3MVHA

Crystal structure of akt-1-inhibitor complexes
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
332
structure length
311
Chain Sequence
VTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQRPHFPQFDYSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords v-akt murine thymoma viral oncogene homolog 1 (AKT1)
publication title Design of selective, ATP-competitive inhibitors of Akt.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 311
sequence length 332
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mvhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mvhA01
5GIOE 3BYVA 2R7IA 3R2YA 4LL0A 4C4FA 4O27B 4HYUA 3QRIA 3BWJA 4ZTHA 3DBCA 5DA3A 3PVGA 2VTSA 5JGBA 2P4IA 2XCHA 3MIAA 2V62A 1TQPA 4NEUA 5ANEA 3ZFMA 5LMBA 4ZMFA 1IG1A 4LUEA 4AACA 3QGYA 2OJJA 1R3CA 5BVDA 2XIYA 3DBEA 4XCUA 3KC3A 3TKUA 3WYXA 2CNQA 5AP3A 2PZIA 4C8BA 3DA6A 3DLSA 4BDIA 1PRYA 1W83A 4XLIA 3VO3A 5DH3A 4M66A 3A61A 3G0FA 5JZJA 1IAJA 4NJ3A 4U3ZA 2GTNA 4GT4A 2W5BA 4CCBA 4FT9A 5EYMA 5I9VA 4QPAA 3UNZA 2HXLA 2IPXA 2CHLA 4D5HA 3DFAA 3TN8A 2OH0E 2R3HA 3FKOA 3U6IA 3BGQA 4AA4A 1YXUA 3K5UA 4LRJA 5IF1A 4GKIA 2O3PA 3CGOA 3EOCA 3WYYA 4PMMA 5L3AA 2Y4IB 3Q4CA 3Q4ZA 3D2KA 3RTPA 2F49A 4BCIA 4EYJA 1BLXA 4E6AA 2EB3A 4IJ9A 3GCQA 4F7JA 2C6OA 3ANQA 1NXKA 4UN0C 4EOSA 4O6LA 5CI6A 2HZIA 4OGRA 2VWVA 3MSSA 3P7BA 2ZM4A 4QTBA 3DKOA 4CMOA 2XK8A 1REKA 4GG5A 1URCA 3FZSA 4MQ1A 3COHA 3SOAA 2QHNA 1W7HA 3QTSA 4FV8A 3DJ6A 5M06A 1J1CA 4U0IA 2QODA 5ETIA 2KTYA 1JWHA 1JAMA 2ITXA 1S9JA 2XJ1A 4PPAA 4BI2A 1MQBA 4L3JA 2BRNA 1DI9A 1SNXA 4AZEA 1RDQE 3O23A 4O91A 1H1WA 3FSKA 4MQ2A 4O0WA 4YR8A 5EI2A 3EFWA 1Y6AA 3C50A 4TYJA 5A3XA 3ORNA 4RC4A 3R7YA 4YLJA 2GNHA 3L1SA 5AUZA 2QG5A 2XUUA 3R7IA 3OTUA 1Q8UA 5M4UA 2R3KA 1V1KA 5DG5A 3NUSA 4G6OA 3UQCA 2C1BA 3OROA 4AE9A 4EOMA 4JG7A 4OTFA 1XBCA 3C13A 4EKKA 2JFLA 2VGOA 4XG6A 5AEPA 3S4QA 4FL2A 1WVXA 2YDKA 5A6OA 5HORA 2XNEA 5DLSA 5DEYA 3NUNA 3FY0A 5HU3A 3MJ1A 2BZIB 4NFNA 3PIXA 2ITOA 1U54A 3GCPA 3RHXA 3MFRA 3QA0A 2VTLA 5B2KA 3W8QA 4PPCA 5ACBC 3T9IA 4AZWA 5EW9A 5JQ5A 5CT0A 3LCTA 2QU6A 4QOXA 4BI1A 5KE0A 3VF8A 5DRBA 1F3MC 1RE8A 1SVGA 2PHKA 4U45A 3ZSGA 4EK6A 5FXQA 5BYYA 3JPVA 5EKOA 5EW8A 4JBQA 2OZAA 3FKLA 4FT0A 2VTIA 1R0PA 4JVGA 4YZ9A 5FWKK 4DG2E 3VUIA 2J5FA 4MAOA 1ZOEA 4USDA 3R8PA 2B9JA 3ZLWA 2X4ZA 5HNIX 5HVKA 5L2IA 2C3JA 3BLRA 4ACMA 3S3IA 4QTDA 2J50A 5FP6A 3AMYA 3OY1A 4JIKA 2CGWA 3UZPA 2Q83A 2F57A 3ZS5A 1AGWA 2WMRA 1SVEA 1Z9XA 3UP2A 2C0TA 1UKHA 5F4NA 3TNIA 3W10A 3DJ5A 3LOKA 3BHTA 1PJKA 3OEZA 4FV5A 2ERKA 4ALVA 4ANNA 4IAZA 4G3FA 3TDVA 4IB1A 4MX9A 5IUGA 1K2PA 5AUTA 2ZYBA 4KIKB 1I09A 2PVRA 2W1EA 2OICA 3KVXA 2RFSA 5AP6A 4A9TA 1JLUE 3FDNA 2PPQA 2JEDA 2X7FA 4FF8A 4H39A 4XH6A 4UWBA 5E8VA 4GW8A 5DHJA 3BV2A 3R9OA 3RPOA 4G17A 3QTRA 4RVLA 1R1WA 4RIOA 3RZBA 4DTBA 2WD1A 4CQGA 4AP7A 1OIYA 4M97A 3T3VA 5FTGA 4V0GA 2WTDA 3PPJA 3HAVA 4ZTRA 1O6KA 3OXTA 2QOIA 4GIIA 5CQUA 4FUXA 1KE7A 1Q8WA 4FUYA 2O65A 2W1FA 4IX6A 3KK8A 2B0QA 4YMJA 5CZHA 3PA3A 3G90X 4A4XA 4CYIA 3QD0A 4JQ7A 4I0SA 4EHGA 2UZTA 4PF4A 2UVXA 4FV3A 4DFNA 3BRBA 3HA6A 4O0VA 2OI4X 3MVJA 2IG7A 2WPAA 5BUIA 4XYFA 3A60A 4MBJA 3QF9A 4QMPA 4QTEA 4YLKA 1YXVA 5AV1A 3L8VA 3HUCA 1U5QA 1TQMA 3DK7A 1ZMVA 1ZXEA 4YPSA 4KIQA 4ANMA 4QYYA 5IA5A 3TJCA 2E9OA 4RLLA 4GFMA 4OUCA 3KL8A 3ATSA 2YIXA 4QMUA 4FTIA 4WHZA 2J9MA 2UW4A 5ANDA 3G9NA 4UZDA 3PE1A 2UW8A 5HEZA 3BWFA 4F6UA 1OM1A 1LEWA 4IWOA 3KXGA 5F9EA 4OT5A 2R3PA 3OWJA 3V8TA 3PSBA 2WU6A 4D9UA 3HV7A 4YO4A 4RVKA 2ETRA 2E9NA 5IA0A 4X2JA 4Y95A 5BUEA 5CI7A 5LJJA 3FLYA 4IZYA 4IQ6A 4AW5A 2BPMA 2CLQA 5CNNA 1OL5A 3QTWA 4FG7A 4W4XA 3AGMA 5IQEA 2ZB0A 3V3VA 4A4OA 4BHNA 3SG9A 4O7TA 1OL2A 4YURA 4YSMA 4O7NA 4QP9A 2XKCA 3QZGA 2ITUA 3ZRMA 5I4NA 4ITIA 1G8AA 3C0HA 3GU8A 4YJSA 4QMSA 3HVCA 4M67A 3B2WA 3NNXA 1AD5A 4GU6A 3PXZA 4NIFA 4WSQA 5D11A 3IW8A 3TV7A 3F2AA 3R7EA 3WZKA 3R1SA 2Y6MA 3C51A 3GC0A 4IB3A 4L43A 3QD2B 4AWIA 4RC2A 2W9FB 4H05A 4RVMA 2PL0A 2YM7A 5DRDA 4S34A 5BUJA 5IA4A 1T45A 4EH6A 3CJFA 4UBAA 1PMEA 4J97A 3QUEA 4FL3A 2C5YA 2YM8A 4B99A 3E93A 3V6RA 4CTCA 3QQKA 2Y7JA 4FVPA 2PULA 3FMMA 3SDJA 2OFUA 3OCSA 3FZ1A 4K8AA 3BU6A 4G9CA 3R2BA 4K11A 2YLEA 4KSPA 3SAYA 4ENYA 3SW7A 2FSTX 3LCOA 4YZCA 5IISA 2QC6A 3C9WA 3PA4A 4JNWA 4I3ZA 5FEDA 3VS5A 4FT5A 5ANOA 4JRNA 2ZM1A 2HZ4A 2VWWA 4ZLZA 3V5LA 4K77A 3CD3A 3KRXA 1XWSA 4HYIA 3R7UA 3ZDUA 4RIYA 4CT2A 4DITA 2W06A 3TWJA 4X6RA 4L68A 4FEXA 2KULA 3IDBA 4ZMEA 2BAQA 4ZY5A 3GENA 2RFNA 4MXCA 4QPSA 4O0UA 5JGDA 3IG7A 4ZAUA 3KVWA 2C69A 3F82A 2A19B 4U5JA 3QFVA 4WRSA 1AQ1A 2W1HA 3I1AA 1YWNA 4FYNA 3W16A 5EQPA 4F08A 1PXPA 4J96A 1H08A 4CV8A 3MH2A 2WMBA 2Y9QA 4RZVA 3FLZA 4FYOA 4LM5A 1B6CB 3LMGA 3ZO2A 3AT3A 4AW0A 3QKMA 4WBBB 1JOWB 1V0PA 1JSUA 1OIQA 3ANRA 3UOKA 3V8SA 1Y8YA 2HY81 3MB7A 4IVCA 2Z7LA 3DU8A 5GHVA 4C7TA 1PYXA 1FINA 5CWZA 4BCFA 4QMMA 4FKQA 4EOPA 1OECA 4DLIA 4MK0A 3F88A 4UV0A 2UW3A 5E92A 4ZTNA 1UA2A 5JKGA 1FVRA 2WMUA 5J7HA 2W1DA 4FT7A 2OW3A 4B8LA 1ZRZA 3UP7A 2XIRA 4ORKA 3LJ0A 4L44A 5ETCA 2CKQA 3O71A 4ASZA 1H0VA 3NS9A 3W2CA 3Q9ZA 4KINA 3D7TB 5AMNA 4P4CA 4D28A 5CEPA 4YJQA 2RG5A 2YCRA 3UPXA 1TVOA 3POOA 3U9CA 1UNGA 3BHVA 3M2WA 1XH5A 3MIYA 3U87A 3KF4A 4G3EA 3NMUF 3UPZA 2Z7SA 3FLWA 4AZFA 2JKMA 3L9MA 1PXOA 3K2LA 1Q41A 4AOIA 4F99A 5BVNA 2VTOA 4GK2A 1WBTA 5IQHA 2RFEA 4D4SA 4WKQA 3RALA 2PU8A 1NVSA 4E8AA 3A2CA 4JBOA 5ANIA 1ZMUA 3A7FA 2GNLA 2O64A 2QOKA 3F5XA 4IAKA 4TNBA 4CZYB 4DEEA 3C5IA 4DE4A 4PDSA 3R00A 2J90A 4ZZMA 3DQWA 1CDKA 5J9LA 4FZAB 5J79A 1IA8A 3A4PA 4IC7A 4XJ0A 5HLNA 1GY3A 2ZVAA 4IVBA 4CKRA 2BKZA 3DAKA 3JXWA 3P86A 4X2KA 3TM0A 1BUHA 3CC6A 2QD9A 1YW2A 2IW6A 4WUAA 5J87A 4DH7A 3D5WA 3MY1A 5LVMA 2PVHA 5GINE 1Q97A 3H10A 5F95A 1DAYA 3HDNA 4GEOA 3PFQA 4FKWA 3G51A 3JY0A 4GSBA 4BGQA 4EHVA 4EZ5A 3EKNA 4NKAA 4DG0E 2EXCX 4QMYA 3UQFA 3EN4A 4NM5A 1H1RA 1WBPA 4ZS0A 5AR3A 4DG3E 2WMTA 2I0YA 3EWHA 3O7LD 4BTMA 3R9HA 3NVMB 3RCJA 5HG5A 3HV5A 5AUUA 4FIFA 2YACA 3ORLA 3AC3A 4YTIA 3LPBA 3WARA 5AR4A 5HX8A 2JITA 2RKUA 4YC3A 3EL8A 3W1FA 4ZSLA 4RX5A 5HNGA 1R39A 3Q2JA 1RJBA 3VRZA 4KIOA 1YWVA 1YQJA 5DT3A 4LG4A 2CDZA 2JBPA 4RLKA 3CE3A 3CPCA 1FVTA 3LCKA 4G34A 5EHOA 5M4FA 2BHHA 4NKSA 3MPTA 4AT3A 5KMNA 1WBNA 3F3TA 1YRPA 3UVRA 3MB6A 5CT7A 5HU9A 2HW6A 2OXXA 3I5NA 3T3UA 4DCEA 3AGLA 4E20A 5K5XA 4E5AX 3S2PA 3ET7A 2J0MB 1BL7A 5EQEA 4PTGA 4RVTA 4D0WA 2ZMDA 4PDPA 5IQDA 4ASXA 3NLBA 4G5JA 4EUUA 4RFZA 5FDPA 3PLAE 2BAKA 2ZV7A 3HX4A 3AD4A 3DZOA 4F1OA 4P7EA 5LWNA 5AV2A 2I0VA 3UQGA 2B9HA 3VS3A 4IAIA 3IW7A 4FODA 3ZC6A 5DR6A 4ENXA 4TYGA 2ZOQA 4KBKA 3I6WA 3K54A 4YJPA 3GFEA 3E8NA 4BDKA 4RQKA 1RW8A 5IH5A 3RK7A 2OG8A 2JKQA 1NVRA 3KXMA 4QTAA 3D14A 1Q3DA 4UZHA 2BALA 2V55A 4K9YA 4R3CA 4YLLA 5FEQA 4E4MA 4KB8A 1OKVA 1UU9A 3POZA 4X3JA 5LVOA 4I5MA 2WQMA 3QWJA 4R1YA 2WTKB 3DBQA 4W9XA 2OIBA 5D7AA 4DN5A 4E3CA 3MH0A 3RJCA 2HXQA 4EI4A 1BL6A 3C5UA 3ZM4A 4BR3A 4CG9A 2WOUA 4FTQA 3O96A 2Y0AA 3BPRA 4M0ZA 3WIGA 4FG9A 1WFCA 4FIEA 4EQMA 4HVIA 4FIHA 1F5QA 4O0RA 4CFVA 2X9FA 3QZIA 4S31A 4ZK5A 3T8OA 1A06A 2XM9A 4YHTA 4X6QC 3O50A 3QTIA 1VEBA 3G33A 5L6OA 4DH8A 4L42A 5AV4A 4AOTA 4PP9A 3L9NA 2J0LA 4XG4A 2DS1A 2W4OA 2YAKA 4QQTA 2XM8A 2DUVA 2WMSA 3SX9A 4X2FA 4FVRA 4ACHA 2OWBA 5TOZA 3BU3A 5IQAA 4IDVA 1YI3A 4YNEA 3HMNA 4KNBA 4EH3A 3GC7A 1ZZLA 2GS7A 3AT2A 4IXPA 1JQHA 5K4IA 1ZY5A 5TF9A 1GIJA 2WOTA 4FV1A 1ZARA 4HNIA 4BYIA 4ZY6A 5DPVA 3EN6A 5CENA 4MWHA 4D58A 4XHKB 3IQ7A 3Q6UA 4ANBA 2NNWB 3HP2A 4YJRA 4RPVA 4NL0A 4CFXA 3UNKA 4RA4A 1Q24A 2WMVA 4QMQA 2BZKB 4WD5A 1P5EA 2C1AA 4EYMA 3ZFYA 2GNJA 2UW6A 4F7SA 4U81A 5A46A 4I23A 1IASA 3GFWA 3U4UA 5CAUA 4EJNA 3Q60A 4I5CA 2ITYA 5FM2A 3D7ZA 5TO8A 4C33A 4C3RA 2FH9A 4KIPA 4F9CA 2I7QA 3G9LX 4G5PA 3WE8A 2A1AB 2C5VA 2V5QA 3ODZX 4JX3A 2CLXA 4ZJIA 5E90A 3TNPC 4DEAA 4O81A 3LJ2A 3B8QA 4RJ4A 4JL9A 1DI8A 4D2SA 5JMSA 2QO9A 4O38A 4CCUA 5L8KA 3S1HA 4FIIA 3U55A 4E6CA 1XH6A 1PXMA 4I4EA 5CYIA 4RFMA 5EI6A 4EOIA 4B8MA 4C38A 2ZB1A 3UYTA 4K33A 4X3FB 4AG8A 3H30A 2WQOA 4RA5A 2OKRA 5G1XA 5HKMA 5FXSA 1U46A 3SRVA 3VJNA 1YOMA 4KAOA 1KOAA 3M42A 5JFVA 2PVLA 3R6XA 4JAIA 3RAHA 4EK8A 1Q8TA 3FZRA 3JS2A 2BKKA 4BCPA 4B9DA 4JAJA 4EZ7A 3FEGA 3FI8A 2X9EA 3EQCA 5E8XA 4EQUA 3HECA 2W17A 3AC4A 3UO6A 1M52A 4YZBA 3OOMA 4MNEA 2X8EA 4AZTA 2I6LA 1YOJA 3MH3A 4IAAA 2CGUA 3MFUA 5CAPA 3DFCB 4FGBA 5M53A 3BCEA 3HZTA 4BDJA 4O86A 4CMTA 2ACXA 4FKVA 1M7NA 3O51A 2QR8A 3FLNC 4ONAA 4ASDA 2O2UA 2OJGA 3G5DA 4DEIA 3LFSA 3ORMA 3TTJA 2CCIA 1Q5KA 4A06A 4TT7A 2BDWA 2CGVA 5E8UA 3OMVA 5L2QA 2UZNA 5HG7A 4ACGA 3QA8A 3F5GA 3AOXA 3BGPA 3D0EA 3V5TA 3W2RA 5LWMA 4DT9A 4QP3A 1JKTA 4JBPA 4YHFA 4GFOA 4QYEA 3PJCA 4ZXTA 2RFDA 4ALUA 5IQIA 2W5AA 4XG9A 5I5ZA 3Q53A 5FUTA 3JVSA 3ERKA 4EK4A 3NAXA 3WBLA 1GZNA 4RWIA 4IEBA 1PXIA 4UYAA 2OIDA 2R3QA 2SRCA 4FSMA 4C57A 4FKLA 4USEA 4APPA 3NGAA 2EB2A 4BCNA 2GNGA 4QQCA 5ITAA 4FGRA 5IH4A 4W8EA 2FSLX 2QKRA 4C4EA 3WZJA 5AIRA 3C0GA 4IZAA 3AC8A 3FE3A 4HZRA 1URWA 4QMXA 4BL1A 3DB6A 3Q32A 4C4HA 3R1QA 3A8WA 3AD6A 4QQ5A 5IA1A 3VQUA 5KHWA 5M4CA 2JIUA 4M15A 5A54A 5HTCA 3LAUA 4JXFA 3RBWA 2X39A 1XHAA 2XNGA 3A8XA 2CJMA 2DQ7X 2PZPA 2X2MA 3R1NA 4N4SA 2C47A 4FZDB 2Z02A 5IDNA 3M1SA 5IEYA 4BICA 4JOAA 3FPMA 5IA2A 2YCQA 3UIBA 4BDEA 5A4EA 3GOPA 4ZJVA 3GT8A 4AZSA 3ALOA 1W98A 4IACA 4FIGA 5FBNC 5CVHA 2YLFA 1PF8A 5KHXA 1ZYCA 5AP2A 2HWOA 2VX1A 4PMTA 2YITA 4P2KA 4NCTC 4WNKA 4Z7GA 3M11A 3PJ1A 3R8ZA 3CCNA 2OLCA 2J0JA 5GIPE 2W05A 3MW1A 4IWDA 1G8SA 4U79A 3F3VA 5DWRA 4BZOA 2WB8A 3FV8A 3EZRA 3BHHA 3VJOA 3SW4A 4DYMA 5C27A 2X0GA 5L8JA 3QX4A 5HD7A 4BGHA 4F9BA 5EM8A 4BDFA 4KD1A 5D9HA 3V5JA 3F2NA 3IS5A 4QP1A 4ZSJA 4U44A 3W2OA 4YJUA 2PVKA 3UMWA 2R3MA 4FTRA 3GNIB 4AXAA 2C6EA 3ULZA 2FB8A 2ITPA 5I0BA 4RG0A 3KXXA 4FICA 4YC6A 3U8WA 3MESA 3F69A 2WTWA 2HZNA 4ZTLA 5A14A 1APME 2BTSA 4DC2A 3QCSA 3HAMA 1XQZA 3QC4A 4L01A 3C4WA 4WBOA 1UU3A 4BCJA 1PYEA 2E9PA 5FDXA 1PKGA 3C4FA 3DCVA 1KSWA 3AG9A 4JQEA 4MD8E 5LOHA 4DA5A 5DN3A 4DFZE 3D5VA 4MH7A 2GCDA 1OPKA 2F2CB 2H9VA 1OKWA 2F7EE 2HENA 4KA3A 5IZFA 4BCKA 2Z7QA 3VN9A 4HYSA 3JR1A 2B53A 3JYAA 2HCKA 3NIZA 4GIHA 1YVJA 5K0XA 3QD4A 3KMMA 4FSUA 3MWUA 5CSWA 4PUZA 2GNIA 2J2IB 4WG4A 4M69B 2W1ZA 3SVVA 5E1SA 4NU1A 5IMEA 1ZOGA 1ZYJA 4EOOA 4J99A 3OXZA 5CEKA 5HZNA 4YBJA 3DXNA 5HE2A 4E6DA 3ZBFA 3NDMA 3FYKX 5LMKA 2QLUA 2QOBA 2QURA 5AA9A 3WILA 4ALWA 1UNHA 4RX8A 2C68A 3RGFA 4FV6A 5BPYA 3W55A 2IVUA 4Y85A 4DFBA 4UMTA 5AM7A 4O0TA 5FBOA 3F9NA 5J8IA 4DH5A 4CFWA 2QU5A 4B0GA 4DH3A 3R9RA 4ZTQA 2C5NA 3QAME 3HRBA 1OKYA 3VVHA 4CGAA 4WA9A 2P33A 4O1PA 4AS0A 4DGMA 3BLQA 3VUTA 3I79A 3H9RA 2REIA 4XRJA 3DOGA 4OTPA 3BZ3A 2IVTA 2UW0A 5C8KA 2YISA 1BX6A 1VYWA 4M3QA 4Z9LA 4L53A 4S30A 5LARA 4PP7A 4OBPA 3BLHA 4O84A 3CPBA 1UWJA 4O7VA 4MNFA 4BYJA 2YIQA 3EYGA 4U43A 4R78A 3FMHA 5FLFA 5KCVA 3UTOA 2CMWA 4CNHA 1GOLA 4FKPA 4WG5A 4XRLA 1O6YA 2AC3A 2RIOA 1H8FA 3MN3A 4HZSA 4UY9A 5F20A 3VWAA 3PPZA 4C4JA 4F0FA 4ZY4A 3HRFA 1KUTA 2JAMA 2UUEA 3MA3A 4AN9A 3DPKA 3LLTA 4QMWA 5CNOA 4NJDA 4NM3A 3E64A 4EH4A 2WELA 2XNPA 4OBOA 2OH4A 4S33A 2CNUA 4L7SA 1IR3A 4AGDA 4S32A 3VBWA 2NRUA 4GU9A 4AW1A 4RJ5A 5EW3A 3ACKA 1Q62A 3ZLSA 4L9IA 1PXJA 4OBQA 4XG2A 4IE9A 1UVRA 4KIKA 4FKGA 4CLJA 4HGSA 4GJ2A 3PXQA 2JLDA 2X81A 5CVFA 4H1JA 5AUVA 3NX8A 4M8TA 5C4LA 3E92A 4G2FA 4XBRA 3KA0A 4C34A 2JC6A 3AD5A 2RGPA 2X2KA 2I1MA 3EFLA 4FV2A 4Q5EA 4YJNA 4C2WA 3BEGA 2WTIA 5JGAA 5D41A 4GYGA 4HGEA 5CVGA 3ZFXA 4AW2A 4D2WA 5BNJA 3MDYA 3EN5A 3ETAA 4FV4A 4G3DA 4GRBA 4DGLC 3GC9A 4NT4A 3AC1A 3ZXZA 5AWMA 4Y5HA 3VUKA 2JDTA 2GMXA 1EH4A 3W2QA 1TQIA 4FKJA 1FBNA 2VO0A 5CU4A 3WE4A 2PVMA 3FC1X 4IAYA 4UWCA 3G15A 3DKFA 3KQ7A 4QMOA 2WMWA 2R3NA 3GQIA 2W7XA 3CR0A 4WSYA 3BYMA 4C37A 3QX2A 4OTRA 4CV9A 3F61A 3HV6A 5EM5A 5K3YA 4ZSEA 3VS7A 1L8TA 2VZ6A 3IK3A 1JVPP 3PJ2A 4I93A 1FGIA 3VUGA 5KNJA 1PXLA 4UXQA 5JEBA 3I7CA 3PLSA 3QUDA 4CKJA 3KULB 1SZMA 3BELA 4UYNA 3ENMA 3E7VA 3REPA 3BYOA 3BX5A 4R77A 2H34A 4KSQA 2XP2A 3HMIA 3A7HA 4FL1A 4C35A 1BI8A 3RZFA 3ZTXA 3TT0A 2QLQA 3CTHA 2R64A 5CU0A 4M13A 1NVQA 1FQ1B 5EM6A 2X6EA 3FJQE 2WU7A 4AFEA 4UMQA 2VWXA 4BC6A 2BFXA 5AX3A 4X2GA 4FSNA 2G15A 2BZHB 4GMYA 3WZDA 3ZZWA 2JGZA 4U80A 4ZOGA 1OI9A 2IWIA 3FL4A 4PPBA 4CYJA 1ZWSA 2XK4A 3CLYA 3H0ZA 1U5RA 3KGAA 1OKZA 3NCZA 4JR7A 3ORPA 3HKOA 4FI1A 3COIA 5H8GA 4APCA 4P5ZA 5LXMA 5E1EA 4RIXB 4AT5A 4ASEA 4AAAA 3H0YA 2WQEA 2IVVA 4JDHA 2PVJA 4HGLA 3ZDIA 3QLFA 3HNGA 4FTTA 4NM0A 3QALE 3CP9A 3QQHA 4NUSA 4R8QA 4AA5A 4OAUC 3GI3A 5IQBA 1Y91A 5A4CA 4LV8A 4C02A 3RINA 3TZ7A 3UE4A 3GU6A 3IPHA 4HGTA 3PE2A 5GNKA 3W33A 4DTAA 4DLJA 1XBAA 2X7GA 4MXOA 2HZ0A 1VJYA 3RWPA 3UOJA 3CQWA 4G9RA 2X2LA 3V8WA 2RL5A 5CSVA 2JDRA 2I0EA 4W4YA 5EQYA 3QL8A 4AN2A 3F66A 4WIHA 1JKLA 3EQFA 4JX7A 3G0EA 2B55A 2YM3A 2B9FA 5M09A 4FTCA 5T3QA 2RG6A 4C36A 2HY0A 3PP0A 4KBAA 4IH8A 3EKKA 4M68A 3ZMMA 5IA3A 5KUPA 4ZP5A 3VHEA 3BV3A 4I5HA 4AX8A 1A48A 3NIEA 4L7FA 4U40A 3DNDA 3BU5A 2QHMA 3MTLA 2VTNA 3A7IA 4I22A 4D4VA 3TDWA 2OO8X 4GJ3A 4F1TA 3VQHA 4O7WA 3QUPA 4FK6A 3C4EA 4ZIMA 2QO7A 4XV1A 1OPJA 3ENHA 1SYKA 2YHVA 3GXLA 5LCKA 4ZEGA 4IX5A 4IVAA 4LGDA 5EM7A 4C4IA 4UMRA 1ATPE 5LVPA 2V0DA 1ZYSA 5CX9A 2W4JA 3F3WA 2VTMA 3R7VA 2BVAA 3BHUA 4O2ZA 4GT3A 1OMWA 3NUXA 3UG2A 3OCGA 5KMKA 2VWYA 4N57A 3PZEA 4OTHA 3DS6A 3QD3A 4U3YA 2PE0A 4E93A 3GU4A 5DI1A 5HQ0A 1REJA 4DCAA 3G6HA 1P4FA 4QYGA 3E3BX 4TZRA 4FTKA 2C0OA 5EYDA 3OFMA 5I9WA 3RKBA 2XEYA 3D7TA 3VS6A 5AUYA 5EDRA 5JRSA 4USFA 3KMUA 3ZUTA 5CS6A 2F7XE 3GGFA 3MVHA 4EOKA 3QTUA 4O7RA 4IM2A 5J5TA 2R9SA 2UVZA 4AUAA 4TYHB 4FSTA 3K3IA 4FNWA 4O0XA 2YDIA 3ZBXA 1SMHA 3FLQA 4IBMA 3RPVA 1J7UA 4BKYA 2J6MA 1MP8A 4GFGA 2PZYA 4R7IA 4UEUA 3EQBA 3KEXA 3P9JA 4O21A 4BDBA 2F7ZE 4YJOA 5L2TA 2PMOX 1DM2A 2XRUA 2Z2WA 3P7AA 3TNHA 4DT8A 4R1VA 3MH1A 5H9BA 4MKCA 3FHIA 3I5ZA 4MF0A 4E5WA 2Z7RA 5EHLA 4ANSA 3N4VA 5C01A 3F5PA 2XVDA 4KRCA 5HBJA 2XNBA 3NW5A 3W8LA 2OZOA 3F5UA 2C3LA 3NUYA 3UO4A 3HGKA 4QP2A 1H1PA 2WO6A 1V0OA 3CY2A 2OF4A 4QP4A 3A7GA 4PTCA 3Q5ZA 2W5HA 3I81A 5HO7A 2CKEA 5B2MA 5J1VA 5CEQA 3PDTA 4R5YA 3AXWA 5B7VA 1J7IA 4JIAA 4X0MA 1UU7A 3EQPA 4HJOA 4IB5A 5HHWA 3TL8A 4CMUA 4F7NA 2YWVA 2G9XA 2WTCA 3O7LB 3RHKA 4DFXE 1UU8A 4H3PA 3ROYA 4TN6A 4BDHA 4YSJA 1MRVA 4Z16A 5JH6A 2JD5A 3V01A 1PY5A 3BE2A 3O8TA 4A4LA 2IZUA 4FTUA 4A9YA 4AGUA 1H28A 3GQLA 3DB8A 3ZO3A 3KMWA 4FV7A 4HCVA 4J52A 5CZIA 1M14A 4U7ZA 4GKHA 3CQUA 2UZWE 4KS7A 3QYWA 2X6DA 3LFAA 5EDQA 3A62A 3TKHA 2C6IA 4CVAA 4FOCA 5AADA 4QMTA 3A99A 5I3OA 4QNYA 5AIKA 4O7ZA 2JIVA 2PMNX 5IQGA 4PL3A 3E87A 4B6LA 4AF3A 1ZYLA 3TNWA 3NNUA 3QQJA 3OZ6A 3MGYA 3TXOA 5HCYA 4IWPA 2Z60A 2Y6OA 1P2AA 1YXXA 5M56A 1CKPA 3OCBA 4ZZOA 1K9AA 5HNBA 4FNXA 3ZSIA 3CGFA 3FHRA 3WF8A 3KKVA 1TKIA 1Q3WA 3ZOSA 5AV0A 4CLIA 4EKLA 3JUHA 5IG1A 4PX6A 3RMFA 2RF9A 4BKZA 4BTJA 4J8NA 2LAVA 4EBWA 2GQSA 4F6SA 2EXMA 5A9UA 3IGGA 3UIMA 4KWPA 1PMUA 5KMMA 3W2SA 2XBAA 2VX3A 3OVVA 2WMQA 5FEEA 1UKIA 1ZYDA 5HVJA 4ZLYA 3FZPA 4C59A 4QNAA 4ZLOA 2GDOA 1NW1A 5FG8A 3ZYAA 4E26A 4IM0A 2ZJWA 5CY3A 3E8CA 3KXNA 1LUFA 2XH5A 4TYIA 3QCYA 3KFAA 4FOBA 1IRKA 2UZUE 3ITZA 2R3GA 3COKA 1WVWA 2FO0A 4PWNA 5AX9A 2IN6A 5GJFA 2A27A 3LHJA 2B7AA 3QU0A 2DYLA 3EN7A 4A7CA 3QHRA 3IGOA 4TPTA 2QOHA 5TE0A 3BHYA 3VS4A 1X8BA 5AP1A 4A9UA 4ERKA 4DHFA 4YZMA 2W96B 3N9XA 3MTFA 3HP5A 2XA4A 5B2LA 1E1XA 4FEWA 3SG8A 1WBSA 5D1JA 3SV0A 4C4GA 4J7BA 4QQJA 4IDTA 5CXHA 5IKWA 2AC5A 3F7WA 5JT2A 2VV9A 5EFQA 1W0XC 3ORXA 4DBXA 3W18A 4E1ZA 3PVWA 1KE9A 2EUFB 2J5EA 3Q5IA 2FGIA 3RK9A 3UZRA 3NEWA 4V04A 3VS0A 4GH2A 4NK9A 5HO8A 1FVVA 3V04A 5C1QB 4LYNA 4LOQA 2YZAA 4FMQA 3II5A 3TACA 4BGGA 3E5AA 3AC5A 3WF6A 3IOPA 5GZAA 3U6HA 4RIWB 4OTWA 2QOCA 4WO5A 4OTGA 5CU6A 3RAWA 3OBJA 1H4LA 2O8YA 2WFYA 2XKFA 4ITJA 4AE6A 3ZONA 2UZDA 5DR9A 2WTKC 2C6MA 2OJIA 5EYCA 5HD4A 4JJRA 2OXDA 4AFJA 2BRHA 2G2IA 2ONLA 5KBRA 4BY9E 4I5PA 2W4KA 4NTSA 4BWXA 3UDBA 4FKUA 2JAVA 3C1XA 4O2PA 3UZTA 2WMXA 3OHTA 5BVOA 5M51A 3GBZA 3ATTA 3IONA 3FZOA 1SVHA 3VBYA 4MD7E 5M57A 3RP9A 2WQBA 5KKRC 3BGZA 4YJTA 3VBQA 3R01A 5GJDA 3NVKI 4ERWA 5CANA 2P55A 4DEHA 2C30A 4TKSA 5J95A 5AR8A 2H96A 4QP8A 4X3FA 3VS2A 5L8LA 2V7AA 5JZNA 3PZHA 4KRDA 3SXRA 3DAJA 4CZTA 2A4LA 2QQ7A 4QPMA 4H58A 2OXYA 3RNIA 5DBXA 2FYSA 4F09A 5M4IA 4I94A 3D5UA 4UX9A 3I0OA 3IOKA 3KU2A 3COMA 1JKKA 1OGUA 1XH4A 3VW8A 5E91A 2XB7A 5C8MA 1XBBA 2WEVA 3QXPA 1MQ4A 1H24A 2W9ZB 4RX7A 2VO7A 3NYVA 3HYHA 4ZTMA 3DAEA 1WVYA 3PXFA 2WTJA 3DQXA 3OWPA 4GG7A 4HNFA 2WMAA 3OBGA 3PIYA 1Z5MA 1KOBA 1XH9A 3KN5A 4LL5A 2P2HA 4BB4A 4LMNA 2CGXA 2UV2A 2B1PA 4OTIA 3QQUA 3HEGA 3L8XA 4E4LA 3NNWA 4KUJA 3IDCA 3KY2A 3NYNA 4BBMA 3HV4A 4HVGA 3N4UA 2XNOA 4WT6A 4WNOA 3DBFA 3LM5A 1XH7A 4F64A 5CAQA 4ARKA 4XV2A 4XG3A 4W4WA 3ZCLA 3ZXTA 1YXSA 5T6KA 4I6BA 3E7OA 1HCKA 4DH1A 3EB0A 1YI6A 4G31A 4MXXA 1J7LA 3QBNA 4V01A 2WQNA 3LFBA 5LCJA 2ZV9A 3NRMA 2ZMCA 4FVQA 5BYLA 4G16A 3P79A 1F0QA 2W1GA 1LP4A 4GVAA 4IB0A 5GJGA 4I24A 1J91A 2EXEA 3QTQA 3NUPA 4LGGA 3UODA 3FQHA 2PZ5A 4C3PA 5HIDA 3HRCA 1GIIA 2Z8CA 4FNYA 4G6LA 5J7BA 3FI2A 3VUHA 4BTFA 3QQGA 5IQFA 5BVEA 5FTOA 1KE6A 2F9GA 4G1WA 5DNRA 4BVUA 4D2PA 5A4LA 4LI5A 5D7VA 3Q04A 4FSRA 2WIHA 5CU3A 2HAKA 3HMMA 5E4HA 4LFIA 2H6DA 2GFCA 5CALA 2XF0A 3QGWA 4L00A 3LCSA 3FUPA 1PKDA 2XK3A 4W4VA 4CQEA 4F63A 4JDJA 1BYGA 4D1ZA 1O9UA 4GYIA 4NW6A 4MTAA 3C7QA 2UZEA 2X7OA 3Q4UA 3KRWA 3I6UA 3EFKA 2J0KA 3D4QA 2VNWA 3DZQA 2C6KA 2NO3A 2XKEA 3LQ8A 4LRKA 5AP4A 3HV3A 1UNLA 5BMSA 4H36A 3DY7A 5K9IA 3VIDA 2GTMA 4O22A 3TIYA 1KWPA 4TNDA 4R6VA 3HA8A 1Q4LA 4FA2A 4D5KA 3FMDA 3OG7A 2VTTA 4KKGA 3DDQA 5FP5A 3UIXA 5EDPA 1JBPE 5EH0A 1H00A 5EK7A 4PQNA 4FZ6A 1G3NA 5CSPA 5HESA 2YERA 3VBXA 5EKNA 2ITVA 1XR1A 4RWLA 5I9YA 4GT5A 3B2TA 4FEQA 4HYHA 2PMIA 3HUBA 3R7OA 4JG8A 4II5A 3CY3A 4KKEA 1O6LA 4X2NA 1CTPE 4D1XA 3G2FA 2VTJA 3DK6A 5DGZA 2IZTA 5H8BA 4BZDA 3NUUA 5ACKA 1OB3A 2HW7A 3D83A 3DKGA 3LW0A 1OIRA 2WEIA 1BI7A 3Q4TA 3OWKA 3ODYX 4BCOA 3ZZEA 3TI1A 4GUEA 4U42A 3AT4A 3FQSA 3PXRA 4YTHA 3FWQA 3LMIA 2UW9A 4JDIA 4O96A 4FG8A 5AJQA 5LQFA 4I0RA 4BI0A 4EORA 4CG8A 4Y83A 1YKRA 2QO2A 2CSNA 4HPUE 3FMJA 1LR4A 4KABA 3QHWA 3ZLYA 3TCPA 4GVJA 4M12A 4EOQA 2HELA 5J9ZA 4RRVA 4BWPA 3EJ1A 4YNOA 5GZ9A 4CFUA 4FZFB 3L9PA 2YM5A 3BBTB 3WI6A 4O7LA 1OUKA 4HVDA 4L45A 4ZSAA 4U41A 2IVSA 3TEIA 3UJGA 1NA7A 1P4OA 1PMVA 2PVYA 4UB7A 3V5PA 4D1SA 3VBVA 4FTOA 4FTAA 5LVLA 1WMKA 3PY0A 3P7CA 5HLPA 5I3RA 5HIBA 3N4TA 1H1QA 3QYZA 4QP6A 5EG3A 4PMPA 4AGCA 2PZRA 2O5KA 3VHKA 3DXPA 2VO6A 1H0WA 2X8DA 2J0IA 3PWDA 4PL4A 4BN1A 4E6QA 4YTFA 2WHBA 2XK9A 1WBOA 3GEQA 4FR4A 4H1MA 3TZ9A 4CXAA 3IECA 2BRGA 4M69A 3QCQA 2JKKA 4ZZNA 2R3LA 4AU8A 5G6VA 4D4RA 4HCTA 5JSMA 4XV3A 5HO6A 1ZY4A 2O0UA 4FBXA 3F3ZA 5KMLA 3ORZA 1W84A 2ZDTA 3LFFA 3DK3A 4MVFA 4DEDA 5F94A 4AGWA 2R5TA 4PTEA 1ERKA 5AR5A 4IZ5A 3DTWA 4WUNA 5EYKA 3PVUA 5BVKA 5K0KA 4XUFA 3MPAA 4CFNA 2A2AA 3FSFA 4QMLA 4CD0A 4PDYA 4XLVA 5AR2A 4DAWA 1FOTA 4C2VA 4XX9A 5KO1A 3NZ0A 3LXKA 5TT7A 5KMOA 1M2PA 2VWIA 1HOWA 2OIQA 2BDFA 2QOQA 3ROCA 4BTKA 5LVNA 3LCDA 5M44A 3GVUA 4G6NA 3H9FA 3D15A 4FKSA 2WNTA 4RJ8A 2R0UA 5DOSA 4O0YA 3F2RA 3P23A 3AC2A 3LFNA 3I60A 2GU8A 3OEFX 4V05A 4Z7HA 5J9YA 1OL1A 4GV1A 1V0BA 3ALNA 3CTQA 1YDRE 5KMJA 4GK4A 2BTRA 4G3CA 2Y4IC 4HOKA 3HMPA 4RJ6A 3HDMA 4UXLA 5H8EA 4ANQA 4E4NA 2YIRA 2CKOA 2VWZA 4EJ7A 5HTIA 4Z3VA 4TWPA 2WZJA 2BUJA 1FGKA 5FQDC 4UMPA 3RI1A 4W9WA 1KV1A 1M17A 1ZLTA 2VX0A 5E8WA 2VTPA 3DV3A 2CN5A 4L6QA 4IVDA 3O2MA 5IPJA 3QC9A 2YWPA 1H26A 2R3OA 2XIZA 4D9TA 1H07A 5HE3A 1Y57A 4K2RA 1B38A 4A9SA 2YJRA 4CTBA 3FMKA 3MJ2A 3Q2MA 5AAGA 2H8HA 1E1VA 3ZU7A 5HVYA 3PSCA 2JIIA 4RZWA 2ESMA 4IC8A 4XG7A 4F0IA 1LPUA 3PXYA 2BIKB 5H3QA 4FK3A 3P1AA 4BIEA 5DMZA 1H1SA 4FSZA 3PWYA 1JSVA 1YOLA 3RCDA 4ACDA 3LMHA 3NUAA 2C3KA 4FE2A 1OL6A 1Y8GA 1SM2A 1OVEA 4TTHB 3KB7A 3L8SA 4J53A 5CSHA 1OBGA 1ZZ2A 5LMKC 5J1WA 5E8YA 3RPSA 3R71A 4IADA 3UIUA 4Y46A 2XKDA 2VAGA 1OPLA 4JQ8A 3K5VA 3KREA 2ITWA 2WGJA 1MRUA 2ERZE 3LQ5A 4IFGA 2RSVA 2V22A 2PVFA 5AUWA 4YP8A 4MBLA 2BHEA 4OR5A 4QRCA 2ZM3A 4JBVA 3PYYA 4NH1A 2IW8A 4EWHA 3PG1A 5JRQA 4TWNA 4MHAA 3PA5A 4RJ3A 4HCUA 3R63A 4I6FA 3ID6C 5HCZA 3R30A 2BDJA 3GP0A 2HK5A 4FKOA 5B0XA 2FA2A 3NW7A 4QD6A 3RM6A 4FEVA 5E9EA 2J51A 2C5XA 3MV5A 5IH6A 3KN6A 4YHJA 4BDCA 4B4LA 3ULIA 3UG1A 3TUCA 4I4FA 5BVWA 2PUPA 4L3PA 2QONA 4XNEA 5BQ0A 3LFCA 5M08A 3OXIA 2QCSA 2QKWB 3EQHA 4FTMA 2R4BA 3EFJA 3MFTA 3MYGA 3OT8A 3OUKA 4FV9A 4BZNA 1T46A 1QPEA 1QCFA 3GOKA 4JR3A 1H01A 5FRIA 2QNJA 3TUBA 5HI2A 3S00A 1IEPA 2W0JA 5DVRA 2JFMA 1U54B 4QT1A 4A9RA 4DGGA 4RX9A 4FSWA 3GCSA 4Y5QA 3KULA 3PJ8A 3CKXA 2Y8OA 2C5OA 3BI6A 3OP5A 3ZSHA 4E5BA 2OBJA 3QZFA 5AA8A 2PE1A 4XOYA 5KBQA 1H25A 5D12A 3VF9A 1DS5A 4WRGA 3U4WA 4ITHA 2OZAB 3OY3A 5CF5A 4LOPA 5HG9A 2ITQA 5C4KA 2EVAA 4U9AA 5AAFA 4CKIA 3UVQA 3ZO1A 4DINA 3TV6A 4YPDA 3MY5A 3RAKA 4YTCA 3FLSA 3OS3A 2CCHA 3OT3A 2G2FA 1K3AA 2YDJA 3QRTA 5DEWA 3BIZA 3RNYA 3TIZA 4M14A 1JKSA 4EH5A 4DTKA 1P14A 5HG8A 5LMAA 4ZS4A 2ITNA 5FXRA 1ZAOA 2Q0BA 3NR9A 3TKIA 5BX0A 4UMUA 3RM7A 3V5QA 3O0GA 3RWQA 4F1MA 3LFQA 1NT2A 3QKKA 2PUNA 5CEIA 4RIXA 1CKIA 4IX3A 1QL6A 3PY3A 3WZUA 1BMKA 4F9WA 3CXWA 3WOWA 4EOLA 3BQRA 5IEVA 4BHZA 1KV2A 2X1NA 2BMCA 4K6ZA 3PRFA 2E9UA 3E63A 2XK6A 3Q6WA 4K18A 3RPRA 3QTZA 4RJ7A 3TV4A 3R9DA 3CKWA 4D2VA 4PDOA 3V6SA 1OITA 5HBHA 3EMGA 4BCGA 2FSMX 4NYEA 3BYSA 5JFXA 3TZMA 3IW4A 4WG3A 4V0GB 3RVGA 1MRYA 5HBEA 4Y73A 1JNKA 4LGHA 5HCXA 3LJ1A 2IO6A 1H27A 4FSQA 4YU2A 5C26A 5EOLA 4R3RA 2XIXA 4FEUA 1XO2B 3FI3A 3SA0A 2QOOA 1KE8A 2BROA 3NW6A 3QKLA 4QMZA 1XH8A 2VO3A 3UO5A 5AM6A 4L52A 4RT7A 3OCTA 1M2RA 1XJDA 2VN9A 2R0IA 4I92A 4D4YA 1GZ8A 3PIZA 3OC1A 3O8PA 2WAJA 5DFPA 4YUQA 3R1YA 4GK3A 3FZTA 3SOCA 2W1IA 4QMVA 3TUDA 3VC4A 2R2PA 4XG8A 4F9YA 2OFVA 4QMNA 4GL9A 5TKDA 5DT0A 3EQRA 2BR1A 4RQVA 2JDVA 2WIPA 3TNQB 4CT1A 4IHPA 1WCCA 4RWKA 1PMNA 1QPCA 2PY3A 3FPQA 5A4QA 2UW5A 3U51A 2OK1A 5HOAA 4DFUA 4BDAA 3FYJX 4R7HA 4U8ZA 1WZYA 3DBDA 1PW2A 2XEZA 2C6LA 1I44A 3FAAA 5KMIA 4Z55A 5EHYA 4AN3A 2YCFA 3I0QA 3DJ7A 1A9UA 1U59A 2JKOA 1YI4A 4I6QA 3U54A 2VTAA 2CNVA 4ANOA 4A07A 3OUNB 4O7SA 4Q9SA 1OUYA 3KCKA 3AMBA 4NM7A 2OSCA 3UNJA 2B9IA 2ZAZA 3G6GA 4AQCA 4CZUA 2EU9A 2YN8A 3R28A 1L3RE 5CF4A 1HCLA 1M2QA 4DGNA 3CEKA 3UBDA 1PXKA 4IZ7A 5ETFA 3OTVA 4QYHA 2NRYA 3QTXA 1GIHA 3KRLA 4L46A 5E8TA 3VUMA 2PK9A 5HE0A 4BF2A 1OL7A 3CJGA 4QP7A 4P5QA 4AA0A 4BBFA 4CSVA 5AAEA 2CKPA 2XIKA 5HGIA 4EC9A 2PYWA 2G2HA 3HMOA 2F4JA 3A7JA 2QG7A 3FC2A 2I40A 2XNNA 3WIKA 3E62A 1UWHA 3FQEA 1PHKA 3MA6A 2OGVA 3NCGA 4NIFB 4PRJA 5EOBA 4TYHA 3TTIA 3HL7A 1Y6BA 2UZOA 4IAFA 2G01A 2XZSA 3LLAA 2W99B 3W32A 3E8DA 4K1BA 4DEBA 3DT1A 1OZ1A 2VUWA 4TYEA 5M55A 1GJOA 3E3PA 5L6WL 3CSVA 4Y8DA 1STCE 1QPJA 3FY2A 3AMAA 2ZV8A 4OT6A 3EIDA 3CQEA 2ITZA 3Q9WA 3C4ZA 4O83A 2BRBA 4YBKA 1J3HA 3U9NA 1QMZA 1CMKE 1XKKA 3UOLA 3PTGA 2PWLA 3LKMA 5K5NA 3R8UA 4F70A 1DAWA 3LVPA 4K0YA 4EC8A 3SHEA 3Q9XA 3R02A 5TR6A 4MCVA 2HIWA 4O1OA 4YZNA 4NFMA 2P2IA 5BMMA 3BE9A 2PSQA 4C61A 4RIYB 5HTBA 1Z57A 2QOLA 2E2BA 4E4XA 4F9AA 3N51A 4AT4A 3IW6A 5DYJA 2GSFA 3F6XA 4EEVA 3CBLA 4L3LA 4O7YA 4TY1A 4PL5A 3GUBA 2GFSA 4F65A 3UVPA 4QTCA 5HICA 4N6ZA 2VGPA 2PE2A 3D2IA 1GAGA 3C4XA 1WBVA 2J4ZA 2XRWA 4BWKA 1VZOA 4KKHA 3T9TA 4XP3A 2BZJA 1OIUA 3BKBA 3EZVA 5HE1A 3PRIA 4MXZA 3DGKA 5C03A 3ZC5A 5CAOA 3EQDA 3R8LA 1NY3A 2XCKA 1W8CA 4BDDA 1FMKA 3IDPA 3U6JA 3QZHA 4BKJA 4ANLA 1Q99A 2BFYA 2YJSA 3FXZA 4FV0A 3DKCA 3SQQA 2C6TA 4LUDA 3S95A 4XBUA 3P5KA 4YGAA 4CFMA 4R5SA 1ZMWA 2YA9A 4OW8A 4ZJJA 3OD6X 3PUPA 3MI9A 4EZ3A 5CXZA 4J98A 5IEXA 5J5SA 3OW4A 4M0YA 4EWQA 5M07A 2AYPA 4BIBA 3SGCA 3FMLA 4BCQA 2WTVA 3NSZA 1FMOE 5CEOA 2FVDA 4WNPA 4D0XA 4G3GA 4D2RA 1PXNA 1YHSA 2VWUA 3NYOA 4ID7A 5IDPA 3VULA 4I6HA 4LRMA 4NTTA 3QQFA 5DIAA 3JVRA 3Q52A 5AP0A 3KXHA 4C58A 2BRMA 4L67A 3KRJA 2XS0A 3NYXA 3PPKA 4FSYA 4DFYA 3KCFA 4TXCA 3VUDA 3ZRLA 3WZEA 3ORKA 4IM3A 4UWYA 3CS9A 3ORIA 2PTKA 4XV9A 3P4KA 5ANJA 4C62A 1CKJA 1WBWA 4EH2A 4FIJA 4JLCA 4EHEA 3AQVA 3PP1A 3R8MA 3RK5A 5CEMA 2YEXA 3IW5A 3MS9A 4MF1A 2PUUA 4O0SA 4RMZA 5H2UA 3WF7A 3FBVA 1G5SA 3FKNA 3KF7A 4WNMA 4XP0A 4FTJA 3QRJA 3UC4A 5CF8A 5L2WA 3DLZA 5AP5A 2YZLA 4HVSA 5FD2A 5AFVA 4EK3A 3S0OA 1U4DA 4I20A 3GU5A 4WOVA 3GB2A 3H3CA 4PNIA 4RBLA 2ZDUA 4BCMA 2OJ9A 1Q8ZA 2YABA 4RGJA 2JBOA 1YHWA 2O63A 5AR7A 4D2TA 3LFEA 5KZ0A 4EH9A 2PVNA 2DWBA 3MBLA 3F3UA 3SD0A 3VW6A 4L8MA 4B7TA 3GU7A 4TW9A 4DBNA 4GUBA 2ITTA 3W2PA 3ELJA 4IJPA 4F4PA 5FTQA 4MEDA 3QWKA 1R78A 4I1ZA 4S2ZA 3BYUA 3PG3A 4F6WA 4FTNA 3CD8A 3I4BA 5C8NA 3R8VA 3ZLXA 4RC3A 4BIDA 4YO6A 4RIWA 4BFMA 5HX6A 4YJVA 3EN9A 4JS8A 4Q2AA 1GNGA 4J95A 4MXAA 3OF0A 2Q0NA 2W1CA 3FL5A 2AUHA 3UC3A 4MYGA 4MBIA 2YAAA 4QYFA 4RFYA 3O17A 2I0HA 2JDSA 2B54A 3ORTA 2OU7A 3QLGA 3ZO4A 3ZUVA 1MUOA 5K4JA 5I9ZA 2GHMA 2IW9A 2QVSE 2P0CA 2XJ0A 3V5WA 1VR2A 4FZ7A 1GZKA 4JG6A 4JT3A 4LV5A 4MD9E 2R3JA 1JPAA 2R7BA 3D94A 5DT4A 3FXWA 1CSNA 2GS6A 3IKAA 3MY0A 5CASA 2BILB 2X8IA 3MVLA 4JRVA 4X7QA 3ZH8A 2PUIA 1FPUA 2P3GX 3LM0A 4FTLA 4LOOA 4RWJA 3SC1A 1JSTA 4O82A 2VRXA 3MVMA 5IUIA 3K3JA 3ACJA 4N70A 5CSXA 4J71A 1M7QA 2NPQA 3RPYA 2VNYA 3PSDA 4IX4A 1QPDA 1W82A 5CU2A 3WF9A 4JI9A 3WF5A 2GPHA 3LIJA 2G1TA 3Q9YA 3L8PA 4HPTE 4IWQA 3GCUA 2VWBA 2UW7A 4X21A 5KKRB 4NZWB 4NSTA 4E7WA 5IUHA 2PMLX 4BCHA 1YXTA 2EWAA 4CEGA 3FMEA 4DGOA 4FKTA 3DTCA 3NAYA 3ZRKA 2UZLA 5DR2A 3R73A 4P90A 4IANA 5L4QA 3EL7A 3R22A 4EK5A 2F2UA 5CTPA 5AV3A 5T68A 3SKCA 2IJMA 3BEAA 3D5XA 4U6RA 2J7TA 4HW7A 2Y4PA 5KX8A 2B4SB 4IIRA 2C0IA 3OOGA 1IA9A 5HIEA 4PNKA 3KK9A 2C3IB 3DDPA 3DNEA 3UOHA 4TRLA 2X4FA 2XYUA 5FGKA 4M7IA 3LE6A 1UV5A 4C0TA 3NPCA 4LMUA 4OLIA 4YZDA 4OTQA 5ICPA 2FSOX 4F0GA 2HWPA 3JY9A 4I41A 4BRXA 1OBDA 4PY1A 3H4JA 4NW5A 4EOJA 2YM4A 4HVHA 4FC0A 2CPKE 3QRKA 2BAJA 5CQWA 2XYNA 5F1ZA 2ONLC 4CFFA 3EHAA 4BDGA 4YC8A 4GS6A 4NWMA 2VU3A 3GCVA 3OWLA 2A0CX 2YFXA 4FKIA 5AUXA 3FI4A 1ZOHA 4ACCA 2VTHA 4AOJA 5ETAA 4O6EA 4D55A 1SNUA 1GZOA 4C3FA 2WKMA 1J1BA 3O8UA 2HOGA 4OTDA 2GNFA 3GC8A 4CRLA 4IW0A 4N0SA 5A4TA 5A6NA 3CIKA 2GHLA 2VTQA 3CTJA 4FNZA 4X3FC 2JDOA 5CF6A 4Y72A 1Q61A 1KE5A 3QCXA 5CLPA 4OAVB 3EQGA 4BBEA 2QOFA 3RAIA 4PMSA 3E88A 3MFSA 4TL0A 4GCJA 3L9LA 3UMXA 4Q5HA 3D9VA 5CAVA 4EH7A 3KRRA 1YHVA 5IU2A 2C6DA 2QR7A 4TWOA 3SXSA 1CM8A 5ANGA 2OJFE 4RSSA 5EI8A 3R9NA 3MPMA 5DE2A 2XK7A 3FXXA 3PY1A 2HYYA 3IO7A 3TG1A 3SRVB 1LEZA 2NP8A 2GHGA 1E9HA 3R04A 4KBCA 4XMOA 3TZ8A 3LXLA 2YIWA 2QI8A 4IFCA 3SLSA 3LXNA 3QXOA 3P08A 1B39A 1Q8YA 3R0TA 4UALA 5HLWA 4MXYA 3V51A 3ZHPC 2GQRA 2C4GA 2ZV2A 4EHZA 4Q9ZA 3LZBA 5JQ8A 3THBA 3A4OX 3Q96A 2YCSA 3VNTA 5D10A 3B8RA 5JN2A 3PVBA 3VS1A 4MNEB 4EONA 3HLLA 2XJ2A 1WAKA 4U97A 3UGCA 3UYSA 4NCTA 1IAHA 5I9UA 2BCJA 2YM6A 4PV0A 4XP2A 3H9OA 1S9IA 5L2SA 5E8ZA 4QO9A 2IZSA 2VTRA 4R3PA 3R83A 5E7RA 3ZEPA 5JK3A 3E8EA 3SXFA 5I9XA 4ZSGA 3Q3BA 3QRUA 2FUMA 4N6YA 3P0MA 3LQ3A 1YWRA 2GS2A 1ND4A 3NNVA 2IZRA 2UZBA 2BIYA 3I7BA 3LFDA 5KZIA 2UZVA 2YIYA 3ZUUA 3VBTA 1RQQA 3C0IA 1BKXA 2XNMA 1VYZA 4J8MA 5FM3A 2CN8A 5E8SA 2GQGA 4W8DA 3BQCA 2OF2A 4XEYA 4KS8A 3OW3A 2ETKA 4F7LA 4I21A 3EH9A 2LGCA 2R3IA 2XBJA 3KXZA 4TWCA 5GZ8A 4EH8A 5C9CA 5IQCA 3F7ZA 5ANKA 1R0EA 4FKRA 3QQLA 4DEGA 3BBWA 3ZEWA 2R3FA 2XMYA 3VRYA 4EUTA 3VAPA 4EQCA 5JFWA 3TJDA 2R3RA 4FT3A 3EYHA 3PXKA 4FX3A 5BYZA 4XS2A 4E73A 4M84A 4IMYA 5JFSA 3ZM9A 3EQIA 4I0TA 4LQMA 4DFLA 3R21A 4AZVA 3DXQA 4JDKA 3NWWA 4J1RA 3P78A 4DF3A 2ETMA 3C4CA 5BVFA 4H3BA 4ZTSA 1YDSE 1YDTE 4R7BA 5L6PA 4XOZA 5IMXA 4H3QA 4EL9A 2VD5A 3LXPA 4CRSA 2WXVA 3R7GA 2UVYA 3PJ3A 4EBVA 2V7OA 4MWIA 2E9VA 5AP7A 2B52A 3FMNA
chains in the Genus database with same CATH superfamily
5GIOE 3BYVA 2R7IA 3R2YA 4LL0A 4C4FA 4O27B 4HYUA 3QRIA 3BWJA 4ZTHA 3DBCA 5DA3A 3PVGA 2VTSA 5JGBA 2P4IA 2XCHA 3MIAA 2V62A 1TQPA 4NEUA 5ANEA 3ZFMA 5LMBA 4ZMFA 1IG1A 4LUEA 4AACA 3UDSA 3QGYA 2OJJA 1R3CA 5BVDA 2XIYA 3DBEA 4XCUA 3KC3A 3TKUA 3WYXA 2CNQA 5AP3A 2PZIA 4C8BA 3DA6A 3DLSA 4BDIA 1PRYA 1W83A 4XLIA 3TMOA 3VO3A 5DH3A 4M66A 3A61A 3G0FA 5JZJA 1IAJA 4NJ3A 4U3ZA 2GTNA 4GT4A 2W5BA 4CCBA 4FT9A 5EYMA 5I9VA 4QPAA 3UNZA 2HXLA 2IPXA 2CHLA 4D5HA 3DFAA 3TN8A 2OH0E 2R3HA 3FKOA 3U6IA 3BGQA 4AA4A 1YXUA 3K5UA 4LRJA 5IF1A 4GKIA 2O3PA 3CGOA 3EOCA 3WYYA 4PMMA 5L3AA 2Y4IB 3Q4CA 3Q4ZA 3D2KA 3RTPA 2F49A 4BCIA 4EYJA 1BLXA 4E6AA 2EB3A 4IJ9A 3GCQA 4F7JA 2C6OA 3ANQA 1NXKA 4UN0C 4EOSA 4O6LA 5CI6A 2HZIA 4OGRA 2VWVA 3MSSA 3P7BA 2ZM4A 4QTBA 3DKOA 4CMOA 2XK8A 1REKA 4GG5A 1URCA 3FZSA 4MQ1A 3COHA 3SOAA 2QHNA 1W7HA 3QTSA 4FV8A 3DJ6A 5M06A 1J1CA 4U0IA 2QODA 5ETIA 2KTYA 1JWHA 1JAMA 2ITXA 1S9JA 2XJ1A 4PPAA 4BI2A 1MQBA 4L3JA 2BRNA 1DI9A 1SNXA 4AZEA 1RDQE 3O23A 4O91A 1H1WA 3FSKA 4MQ2A 4O0WA 4YR8A 5EI2A 3EFWA 1Y6AA 3C50A 4TYJA 5A3XA 3ORNA 4RC4A 3R7YA 4YLJA 2GNHA 3O5AA 3L1SA 5AUZA 2QG5A 2XUUA 3R7IA 3OTUA 1Q8UA 5M4UA 2R3KA 1V1KA 5DG5A 3NUSA 4G6OA 3UQCA 2C1BA 3OROA 4AE9A 4EOMA 3BLAA 4JG7A 4OTFA 1XBCA 3C13A 4EKKA 2JFLA 2VGOA 4XG6A 5AEPA 3S4QA 4FL2A 1WVXA 2YDKA 5A6OA 5HORA 2XNEA 5DLSA 5DEYA 3NUNA 3FY0A 5HU3A 3MJ1A 2BZIB 4NFNA 3PIXA 2ITOA 1U54A 3GCPA 3RHXA 3MFRA 3QA0A 2VTLA 5B2KA 3W8QA 4PPCA 5ACBC 3T9IA 4AZWA 5EW9A 4QDEA 5JQ5A 5CT0A 3LCTA 2QU6A 4QOXA 4BI1A 5KE0A 3VF8A 5DRBA 1F3MC 1RE8A 1SVGA 2PHKA 4U45A 3ZSGA 4EK6A 5FXQA 5BYYA 3JPVA 5EKOA 5EW8A 4JBQA 2OZAA 3FKLA 4FT0A 2VTIA 1R0PA 4JVGA 4YZ9A 5FWKK 4DG2E 4EQMA 3VUIA 2J5FA 4MAOA 1ZOEA 4USDA 3R8PA 2B9JA 3ZLWA 2X4ZA 5HNIX 5HVKA 5L2IA 2C3JA 3BLRA 4ACMA 1W2FA 3S3IA 4QTDA 2J50A 5FP6A 3AMYA 3OY1A 4JIKA 2CGWA 3UZPA 2Q83A 2F57A 3ZS5A 1AGWA 2WMRA 1SVEA 1Z9XA 3UP2A 2C0TA 1UKHA 5F4NA 3TNIA 3W10A 4MUQA 3DJ5A 3LOKA 3BHTA 1PJKA 3OEZA 4FV5A 2ERKA 4ALVA 4ANNA 4IAZA 4G3FA 3TDVA 4IB1A 4MX9A 1G8JA 5IUGA 1K2PA 5AUTA 2ZYBA 4KIKB 1I09A 2PVRA 2W1EA 2OICA 3KVXA 2RFSA 5AP6A 4A9TA 1JLUE 3FDNA 2PPQA 2JEDA 2X7FA 4FF8A 4H39A 4XH6A 4UWBA 5E8VA 4GW8A 5DHJA 3BV2A 3R9OA 3RPOA 4G17A 3QTRA 4RVLA 1R1WA 4RIOA 3RZBA 4DTBA 2WD1A 4CQGA 4AP7A 2AEGA 1OIYA 4M97A 3T3VA 5FTGA 4V0GA 2WTDA 3PPJA 3HAVA 4ZTRA 1O6KA 3OXTA 2QOIA 4GIIA 5CQUA 4FUXA 1KE7A 1Q8WA 4FUYA 2O65A 2W1FA 4IX6A 3KK8A 2B0QA 4YMJA 5CZHA 3PA3A 3G90X 4A4XA 4CYIA 3QD0A 4JQ7A 4I0SA 4EHGA 2UZTA 4PF4A 2UVXA 4FV3A 4DFNA 3BRBA 3HA6A 4O0VA 2OI4X 3MVJA 2IG7A 2WPAA 5BUIA 4XYFA 3A60A 4MBJA 3QF9A 4QMPA 4QTEA 4YLKA 1YXVA 5AV1A 3L8VA 3HUCA 1U5QA 1TQMA 3DK7A 1ZMVA 1ZXEA 4YPSA 4KIQA 4ANMA 4QYYA 5IA5A 3TJCA 2E9OA 4RLLA 4GFMA 4OUCA 3KL8A 3ATSA 2YIXA 4QMUA 4FTIA 4WHZA 2J9MA 2UW4A 5ANDA 3G9NA 4UZDA 3PE1A 2UW8A 5HEZA 3BWFA 4F6UA 1OM1A 1LEWA 4IWOA 3KXGA 5F9EA 4OT5A 2R3PA 3OWJA 3V8TA 3PSBA 2WU6A 4D9UA 3HV7A 4YO4A 4RVKA 2ETRA 2E9NA 5IA0A 4FRFA 4X2JA 4Y95A 2X0OA 5BUEA 5CI7A 5LJJA 3FLYA 4IZYA 3AKJA 4IQ6A 4AW5A 2BPMA 2CLQA 5CNNA 1OL5A 3QTWA 4FG7A 2XALA 4W4XA 3AGMA 5IQEA 2ZB0A 3V3VA 4A4OA 4BHNA 3SG9A 4O7TA 1OL2A 4YURA 4YSMA 4O7NA 4QP9A 2XKCA 3QZGA 2ITUA 3ZRMA 5I4NA 4ITIA 1G8AA 3C0HA 3GU8A 4YJSA 4QMSA 3HVCA 4M67A 3B2WA 3NNXA 1AD5A 4GU6A 3PXZA 4NIFA 4WSQA 5D11A 3IW8A 3TV7A 3F2AA 3R7EA 3WZKA 3R1SA 2Y6MA 3C51A 3GC0A 4IB3A 4L43A 3QD2B 4AWIA 4RC2A 2W9FB 4H05A 4RVMA 2PL0A 2YM7A 5DRDA 4S34A 5BUJA 5IA4A 1T45A 4EH6A 3CJFA 4UBAA 1PMEA 4J97A 3QUEA 4FL3A 2C5YA 2YM8A 4B99A 3E93A 3V6RA 4CTCA 3QQKA 2Y7JA 4FVPA 2PULA 3FMMA 3SDJA 2OFUA 3OCSA 3FZ1A 4K8AA 3BU6A 4G9CA 3R2BA 4K11A 2YLEA 4KSPA 3SAYA 4ENYA 3SW7A 2FSTX 3LCOA 4YZCA 5IISA 2QC6A 3C9WA 3PA4A 4JNWA 4I3ZA 5FEDA 3VS5A 4FT5A 5ANOA 4JRNA 2ZM1A 2HZ4A 2VWWA 4ZLZA 3V5LA 4K77A 3CD3A 3KRXA 1XWSA 4HYIA 3R7UA 3ZDUA 4RIYA 4CT2A 4DITA 2W06A 3TWJA 4X6RA 4L68A 4FEXA 2KULA 3IDBA 4ZMEA 2BAQA 4ZY5A 3GENA 2RFNA 4MXCA 4QPSA 4O0UA 5JGDA 2X0QA 3IG7A 4ZAUA 3KVWA 2C69A 3F82A 2A19B 4U5JA 2NYAA 3QFVA 4WRSA 1AQ1A 2W1HA 3I1AA 1YWNA 4FYNA 3W16A 5EQPA 4F08A 1PXPA 4J96A 1H08A 4CV8A 3MH2A 2WMBA 2Y9QA 4RZVA 3FLZA 4FYOA 4LM5A 1B6CB 3LMGA 3ZO2A 3AT3A 4AW0A 3QKMA 4WBBB 1JOWB 1V0PA 1JSUA 1OIQA 3ANRA 3UOKA 3V8SA 1Y8YA 2XANA 2HY81 3MB7A 4IVCA 2Z7LA 3DU8A 5GHVA 4C7TA 1PYXA 1FINA 5CWZA 4BCFA 4QMMA 4FKQA 4EOPA 1OECA 4DLIA 4MK0A 3F88A 3AKLA 4UV0A 2UW3A 5E92A 4ZTNA 1UA2A 5JKGA 1FVRA 2WMUA 5J7HA 2W1DA 4FT7A 2OW3A 4B8LA 1ZRZA 3UP7A 2XIRA 4ORKA 3LJ0A 4L44A 5ETCA 2CKQA 3O71A 4ASZA 1H0VA 3NS9A 3W2CA 3Q9ZA 4KINA 3D7TB 5AMNA 4P4CA 4D28A 5CEPA 4YJQA 2RG5A 2YCRA 3UPXA 1TVOA 3POOA 3U9CA 1UNGA 3BHVA 3M2WA 1XH5A 3MIYA 3U87A 3KF4A 4G3EA 3NMUF 3UPZA 2Z7SA 3FLWA 4AZFA 2JKMA 3L9MA 1PXOA 3K2LA 1Q41A 4AOIA 4F99A 5BVNA 2VTOA 4GK2A 1WBTA 5IQHA 2RFEA 4D4SA 4WKQA 3RALA 2PU8A 1NVSA 4E8AA 3A2CA 4JBOA 5ANIA 1ZMUA 3A7FA 2GNLA 2O64A 2QOKA 3F5XA 4IAKA 4TNBA 4CZYB 4DEEA 3C5IA 4DE4A 4PDSA 3R00A 2J90A 4ZZMA 3DQWA 1CDKA 5J9LA 4FZAB 5J79A 1IA8A 3A4PA 4IC7A 4XJ0A 5HLNA 1GY3A 2ZVAA 4IVBA 4CKRA 2BKZA 3DAKA 3JXWA 3P86A 4X2KA 3TM0A 1BUHA 3CC6A 2QD9A 1YW2A 2IW6A 4WUAA 5J87A 4DH7A 3D5WA 3MY1A 5LVMA 2PVHA 5GINE 1Q97A 3H10A 5F95A 1DAYA 3HDNA 4GEOA 3PFQA 4FKWA 3G51A 3JY0A 4GSBA 4BGQA 4EHVA 4EZ5A 3EKNA 4NKAA 4DG0E 2EXCX 4QMYA 3UQFA 3EN4A 4NM5A 1H1RA 1WBPA 4ZS0A 5AR3A 4DG3E 2WMTA 2I0YA 3EWHA 3O7LD 4BTMA 4AXCA 3R9HA 3NVMB 3RCJA 5HG5A 3HV5A 5AUUA 4FIFA 2YACA 3ORLA 3AC3A 4YTIA 3LPBA 3WARA 5AR4A 5HX8A 2JITA 2RKUA 4YC3A 3EL8A 3W1FA 4ZSLA 4RX5A 5HNGA 1R39A 3Q2JA 1RJBA 3VRZA 4KIOA 1YWVA 1YQJA 5DT3A 4LG4A 2CDZA 2JBPA 4RLKA 3CE3A 3CPCA 1FVTA 3LCKA 4G34A 5EHOA 5M4FA 2BHHA 4NKSA 3MPTA 4AT3A 5KMNA 1WBNA 3F3TA 1YRPA 3UVRA 3MB6A 5CT7A 5HU9A 2HW6A 2OXXA 3I5NA 3T3UA 4DCEA 3AGLA 3NFGB 4E20A 5K5XA 4E5AX 3S2PA 3ET7A 2J0MB 1BL7A 5EQEA 4PTGA 4RVTA 4D0WA 2ZMDA 4PDPA 5IQDA 4ASXA 3NLBA 4G5JA 4EUUA 4RFZA 5FDPA 3PLAE 2BAKA 2ZV7A 3HX4A 3AD4A 3DZOA 4F1OA 4P7EA 5LWNA 5AV2A 2I0VA 3UQGA 2B9HA 3VS3A 4IAIA 3IW7A 4FODA 3ML1A 3ZC6A 5DR6A 4ENXA 4TYGA 2ZOQA 4KBKA 3I6WA 3K54A 4YJPA 3GFEA 3E8NA 4BDKA 4RQKA 1RW8A 5IH5A 3RK7A 2OG8A 2JKQA 1NVRA 3KXMA 4QTAA 3D14A 1Q3DA 4UZHA 2BALA 2V55A 4K9YA 4R3CA 4YLLA 5FEQA 4E4MA 4KB8A 1OKVA 1UU9A 3POZA 4X3JA 5LVOA 4I5MA 2WQMA 3QWJA 4R1YA 2WTKB 3DBQA 4W9XA 2OIBA 5D7AA 4DN5A 4E3CA 3MH0A 3RJCA 2HXQA 4EI4A 1BL6A 3C5UA 3ZM4A 4BR3A 4CG9A 2WOUA 4FTQA 3O96A 2Y0AA 3BPRA 4M0ZA 2IF8A 4FG9A 1WFCA 4FIEA 3WIGA 4HVIA 4FIHA 1F5QA 4O0RA 4CFVA 2X9FA 3QZIA 4S31A 4ZK5A 3T8OA 1A06A 2XM9A 4YHTA 4X6QC 3O50A 3QTIA 1VEBA 3G33A 5L6OA 4DH8A 4L42A 5AV4A 4AOTA 4PP9A 3L9NA 2J0LA 4XG4A 2DS1A 2W4OA 2YAKA 4QQTA 2XM8A 2DUVA 2WMSA 3SX9A 4X2FA 4FVRA 4ACHA 2OWBA 5TOZA 3BU3A 5IQAA 4IDVA 1YI3A 4YNEA 3HMNA 4KNBA 4EH3A 3GC7A 1ZZLA 2GS7A 3AT2A 4IXPA 1JQHA 5K4IA 1ZY5A 5TF9A 4DDGA 1GIJA 2WOTA 4FV1A 1ZARA 4HNIA 4BYIA 4ZY6A 5DPVA 3EN6A 5CENA 4MWHA 4D58A 4XHKB 3IQ7A 3Q6UA 4ANBA 2NNWB 3HP2A 4YJRA 4RPVA 4NL0A 4CFXA 3UNKA 4RA4A 1Q24A 2WMVA 4QMQA 2BZKB 4WD5A 1P5EA 2C1AA 4EYMA 3ZFYA 2GNJA 2UW6A 4F7SA 4U81A 5A46A 4I23A 1IASA 3GFWA 3U4UA 5CAUA 4EJNA 3Q60A 4I5CA 2ITYA 5FM2A 3D7ZA 5TO8A 4C33A 4C3RA 2FH9A 4KIPA 4F9CA 2I7QA 3G9LX 4G5PA 3WE8A 2A1AB 2C5VA 2V5QA 3ODZX 4JX3A 2CLXA 4ZJIA 5E90A 3TNPC 4DEAA 3PFYA 4O81A 3LJ2A 3B8QA 4RJ4A 4JL9A 1DI8A 4D2SA 5JMSA 2QO9A 4O38A 4CCUA 5L8KA 3S1HA 4FIIA 3U55A 4E6CA 1XH6A 1PXMA 4I4EA 5CYIA 4RFMA 5EI6A 4EOIA 1ST0A 4B8MA 4C38A 2ZB1A 3UYTA 4K33A 4X3FB 4AG8A 3H30A 2WQOA 4RA5A 2OKRA 5G1XA 5HKMA 5FXSA 1U46A 3SRVA 3VJNA 1YOMA 4KAOA 1KOAA 3M42A 5JFVA 2PVLA 3R6XA 4JAIA 3RAHA 4EK8A 1Q8TA 3FZRA 3JS2A 2BKKA 4BCPA 4B9DA 4JAJA 4EZ7A 3FEGA 3FI8A 2X9EA 3EQCA 5E8XA 4EQUA 3HECA 2W17A 3AC4A 3UO6A 1M52A 4YZBA 1XMMA 3OOMA 4MNEA 2X8EA 4AZTA 2I6LA 1YOJA 3MH3A 4IAAA 2CGUA 3MFUA 5CAPA 3DFCB 4FGBA 5M53A 3BCEA 3HZTA 4BDJA 4O86A 4CMTA 2ACXA 4FKVA 1M7NA 3O51A 2QR8A 3FLNC 4ONAA 4ASDA 2O2UA 2OJGA 3G5DA 2IEWA 3LFSA 3ORMA 4DEIA 3TTJA 2CCIA 1Q5KA 4A06A 4TT7A 2BDWA 2CGVA 5E8UA 3OMVA 5L2QA 2UZNA 5HG7A 4ACGA 3QA8A 3F5GA 3AOXA 3BGPA 3D0EA 3V5TA 3W2RA 5LWMA 4FJVA 4DT9A 4QP3A 1JKTA 4JBPA 4YHFA 4GFOA 4QYEA 3PJCA 4ZXTA 2RFDA 4ALUA 5IQIA 2W5AA 4XG9A 5I5ZA 3Q53A 5FUTA 3JVSA 3ERKA 4EK4A 3NAXA 3WBLA 1GZNA 4RWIA 4IEBA 1PXIA 4UYAA 2OIDA 2R3QA 2SRCA 4FSMA 4C57A 4FKLA 4USEA 4APPA 3NGAA 2EB2A 4BCNA 2GNGA 4QQCA 5ITAA 4FGRA 5IH4A 4W8EA 2FSLX 2QKRA 4C4EA 3WZJA 4BJJA 5AIRA 3C0GA 4IZAA 3AC8A 3FE3A 4HZRA 1URWA 4QMXA 4BL1A 3DB6A 3Q32A 4C4HA 3R1QA 3A8WA 3AD6A 4QQ5A 5IA1A 3VQUA 5KHWA 5M4CA 2JIUA 4M15A 5A54A 5HTCA 3LAUA 4JXFA 3RBWA 2X39A 1XHAA 2XNGA 3A8XA 2CJMA 2DQ7X 2PZPA 2X2MA 3R1NA 4N4SA 2C47A 4FZDB 2Z02A 5IDNA 3M1SA 5IEYA 4BICA 4JOAA 3FPMA 5IA2A 2YCQA 3UIBA 4BDEA 5A4EA 3GOPA 4ZJVA 3GT8A 4AZSA 3ALOA 1W98A 4IACA 4FIGA 5FBNC 5CVHA 2YLFA 1PF8A 5KHXA 1ZYCA 5AP2A 2HWOA 2VX1A 4PMTA 2YITA 4P2KA 4NCTC 4WNKA 4Z7GA 3M11A 3PJ1A 3R8ZA 3CCNA 2OLCA 2J0JA 5GIPE 2W05A 3MW1A 4IWDA 1G8SA 4U79A 3F3VA 5DWRA 4BZOA 2WB8A 3FV8A 3EZRA 3BHHA 3VJOA 3SW4A 4DYMA 5C27A 2X0GA 5L8JA 3QX4A 5HD7A 4BGHA 4F9BA 5EM8A 4BDFA 4KD1A 5D9HA 3V5JA 3F2NA 3IS5A 4QP1A 4ZSJA 4U44A 3W2OA 4YJUA 2PVKA 3UMWA 2R3MA 4FTRA 3GNIB 4AXAA 2C6EA 3ULZA 2FB8A 2ITPA 5I0BA 3KIOC 4RG0A 3KXXA 4FICA 4YC6A 3U8WA 3MESA 3F69A 2WTWA 2HZNA 4ZTLA 5A14A 1APME 2BTSA 4DC2A 3QCSA 3HAMA 1XQZA 3QC4A 4L01A 3C4WA 4WBOA 1UU3A 4BCJA 1PYEA 2E9PA 5FDXA 1PKGA 3C4FA 3W0OA 3DCVA 1KSWA 3AG9A 4JQEA 4MD8E 5LOHA 4DA5A 5DN3A 4DFZE 3D5VA 4MH7A 2GCDA 1OPKA 2F2CB 2H9VA 1OKWA 2F7EE 2HENA 4KA3A 5IZFA 4BCKA 2Z7QA 4O4BB 3VN9A 4HYSA 3JR1A 2B53A 3JYAA 2HCKA 3NIZA 4GIHA 1YVJA 5K0XA 3QD4A 3KMMA 4FSUA 3MWUA 5CSWA 4PUZA 2GNIA 2J2IB 4WG4A 4M69B 2W1ZA 3SVVA 5E1SA 4NU1A 5IMEA 1ZOGA 1ZYJA 4EOOA 4J99A 3OXZA 5CEKA 5HZNA 4YBJA 3DXNA 5HE2A 4E6DA 3ZBFA 3NDMA 3FYKX 5LMKA 2QLUA 2QOBA 2QURA 5AA9A 3WILA 4ALWA 1UNHA 4RX8A 2C68A 3RGFA 4FV6A 5BPYA 3W55A 2IVUA 4Y85A 4DFBA 4UMTA 5AM7A 4O0TA 5FBOA 3F9NA 5J8IA 4DH5A 4CFWA 2QU5A 4B0GA 4DH3A 3R9RA 4ZTQA 2C5NA 3QAME 3HRBA 1OKYA 3VVHA 4CGAA 4WA9A 2P33A 4O1PA 4AS0A 4DGMA 3BLQA 3VUTA 3I79A 3H9RA 2REIA 4XRJA 3DOGA 4OTPA 3BZ3A 2IVTA 2UW0A 5C8KA 2YISA 1BX6A 1VYWA 4M3QA 4Z9LA 4L53A 4S30A 5LARA 4PP7A 4I6LA 4OBPA 3BLHA 4O84A 3CPBA 1UWJA 4LDTA 4O7VA 4MNFA 4BYJA 2YIQA 3EYGA 4U43A 4R78A 3FMHA 5FLFA 5KCVA 3UTOA 2CMWA 4CNHA 1GOLA 4FKPA 4WG5A 4XRLA 1O6YA 2AC3A 2RIOA 1H8FA 3MN3A 4HZSA 4UY9A 5F20A 3VWAA 3PPZA 4C4JA 4F0FA 4ZY4A 3HRFA 1KUTA 2JAMA 2UUEA 3MA3A 4AN9A 3DPKA 3LLTA 4QMWA 5CNOA 4NJDA 4NM3A 3E64A 4EH4A 2WELA 2XNPA 4OBOA 2OH4A 4S33A 2CNUA 4L7SA 1IR3A 4AGDA 4S32A 3VBWA 2NRUA 4GU9A 4AW1A 4RJ5A 5EW3A 3ACKA 1Q62A 3ZLSA 4L9IA 1PXJA 4OBQA 4XG2A 4IE9A 1UVRA 4KIKA 4FKGA 4CLJA 4HGSA 4GJ2A 3PXQA 2JLDA 2X81A 5CVFA 4H1JA 1G8KA 5AUVA 3NX8A 4M8TA 5C4LA 3E92A 4G2FA 4XBRA 3KA0A 4C34A 2JC6A 3AD5A 2RGPA 2X2KA 2I1MA 3EFLA 4FV2A 4Q5EA 4YJNA 4C2WA 3BEGA 2WTIA 5JGAA 5D41A 4GYGA 4HGEA 5CVGA 3ZFXA 4AW2A 4D2WA 5BNJA 3MDYA 3EN5A 3ETAA 4FV4A 4G3DA 4GRBA 4DGLC 3GC9A 4NT4A 3AC1A 3ZXZA 5AWMA 4Y5HA 3VUKA 2JDTA 2GMXA 1EH4A 3W2QA 1TQIA 4FKJA 1FBNA 2VO0A 5CU4A 3WE4A 2PVMA 3FC1X 4IAYA 4UWCA 3G15A 3DKFA 3KQ7A 4QMOA 2WMWA 2R3NA 3GQIA 2W7XA 3CR0A 4WSYA 3BYMA 4C37A 3QX2A 4OTRA 4CV9A 3F61A 3HV6A 5EM5A 5K3YA 4ZSEA 3VS7A 1L8TA 2VZ6A 3IK3A 1JVPP 3PJ2A 4I93A 1FGIA 3VUGA 5KNJA 1PXLA 4UXQA 5JEBA 3I7CA 3PLSA 3QUDA 4CKJA 3KULB 1SZMA 3BELA 4UYNA 3ENMA 3E7VA 3REPA 3BYOA 3BX5A 4R77A 2H34A 4KSQA 2XP2A 3HMIA 3A7HA 4FL1A 4C35A 1BI8A 3RZFA 3ZTXA 3TT0A 2QLQA 2R64A 3CTHA 5CU0A 4M13A 1NVQA 1FQ1B 5EM6A 2X6EA 3FJQE 2WU7A 4AFEA 4UMQA 2VWXA 4BC6A 2BFXA 5AX3A 4X2GA 4FSNA 2G15A 2BZHB 4GMYA 3WZDA 3ZZWA 2JGZA 4U80A 4ZOGA 1OI9A 2IWIA 3FL4A 4PPBA 4CYJA 1ZWSA 2XK4A 3CLYA 3H0ZA 1U5RA 3KGAA 1OKZA 3NCZA 4JR7A 3ORPA 3HKOA 4FI1A 3COIA 5H8GA 4APCA 4P5ZA 5LXMA 5E1EA 4RIXB 4AT5A 4ASEA 4AAAA 3H0YA 2WQEA 2IVVA 4JDHA 2PVJA 4HGLA 3ZDIA 3QLFA 3HNGA 4FTTA 4NM0A 3QALE 3CP9A 3QQHA 4NUSA 4R8QA 4AA5A 4OAUC 3GI3A 5IQBA 1Y91A 5A4CA 4LV8A 4C02A 4O4CA 3RINA 3TZ7A 3UE4A 3GU6A 3IPHA 4HGTA 3PE2A 5GNKA 3W33A 4DTAA 4DLJA 1XBAA 2X7GA 4MXOA 2HZ0A 1VJYA 3RWPA 3UOJA 3CQWA 4G9RA 2X2LA 3V8WA 3W0PA 2RL5A 5CSVA 2JDRA 2I0EA 4W4YA 5EQYA 3QL8A 4AN2A 3F66A 4DHZA 4WIHA 1JKLA 3EQFA 4JX7A 3G0EA 2B55A 2YM3A 2B9FA 5M09A 4FTCA 3UDTA 5T3QA 2RG6A 4C36A 2HY0A 3PP0A 4KBAA 4IH8A 3EKKA 4M68A 3ZMMA 5IA3A 5KUPA 4ZP5A 3VHEA 3BV3A 4I5HA 4AX8A 1A48A 3NIEA 4L7FA 4U40A 3DNDA 3BU5A 2QHMA 3MTLA 2VTNA 3A7IA 4I22A 4D4VA 3TDWA 2OO8X 4GJ3A 4F1TA 3VQHA 4AXDA 4O7WA 3QUPA 4FK6A 3C4EA 4ZIMA 4F78A 2QO7A 4XV1A 1XMLA 1OPJA 3ENHA 1SYKA 2YHVA 3GXLA 5LCKA 4ZEGA 4IX5A 4IVAA 4LGDA 5EM7A 4C4IA 4UMRA 1ATPE 5LVPA 2V0DA 1ZYSA 5CX9A 2W4JA 3F3WA 2VTMA 3R7VA 2BVAA 3BHUA 4O2ZA 4GT3A 1OMWA 3NUXA 3UG2A 3OCGA 5KMKA 2VWYA 4N57A 3PZEA 4OTHA 3DS6A 3QD3A 4U3YA 2PE0A 4E93A 3GU4A 5DI1A 5HQ0A 1REJA 4DCAA 3G6HA 1P4FA 4QYGA 3E3BX 4TZRA 4FTKA 2C0OA 5EYDA 3OFMA 5I9WA 3RKBA 2XEYA 3D7TA 3VS6A 5AUYA 5EDRA 5JRSA 4USFA 3KMUA 3W0NA 3ZUTA 5CS6A 2F7XE 3GGFA 3MVHA 4EOKA 3QTUA 4O7RA 4IM2A 5J5TA 2R9SA 2UVZA 4AUAA 4TYHB 4FSTA 3K3IA 4FNWA 4O0XA 2YDIA 3ZBXA 1SMHA 3FLQA 4IBMA 3RPVA 1J7UA 4BKYA 2J6MA 1MP8A 4GFGA 2PZYA 4O4DA 4R7IA 4UEUA 3EQBA 3KEXA 3P9JA 4O21A 4BDBA 2F7ZE 4YJOA 5L2TA 2XAOA 2PMOX 1DM2A 2XRUA 2Z2WA 3P7AA 3TNHA 4DT8A 4R1VA 3MH1A 5H9BA 4MKCA 3FHIA 3I5ZA 4MF0A 4E5WA 2Z7RA 5EHLA 4ANSA 3N4VA 5C01A 3F5PA 2XVDA 4KRCA 5HBJA 2XNBA 3NW5A 3W8LA 2OZOA 3F5UA 2C3LA 3NUYA 3UO4A 3HGKA 4QP2A 1H1PA 3W0MA 2WO6A 1V0OA 3CY2A 2OF4A 4QP4A 3A7GA 4PTCA 3Q5ZA 2W5HA 3I81A 5HO7A 2CKEA 5B2MA 5J1VA 5CEQA 3PDTA 4R5YA 3AXWA 5B7VA 3BL7A 1J7IA 4JIAA 4X0MA 4O4EA 1UU7A 3EQPA 4HJOA 4IB5A 5HHWA 3TL8A 4CMUA 4F7NA 2YWVA 2G9XA 2WTCA 3O7LB 3RHKA 4DFXE 1UU8A 4H3PA 3ROYA 4TN6A 4BDHA 4YSJA 1MRVA 4Z16A 5JH6A 2JD5A 3V01A 1PY5A 3BE2A