA 4D58A 4RVTA 4L7SA 3VNTA 1DAYA 3A62A 3IOKA 5EM5A 5LVPA 1REJA 4FG8A 4D1ZA 3DKFA 4EKLA 1A48A 3HMMA 4C33A 4FE2A 2XJ1A 1OPLA 3QTQA 4GG5A 5ETAA 5I4NA 4A4LA 4JIAA 4AX8A 3ZHPC 1H08A 5ACKA 2Z7SA 1CMKE 4JBVA 4XBRA 4ANQA 2HIWA 2OH4A 4ZSEA 2Y8OA 4AP7A 4USFA 4AZTA 2Y7JA 2W06A 1YI3A 1NW1A 2R3FA 3LXPA 4GEOA 4FOCA 4OBOA 5E92A 4EJNA 4QP8A 3Q52A 4RWJA 4UALA 4X2KA 3L9MA 4QMUA 5GJDA 1Q3WA 4IJPA 4D4RA 3QBNA 3P4KA 5JFSA 4BDGA 3P0MA 1Q61A 5BPYA 4I0RA 1IAHA 2YLEA 4M12A 4EOLA 4UYAA 3LHJA 3EL8A 2GTNA 2R3KA 4IFCA 4ALUA 2JITA 3VJNA 3ZH8A 2ITYA 5DEYA 3RZBA 4I93A 3ET7A 4OTIA 4CT2A 4AQCA 1HCKA 3ZBFA 1BLXA 4UX9A 2AYPA 3D5VA 2IZTA 5D7AA 3PUPA 4ANSA 3DXQA 3IPHA 2WD1A 1P5EA 4DH1A 3PXKA 5DWRA 4LGHA 2ZJWA 4AOTA 3NRMA 4TL0A 2ZM3A 3QUDA 4CTCA 1NVSA 4GV1A 2ITVA 4QO9A 2EXEA 4RIWB 4NUSA 3R7OA 2PYWA 3O71A 3PLSA 4W4XA 3HMPA 4O0VA 3CD3A 5KKRB 4FEXA 4W8DA 3HYHA 3DOGA 4TRLA 5AX9A 3WF9A 4ASEA 4BDFA 2E9PA 3MSSA 4IBMA 1H24A 2AC3A 2V62A 4PPCA 2HXLA 2UW3A 5M53A 3UMWA 2R4BA 4ID7A 3R1SA 4O38A 4XP2A 5AP2A 4BTJA 3D2KA 2BRBA 5EKNA 3PLAE 4X3FA 5BVWA 3UO4A 3VBTA 1ZY5A 4F0GA 5IH6A 1ZLTA 2I0YA 3BHVA 3F5GA 4JRNA 5CU4A 4A7CA 5G6VA 4YBJA 1YRPA 4GT5A 1Q8YA 4YLJA 3FMNA 1W98A 5AR3A 3BCEA 3C4WA 2I1MA 3OXTA 2CGUA 3PPJA 4GU6A 2ESMA 3R73A 3UTOA 1M52A 3AC2A 4D4SA 5BVOA 3ZRLA 2FYSA 5T3QA 4FIEA 4CG8A 2XCHA 5HX8A 5GIPE 5CEMA 3ZFXA 2WMUA 3ULZA 4YZMA 3RALA 1BL6A 2V0DA 4GW8A 4ZP5A 5CEIA 2X9FA 4WO5A 4AN2A 3RMFA 3RPRA 1OZ1A 3BZ3A 2HY81 5C8MA 4KKHA 3MN3A 4FV7A 2XBJA 4N0SA 5AA8A 2O3PA 2C3LA 2UZBA 5JN2A 2UV2A 4C34A 1YDRE 2G2FA 3FMJA 4FTOA 4B6LA 4GCJA 4MHAA 2EU9A 2B55A 5CU6A 3UO5A 2PMIA 4R7IA 2IVVA 5L2TA 3SGCA 4AACA 3GCUA 2WPAA 5E8UA 3ODZX 2OG8A 1R78A 2HCKA 1JKSA 3NIZA 3GEQA 3RNYA 2OLCA 2EB2A 4D9TA 4MXOA 3WYXA 3EQDA 1UU8A 4E1ZA 4F9BA 4A07A 5L8LA 4D4VA 4JI9A 5DIAA 2PSQA 4YGAA 5EYDA 1QPCA 2J9MA 4FICA 4J7BA 4K6ZA 2I0HA 5IA4A 5DYJA 3QUEA 2BHEA 3DBFA 4JQ7A 1J91A 4AG8A 4WA9A 2CKOA 3F3ZA 4OTFA 2A4LA 4IWOA 4O6LA 3CEKA 4FUXA 4QP2A 5HG7A 4CD0A 5IQFA 3HRBA 3TIZA 1RQQA 3C0GA 1K2PA 2GHGA 3UQFA 4MK0A 5EHOA 2QOOA 3SKCA 3Q9YA 2BRMA 1P4FA 5CLPA 4BIEA 5KE0A 3V3VA 2IVTA 3QX2A 3OUNB 3PVWA 4L45A 2R3RA 4TN6A 2X1NA 1J1CA 2QR8A 3MIYA 4FNZA 4FTCA 3P08A 5JGAA 4IADA 2BAJA 3QLGA 3OEZA 3S4QA 3NYXA 3PWYA 3RBWA 2I7QA 4L3LA 2WIHA 4BDKA 2W1DA 2QO2A 1KE9A 3F3VA 4NM0A 4DF3A 4Y72A 4O81A 4XG4A 2XYNA 4MD8E 3DZQA 4O7LA 4L52A 2PMOX 2B9JA 5E9EA 3MS9A 1U5QA 5ITAA 3EKNA 4FT0A 5DLSA 4TYEA 5M07A 5K5NA 3EN5A 4IDVA 4KINA 1O6LA 4FKJA 4NWMA 1PMVA 3DJ7A 5EYMA 1Q8WA 4RWLA 5IA1A 2O2UA 2YIWA 4PDPA 1G3NA 3WOWA 4FF8A 4Z7HA 4MNEA 2WQBA 4FKIA 3VBVA 5HLPA 3FMDA 5DH3A 5ANOA 1RJBA 2Y4PA 3KF7A 4DTKA 2C1BA 5LMAA 3L9LA 3LXLA 4EK4A 4I5MA 4NT4A 2W0JA 4E3CA 2RG5A 4QMXA 4FV4A 5A46A 2YM3A 2JKKA 3LFCA 3PY0A 1UA2A 2PWLA 4BCNA 3VUTA 4K33A 2W05A 4RT7A 3VBQA 4NU1A 3W2CA 4EHGA 1JKKA 2BTSA 2WMRA 5J7HA 4TYGA 3OWPA 4FTJA 4C3PA 3DAKA 2VWIA 2QOCA 5CAVA 5FDPA 3QXOA 4CFVA 4YJSA 3OMVA 4EEVA 2OZAB 4AOJA 5HBJA 5M4CA 5AR2A 4P90A 4JVGA 5HESA 2UW5A 4EK5A 5AR7A 1ATPE 4AGCA 4TNBA 1MUOA 5DEWA 2E9UA 4EORA 2X6EA 4D0XA 3HECA 3DB8A 3NYVA 3MFSA 2VGOA 3FYKX 4I41A 3HV3A 4PF4A 1OL2A 4ONAA 3Q53A 3TACA 4IVAA 4ARKA 2JGZA 4O0TA 5HO8A 4BCHA 5HE3A 4DH5A 4FYNA 5KX8A 4ZTNA 4XG6A 4FKRA 3RM6A 2OICA 4ZLZA 4C0TA 5EI2A 3TJDA 3PE1A 4WNPA 3HLLA 2V7OA 2OU7A 4L6QA 1OMWA 4QT1A 2H6DA 3VRYA 3PXYA 4YJRA 4CZUA 4D2TA 1MQBA 3VULA 4P5QA 4U43A 4AGWA 2GQRA 4D2PA 3GCPA 4YJNA 3KF4A 3NSZA 4IAAA 1ZRZA 5EI6A 2C69A 1L8TA 1G8SA 3EFLA 3DZOA 3MH1A 3E7VA 5IUIA 3ZC5A 4F7JA 4PPAA 5CF4A 4Y95A 2A0CX 3QCQA 4LV8A 2HK5A 2PE2A 2QCSA 4FSRA 4G31A 3COHA 4IWDA 4XOYA 3QZHA 3V8TA 4DITA 1GOLA 5IKWA 4PPBA 2RFDA 2CNQA 5EM7A 5GJFA 4FG7A 4FTTA 4EK3A 4F99A 4FEQA 4UN0C 3NPCA 5E8SA 3I7CA 1F0QA 5AAGA 2X2KA 1WBTA 4XJ0A 5FM3A 4E5WA 2R3IA 4M8TA 4O84A 4R1VA 3A7FA 2UZNA 3GOPA 4YC3A 2XVDA 1DM2A 3HUCA 4OTHA 1BMKA 4YPDA 4BY9E 2XMYA 3MIAA 4Y5HA 1ZARA 5J7BA 1J7UA 4O22A 4HCVA 3CJGA 4EQMA 1R0PA 3PZHA 2C0TA 2UZDA 2PU8A 2OFVA 2XK3A 5DOSA 3W1FA 3CC6A 4ZSAA 3MVJA 5CEOA 2J5EA 5B2MA 3NDMA 5LQFA 3F6XA 4O27B 5CT0A 3KA0A 5DHJA 4U8ZA 2RGPA 3D5WA 3CTHA 4G16A 5E91A 3W8LA 4AZEA 1ZWSA 3M1SA 2R3LA 3VS6A 3DJ5A 5K9IA 4MH7A 4N70A 2OH0E 4JG7A 3BHYA 3FY0A 3MH0A 4JRVA 4C4EA 3U6IA 1NT2A 3IGGA 2NNWB 5E4HA 4QTBA 4QRCA 5D7VA 2NPQA 3LE6A 3LFBA 2PULA 3UC4A 3ID6C 3QWKA 2GS7A 4HYUA 3RWPA 3SRVB 3OZ6A 4KD1A 5K4JA 1ZOGA 5A4QA 5I9ZA 3GCVA 4S30A 1H26A 4BI2A 3RAIA 3UP2A 3ZO4A 4TTHB 4NM7A 3MPAA 2YEXA 2XH5A 1SNXA 1WCCA 4RIXB 3S0OA 2BPMA 3F2NA 5HTCA 4BI0A 3S3IA 2BIYA 3QQHA 1ZYDA 4FSMA 3LCTA 4GMYA 4MXYA 4CV9A 3F7ZA 5J5TA 2OZOA 4F7LA 5FTGA 4MD7E 3F7WA 4FVQA 4KA3A 1MRUA 5D1JA 2BVAA 4RFMA 5KMOA 4DA5A 4M67A 1FPUA 2P3GX 3QD3A 2PPQA 3G9NA 5HNBA 3NUUA 4WT6A 3FV8A 1R0EA 5E8TA 3NNXA 5FQDC 2VTHA 4K0YA 3D2IA 1ZOEA 4UMTA 3KGAA 2YWVA 1HOWA 2VTJA 3D9VA 4M69B 4O2ZA 3W33A 3FDNA 4AFJA 4LYNA 1YI4A 1H25A 3AC5A 4BHNA 3R00A 3LAUA 3OS3A 3EZVA 2DYLA 4ZK5A 4TWOA 3AGMA 1BUHA 1R39A 3UJGA 3BU6A 4BF2A 5M51A 4O7NA 5AV0A 3U54A 5CF5A 3W55A 2ZDTA 3I5ZA 4W4YA 4I5CA 4NIFB 2R3GA 3H3CA 4LOPA 5CX9A 3V8WA 2XEZA 4W9WA 2W99B 3LXNA 4G5JA 4TW9A 3CKXA 3EN4A 3VS1A 3GU8A 3WZKA 1A06A 1MRVA 4PTGA 2W9ZB 2VO7A 3TTJA 4YTCA 1JWHA 5D11A 4IE9A 5AR8A 5CENA 4ZEGA 4IZ7A 4YR8A 5IUGA 4Q9ZA 4QPMA 3POOA 4BCMA 4O7SA 4NW5A 4UWYA 2UUEA 4BGHA 3OF0A 1KSWA 3GQIA 2ZMCA 3A7GA 5I5ZA 1Q41A 2X9EA 2Y9QA 4R7HA 3EQRA 3W8QA 2WIPA 1J7IA 4XLVA 1IG1A 5EHLA 3CSVA 2YITA 3DV3A 2J0KA 3KULA 4Z16A 5IQGA 2Q0BA 2WTWA 2NO3A 3NAXA 1FGIA 4U9AA 4F9AA 3C51A 3FI3A 1OUKA 4QMNA 5TE0A 2XIRA 5AAFA 4BZOA 4HGSA 4AWIA 2O0UA 2HENA 4M97A 3NR9A 4QP4A 1ZMUA 5C01A 3SHEA 4AZWA 2YM6A 3WF5A 4AE9A 4BCPA 4DEGA 4ERWA 4FNYA 5GHVA 4LI5A 4CKRA 2GNJA 3B8RA 3JYAA 4FTMA 3MVHA 2FO0A 4U81A 5DR9A 4JBPA 4ZAUA 3JVRA 3ORLA 4XP3A 2I0VA 3E7OA 4CFFA 4JDHA 4ORKA 4ZTQA 2VTPA 3LJ1A 2YHVA 2FSLX 5DGZA 4ZS0A 2HZIA 3CPBA 3QYZA 3AD4A 2HXQA 3E5AA 3PVUA 3IW8A 4OBQA 2QI8A 5DPVA 3V6SA 3WF8A 2JDOA 4HZRA 4AN3A 3L9NA 4EH7A 4PX6A 3UP7A 3ZO1A 2X39A 3EN6A 4LGDA 2CJMA 4JAIA 2OI4X 4F6UA 3UIMA 5M4UA 2Z7RA 2YM4A 2Y6OA 4KABA 3CY2A 1ZMVA 2H9VA 3R6XA 4JR3A 5CASA 3H30A 3R7YA 3DBDA 5HVYA 1SM2A 2X6DA 4XV9A 2W1CA 4FKUA 3FZOA 1OECA 3OWJA 3MH2A 3ZS5A 1QMZA 2YN8A 4YC8A 2J7TA 3FJQE 5DT4A 4Y8DA 3PXQA 4FSYA 4QP3A 3G0FA 1OIYA 5C03A 3TNIA 4BL1A 3BHHA 4V01A 1U59A 2QLQA 4ENYA 3F3UA 4CMTA 3NNWA 4D55A 1SMHA 3R8ZA 4EH5A 4BDAA 3ENHA 4IXPA 1KOBA 4E5AX 1H1SA 3GC9A 2OIBA 2UZEA 5AUXA 3LCDA 4ZSJA 3GNIB 4MXXA 4FL1A 5JT2A 1E1VA 2Z2WA 3EKKA 1WAKA 3VS3A 4AA4A 3DS6A 4O0RA 2C1AA 4PQNA 5CT7A 2XIZA 3ERKA 2FGIA 3IW7A 4QMPA 5KZ0A 3DCVA 5AAEA 5HU3A 2BZHB 5CTPA 1ZXEA 4UXQA 3HV7A 4NTTA 5T68A 3VS5A 1H1WA 5FP6A 4S34A 1U54A 2QO9A 2V7AA 3IOPA 4ZY6A 4F9CA 4IZYA 2X8DA 3IW6A 4KNBA 5IA0A 1YXUA 5BX0A 2QKRA 2WQNA 3JVSA 3NNVA 3P23A 3PP1A 2IVSA 5IPJA 2W96B 1U5RA 4JAJA 4DYMA 4QQCA 2PTKA 3EN7A 4W4VA 4PP9A 4DEHA 3G6GA 4E4MA 4QP6A 3PSBA 5M56A 3ANRA 1WBSA 4C3FA 4AA5A 3OCSA 3NW5A 4ALWA 5FEQA 4GVAA 3QKKA 5C9CA 1MQ4A 4IAYA 5FWKK 4BB4A 3W2QA 4U6RA 3HKOA 4IAFA 2ZV7A 3QQUA 3WI6A 3VF8A 4M15A 3U9CA 5LCKA 4IX3A 4FKQA 2FVDA 3RKBA 4KIKB 2R0IA 3PY1A 5CU2A 3ZCLA 4PMPA 4I5PA 3R9OA 2BIKB 5CY3A 4XHKB 5HBHA 3ZRMA 4EKKA 3UZRA 2WTKC 4RA4A 2C0IA 3GB2A 1DI9A 4XOZA 3U51A 3UBDA 3UIBA 1RDQE 2BCJA 3M42A 3T9TA 5BMMA 3KKVA 2W1HA 4UY9A 3T3VA 5IQCA 2A2AA 3MW1A 5B0XA 2XK9A 3GGFA 3BV2A 4FSNA 4FKLA 5IEVA 3IGOA 3QQJA 4L53A 4W4WA 3MVLA 4U40A 2RFSA 2WOTA 4DH3A 1PYXA 4FSUA 3IS5A 2IZSA 3SVVA 4O0WA 2IWIA 1IA8A 4PDOA 4F65A 1VYZA 1GJOA 2UZUE 2WMTA 3K5UA 4U3YA 4XRJA 5CZIA 4AZVA 2BALA 4FEWA 3R04A 4CVAA 3ZC6A 5FBOA 2X8EA 4U5JA 2BZIB 2J2IB 3FQSA 2YERA 4LV5A 3O0GA 4YJTA 2H34A 3E88A 3Q9WA 5EG3A 1H0VA 3HMOA 3R8VA 3WZDA 2E9VA 3NNUA 3QTZA 1GIJA 3R0TA 4M66A 4UXLA 5C27A 3NVMB 3KVXA 4RJ8A 5GZAA 3CTQA 4IAZA 4S32A 4I24A 3UYSA 4DE4A 4E6QA 4RC2A 2Z7LA 5E8XA 4ANMA 5CEPA 5EFQA 2GTMA 3MI9A 1KV1A 4RBLA 4K77A 5J5SA 4EI4A 1LP4A 3KXZA 3AXWA 3F9NA 4F70A 4H3QA 4IACA 3UOLA 1XWSA 3GCSA 4YSJA 2F7ZE 5DMZA 2VV9A 2XNPA 3CR0A 4RLKA 5GZ8A 5KNJA 3AC8A 2ZV2A 4ACGA 1OB3A 3NYOA 4U97A 4QYFA 2R7BA 2JEDA 3JUHA 5EQPA 2BMCA 2OK1A 3CXWA 4FTNA 1KE5A 5JK3A 1YKRA 3FE3A 4PL3A 4WSQA 2A1AB 5IQEA 3GC7A 4QMZA 3HNGA 4LQMA 3LPBA 4AT4A 5ANJA 5BNJA 2Z7QA 4Z9LA 2HYYA 4PNIA 3BBWA 1Q97A 2W1EA 5EDRA 3LM0A 4AU8A 4U7ZA 1ZYCA 5CNOA 4UEUA 1Q99A 4W9XA 5EW9A 2OXYA 3V5QA 5IH4A 3NCZA 4FIIA 4A4OA 3FY2A 3JS2A 5HLNA 4HYIA 1Z5MA 4UWCA 4EH4A 3HV4A 4OW8A 4Q5EA 4M0YA 2OO8X 4I0TA 1Q62A 2JFMA 4IB0A 2YCSA 3FSFA 2CN5A 2ITNA 3S2PA 3R2BA 2Z60A 4TYHB 3ZZEA 3QX4A 4D5HA 2W1GA 2VNWA 5HX6A 4NCTC 2JKQA 4F9WA 4IZAA 2QOFA 4I6HA 2YIQA 4OBPA 5BVDA 2GHMA 5L2IA 1F3MC 3QTIA 2UVZA 3AD5A 4X6RA 3DU8A 5DFPA 3RINA 1YXXA 3AC3A 3BELA 5I3OA 4DHFA 2YZLA 5IA5A 4JDKA 5CU3A 4OAUC 1DS5A 2ITUA 4PTEA 4IVCA 2PE1A 3O2MA 3KMUA 1Q4LA 1FVRA 1U46A 5BQ0A 4F64A 3D94A 3HAVA 5E1SA 4IWPA 3WE4A 3CQEA 3IG7A 4M0ZA 4MAOA 2ZMDA 4RFYA 2B53A 4U45A 4FKOA 3AMAA 3HP5A 3AMYA 5ANGA 1H28A 3II5A 4J8NA 3CTJA 3ZYAA 4PMSA 1OIUA 2VNYA 3GU4A 3UOKA 1FOTA 3OFMA 2CMWA 3C5IA 1LUFA 2QLUA 1KE7A 5K0XA 4FIFA 4FTIA 3C13A 2X81A 3ORZA 2C5XA 4RSSA 5BVEA 1U4DA 1JVPP 3RPSA 4LMNA 4FKTA 4KSPA 3R8LA 2UZWE 5M4IA 3AT4A 1PKGA 3PFQA 3NS9A 1YI6A 2QHNA 4ZY5A 3EOCA 1UU7A 3OW3A 4DGLC 4FZDB 5IMEA 3EB0A 3QRJA 4ZLYA 2WMAA 1PMNA 3BEGA 5LWNA 4G3EA 4EH3A 5AUVA 2J50A 3OP5A 2XNGA 3ZDIA 3TV4A 4FT7A 4ITIA 3R01A 2WMQA 3C4EA 4FKPA 3PG1A 3QQFA 4GS6A 3JXWA 3EYHA 2FH9A 3BI6A 4O7TA 2UW9A
chains in the Genus database with same CATH superfamily
4HNIA 2BRGA 5K3YA 3DTCA 4O6EA 4I92A 5FXRA 3MBLA 1JNKA 3OY1A 3MTLA 4KKEA 3VUKA 2DWBA 3ELJA 3W2SA 2C3JA 4WRGA 3LFSA 1OKYA 2KTYA 2UZOA 2QVSE 3A2CA 4WBOA 4ZTSA 3ZLWA 2CKQA 2XYUA 1RE8A 5F95A 4J8MA 4EOIA 1KV2A 4LFIA 3NX8A 2HZ0A 3FLYA 4V0GA 3T3UA 4O7YA 4WNMA 2ERKA 1VJYA 1UKHA 4FC0A 3UE4A 2YJSA 1YWVA 4KWPA 3KRRA 2RKUA 3DGKA 3A8WA 4FIHA 3QXPA 2BHHA 3VS4A 3TIYA 3UPXA 1BKXA 2IO6A 1VEBA 4BCKA 4BVUA 4TPTA 3FL5A 1TQPA 3OCTA 2XIYA 4EHEA 2CKEA 3ACKA 4GK2A 4AW5A 2OGVA 5A4LA 4QMLA 2P0CA 4HVGA 3TKUA 3ZUTA 4RJ6A 2RF9A 1Z57A 5E7RA 3PJ8A 2RFEA 3OBGA 4F4PA 1OGUA 4E7WA 3BKBA 2CSNA 2R2PA 1CTPE 2XF0A 4BCJA 4YTHA 4D2SA 1HCLA 2UW4A 2YZAA 4QYHA 3VS2A 3IDPA 2VAGA 3V01A 4F08A 3DT1A 3OROA 2B52A 5CU0A 2BRNA 2PVNA 2IPXA 4YC6A 2YA9A 3KY2A 3BYMA 3OCGA 3BIZA 4QNYA 2YM8A 3LXKA 3QRTA 4YNEA 4DGOA 4DEEA 1CM8A 5BUIA 4BICA 3R9RA 4FIGA 4RA5A 4MTAA 3DY7A 3LZBA 1VZOA 5L6PA 2JFLA 3NYNA 1OL7A 4RWKA 4S33A 2Y4IB 4X3FB 3FXXA 4GK3A 3R7UA 3UIXA 4NCTA 4XV1A 1QPJA 4NH1A 1XH5A 3KQ7A 1V1KA 3P7BA 2W1IA 3A60A 4E4NA 4JJRA 2GNFA 3DNDA 3ALNA 4RJ4A 1IR3A 4EOPA 3U6JA 2IG7A 5E1EA 5HCZA 4KSQA 4PDYA 2F57A 5E8VA 3TN8A 3Q04A 3VHEA 5HNGA 3TL8A 4IM3A 3TWJA 1GIHA 1G8JA 3W0NA 5F1ZA 3Q9XA 4FK6A 2W4KA 5FM2A 3WZUA 1Q5KA 3FSKA 3K3JA 5FTOA 3RK9A 3MV5A 4MXZA 4BGQA 3HV5A 3IO7A 2HZ4A 4RJ5A 4CRSA 1YDTE 2OJJA 1OPJA 3OHTA 4D2VA 1XO2B 2BILB 4MKCA 1CSNA 3FWQA 3QHWA 4PMMA 5CVHA 2ITZA 4ZSGA 4HVSA 2B9IA 3KC3A 5I3RA 3FZPA 3QLFA 4BBEA 1J7LA 4FEVA 4O7RA 3DFCB 4ZJVA 4AXFA 2WXVA 3VW8A 3AD6A 3FXZA 3RCDA 3R28A 4DDIA 3A7IA 4S31A 1OPKA 3QALE 2PHKA 3TUBA 1G8AA 5KMIA 1LEZA 1YWRA 1XBAA 3QQKA 2HWPA 3R30A 5I9WA 1XJDA 3MGYA 4IX4A 2GHLA 5J8IA 4JDIA 5IF1A 2GS6A 4XCUA 2ITXA 3I60A 3BRBA 3LFAA 3CE3A 3DXNA 4GFGA 3TEIA 3QCXA 3ZLSA 4DFNA 2F2UA 3TM0A 5ANIA 3FMKA 4Y83A 4AW1A 1DAWA 2NP8A 4PWNA 4B0GA 4C2WA 4DG0E 3UOJA 1WVWA 1G8KA 3RTPA 4UBAA 3Q2JA 4LOQA 3QL8A 1XH6A 3C0HA 4J71A 4FL3A 3ROYA 3G6HA 4ZOGA 4XG9A 3W2RA 2FUMA 2X0GA 3RAKA 4DTBA 3BPRA 4RX9A 4BKYA 4FV0A 4GKHA 5J1WA 2UZLA 4FKWA 5LCJA 2XB7A 1SNUA 3TV7A 3PSDA 4G3DA 2W7XA 4IVBA 3GP0A 5AV3A 1QL6A 1JQHA 1VR2A 4LUDA 1XBBA 4GIIA 1OGYA 2HOGA 3TMOA 3BE2A 3NCGA 3CGFA 2WTJA 5KMNA 2QHMA 4S2ZA 1CDKA 4Z7GA 1OBGA 3QKLA 3MFTA 3PUFC 3KRJA 5JMSA 2R0UA 2IVUA 1AQ1A 2VUWA 4X21A 4BYJA 1JSVA 5IEYA 1PJKA 4DT9A 3F5XA 3AQVA 5AADA 5CALA 4C8BA 5EI8A 1Q24A 2J90A 5HIDA 3TT0A 3TNWA 1ZZ2A 3LM5A 2IEWA 4GFOA 4RPVA 3CPCA 4GUEA 3D83A 4WG5A 5AV1A 3COKA 5HQ0A 4CSVA 1URCA 4FV6A 3ITZA 2OJFE 2W5AA 3LCOA 4YHJA 5LJJA 4UWBA 2BUJA 2OZAA 5ETCA 2X7FA 3PJ1A 1H8FA 4MNEB 1XQZA 1E1XA 4A9TA 2ZM1A 4I0SA 2A19B 2Z02A 2VTIA 5CAUA 2QC6A 3GVUA 3DDQA 2XCKA 1W83A 2IN6A 3E8CA 3PRIA 4JBOA 4YUQA 2H96A 3BGZA 4ZZOA 4EK6A 5M08A 4WHZA 3LFFA 5EOLA 3OVVA 3K2LA 4FG9A 2R7IA 4RG0A 4NJDA 3AKLA 3SXRA 3FPMA 1FVVA 3HEGA 3F3WA 5A6OA 4MWHA 4GYIA 1YXTA 4FSTA 2VU3A 2VO3A 4YHTA 3N9XA 5I9UA 2X2MA 3R1NA 4G6LA 4QYEA 4FA2A 5AFVA 4RZVA 4XG2A 4IVDA 4ACMA 3KXNA 2ETRA 1PKDA 3UYTA 2X8IA 2UZVA 4E20A 3FBVA 2F7XE 5F9EA 3E8DA 2B9FA 3R1QA 5H3QA 3SG9A 1NA7A 5C26A 5IDPA 2BKKA 4U79A 3G5DA 5E8WA 5HKMA 1Y8YA 2IW8A 4ANNA 4BI1A 4D1XA 4EJ7A 3PPZA 4PRJA 4C61A 3Q6UA 3AKKA 3HMIA 5A6NA 5FRIA 4ZTHA 4NSTA 3Q5ZA 5K4IA 2XK4A 4HYSA 5E8ZA 3QTWA 4GYGA 1P2AA 4TNDA 4CCUA 5FGKA 3T8OA 3CS9A 4E6CA 4C4GA 1Y57A 1PXMA 5HNIX 4D2RA 2V22A 2WQOA 3ORNA 3LCKA 2PVMA 4QMMA 2R3JA 2ZDUA 3NUSA 4G9CA 1T45A 2ITTA 4MF0A 5E90A 4YZCA 3H9FA 2ZV8A 4TWPA 3RPVA 2PVFA 4H05A 4QEBA 2R5TA 4QPAA 3CIKA 4BN1A 2QURA 3FC1X 3PIYA 1M17A 4CTBA 2WNTA 4HVIA 3RGFA 4BRXA 2F9GA 5DG5A 2HY0A 4E6DA 3EN9A 4QQ5A 4USEA 3BL7A 4N6ZA 3OG7A 3VO3A 4EOSA 3G15A 3WARA 4WRSA 3T9IA 5DR6A 3UIUA 3NFGB 5AUTA 1FVTA 3D15A 3F2AA 4CZYB 3AC4A 5KHXA 4RQVA 2ETMA 4IIRA 3C1XA 3F5UA 3OTUA 5I0BA 4EK8A 1CKIA 1RW8A 2I6LA 4K2RA 5BVKA 4RJ3A 4Z55A 1B38A 1KWPA 4FKVA 2BTRA 3BYVA 2PVJA 4FKSA 4YNOA 4IFGA 2X7GA 3NZ0A 3R1YA 3FQHA 3KXXA 1T46A 5F20A 3RVGA 5C4LA 3QD2B 4A06A 4BBMA 3D7TA 2BAKA 3WIKA 1H01A 5CEKA 3PXFA 3SRVA 5HD4A 1Y6BA 1TVOA 2VD5A 1IASA 3H9OA 3ORPA 3E3PA 4JOAA 4P7EA 4BWKA 5AWMA 5A4TA 5CQWA 2XNOA 3K54A 3QU0A 2PVRA 2C3IB 5TKDA 2SRCA 2ZB0A 5GJGA 4EYMA 5KMLA 4GFMA 4ZTMA 4G2FA 2BDWA 3FZSA 3SW4A 4EHVA 2VZ6A 4QMQA 2C6KA 4EWHA 4ZMFA 5TOZA 4C3RA 5L6WL 4TWCA 4R3RA 2BZJA 4HZSA 3UGCA 3R7IA 1KE8A 4AN9A 3R9DA 1M7NA 4CGAA 4FL2A 5IA2A 4E8AA 2GQGA 4IX5A 4R6VA 3VS7A 5TF9A 4FTUA 1L3RE 1OI9A 3RAHA 4EOQA 5EM8A 5G1XA 4FRFA 3HAMA 4II5A 3DJ6A 3ATSA 2WTDA 1JLUE 3OWKA 5CYIA 3VONA 4E4XA 2C6EA 4DFLA 3EQHA 3KU2A 4Q9SA 4R3PA 4FNWA 1Q8ZA 3B2WA 2OJGA 4OTDA 3LLTA 3TKHA 4O83A 3COMA 3I79A 3ZBXA 4GU9A 1X8BA 3IDBA 2QOIA 4FR4A 3PXZA 1B39A 5HD7A 2Y0AA 3KXHA 3C4FA 3EH9A 5HI2A 3P7AA 3MB7A 1YXSA 2XJ0A 1PY5A 3QZFA 2UVYA 2XKEA 3SLSA 5I9XA 3KRXA 3ORXA 1WBWA 3W18A 2VX0A 3DNEA 4AFEA 1WBPA 2J51A 2NRYA 4D0WA 5J95A 2ACXA 4NYEA 2OW3A 3W32A 4GK4A 4O7VA 3IW4A 4WNOA 3O50A 4KUJA 3DXPA 3W0PA 2YLFA 2B0QA 4FZ6A 5KZIA 3F61A 5JH6A 5IQIA 2JC6A 4BDEA 3HVCA 1GZKA 4DG2E 3H0YA 3L8XA 1PXJA 3ZXTA 3Q6WA 3PFYA 5HOAA 3GENA 4APCA 4IAIA 4IEBA 3ULIA 3U55A 5HICA 3KL8A 3P79A 2XALA 2QG7A 4WSYA 3QKMA 4EQCA 3OC1A 1YOJA 2QONA 2ZVAA 4HPUE 4MNFA 3VW6A 3FL4A 2R3NA 2WMSA 5AA9A 1SYKA 2WU6A 4NM3A 3RI1A 3BEAA 3OT8A 1A9UA 4QD6A 1KOAA 3MFRA 4RX8A 3VS0A 2VWXA 4RLLA 4E5BA 2IZUA 5JRSA 3K3IA 1B6CB 3WBLA 2OKRA 2YFXA 1XH9A 1SZMA 2CN8A 3H10A 4LMUA 3PVBA 4C37A 3AGLA 3BBTB 3PIXA 3TKIA 2YACA 5KBQA 5HIBA 4FIJA 5TO8A 2CNVA 4CCBA 3UZTA 4G9RA 4BJJA 1REKA 4DLIA 2YAKA 3HRFA 2WQEA 4I5HA 4EBWA 2WTCA 5JSMA 3A7HA 3BE9A 4OTWA 4Q2AA 4XS2A 3LW0A 3LQ5A 4WKQA 5AR5A 1URWA 2OXXA 4JT3A 3L9PA 4JXFA 5HO6A 1G5SA 3R7GA 3UMXA 1V0BA 2HWOA 4RIYA 3D4QA 4CEGA 4GVJA 2XNNA 4BTMA 1XR1A 4RX7A 4ZY4A 1TZDA 3EMGA 1UU9A 3QTUA 2ZOQA 3ZZWA 3KULB 3QUPA 5IMXA 3U6HA 3CCNA 3Q60A 2VTAA 2JBPA 2W5HA 3OXZA 5D12A 2PMLX 5IU2A 2J0MB 4EZ3A 5FD2A 3SD0A 3DB6A 4ITJA 4GT3A 3TNQB 5DRBA 4YPSA 2UVXA 2FB8A 1GZ8A 2PMNX 4F7SA 5K0KA 2PVHA 2J5FA 2AEGA 4CT1A 3LLAA 5IQAA 2PZYA 4FX3A 2UW0A 2ZV9A 2QU5A 4YZBA 3ORTA 2UW6A 1O9UA 2C6DA 2XAOA 5FTQA 3CKWA 3NUYA 4DAWA 3OOMA 2P4IA 3F5PA 4R5SA 4YO6A 1H27A 1QCFA 3FI8A 2PY3A 2IJMA 4RRVA 4XMOA 3ZEWA 1SVHA 5AEPA 2XUUA 3D7ZA 5CNNA 4BHZA 4DFXE 4FJVA 4RFZA 1M2RA 4MBLA 1FGKA 3A4PA 1W7HA 5FUTA 3VUDA 2AC5A 4FNXA 3VIDA 4ERKA 4CLIA 5IG1A 4FTKA 1Y6AA 5CAPA 5JGBA 1JKLA 3HZTA 3GCQA 4FT9A 1UWJA 3P78A 4KBKA 4FYOA 2ZYBA 2HW6A 2GS2A 3LFQA 4IMYA 2LGCA 3ZSHA 2XNBA 1IRKA 3RM7A 5BUEA 3JY0A 4F7NA 4L01A 1BI8A 2YIYA 3Q96A 3ZU7A 3NLBA 3PPKA 4I4EA 3DBEA 5CF8A 1WFCA 3UOHA 4O21A 3WZJA 4BIDA 2VWWA 1OKZA 3I5NA 4X2NA 4L9IA 3EIDA 4CFMA 3RCJA 2JKMA 2OF4A 1IA9A 5JGDA 1YVJA 2VX1A 1WMKA 2G01A 3NUPA 4ACHA 3G9LX 2VX3A 1UVRA 2JIIA 2VTQA 4FSWA 4DN5A 1TQIA 2XIKA 4YLLA 5B7VA 3G33A 3MJ2A 3LMIA 2J6MA 2YDIA 3OOGA 5FEEA 1SVEA 2R3PA 4CZTA 5HO7A 3QRIA 4OT5A 4X7QA 5L8JA 5JKGA 1GNGA 5HE0A 3OT3A 4O1OA 4KS8A 2A27A 3A7JA 4BIBA 4LUEA 4UYNA 2W9FB 2WMWA 1K3AA 4YO4A 4HW7A 3P1AA 2GFSA 1ZY4A 2OFUA 4E4LA 4F9YA 5AP6A 5IEXA 3QA8A 3O8TA 4QTAA 1U54B 2VWVA 1OKWA 5KO1A 4WG4A 4A9RA 4H1MA 3GQLA 3ZM4A 4R5YA 2G2HA 4LV7A 2PZ5A 1PXPA 5A3XA 3FHIA 3ANQA 4G34A 1YHWA 4D4YA 4NL0A 3DKGA 3UQCA 3NIEA 4USDA 4CYJA 3ALOA 2XK7A 3VJOA 3QQLA 2PVKA 4D5KA 5EW3A 3DAJA 3EQCA 3I6UA 4D1SA 4H39A 4HJOA 4NM5A 5JZJA 5TR6A 3FMMA 3ZOSA 4AOIA 5AIKA 4TY1A 4YP8A 3SC1A 4MVFA 3DDPA 3UPZA 4M68A 2XAMA 4JG6A 4JG8A 4QP1A 4KS7A 1R3CA 3O17A 1XH8A 3QGYA 4LOOA 3RWQA 4P5ZA 2B54A 3F88A 3IQ7A 3V5TA 4J53A 2WEIA 4LGGA 1V0PA 2P2HA 3KK8A 3FPQA 3MESA 4R7BA 2R64A 4OT6A 3QCSA 5IQBA 4BCFA 4PMTA 5D9HA 3TNPC 3JR1A 3L8PA 3IONA 3VN9A 4A9YA 3KIOC 4J1RA 3ZONA 5KKRC 4I6FA 5LVLA 2CNUA 4RVLA 4FUYA 5DVRA 2VTMA 2E2BA 3O23A 4QMSA 4R3CA 5M57A 4ZZNA 4WIHA 4JIKA 3HGKA 3RPYA 4YSMA 3VQUA 3UO6A 3SOCA 4ZMEA 4M7IA 2DS1A 2G15A 3TI1A 3PA5A 3E93A 4D28A 4W8EA 4JQ8A 2JDTA 3PA4A 4OR5A 4DTAA 3DK6A 2YM7A 3R2YA 5D10A 4BWXA 1LEWA 3QWJA 4CFNA 5FLFA 3DKOA 5CI7A 4DGGA 4I23A 3IW5A 3PZEA 4BDDA 1WZYA 1CKJA 4BWPA 4MD9E 3U87A 4RMZA 2CLXA 3UDTA 3RJCA 2XK6A 4XRLA 2QKWB 2X7OA 4C35A 2GSFA 5CVFA 4MCVA 4ACCA 2C6LA 3C4ZA 4HGTA 4CKIA 4X3JA 3EL7A 4IDTA 2EB3A 3PG3A 2XM8A 3FI4A 3QC4A 4IC8A 4K1BA 4NKSA 3QHRA 4CKJA 4EH8A 2PUPA 1QPEA 3MVMA 2C5VA 3O51A 5CF6A 3EYGA 3TNHA 3VF9A 3C9WA 2JDVA 4KRDA 4RVKA 5ACBC 3EFWA 4R8QA 5ANEA 3PWDA 4JDJA 3ZFYA 5J9ZA 2XNMA 3MTFA 1LR4A 5FDXA 4F1TA 3RNIA 2WZJA 2QQ7A 2C5NA 4EOMA 3S1HA 1H4LA 4OTPA 3OW4A 3OXIA 3NFFB 2WEVA 2JBOA 4J99A 5AP0A 2GNHA 3RHXA 3SXSA 3RZFA 4O1PA 2DQ7X 4IANA 1Q8TA 3GBZA 4IH8A 3BWFA 2X4ZA 2XKCA 3CD8A 3G51A 3R8UA 4DHJA 2QOKA 3ZUVA 4XX9A 3H4JA 4C62A 3DBQA 5HIEA 2OWBA 3SDJA 5CSVA 4ACDA 2XA4A 4EBVA 4UMRA 4PTCA 2NRUA 2X0QA 4XLIA 3TUDA 4CFXA 1R1WA 2WTIA 2V55A 4G1WA 4XH6A 3V51A 3V5JA 3Q32A 4ASZA 2FA2A 4FBXA 3P5KA 3VHKA 3BYSA 4GH2A 3PA3A 3EQFA 4NEUA 4WUAA 2IW6A 4FTQA 4GKIA 2DUVA 4O4BB 1FINA 4I3ZA 1YHSA 1P14A 4FT3A 5BYZA 3AMBA 4NFNA 3PVGA 3TUCA 4JL9A 4HGEA 4MXAA 5T6KA 5CAQA 4QOXA 5FXSA 4NK9A 2CGVA 3QZGA 1PMEA 3W16A 3GXLA 1PXOA 2QR7A 3A8XA 5CANA 4AW2A 2WO6A 1XH7A 4I94A 5LXMA 5AP3A 4NKAA 4ALVA 5HZNA 3KXGA 4Y85A 4CYIA 2UW7A 3KREA 2XEYA 3VUIA 4I6LA 1H00A 3GU6A 2RFNA 3LCSA 4LRJA 4QYGA 3MY5A 4RZWA 2FSTX 4C2VA 2YCRA 4EOJA 2EWAA 4AS0A 1GY3A 2WTKB 2HW7A 2I40A 4IB3A 2C5OA 1W0XC 3MJ1A 4M3QA 5L2QA 4C59A 3U4WA 2B4SB 3KMWA 2BROA 4BYIA 3OUKA 4RIWA 4YURA 4PV0A 5CXZA 4J97A 2PZPA 2RG6A 2B1PA 2XJ2A 4IJ9A 4LRKA 4BDIA 3CQUA 2OF2A 2EUFB 4N4SA 1Q8UA 2YIXA 3BGQA 3HL7A 3R22A 5IA3A 3KMMA 3PIZA 2O8YA 2ZAZA 3DKCA 5C8NA 5AP5A 5DR2A 3PDTA 2CGWA 4TYIA 3FLWA 4BDBA 2XM9A 5DA3A 5CWZA 3KFAA 4YJOA 2WMVA 4C57A 3VWAA 3GU5A 4JBQA 2YIRA 4YZ9A 4FGRA 4AGDA 4BC6A 2OXDA 3M11A 3UDSA 2F49A 4HCUA 2GDOA 5CSWA 5GNKA 3CY3A 5ANKA 4AGUA 3ORIA 5FBNC 1M7QA 4WNKA 2YDKA 2C30A 3HA6A 3PTGA 4LM5A 5CSXA 3WF7A 3ZUUA 1IAJA 4V0GB 5GINE 2YJRA 5JQ8A 3BHUA 4DFZE 5C4KA 4CLJA 5F4NA 4APPA 4QPSA 1ZYSA 3QD0A 2PUUA 3DLZA 3NWWA 3O96A 3OWLA 4QMVA 3BYUA 2VWZA 3C7QA 4EOKA 4F6WA 4HOKA 5EK7A 3FLNC 3VAPA 1ERKA 1XHAA 2VWBA 5AX3A 3UNZA 4IM2A 5JRQA 4AZFA 3C5UA 4FK3A 4FOBA 4F78A 4F63A 3QGWA 4I1ZA 4OLIA 3VUGA 5BVNA 2REIA 3CBLA 3G0EA 4YJQA 3R7VA 2XKDA 3COIA 4G5PA 4IWQA 2ITQA 4QP7A 4YZNA 3QF9A 4KIQA 4H36A 4JX3A 3MA6A 4DCEA 2CKPA 5BYLA 4WG3A 5J9LA 3SAYA 4D2WA 2WHBA 2O65A 1SVGA 4UZDA 4K11A 3BX5A 1OVEA 3E3BX 3MY1A 5AIRA 3DAEA 3GU7A 1OITA 5LMKC 4QDVA 4IHPA 2VWUA 5IQHA 3BWJA 4TXCA 5EM6A 4FV8A 2QU6A 3UVPA 2GU8A 4DCAA 1PHKA 1PW2A 4BCIA 1UKIA 4H3PA 3VQHA 3LKMA 4DH7A 5JQ5A 3OBJA 2BFXA 5LARA 3EQGA 2PK9A 3NMUF 1YWNA 2EVAA 2O63A 1JAMA 4G6NA 3NVKI 4MBIA 3W2OA 4GJ3A 3LMHA 1YQJA 4AUAA 4CV8A 5CVGA 3A99A 3HDMA 3RPOA 2LAVA 3D14A 3BLQA 4QQTA 5L2SA 4I21A 3D5XA 3HA8A 4C02A 2J0JA 4CQEA 4G6OA 3NUAA 4HPTE 3JPVA 1JKTA 3BQCA 1QPDA 2BRHA 1NVRA 4ANOA 4KKGA 4EH6A 4MWIA 4O7ZA 4L42A 2R3OA 4CQGA 4DGMA 3BYOA 2BAQA 4Y5QA 3BGPA 1JBPE 2BKZA 3FLQA 4O96A 1FBNA 3ROCA 2GNLA 2VGPA 2CCHA 1Z9XA 1Q3DA 2VTLA 3N4TA 4HCTA 4DEAA 5A4CA 2FSOX 1K9AA 3DPKA 3TZMA 3F2RA 3F66A 3AT3A 4XUFA 2QOBA 1AD5A 1BX6A 2KULA 4PL5A 3ZXZA 4KB8A 1YDSE 5A54A 3PRFA 5L2WA 1JOWB 4DH8A 5H8EA 4HYHA 3V04A 3KB7A 1W2FA 2X2LA 1Y91A 4EH9A 2QOQA 1VLRA 2GQSA 5HU9A 3FLSA 4MF1A 1OL5A 2YCFA 3SXFA 1YW2A 2F7EE 3DQXA 3NAYA 4FSQA 1OL1A 4NTSA 5ICPA 1JSTA 1OKVA 4L3PA 4ZZMA 5GIOE 3UNJA 4AA0A 4L8MA 3E64A 4EYJA 5ETFA 4Y73A 4PUZA 4I4FA 4O2PA 4U41A 5HBEA 4LG4A 3POZA 2EXCX 4DHIB 4QTEA 2R9SA 4EC8A 4QMTA 3RHKA 5AV4A 4QYYA 1I44A 3LOKA 3I1AA 4FV1A 4I6QA 4MQ2A 5EW8A 2CCIA 1YOLA 3EQBA 2V5QA 2J0LA 4JLCA 4TKSA 2HAKA 1I09A 3OTVA 3WF6A 1NY3A 4R78A 4N57A 3G2FA 3I0OA 4YHFA 5A4EA 5HG9A 4FTLA 5HVKA 4ZTLA 3V6RA 2P33A 4L00A 4K18A 4WUNA 3FMLA 1YHVA 2GNGA 5AR4A 4JNWA 5AM7A 4FEUA 4BR3A 2C3KA 4EUUA 5IH5A 3ORMA 1OUYA 4O86A 4F1MA 4ZS4A 1UNGA 5DNRA 3FEGA 3P86A 4EZ7A 2VWYA 3H9RA 1UNLA 3PXRA 5HVJA 1GZNA 2JAMA 3BLRA 3EQPA 5HE1A 4ZJJA 2Q0NA 3HDNA 3DFAA 4L44A 4YU2A 3UDZA 4BKZA 3C4CA 5FG8A 3GFWA 3KCKA 4QMWA 4XEYA 5C8KA 1V0OA 3QZIA 4RJ7A 1CKPA 2GCDA 3EWHA 4X0MA 1JPAA 1EH4A 5AUZA 3L8VA 4QTCA 3AC1A 4EQUA 4O7WA 3C50A 5H8GA 1FQ1B 5CI6A 2BFYA 3R8MA 1FMOE 5LMKA 5EQYA 3MPTA 2BZKB 4WOVA 2VTNA 4KBAA 3KN6A 2O5KA 4KBCA 2XIXA 3PJ2A 1Y8GA 3QTSA 3KEXA 4MX9A 4QMYA 3U4UA 5A14A 2PVYA 5JFVA 2WQMA 4I6BA 4BCOA 4BZNA 2XZSA 3MA3A 4BBFA 5H9BA 4HVHA 5C1QB 4XG3A 2Y6MA 4GG7A 4EL9A 4G17A 3WYYA 2OSCA 3Q2MA 4FTAA 4XG8A 3WIGA 2W5BA 5J79A 5DRDA 4C36A 3D5UA 2FSMX 3ENMA 4P4CA 4UMQA 5EDQA 3W10A 2CHLA 5IDNA 4L43A 5HGIA 4B9DA 5FP5A 3TDWA 1LPUA 1ZZLA 4JR7A 5CEQA 3RK5A 2JDRA 4ITHA 2R3QA 4DBNA 5DT0A 4H1JA 4C4HA 5BVFA 4C4FA 4C4IA 5JEBA 4EUTA 2QNJA 4FV9A 3ZFMA 3DQWA 3ML1A 2W1ZA 1PXIA 3E62A 3KRWA 3BL9A 1M2PA 4MBJA 5CSHA 4AW0A 5HORA 3O8PA 3FMEA 5AP7A 1S9IA 3KXMA 3N4VA 5EOBA 2Q83A 4ZJIA 2YWPA 1OIQA 3TZ7A 4BKJA 3DA6A 4CMUA 2E9NA 3GOKA 5L6OA 3HUBA 4V05A 4TT7A 5L4QA 2BDJA 2PZIA 5HG5A 5CSPA 4FV5A 4LL0A 3MPMA 1BI7A 4LL5A 5J1VA 2C6MA 3LFNA 4TZRA 4C58A 3V5WA 3R7EA 3HX4A 3ZRKA 3V5PA 3A61A 5CXHA 3NEWA 3BU3A 5ANDA 5KMMA 5LVMA 4AAAA 4U3ZA 4X2GA 1WVYA 1XKKA 3KK9A 3U9NA 4FSZA 4IX6A 4UZHA 4XNEA 5IZFA 2WU7A 3BLHA 5HG8A 5AJQA 4QP9A 2Z8CA 3PY3A 3FMHA 3E92A 4GRBA 4FI1A 4ASXA 3M2WA 3L1SA 3BV3A 1J1BA 2C4GA 3QRUA 4R1YA 4RIXA 1H1RA 5AP1A 4E93A 3VBXA 3G90X 2C6IA 3OEFX 4X2FA 5HE2A 4TYJA 3ZMMA 3R21A 2C0OA 2UZTA 3Q3BA 3OY3A 2J0IA 4XP0A 2JKOA 4ENXA 3FKLA 2XBAA 4AZSA 3MWUA 1OIRA 3D7TB 5KMJA 1J3HA 2YCQA 2OIDA 2WMBA 2C6OA 1O6KA 3SW7A 2PVLA 5EQEA 3LQ8A 3N51A 4UMUA 2F2CB 5I9YA 4MQ1A 3E63A 2VTSA 4DEIA 5LVNA 3A4OX 3Q4TA 2ITOA 4Q5HA 3R02A 3FZ1A 3HV6A 4O0XA 4ZTRA 4M69A 2G9XA 2G2IA 2WTVA 4K8AA 1W82A 2ZM4A 3B2TA 4X2JA 5CAOA 2R3MA 4BDJA 3QYWA 3LQ3A 3ZLYA 3UVRA 1STCE 4RC4A 2P55A 4BDHA 2ONLC 5J9YA 4KIOA 5M06A 1F5QA 3FI2A 3VBYA 4NIFA 1NVQA 2XK8A 4O0YA 4QNAA 4U0IA 4DFYA 1E9HA 2G1TA 3Q4UA 3PJ3A 3EFKA 4O91A 3RP9A 2VO0A 1YXVA 3KRLA 3BU5A 4ASDA