3MVHA

Crystal structure of akt-1-inhibitor complexes
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
332
structure length
311
Chain Sequence
VTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQRPHFPQFDYSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords v-akt murine thymoma viral oncogene homolog 1 (AKT1)
publication title Design of selective, ATP-competitive inhibitors of Akt.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 311
sequence length 332
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mvhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mvhA01
3FQEA 4XBRA 1OKZA 3SRVB 2JKMA 3DPKA 4GK4A 5M4UA 5CT0A 3VNTA 4UMPA 3ORTA 4PMMA 3PZHA 3C4ZA 1ZMWA 3CIKA 4ANSA 2GCDA 4AACA 4DH3A 3QYWA 4RLLA 3WOWA 2CNUA 5HG5A 3PSDA 2XZSA 2IN6A 3PY1A 3RPOA 3MGYA 5BVDA 5EKNA 5IA1A 5HBJA 3FQSA 3MI9A 3UIBA 4JR3A 3R7IA 4X6QC 2X2KA 1AD5A 1PHKA 3R8MA 2R3MA 2R3KA 3G90X 2PTKA 3D4QA 5AM6A 3W55A 3IDBA 4IWPA 5FEEA 3DXQA 4C7TA 4BIDA 3F3VA 4LG4A 4JL9A 3QQUA 4A9YA 4USFA 4GKIA 2ETRA 3FKLA 4WNKA 3FLYA 4FV1A 4YJVA 3OZ6A 1IA9A 4YSMA 4BKYA 4FKOA 4X21A 2CHLA 2GNFA 3DFAA 4GS6A 2UUEA 5L2QA 5HE0A 4D9TA 3QU0A 4GU9A 5AA8A 2R3HA 4E5WA 2YCSA 4D9UA 4OAUC 5IF1A 3HV7A 1WVYA 1XHAA 2W9ZB 3QLGA 5JN2A 4J97A 4QQ5A 4C2WA 2QNJA 4FIEA 2YIWA 1XQZA 4DEGA 4WNOA 5D7AA 3DNDA 5DBXA 3U87A 3ZC6A 4D5HA 5EW8A 2QOLA 2X8DA 2CNQA 4U45A 4L44A 3AD4A 3IW8A 4M0YA 3A7FA 1V0OA 3PY3A 3Q9XA 1H0VA 4EQCA 2JKQA 3NW6A 2W1IA 3FC1X 3DGKA 5ETFA 4L46A 4APCA 3TZMA 2GTNA 3EQBA 3F5GA 3SAYA 5B2KA 2W4KA 4RIYB 4IX6A 2QU5A 4AA4A 3H30A 4FKWA 3AXWA 4F9CA 3LZBA 3UO4A 3UG1A 2XKDA 4IAKA 2ITWA 1SVEA 1WVXA 4QTDA 4ZTSA 5HVJA 3GU8A 3NYXA 2CGVA 2XF0A 2DQ7X 3GFWA 4IZ5A 3G15A 2CKPA 1PXLA 4JT3A 3UVQA 4UMQA 4TPTA 2PYWA 5LJJA 4M15A 3CPBA 4U79A 4YBJA 4PQNA 3SHEA 2BZHB 4CZTA 2WMVA 3R73A 4YO6A 4IB3A 2GNHA 4NCTC 2ZV8A 1S9JA 4D2RA 4OW8A 2YIYA 3MIYA 3ENMA 5AJQA 4XV9A 2C3KA 4DITA 4XMOA 3RNIA 3ZS5A 5HIEA 2QO2A 5AUUA 5CSXA 4I6HA 5IISA 3G51A 4IAZA 4JVGA 1T46A 2G2FA 2W1CA 2EVAA 2X8EA 4BDIA 1YWVA 4EK8A 4MNEB 4JLCA 1ATPE 5FTOA 4Y46A 3OTVA 3PUPA 3DFCB 4YGAA 5K4JA 4YJPA 4D55A 2JIIA 3R6XA 1W83A 2J0KA 4FODA 3VUGA 5J9LA 1PYXA 3RPRA 3HAMA 2QO9A 1O9UA 1YXXA 4UV0A 5IQCA 1Q99A 5BQ0A 3ALOA 4ALVA 3OXZA 3KB7A 4YPSA 5F94A 2BRMA 2AC5A 5K5NA 4FE2A 4KIKB 5HG7A 1YI4A 1UNLA 1Q8UA 4KRDA 5AV0A 2VN9A 3AD6A 2R3GA 3G6HA 3KK8A 3LM5A 3E63A 5E8VA 4R78A 2Y7JA 3DK3A 4G17A 5C8NA 2VTIA 3VRYA 3QF9A 4HYIA 1JSUA 1FVVA 5JZJA 1FVRA 3R9NA 2P2HA 2VX3A 3QZHA 5LMAA 4IVDA 4NM3A 2PZYA 4EBVA 2J0MB 1KE9A 1R1WA 3KFAA 3LXNA 2E9UA 2VTLA 5ANGA 3FZPA 4QMOA 4QP8A 5KMKA 4O83A 4BICA 4D2TA 2Y4PA 3MDYA 4RRVA 2RG6A 1TVOA 5M57A 5KKRB 3MTFA 4IANA 3MPMA 2BFYA 1BI7A 5A4CA 3RCJA 5IEVA 5KKRC 1Q3WA 4ZSLA 2C30A 5EW3A 3UO6A 4J99A 2JAVA 3HX4A 3OTUA 4AGDA 4IC7A 2W1GA 3KXXA 4YTCA 2VO7A 4IBMA 4M3QA 2BZIB 3MB7A 5J9YA 3TNQB 2OWBA 3VJOA 1CM8A 1IRKA 2OKRA 4FKIA 4L68A 3Q2JA 1TKIA 4FTKA 1ZYCA 4AW1A 1NA7A 3F6XA 2YAKA 3G9NA 3QQHA 5IA5A 2YAAA 4JR7A 5AP7A 5EQPA 3LFFA 2WMQA 5T68A 1KSWA 4ZZOA 2O8YA 4D0XA 3OT8A 4YTIA 2IW8A 3FMMA 2Z7RA 5CEKA 4IM2A 3U4WA 4CRSA 5JGBA 3ZFYA 5DLSA 3QGWA 5CAOA 4FVPA 1M2QA 1XH8A 4ZS4A 1OB3A 5EYDA 4Q5HA 2QKRA 3QRTA 5FP6A 4ZY5A 3WILA 4XG2A 2I1MA 5DT4A 3MVLA 2B9IA 2J0JA 3NYOA 1JKKA 3THBA 4AQCA 4S30A 5L2SA 3LCOA 3GCVA 2RFSA 4E4NA 3CQWA 3FI4A 2PSQA 3LFSA 4HGLA 2C6KA 2UW4A 4YP8A 4CRLA 3ORNA 5JGAA 3NLBA 4TWCA 3E5AA 2OG8A 3A4PA 4CQEA 1PXKA 3W8QA 4EQUA 2W17A 4C4EA 3BYUA 4EZ5A 5D41A 2C5NA 1OL2A 3O2MA 1MQBA 5KMNA 3C0HA 3FWQA 1LEZA 4FV3A 4AW0A 4BTFA 4YBKA 5ETCA 4QMYA 3R30A 5AV4A 5ANKA 2JBOA 1OPJA 3HV3A 4GV1A 3EIDA 3OXTA 1XR1A 3PPZA 2YWPA 2X0GA 2GHMA 3REPA 4XJ0A 3VS0A 1A06A 3TDWA 2FB8A 3PIXA 3D7ZA 4KB8A 3CTQA 3NDMA 1PXPA 4FKGA 3HRFA 5FEDA 3PA4A 1E1VA 4QMLA 4BZOA 3RK5A 4Z7HA 1NVQA 2Y6OA 3PIZA 3Q9WA 2UW9A 3H9OA 3Q5ZA 4ANBA 3T9TA 4DGNA 5D10A 3QTWA 4O0YA 2XS0A 3F88A 2VWUA 2WTIA 4LQMA 3RK9A 3U8WA 4UX9A 4KIPA 4CNHA 3R9RA 3GI3A 3TZ8A 2R3PA 4W4WA 4FKTA 1U5QA 2P0CA 4HW7A 2OIQA 1APME 3R8LA 4QP6A 2W06A 4OLIA 5FP5A 5LARA 2B53A 4FTLA 1Q8YA 1YHWA 4RWLA 4F0IA 2C47A 2GS7A 3ACJA 3PJ8A 3S0OA 4CFNA 2OXDA 3OP5A 4G16A 5E8SA 3QTXA 5JT2A 2WQNA 4LOQA 4UWYA 4FICA 3SVVA 3HRCA 2CCIA 4FI1A 4IADA 1NY3A 2PE1A 4J71A 4ZZNA 5HHWA 3PLSA 3OBGA 5CEOA 2F57A 4CFWA 4FSQA 2XH5A 3QCXA 4UZHA 4GJ2A 1OI9A 2FH9A 4BIBA 5KHXA 4FV0A 4J98A 3MJ2A 2W1ZA 4X2NA 4AGUA 2X2MA 2F7EE 4O6EA 5TR6A 3UOLA 1YWNA 2BVAA 5EYMA 4G3DA 4C57A 4EONA 4ASDA 3EYHA 1V0BA 2ITZA 3I79A 3Q52A 4HYUA 3OWKA 3RHXA 1ZYSA 3ROYA 4CG8A 4TYIA 5L8JA 4F0GA 5E8WA 4D4YA 2YIXA 1OM1A 3DB6A 2Z8CA 3Q9ZA 5E92A 2WOTA 5JEBA 4ANQA 3FMKA 3LFCA 3P78A 5CQWA 5H2UA 5J95A 2ZMDA 3IGGA 5IUHA 1H8FA 4X2FA 3DB8A 3KL8A 2J9MA 3GNIB 4C4HA 2FYSA 4FSUA 2YLFA 3NNUA 1YXVA 5F20A 5BVWA 3F7WA 2IZTA 3QQLA 5C9CA 4AGCA 5CXHA 5TE0A 2XJ2A 5KO1A 2QOKA 4YLKA 2Z60A 3VUMA 4KSPA 5IH5A 4AT3A 1XH7A 2RKUA 4X7QA 5FXQA 3QD0A 1H27A 4NCTA 5DIAA 3MTLA 2OFUA 2XCHA 4R3RA 4TWOA 2J50A 3TCPA 3B2WA 4MD8E 3QALE 4BWKA 3PXQA 2CKEA 3BCEA 2UZDA 5I9WA 2O65A 4TYHA 2XNEA 3R01A 2JKKA 3F61A 3RP9A 1OKYA 2IO6A 2Q0BA 2VO3A 2CGWA 4FYNA 4MYGA 5H8GA 2BALA 1R0PA 5CVFA 4F09A 5FM3A 4Y85A 3UQCA 2YZLA 4WNMA 4TYEA 3WIKA 2G9XA 4J52A 1ZOGA 1Z57A 2XMYA 1OL1A 4XLIA 4CSVA 2H8HA 3PXRA 3D7TA 3OT3A 3LW0A 4ZY4A 5E8XA 2JD5A 4E4MA 4J95A 1IAHA 1SZMA 3P08A 4FF8A 4ZSGA 4AF3A 4BDDA 3MJ1A 5HTIA 2V62A 1HCLA 4YLLA 4NSTA 3VULA 4FYOA 3LPBA 5EI2A 2X4ZA 3LQ8A 3QZFA 5CEQA 4DFUA 3BE2A 5IQFA 5IDPA 1AQ1A 2PZRA 3POZA 4XH6A 1JPAA 3K3JA 5L3AA 4M13A 4AT5A 3QCQA 1H08A 4E6DA 4E93A 5IEYA 4DGMA 4N0SA 4M67A 4N57A 4ENYA 3OROA 4FIGA 3RAWA 4J8NA 4JRNA 2WB8A 1JKLA 3DKOA 5J87A 4BDKA 2JIUA 2VWZA 4NK9A 2VO6A 3ROCA 4EOSA 4F1OA 5A54A 4ID7A 3TUDA 4KA3A 3GC7A 4D4VA 1BYGA 2I0EA 3CLYA 2BZKB 2YERA 1O6KA 3CTHA 3MVMA 4BDFA 4D2PA 5BVEA 4IB5A 5AAEA 2XM9A 1OITA 4E5BA 4C4IA 4DFLA 3VHKA 4DH5A 2G2HA 5LCJA 5IH6A 5FBOA 3LVPA 2YJRA 1M17A 5HVYA 3NYVA 3KCKA 4AZWA 2OF4A 1J1CA 4FL3A 4RWKA 1J91A 3TIYA 4ZZMA 3VAPA 3C0GA 1BLXA 3EZVA 5JFWA 2YM5A 3FSKA 3TNIA 5CASA 1XJDA 4FSTA 2F7ZE 1FGKA 1Y6AA 3NAXA 4D0WA 5IQHA 5HG8A 4DFNA 4YU2A 4O7NA 4B8MA 1UNGA 5DE2A 3BGQA 4TNBA 4C33A 4F65A 2FA2A 4EZ3A 4FOCA 1P14A 4IVAA 4QMTA 3ANQA 5CEPA 2ACXA 3POOA 1I44A 1QCFA 4L43A 4WG4A 2DYLA 4RC2A 3T9IA 4NM5A 4FUYA 1OGUA 4LYNA 4QP1A 1SNXA 1CKPA 4JXFA 3DLSA 4RIWA 4I4EA 2ZB1A 3TKUA 3JPVA 3MH1A 5DFPA 1Q8WA 4E5AX 3NVKI 3ORZA 2QG7A 5DRBA 3P7CA 3D0EA 4S34A 4AE9A 3NRMA 1GZ8A 4O7LA 1DI8A 2GHGA 4QQCA 3KULA 2W7XA 4RVMA 1ZAOA 4IB1A 5FD2A 4H05A 4ZS0A 4HPTE 4PP7A 2C3JA 3AC8A 3CKWA 4L01A 4U44A 3GC0A 4FTMA 4A06A 4C59A 5IMEA 3EQDA 2BDJA 2Z2WA 4EOOA 4EH6A 1E9HA 2HZIA 3IECA 3VF9A 5DN3A 3K2LA 2PVRA 5GJGA 1F3MC 1MP8A 4DN5A 3GFEA 5BYZA 4NFNA 4WRSA 3UOJA 5EM6A 3FI2A 2QC6A 5EHOA 4B99A 4CGAA 5HOAA 4BL1A 3DJ6A 4FTQA 5HKMA 3D5UA 2X7FA 4GT3A 4FEVA 2VTTA 3DNEA 4N4SA 4EORA 4IIRA 4BCJA 1NT2A 2HWOA 4F9YA 2A4LA 2IZSA 3UYTA 3BBTB 4X3FC 5DEWA 2YZAA 4XRJA 1GIIA 3V5QA 1UVRA 3FQHA 3NGAA 4TXCA 3NEWA 2UZUE 4EL9A 2B54A 2HZ4A 3EQIA 2IW9A 3R1NA 4FV5A 4LGGA 3VBTA 4TW9A 1JBPE 1SNUA 4C0TA 4EOPA 4GUBA 3VVHA 1X8BA 3G33A 4I93A 4LOPA 3I5ZA 3PRFA 4U81A 3ZLYA 4EEVA 1Y8GA 4ACHA 4FV6A 3W33A 4B0GA 2X7OA 4EUTA 4FV8A 4EHEA 1ND4A 1LUFA 5HCYA 1J7UA 5HD7A 2ITOA 2C4GA 3R9OA 2WMSA 3MIAA 3VC4A 1WBWA 3GU5A 3HRBA 4BBFA 3MESA 4IFGA 4V01A 1PXIA 3IK3A 4W8DA 1Y91A 4HGSA 5J5SA 4IWOA 3QWJA 3TM0A 4KKEA 3SDJA 2JC6A 3ZO3A 2FSTX 4P7EA 2XYUA 3UQFA 5EQEA 3P23A 5J8IA 3R9HA 4BZDA 4ZLZA 4LMNA 2W4OA 1UKHA 1KE6A 4ZJJA 5HE2A 5ITAA 2OBJA 4QMUA 4BDGA 3LCKA 5DPVA 5M56A 4G6NA 5HD4A 4RIOA 4BKZA 5IMXA 1OIUA 3GQIA 4R3PA 2IG7A 4DCAA 3PXYA 1UNHA 3AT4A 3GP0A 2BFXA 4I3ZA 2WEIA 4R7IA 4BN1A 3KU2A 1ZZLA 2W1HA 5HU3A 2F49A 4O0VA 3O8UA 5M51A 4O0SA 2R3JA 1OKWA 2O63A 4RQVA 4F7LA 3FAAA 3QA0A 4TTHB 2C3IB 3NNVA 3UNJA 1DM2A 3ENHA 5BYLA 2EUFB 4RG0A 2NO3A 4JBVA 5HESA 1UU8A 3COKA 2ZV7A 5IQAA 3MYGA 4GU6A 3LQ5A 5GIOE 2PUNA 3TN8A 5DWRA 3BHYA 4OR5A 3R7UA 3G5DA 4DH8A 3MVJA 2QOBA 3NCGA 3LMGA 4AX8A 3MH2A 2YITA 3RWQA 3R83A 4CXAA 3HV4A 4R1YA 4ZTNA 3UVPA 2QR7A 1ZYLA 5EYKA 2UZWE 1K2PA 4RJ4A 2VX1A 4YPDA 3RPVA 3UP7A 3OCGA 3LXLA 3NUSA 1Q24A 3ET7A 2A0CX 2QHNA 3V6SA 3JR1A 4L8MA 3FV8A 5HX8A 3LLTA 5HICA 4FKPA 2XJ1A 3CY3A 5CX9A 3F82A 1YVJA 4BWPA 4P5QA 5F9EA 1M2RA 5ANDA 2CLXA 3DJ7A 4GIHA 2WHBA 4LRKA 1J7IA 1OBDA 4G34A 5CF6A 3R8PA 4FX3A 3E8DA 1QPEA 4CEGA 2QU6A 2XCKA 2ITTA 2WU6A 4FK3A 3GUBA 4AOIA 4NJDA 5AR4A 3VUHA 1ERKA 3C9WA 5HCZA 4HVSA 5JFSA 4MQ2A 3COMA 3DQXA 4I5PA 5HZNA 1T45A 3OWLA 2GDOA 5AIRA 5DT3A 5ANEA 3TT0A 3B8RA 2VD5A 5D7VA 2J7TA 2E9NA 3F2AA 5BMMA 1DAWA 4I92A 4UYAA 5AV2A 4V05A 5B2LA 2WGJA 4FV9A 4IZ7A 3ULIA 4CYJA 4LL5A 1ZYJA 3PA3A 4UZDA 5IQDA 3ZLWA 4ITHA 2C0IA 2C5OA 3R7OA 1W82A 4RA4A 4YZMA 2AC3A 5C8MA 1ZOEA 3CBLA 3MSSA 3LOKA 1JAMA 3P7BA 3BKBA 3QTUA 1M7NA 4ASEA 2VTJA 4MNFA 4C4GA 4FG7A 2R64A 4RFZA 3ZSGA 3DA6A 3ZO2A 3ZYAA 3I81A 4RMZA 4QMNA 2BTSA 3D9VA 2CGUA 1UKIA 4GG5A 1KUTA 3PJCA 2HOGA 4G3EA 3UDBA 2E9VA 2Z7LA 4EOLA 4G6OA 1YWRA 5AR3A 3ZUUA 2ERZE 3QUPA 1J1BA 4ZTHA 4FUXA 1H1SA 3ZU7A 4E20A 4CKJA 2YACA 5CXZA 4WG5A 5HVKA 5CYIA 1H01A 2UVYA 4BCGA 1Z5MA 3Q2MA 4G3GA 1E1XA 3UNZA 2IZRA 2PVKA 4TWNA 4NM7A 5ANIA 2C1BA 1M52A 3QWKA 4ASZA 4IWDA 4EOKA 4ASXA 1XH6A 4JNWA 5B0XA 4L67A 5CNOA 4C8BA 5E8TA 5JZNA 3WYXA 2B9HA 5BYYA 1XBBA 2CLQA 4I6FA 3VUTA 4CV8A 4DTBA 3TEIA 4G9CA 3TJDA 4QTEA 4O7VA 2C6TA 2ZM3A 3VBYA 4ACGA 3LCSA 4IM0A 4X2JA 2ITXA 4OGRA 5KMJA 3E64A 3JY0A 5ICPA 3KGAA 4M84A 3W32A 4QPSA 4RVLA 2UW7A 4R6VA 2XUUA 3EJ1A 4MD9E 4QP9A 2IW6A 4R5YA 4TKSA 4CFFA 4YMJA 5KCVA 3UO5A 3PZEA 4DT9A 2OZAA 3COIA 3AMAA 2XKEA 5CEIA 4AZTA 3LXPA 3ZDIA 4OTWA 3IOPA 3DK6A 3VBWA 4XG8A 2YCFA 3NUPA 2J51A 3V51A 4C3PA 3ANRA 4E8AA 5LXMA 4BCQA 3DDPA 4DEIA 1Q5KA 2JITA 3G2FA 4M8TA 3PSCA 3AQVA 2JKOA 3EZRA 4FNZA 4EH2A 4UWBA 4G5JA 4PPAA 4XG9A 3BHUA 4O1OA 4HVHA 3MFUA 3HDMA 4DGOA 3IDPA 5AV1A 5KBRA 4Z9LA 2F9GA 4HCVA 4EBWA 3A7IA 2FSOX 3QX4A 4RJ8A 5CI6A 3L8VA 3BV2A 3FI3A 3FLWA 2C6OA 4IHPA 2R4BA 2IVSA 3DTCA 4EH3A 1HCKA 3VS5A 4X3FA 1RQQA 3ERKA 4TN6A 3SQQA 3EKKA 2ITVA 3T8OA 4GVJA 2AUHA 4QP7A 5K0XA 3KXMA 3ZLSA 3GU6A 5DMZA 5D11A 3W2OA 5FBNC 4RX5A 3SOCA 2X6DA 3MH0A 2W99B 2XB7A 4FZ6A 5JK3A 3QC9A 2XK7A 4CT1A 3FXXA 1IR3A 3UOKA 3RMFA 4Z16A 2PUIA 2YDKA 5GIPE 1B39A 3QQFA 4TWPA 4XP0A 2FSMX 2HK5A 3O50A 1WMKA 2I6LA 4FSYA 1OIQA 3ORIA 4PPCA 2Z02A 2ZOQA 4YZBA 2GS2A 4YZNA 2GPHA 4KKGA 3NIZA 3QGYA 4NW5A 4RFMA 2G15A 4RWIA 3ATSA 2EXCX 3FMJA 3R1SA 3GEQA 4Q9SA 4HNFA 5CAPA 4O0WA 5ACKA 3Q4CA 1ZMUA 3EHAA 3EQCA 4U6RA 4IX4A 2GU8A 3RZFA 3QRIA 3OCSA 4AN2A 3KRRA 2WFYA 3R7YA 2WAJA 3R1YA 4AZFA 4B6LA 4PMPA 2ETMA 5A9UA 3H0ZA 3KRWA 4GFMA 4HNIA 3BBWA 4K9YA 4PDSA 4TYHB 1YKRA 1QL6A 3NCZA 1F5QA 2HZNA 3JYAA 5AMNA 3DZQA 4ITIA 5IQIA 4FTNA 2B0QA 3RBWA 3RAHA 4O2ZA 3QZIA 3Q96A 4ANOA 5KMOA 5AP4A 1Q8ZA 3RI1A 4S32A 4AXAA 1U46A 4S2ZA 4U8ZA 3TTIA 4B7TA 3D7TB 1W84A 4OTIA 3I0QA 4YJNA 2JDTA 2B9JA 5AWMA 3ZBFA 4B8LA 4FKJA 2GMXA 3QKMA 4O7RA 4K18A 3KXHA 4FZAB 5JKGA 1PXMA 4KAOA 3CPCA 4WA9A 3DS6A 2OLCA 1STCE 2UVXA 4XOYA 4Q9ZA 5J1VA 2BZJA 3LFAA 3AT3A 3KVWA 3L8PA 3BE9A 4IM3A 4BDBA 1VYWA 1VZOA 3PY0A 3C4XA 3U9CA 5FXSA 3VQUA 2G1TA 3GCSA 3R7GA 2H6DA 1LP4A 1REKA 3KF7A 1FINA 4ZLOA 1S9IA 3QUEA 3WE8A 1PKDA 2O64A 4WG3A 4MK0A 1QMZA 4U3YA 3LLAA 1LR4A 2Y9QA 3D15A 3UIUA 4QQJA 5M08A 3ZSIA 5K3YA 3W1FA 5KMMA 3TV7A 2QLUA 2Q0NA 5EG3A 4KIOA 5LVOA 1JSVA 3E8CA 3NUAA 2CSNA 4LM5A 5C03A 4AA5A 5I3RA 5EDPA 3I6UA 5JH6A 5L4QA 4WHZA 4Q5EA 5KNJA 2WU7A 2R0IA 2OK1A 3NAYA 2X9EA 3IO7A 1PY5A 4QNAA 4O82A 5L8KA 5KUPA 2YCRA 3DAJA 4EK4A 3KVXA 1Y57A 2WIPA 4QOXA 3RWPA 2WELA 2WTKC 3O8TA 1DI9A 4FEXA 5AX9A 3L9MA 3SXFA 1BL7A 4ACCA 4I0RA 4E1ZA 3AC1A 5I9VA 1M2PA 4IW0A 1K3AA 2FO0A 2QCSA 3QHWA 1BX6A 2Y4IC 4QD6A 4XLVA 3UVRA 1GAGA 3W10A 4MCVA 4FOBA 4CD0A 4GJ3A 2UW8A 4IZAA 4H1MA 1I09A 4QYGA 1ZY4A 4QP2A 1PRYA 2H96A 3HECA 5A4QA 3RPSA 3CSVA 4QPMA 1IG1A 3BYSA 4LFIA 5K0KA 4IACA 4EK6A 4II5A 2VTAA 4RIWB 3U54A 2PPQA 3NR9A 4YJQA 4PTGA 5FDXA 4BVUA 1OZ1A 2XIKA 1PYEA 4DEHA 5AADA 2HWPA 4UYNA 4WSQA 4O2PA 2R7IA 2VTQA 4A7CA 2VWWA 2BHHA 2XBAA 2BKKA 3KULB 3SC1A 3TV4A 4JBQA 4NJ3A 1GY3A 3TTJA 5HBHA 4O0TA 5ANJA 3OS3A 2R3RA 3F7ZA 4L52A 4ERWA 3RK7A 4F08A 3VS3A 3OWPA 3PWYA 5FRIA 3V5WA 5M4IA 4AN3A 4E4XA 3D2IA 5AUYA 4U80A 4QO9A 4J1RA 4G2FA 1NXKA 4U43A 1H1PA 4ACDA 4IAYA 4BDEA 4IEBA 2JAMA 4BKJA 3R8VA 5E91A 3GENA 3R28A 3FZ1A 2B4SB 3AC5A 4RX7A 1PXNA 2B55A 3G9LX 4UMUA 2WTVA 4YZDA 3U55A 3RZBA 1BI8A 3BHVA 4BTJA 5HORA 4JG7A 5DI1A 5E4HA 5GJFA 4R7HA 2PZIA 2ZVAA 2VAGA 4PMTA 4DYMA 3ZUTA 2PVYA 2OJ9A 3RKBA 4WSYA 3NW7A 1G3NA 3WARA 1ZLTA 1YOJA 3EL8A 3MFRA 4F7NA 4F7SA 2XK3A 4D2VA 4PP9A 4F9BA 4Y5QA 1MRYA 2VTRA 4X2GA 1O6LA 3DK7A 1GZOA 4I24A 3QXOA 3OXIA 4EKLA 1SYKA 2YM6A 4BBEA 2REIA 3PJ1A 4JIAA 5DR2A 4CTCA 2R0UA 5CT7A 1RW8A 1DAYA 3SXRA 4XG4A 4D2WA 2GQSA 3MA6A 5BUEA 4O6LA 2IVUA 3VO3A 4RT7A 3HMIA 4EC8A 5GZ8A 4DCEA 4EK5A 2HXLA 3OCTA 4QTBA 5EM5A 5IG1A 4LGHA 2OSCA 2X2LA 1SVHA 3ACKA 4IB0A 5CWZA 3R63A 1H25A 4I23A 3PPJA 3FL4A 2WPAA 1PMNA 5CF5A 2XNGA 4BCKA 4M0ZA 4D1ZA 4Z7GA 4FSNA 4F0FA 4FTIA 4NU1A 3KXNA 3OF0A 5I9ZA 5AAFA 3AT2A 3DQWA 4ANLA 4AS0A 4MQ1A 2WMTA 4PF4A 4XG7A 1YDSE 3UG2A 2E2BA 4U41A 5I0BA 5EKOA 4AW2A 4ZTMA 3MFSA 2V5QA 2F4JA 4L9IA 1OUKA 1PMVA 3AGMA 4O86A 4GT4A 3VW6A 4NTTA 2BCJA 5JQ8A 3L9LA 4GKHA 3CJGA 5BMSA 1XKKA 3CKXA 3U9NA 2J2IB 4FZDB 3KMWA 1AGWA 2XIRA 4QMMA 3P4KA 3DY7A 4RJ6A 2HENA 5CU2A 4W4VA 2ITYA 5E9EA 3OY1A 4NUSA 4WBBB 4XHKB 3U6IA 4O7TA 4LMUA 4MXZA 3EH9A 2ESMA 3EN7A 3ZZWA 3W2SA 3DBEA 4J8MA 3UMXA 3VRZA 3FUPA 4IAAA 4YTFA 3CEKA 5DH3A 3PPKA 4CVAA 1RE8A 4GFOA 1YXUA 4QPAA 5CSVA 4ERKA 5EOBA 3UMWA 4WNPA 5BVKA 2OIBA 4FT7A 2R3LA 4O96A 1MUOA 4KKHA 3U4UA 4DH7A 4Z3VA 5EDRA 4K8AA 5CQUA 3LFEA 3ORXA 2R3FA 3PVWA 2RFNA 3CP9A 4MBLA 3AC3A 3WF7A 3ZXTA 4U0IA 3ZOSA 4AOTA 1KE5A 2C6MA 4EH9A 5GZ9A 3DXNA 3KRLA 5CS6A 4BCHA 2PMIA 3CQEA 4C3FA 2QOHA 2AYPA 4RX9A 2ONLC 1YDRE 3VBXA 4BDCA 3DBFA 3O7LB 4J96A 3U51A 4OTDA 3L9NA 3TG1A 3MY1A 1FMKA 3H4JA 3COHA 4D4SA 4U97A 4O0RA 2E9OA 4BYIA 4BCNA 5DR9A 1CKJA 4BCFA 4YUQA 2UV2A 3QUDA 4ZMEA 2V22A 3ZM9A 3W2QA 2BRNA 5HE3A 4BI0A 4IDVA 3NS9A 3GC9A 2VNWA 2NRYA 2QO7A 2X4FA 3NVMB 2R3OA 4DC2A 5K9IA 5AP1A 3GOKA 4EHVA 3FMLA 5M4CA 4AW5A 4PL4A 3A8XA 4P2KA 5HTCA 2WMXA 2YM4A 4RQKA 3CS9A 1WBVA 4EH4A 4XP3A 2NRUA 2RGPA 4FT9A 3PE2A 3H9FA 4WO5A 2EU9A 3R7EA 1MRUA 3AMYA 1H1RA 4QMPA 3ZRKA 4O38A 2UW3A 3DDQA 2QURA 3PWDA 2FSLX 4RLKA 3QCSA 4I5HA 5HTBA 3FMEA 3ZSHA 4AE6A 2I7QA 2WQEA 2PE0A 5EYCA 3W8LA 4AG8A 2PHKA 2W05A 5LMBA 2B7AA 3BEAA 3PFQA 2IZUA 3F69A 4KWPA 4NTSA 4EOMA 4I20A 5CLPA 3UGCA 3VHEA 4FT0A 4R1VA 3BGZA 4G31A 4CLIA 4W9WA 4RVTA 3QRJA 3W2PA 4O7WA 2VGPA 4YHTA 2OF2A 5IH4A 1PMEA 2VU3A 3EFWA 3UPZA 4FC0A 3ZUVA 3HMPA 5LVNA 4U7ZA 3W18A 4EI4A 3A61A 4JI9A 3KXGA 2BILB 4DTKA 4YHFA 3FMDA 4DBNA 2OZAB 5CTPA 5FDPA 4W4XA 2YIQA 3PG3A 2J5FA 3IW4A 3Q04A 4RA5A 2NNWB 2IVTA 1PF8A 2VWXA 3GQLA 3UPXA 2PL0A 1R78A 3FBVA 4GG7A 3F2RA 3FLZA 3L8XA 3UZPA 4A9TA 1BMKA 4ZXTA 2V7AA 4WOVA 3L9PA 3HA6A 4GCJA 4RWJA 4XRLA 4FEQA 3RTPA 4I6QA 3ZMMA 3AC4A 4R77A 4OUCA 3SKCA 4XEYA 5A3XA 1NVRA 4XG6A 4H3PA 5E7RA 5EI6A 3QRKA 3GU4A 3FC2A 1YRPA 3DZOA 2GTMA 2ZV2A 2H9VA 4NFMA 4FSWA 5IQGA 2Y8OA 3R2BA 5M4FA 2EWAA 2OH0E 5GZAA 1V1KA 3K54A 1ZARA 4M7IA 4UBAA 4QP3A 4PRJA 3W2RA 3M1SA 3V8SA 3NNXA 4F1MA 5E1SA 1CSNA 4ITJA 4X3FB 2HIWA 4YJRA 5JRQA 5EK7A 2C6LA 3NYNA 3OVVA 5BVOA 1IA8A 4OTRA 1YHSA 4EYMA 3TI1A 2HAKA 5LVLA 3VS1A 5HO7A 4ONAA 4DE4A 3A8WA 3C51A 4F6WA 3F2NA 3EYGA 4QTAA 4PTEA 4UMRA 4JJRA 4N6ZA 4YHJA 4S33A 4EH8A 4F6SA 1URWA 2DS1A 3WI6A 4MD7E 3GT8A 3CE3A 3WIGA 2BTRA 5H3QA 4X2KA 5C26A 3V8WA 1G5SA 2OJIA 5F95A 3V5LA 2JEDA 3BLHA 3C13A 4TY1A 4ZP5A 5EI8A 5AFVA 3M42A 2C6IA 4O22A 2X39A 2W5HA 3WZJA 3BRBA 2YIRA 3IG7A 4K0YA 2C5VA 4M69A 4FTRA 1K9AA 4F1TA 3KRXA 3PA5A 4NH1A 4AAAA 1PKGA 1OL6A 5AP5A 2XP2A 5IQEA 3PTGA 3T3VA 4BZNA 4QMWA 2YM7A 4DLJA 2C0TA 5IQBA 4OTQA 4C3RA 4GFGA 3VWAA 4DGLC 1HOWA 3MPTA 2ITNA 2OU7A 3N51A 4RIXA 5CAVA 3OC1A 1YI6A 3FLSA 2C1AA 3R22A 4BI1A 2Y0AA 4V0GA 3DXPA 4UXLA 4Y73A 3FKNA 3QL8A 4NEUA 1WBNA 2YWVA 4PDYA 4KNBA 2ZMCA 2OI4X 2VTNA 4EHZA 2JGZA 2VWIA 2WOUA 2X9FA 3AOXA 5CZIA 2V55A 3HA8A 1H24A 5CSPA 4FSMA 4KS8A 3MBLA 1Q41A 1A9UA 3IONA 1XH4A 3TNWA 3SV0A 5BPYA 3GVUA 4FKLA 1M14A 4XCUA 4IXPA 5KE0A 2OGVA 4L00A 2ITUA 3QX2A 4EZ7A 2XRUA 4H58A 3CGOA 3TZ9A 5J5TA 5KMIA 4AT4A 2CNVA 2W5AA 3LJ2A 1H0WA 5L6PA 4IVCA 4FKQA 3CJFA 3O17A 2J5EA 3C4EA 4FL2A 2XNPA 2WQOA 4USDA 3WF6A 3ZEWA 3UIMA 2RL5A 2P55A 5M09A 2BAQA 3C5UA 4MKCA 5JRSA 3TXOA 2PVMA 3QQJA 2PUPA 1OPLA 3D14A 5TOZA 3NW5A 2YHVA 3S4QA 3TWJA 3LFQA 3LCDA 3BGPA 5C1QB 3MN3A 3PLAE 4RGJA 3PG1A 3A62A 4QMXA 4NT4A 3SW4A 3UIXA 5HU9A 4R8QA 5L6WL 5L8LA 1IEPA 5TF9A 3D83A 4FV4A 2IJMA 1WVWA 3MA3A 3O71A 1WBOA 2OJFE 4KINA 5AUZA 4HGTA 3EFLA 4X6RA 3V6RA 3BELA 4FIIA 2GQRA 3T3UA 4BGGA 3PYYA 2HY81 3EQGA 5IA4A 3C0IA 3HMOA 3ZDUA 3TUBA 4PUZA 4U9AA 3RCDA 4EOJA 1WBTA 4JAJA 1QPJA 2ONLA 3RAIA 5AUVA 4BHZA 3ITZA 2VTPA 3M2WA 4A9SA 3R00A 2J4ZA 4C58A 2BIKB 4Y83A 4D1SA 5FXRA 4K33A 3SGCA 4M14A 4QQTA 4C35A 4UY9A 5E8YA 3UNKA 5A4TA 3L1SA 3EKNA 3PVUA 3I7CA 4BTMA 2UW0A 3Q53A 3ALNA 4E6AA 1U54A 5A14A 4AGWA 3FHIA 3AG9A 2UVZA 2SRCA 3MVHA 4CKIA 4RSSA 4IJPA 4I5CA 4UXQA 3R04A 2PULA 2IWIA 4ALWA 2YLEA 4CG9A 4JIKA 4E4LA 4N70A 3EMGA 4FKSA 4FVQA 2HELA 3EN6A 2GSFA 4F6UA 2OXXA 2X1NA 5FM2A 4C34A 2OFVA 5HLPA 3TL8A 4ZOGA 1PJKA 4OTHA 4JQ7A 4ZSJA 1H07A 1NVSA 3AC2A 1CMKE 2XA4A 3EN9A 4I6BA 4EQMA 3QRUA 3RPYA 2O0UA 2BMCA 4LV8A 4L6QA 4FNWA 4LOOA 2VWBA 2A2AA 1JVPP 4ACMA 5M44A 2PU8A 1PW2A 4IWQA 1R3CA 2YFXA 4RZVA 4Y72A 1H28A 4YZ9A 5J1WA 1G8AA 3RALA 1TQIA 4MHAA 2A1AB 2HW6A 2BPMA 1MRVA 4BYJA 3F66A 2W0JA 3SG9A 3Q6WA 3OW4A 4ZTRA 5I3OA 1GZNA 4GYGA 4FTTA 5HG9A 3HLLA 5DGZA 2R2PA 4YR8A 3AD5A 4CMTA 1BUHA 4EOQA 5FTQA 3SA0A 3HUCA 5AP2A 4CKRA 3Q4TA 5CU6A 3IQ7A 1ZWSA 4D4RA 1ZY5A 1OPKA 3KC3A 4MVFA 2WEVA 4QYHA 5CI7A 5A4EA 4A4OA 3BLQA 4FGBA 3ID6C 4DFXE 4LRJA 2XNBA 2BAKA 2GQGA 3FJQE 3OOMA 3A7JA 2DWBA 4BDAA 5J7HA 4NIFA 4C62A 2XNNA 1QPCA 4ENXA 4BIEA 2XK8A 5CSHA 4LRMA 2XK4A 2QONA 3P5KA 4IDTA 2OH4A 4FSZA 5ETAA 4EJNA 4DT8A 2C6EA 5I5ZA 4K1BA 1YHVA 3OD6X 5EHLA 4DAWA 2RG5A 3LXKA 3M11A 4JOAA 5CF8A 4KUJA 4HVIA 3MH3A 3F5PA 4DTAA 1U59A 2YEXA 4GT5A 4HYSA 3FZOA 3NPCA 3LAUA 3HEGA 2C5YA 4JS8A 5D1JA 4DF3A 2EB3A 1Q4LA 4IC8A 4FT5A 4BCPA 1TQMA 3VS2A 3EN4A 3NUUA 4BHNA 3EQRA 4G3CA 4APPA 2HXQA 4QT1A 4BDJA 2PMOX 5G6VA 3TNHA 4ORKA 4RFYA 4XV3A 3HV5A 5DT0A 3IDCA 3OFMA 5ETIA 4DHFA 4HOKA 4YNOA 5AA9A 4BRXA 4YLJA 3CR0A 3KCFA 4EOIA 1QPDA 5AAGA 3I4BA 3DKFA 5F4NA 4NKSA 4FGRA 4E7WA 4M66A 1OKVA 2J90A 3IW7A 4DEBA 5CY3A 5JGDA 3IGOA 1ZZ2A 3NUNA 3EQFA 5HQ0A 2X6EA 4L42A 3PXFA 3QBNA 1OIRA 3TIZA 4IAIA 2WO6A 3BU5A 3BU3A 2QKWB 5CF4A 3KKVA 4C02A 3LQ3A 3QYZA 3A7GA 5DHJA 2WMBA 3BPRA 4J7BA 3II5A 5IZFA 1J7LA 1SMHA 2CN8A 3F3TA 1F0QA 3JS2A 1RDQE 3JVRA 4YSJA 3BWJA 2C6DA 4WBOA 4ARKA 2YN8A 4C36A 2ZB0A 4MXOA 4L3LA 5E8ZA 4NWMA 3H10A 5FUTA 1PXOA 2YJSA 4IQ6A 3D5VA 3TUCA 1JNKA 4OT6A 1BKXA 2OZOA 4YNEA 3HNGA 3BLRA 3D94A 3S95A 3IOKA 3TACA 3UP2A 5CANA 2QOFA 2UZNA 5GHVA 3LJ0A 4FIHA 2VWYA 2PVJA 4CFMA 4E3CA 4L45A 4FG8A 4ZMFA 2G01A 2BRBA 3DBDA 4YTHA 4YURA 4FNXA 3H0YA 4MF1A 4EC9A 3RM7A 3WE4A 4EK3A 5CALA 4XV1A 3FPMA 4GK3A 3UBDA 5M07A 2YDJA 4RC3A 5EHYA 4BDHA 3CCNA 3FMHA 3O0GA 5HE1A 2I0HA 4JQ8A 3RJCA 3HL7A 3UQGA 4QMQA 4DA5A 1WAKA 4G6LA 5AEPA 3HV6A 4RX8A 5J9ZA 1UU3A 1FMOE 3E8EA 2WTDA 3QLFA 5A46A 5IA2A 5LVPA 2X81A 4D5KA 4O21A 2ITQA 4AN9A 2QOIA 3L8SA 5EM7A 3H9RA 2WMWA 1B6CB 2VZ6A 2UZOA 3A4OX 1Q61A 3SOAA 4O7SA 5DR6A 5C27A 2PZPA 3A2CA 3MWUA 3PRIA 4G3FA 4DEDA 3UZTA 3BX5A 2VTMA 5CU4A 3OEZA 2E9PA 3SLSA 5EFQA 3VQHA 3QFVA 4DFYA 5EOLA 4K6ZA 1XWSA 3KA0A 2VO0A 4I94A 3DAEA 3R02A 5HX6A 5JFVA 4OAVB 2JDOA 2VTSA 3BWFA 2Z7QA 4I21A 4ZSAA 1ZMVA 4A07A 3QKLA 1YI3A 4YC8A 3GBZA 4ZEGA 3K5VA 5KBQA 4OTGA 2C5XA 3S00A 2RF9A 2CMWA 4TRLA 2F2UA 2QOCA 5EW9A 2XNOA 4AFEA 3UC3A 3BQCA 3CXWA 1BL6A 4EH7A 2P4IA 3ZC5A 4MF0A 3EL7A 1VEBA 5KX8A 4AA0A 1OVEA 4WIHA 4HGEA 1GZKA 4QYEA 3DV3A 3FPQA 5JSMA 5AP6A 2PVNA 3ELJA 4R5SA 5I9UA 4KSQA 2XK6A 2PK9A 2WQBA 1Y8YA 3I60A 1OL7A 4DG3E 2ZAZA 2PUUA 4OTFA 4L3PA 3OHTA 3B2TA 3F5UA 1GIJA 5HO8A 4ZJIA 3VUKA 2GNGA 4Z55A 3ZONA 2WTKB 4HCUA 2XNMA 5GJDA 3R7VA 4C4JA 1OECA 4GRBA 3VS7A 2XKFA 4AUAA 4P4CA 3SW7A 3LKMA 4PMSA 4BC6A 1H4LA 3P1AA 3U6JA 2XIYA 1CKIA 1FQ1B 2Y4IB 2UZLA 4BY9E 2QI8A 5DNRA 5J79A 3LHJA 3O7LD 2JLDA 1O6YA 5AX3A 3TKIA 2FGIA 3VUDA 5L2WA 3BYVA 3C1XA 3IPHA 2PWLA 5HI2A 4BBMA 1WBSA 2B1PA 2CKOA 2QVSE 1TQPA 4AOJA 3FL5A 4F9WA 5F1ZA 4QYYA 5BUJA 4GH2A 1NW1A 3A7HA 1WZYA 2BRHA 3NWWA 2WTWA 5DRDA 3O96A 4EHGA 3JY9A 4BR3A 3OY3A 4U3ZA 1P5EA 3FI8A 2HCKA 3OMVA 4A9UA 4JQEA 4AU8A 3PJ3A 3GCUA 5HNBA 1FGIA 3P79A 4MXAA 2V0DA 2ZM1A 2ITPA 2RSVA 3FY0A 4FIJA 4KIQA 4QRCA 4ZIMA 2EXMA 2P2IA 3P0MA 3ORKA 4HZSA 3NUYA 3FMNA 4QYFA 2VNYA 2XEZA 3DBCA 4ZTLA 4EWQA 5EDQA 2F7XE 3KF4A 4PNKA 3FEGA 3I6WA 1GNGA 2G2IA 3GC8A 4ANMA 4LGDA 1Y6BA 2ZV9A 4USEA 2BROA 3FDNA 5DYJA 4JDIA 4TNDA 3VF8A 1JSTA 2KULA 3HZTA 3EWHA 3FYJX 4XNEA 3TV6A 5L6OA 1ZRZA 3DKCA 4BGQA 2B9FA 4PDPA 2UW6A 3HMNA 4NYEA 4O91A 5L2TA 4PL3A 3R8ZA 2YISA 3PXKA 3UC4A 1L8TA 2O3PA 3PP1A 3GU7A 4RJ5A 1UA2A 3MB6A 3P7AA 4D28A 4O27B 5FEQA 1UU9A 2R3IA 3LCTA 1R0EA 3OUNB 4TL0A 3NMUF 4ALUA 4TZRA 2XIZA 2QR8A 3A99A 3MY5A 4A4XA 1FBNA 3ZZEA 5DEYA 4I41A 3PXZA 3CQUA 3C50A 3DT1A 3QD3A 2OICA 2DUVA 2C0OA 2ZM4A 3ODZX 4CQGA 2QOOA 5IA0A 3G0FA 3BU6A 4FBXA 5LMKC 5DOSA 3V8TA 4EJ7A 4IX3A 3UODA 3LJ1A 3RM6A 4KBKA 4Y8DA 3GB2A 4XP2A 2X8IA 3SRVA 3WZKA 4MEDA 2UZEA 2XK9A 2HZ0A 4FTOA 4JDKA 3E62A 1IASA 3DJ5A 2WTCA 1URCA 4NZWB 3LFNA 5AR8A 2JIVA 3ZTXA 4EWHA 4F99A 4M68A 2QG5A 2XJ0A 4DINA 3FZSA 3VN9A 3ZO1A 3DU8A 4FEWA 4YC6A 2PVFA 2GFCA 4FZFB 4M69B 3HVCA 5DA3A 4JX3A 1ZYDA 1JLUE 2W5BA 2B52A 4IAFA 3HYHA 4OT5A 2JDRA 2Q83A 4GK2A 1JOWB 3PIYA 4FKRA 4Y5HA 5K4IA 3Q4UA 4FT3A 4G1WA 2W1DA 1GIHA 3Q3BA 3QC4A 4XX9A 3VBVA 3ZRMA 1OIYA 4F64A 1Q3DA 1VJYA 3E92A 1CTPE 3SX9A 3KRJA 4FTUA 4RIXB 3DCVA 4PPBA 5HIBA 1OBGA 3E8NA 4FEUA 3NZ0A 4FSRA 3I5NA 3K5UA 3O23A 4V0GB 2R3NA 3DAKA 4GVAA 4LL0A 5H9BA 2OXYA 4FA2A 2QQ7A 3SD0A 4U42A 3UTOA 5AR7A 4C4FA 5T6KA 4NW6A 4YJOA 3SG8A 1W0XC 4O84A 2J6MA 4UN0C 4O7ZA 4E6QA 3JVSA 4L3JA 4DEAA 5IU2A 2YCQA 4Y95A 3ORPA 3R71A 4XS2A 4I22A 5B7VA 4PX6A 4FR4A 3DOGA 1YDTE 2W4JA 3HAVA 4M12A 2QLQA 4FKVA 4W9XA 4DG2E 2W96B 2I40A 1IAJA 3RVGA 5CAUA 4BTKA 4DG0E 4KABA 4IJ9A 3KN6A 2VWVA 1YQJA 5D9HA 5C4LA 4CTBA 3HP2A 2WMUA 1H00A 2ZYBA 4I4FA 2A27A 4O81A 4HVGA 5LWNA 4UALA 3AMBA 4BWXA 5I9YA 4KBCA 3WZUA 1LPUA 3ATTA 4PV0A 3V5JA 3QD4A 2CN5A 3KK9A 4BFMA 5EQYA 1DS5A 3K3IA 1KE8A 4RIYA 3VS6A 3TZ7A 2CGXA 3MW1A 4U5JA 3Q60A 5CAQA 2OIDA 4H1JA 2JFMA 1LEWA 3MS9A 3TJCA 1ZOHA 1JQHA 4GL9A 4B9DA 3N9XA 4EUUA 2FVDA 4JG6A 4XV2A 4H36A 5HGIA 1Q62A 2WMAA 5H8EA 1P4OA 1SM2A 2ZDTA 2CKQA 3HKOA 3ZO4A 4N6YA 3HDNA 3R9DA 4WT6A 2QODA 4F9AA 4UEUA 3FZTA 5KHWA 3E93A 3EFKA 5I4NA 2FUMA 3JUHA 4DFBA 4YJSA 5B2MA 3ULZA 4YJUA 2BKZA 2WZJA 5IEXA 4MNEA 5CVHA 3ZFMA 3CD3A 1OUYA 2RFEA 3NSZA 2OO8X 2YM8A 3DBQA 3FKOA 4K11A 5CU3A 3VUIA 2OW3A 3C4CA 4RC4A 3IKAA 1VR2A 4DH1A 5IUGA 2RFDA 1U54B 2O2UA 4OBQA 4QP4A 5IPJA 4QTCA 4CCBA 4FL1A 2OJJA 4KIKA 3ZBXA 3E87A 4NKAA 1J3HA 4A9RA 1RJBA 2Z7SA 3MPAA 3WF5A 1WBPA 3MY0A 4W4YA 3TNPC 4FIFA 2C69A 5CEMA 3VW8A 2WKMA 3BI6A 4MTAA 1Q97A 2R5TA 4H3QA 4I1ZA 2J0IA 2UW5A 4RJ3A 1SVGA 3V01A 2IPXA 3LFBA 2PVLA 3FLNC 3TKHA 4JDJA 1MQ4A 2V7OA 4MWIA 3UJGA 3BQRA 3AGLA 1VYZA 4M97A 1OMWA 4MAOA 2RIOA 2W1FA 2XM8A 4AZVA 4R7BA 5CVGA 3KMMA 5HCXA 3ORLA 5IUIA 3N4UA 3PP0A 3GCPA 1YOLA 4NL0A 4RPVA 2LGCA 2W9FB 3FE3A 4GW8A 4MX9A 2KTYA 2WMRA 1WFCA 1YOMA 3RNYA 3A60A 3ZHPC 1WCCA 2F2CB 3OBJA 4HCTA 4K77A 4L7FA 4AZSA 4D58A 1P2AA 1KOBA 3OUKA 1YXSA 5CSWA 5EM8A 2PE2A 4F63A 4CCUA 4IVBA 3GCQA 4KS7A 2WIHA 5FQDC 2WXVA 4JRVA 5BVFA 2J0LA 2W1EA 5JQ5A 3O8PA 3LMHA 4CMUA 2JDVA 3RAKA 2X7GA 4BGHA 4LV5A 4YC3A 2PMLX 5AV3A 2YM3A 4V04A 5TT7A 1YXTA 2CJMA 2I0YA 4PNIA 5HBEA 3N4TA 1P4FA 1H26A 5JMSA 4OTPA 3P86A 3D5XA 1PMUA 4IFCA 3ZFXA 4CZUA 1M7QA 5LWMA 3WZDA 4XUFA 4QMZA 2WQMA 3D5WA 3RINA 4BCMA 4O0UA 4ZLYA 5T3QA 4NIFB 1FPUA 2JBPA 3LE6A 2EB2A 4ZTQA 3E3PA 1Z9XA 3KREA 3UYSA 3CC6A 3TDVA 3FYKX 3QCYA 2C3LA 2NPQA 1UV5A 3WF9A 1XBCA 5J7BA 3NIEA 3KXZA 4RVKA 3QHRA 5HLNA 5HEZA 3C7QA 4ZK5A 3ZM4A 3BIZA 4G5PA 3C4FA 3NX8A 2GNIA 4DFZE 3EFJA 4E73A 1XH9A 2IVVA 2VRXA 3QA8A 3QQKA 3CTJA 2HY0A 3HUBA 4TYJA 4EKKA 3F9NA 1UU7A 3E7VA 3Q4ZA 3QTQA 4FG9A 4FV7A 3R8UA 3GXLA 3RGFA 3GGFA 3QQGA 4WUNA 5AP0A 4KD1A 4D2SA 3VBQA 5AUWA 3LMIA 5KMLA 4CV9A 2XEYA 5LMKA 4ZJVA 4AWIA 3QAME 4U40A 3UZRA 3PSBA 1Q8TA 3HMMA 4RBLA 4FNYA 2R3QA 4FTCA 4J53A 4WKQA 5E90A 3ZH8A 4BF2A 4I0SA 4LI5A 5CZHA 3E7OA 3KY2A 4NM0A 5IDNA 4X3JA 4O0XA 2C68A 1H1QA 4JDHA 3EN5A 3BHTA 4PWNA 3SXSA 2JFLA 4WD5A 4YJTA 5FTGA 4CYIA 5A6NA 1KOAA 3Q6UA 4O1PA 5GNKA 2O5KA 5AP3A 4YO4A 3MFTA 3C5IA 2CCHA 3LM0A 4GYIA 3B8QA 3E3BX 3U6HA 3WF8A 4E26A 3QKKA 3ORMA 5FG8A 3WZEA 3R1QA 4MWHA 3C4WA 5TKDA 3F3ZA 3V04A 1UWHA 5BNJA 1W8CA 4CFUA 3FXZA 4EYJA 5A4LA 3ZLXA 1B38A 2PVHA 1JWHA 3OG7A 3PE1A 4C2VA 4FMQA 4IZYA 3IW5A 2XVDA 3PVGA 2CPKE 2A19B 3KQ7A 3WYYA 4CZYB 4PY1A 2PMNX 3QTSA 4GIIA 3EOCA 2ETKA 4XYFA 5LVMA 5I9XA 2WTJA 2CDZA 3Q9YA 3DTWA 4CMOA 4GSBA 4R3CA 4EH5A 4W8EA 3DKGA 4HJOA 3DLZA 3W16A 3KEXA 5E1EA 1A48A 3FY2A 2GNJA 3NNWA 3QTZA 3VS4A 3WBLA 4CLJA 3V5TA 1UWJA 5HIDA 4FVRA 1XBAA 2PY3A 2UZVA 2QHMA 2YDIA 1KV2A 3P9JA 3S1HA 1R39A 4CFVA 5M53A 1H1WA 4HPUE 4JX7A 2P3GX 2HYYA 4HZRA 3BYMA 4IX5A 3ZCLA 1REJA 2XRWA 2YABA 3F3UA 5AR2A 4LUEA 3HP5A 3ZXZA 2XBJA 4UB7A 4JBPA 1KWPA 1XO2B 2BIYA 3OEFX 3F3WA 2XKCA 2ZJWA 4F4PA 5ACBC 4UMTA 2Y6MA 5G1XA 4D1XA 3OW3A 2BAJA 2ERKA 5AR5A 4OBPA 4CT2A 5E8UA 3QXPA 4ZAUA 1G8SA 4FKUA 4GEOA 1W7HA 5M55A 3NUXA 3EQPA 3LIJA 4QMVA 4IMYA 5D12A 3V5PA 3R21A 3QD2B 4AFJA 2UZBA 3R2YA 3E88A 5HO6A 2VV9A 5DG5A 3CGFA 2R9SA 4G9RA 2VGOA 3I0OA 5H8BA 5AUTA 4L7SA 4MH7A 5HLWA 2BRGA 4I0TA 2BDWA 1ZXEA 4MBJA 3HGKA 3PJ2A 4FK6A 3FSFA 4JBOA 4QMSA 4A4LA 5HNIX 3UOHA 1KV1A 5HNGA 4BCOA 1XH5A 3F5XA 4PDOA 4XOZA 1KE7A 3BV3A 4BB4A 3EB0A 3JXWA 4ZSEA 3W2CA 4BI2A 5AUXA 3O51A 4DBXA 4OBOA 4FV2A 5CU0A 4TT7A 2BHEA 5BVNA 3LFDA 3GOPA 3ZRLA 2GFSA 4AP7A 1U5RA 3BZ3A 4LUDA 3UE4A 4B4LA 2QD9A 4WRGA 4C61A 3S3IA 2LAVA 3VIDA 3IS5A 5AM7A 3RHKA 4TYGA 3VJNA 5LCKA 4IH8A 2UZTA 2VUWA 3QTRA 4MXYA 1V0PA 3OWJA 2WNTA 3FZRA 2VX0A 2XYNA 3ZEPA 4DEEA 4F70A 2GS6A 4ANNA 4KBAA 4L53A 5CNNA 5IA3A 4KRCA 3S2PA 5AIKA 2NP8A 4S31A 4P90A 4X0MA 4HVDA 3EQHA 1PXJA 4PTCA 2HW7A 4JG8A 1JKTA 4C38A 4XG3A 3PVBA 1GOLA 4Q2AA 5LOHA 4JAIA 4FTJA 3BYOA 2H34A 4RJ7A 1U4DA 2OJGA 4IE9A 1FOTA 2GNLA 5JFXA 4CFXA 2QOQA 3QTIA 4AZEA 3KMUA 5M06A 4GMYA 5IKWA 4H39A 2BR1A 2WD1A 3FHRA 3G6GA 5C8KA 4C37A 3Q32A 4FZ7A 2YA9A 4K2RA 4P5ZA 2VTHA 4MXXA 4GUEA 2EXEA 3FXWA 5LQFA 4MBIA 3OOGA 5CENA 1YW2A 1OL5A 5L2IA 3BEGA 4FTAA 4O7YA 2P33A 4BCIA 4XBUA 5FWKK 5C4KA 2I0VA 3CD8A 3N4VA 3ODYX 3D2KA 1FVTA 3MV5A 2ZDUA 5KZIA 3V3VA 4H3BA 3Q5IA 2GHLA 2R7BA 5BX0A 3FLQA 4HYHA 3PDTA 5A6OA 3H3CA 4WUAA 3BHHA 3CY2A 4RZWA 5C01A 5K5XA 4DLIA 3QZGA 5DVRA 3ETAA 1JKSA 2JDSA 2BUJA 5TO8A 1EH4A 3R0TA 4UWCA 5EH0A 2PZ5A 4MXCA 4ZY6A 4QNYA 4DGGA 3KN5A 2XIXA 3I7BA 5KZ0A 3IW6A 2VTOA 3I1AA 4PL5A 4YZCA 1CDKA 5FGKA 4E6CA 3G0EA 4F7JA 1GJOA 5GINE 4I5MA 3OCBA 5FLFA 5ANOA 1W98A 5BUIA 2BDFA 1L3RE
chains in the Genus database with same CATH superfamily
3FQEA 4XBRA 1OKZA 3SRVB 2JKMA 3DPKA 4GK4A 5M4UA 5CT0A 3VNTA 4QDEA 4UMPA 3ORTA 4DHZA 4PMMA 3PZHA 3C4ZA 1ZMWA 3CIKA 4ANSA 2GCDA 4AACA 4DH3A 3QYWA 4RLLA 3WOWA 2CNUA 5HG5A 3PSDA 2XZSA 2IN6A 3PY1A 3RPOA 3MGYA 5BVDA 5EKNA 5IA1A 5HBJA 3FQSA 3MI9A 3UIBA 3W0QA 4JR3A 3R7IA 4X6QC 2X2KA 1AD5A 1PHKA 3R8MA 2R3MA 2R3KA 3G90X 2PTKA 3D4QA 5AM6A 3W55A 3IDBA 4IWPA 5FEEA 3DXQA 4C7TA 4BIDA 3F3VA 4LG4A 4JL9A 3QQUA 4A9YA 4USFA 4GKIA 2ETRA 3FKLA 4WNKA 3FLYA 4FV1A 4YJVA 3OZ6A 1IA9A 1TZDA 4YSMA 4BKYA 4AXDA 2XANA 4FKOA 4X21A 2CHLA 2GNFA 3DFAA 4GS6A 2UUEA 5L2QA 5HE0A 4D9TA 3QU0A 4GU9A 5AA8A 2R3HA 4E5WA 2YCSA 4D9UA 4OAUC 5IF1A 3HV7A 1WVYA 1XHAA 2W9ZB 3QLGA 5JN2A 4J97A 4QQ5A 4C2WA 2QNJA 4FIEA 2YIWA 1XQZA 4DEGA 4WNOA 5D7AA 3DNDA 5DBXA 3U87A 3ZC6A 4D5HA 5EW8A 2QOLA 2X8DA 2CNQA 4U45A 4L44A 3AD4A 3IW8A 4M0YA 3A7FA 1V0OA 3PY3A 3Q9XA 1H0VA 4EQCA 2JKQA 3NW6A 2W1IA 3FC1X 3DGKA 5ETFA 4L46A 4APCA 3TZMA 2GTNA 3EQBA 3F5GA 3SAYA 5B2KA 2W4KA 4RIYB 4IX6A 2QU5A 4AA4A 3H30A 4FKWA 3AXWA 4F9CA 3LZBA 3UO4A 3UG1A 2XKDA 4IAKA 2ITWA 1SVEA 1WVXA 4QTDA 4ZTSA 5HVJA 3GU8A 3NYXA 2CGVA 2XF0A 2DQ7X 3GFWA 4IZ5A 3G15A 2CKPA 1PXLA 4JT3A 3UVQA 4UMQA 4TPTA 2PYWA 5LJJA 4M15A 3CPBA 4U79A 4YBJA 4PQNA 3SHEA 2BZHB 4CZTA 2WMVA 3R73A 4YO6A 4IB3A 2GNHA 4NCTC 2ZV8A 1S9JA 4D2RA 4OW8A 2YIYA 3MIYA 3ENMA 5AJQA 4XV9A 2C3KA 4DITA 4XMOA 3RNIA 3ZS5A 5HIEA 2QO2A 5AUUA 5CSXA 4I6HA 5IISA 3G51A 4IAZA 4JVGA 1T46A 2G2FA 2W1CA 2EVAA 2X8EA 4BDIA 1YWVA 4EK8A 4MNEB 4JLCA 1ATPE 5FTOA 4Y46A 3OTVA 3PUPA 3DFCB 4YGAA 5K4JA 4YJPA 4D55A 2JIIA 3R6XA 1W83A 2J0KA 4FODA 3VUGA 5J9LA 1PYXA 3RPRA 3HAMA 2QO9A 1O9UA 1YXXA 4UV0A 5IQCA 1Q99A 5BQ0A 3ALOA 4ALVA 3OXZA 3KB7A 4YPSA 5F94A 2BRMA 2AC5A 5K5NA 4FE2A 4KIKB 5HG7A 1YI4A 1UNLA 1Q8UA 4KRDA 5AV0A 2VN9A 3AD6A 2R3GA 3G6HA 3KK8A 3LM5A 3E63A 5E8VA 4R78A 2Y7JA 3DK3A 4G17A 5C8NA 2VTIA 3VRYA 3QF9A 4HYIA 1JSUA 1FVVA 5JZJA 1FVRA 3R9NA 2P2HA 2VX3A 3QZHA 5LMAA 4IVDA 4NM3A 2PZYA 4EBVA 2J0MB 1KE9A 1R1WA 3KFAA 3LXNA 2E9UA 2VTLA 5ANGA 3FZPA 4QMOA 4QP8A 5KMKA 3PUFC 4BICA 4O83A 4D2TA 2Y4PA 3MDYA 4RRVA 2RG6A 1TVOA 5M57A 5KKRB 3MTFA 3AKLA 4IANA 3MPMA 2BFYA 1BI7A 5A4CA 3RCJA 5IEVA 5KKRC 1Q3WA 4ZSLA 2C30A 5EW3A 3UO6A 4J99A 2JAVA 3HX4A 2X0PA 3OTUA 4AGDA 4IC7A 2W1GA 3KXXA 4YTCA 2VO7A 4IBMA 4M3QA 2BZIB 3MB7A 5J9YA 3TNQB 2OWBA 3VJOA 1CM8A 1IRKA 2OKRA 4FKIA 4L68A 3Q2JA 1TKIA 4FTKA 1ZYCA 4AW1A 1NA7A 3F6XA 2YAKA 3G9NA 3QQHA 5IA5A 2YAAA 4JR7A 5AP7A 5EQPA 3LFFA 2WMQA 5T68A 1KSWA 4ZZOA 2O8YA 4D0XA 3P5JC 3OT8A 4YTIA 2IW8A 3FMMA 2Z7RA 5CEKA 2IF8A 4IM2A 3U4WA 4CRSA 5JGBA 3ZFYA 5DLSA 3QGWA 4DDIA 5CAOA 4FVPA 1M2QA 1XH8A 4ZS4A 1OB3A 5EYDA 4Q5HA 2QKRA 3QRTA 5FP6A 4ZY5A 3WILA 4XG2A 2I1MA 5DT4A 3MVLA 2B9IA 2J0JA 3NYOA 1JKKA 3THBA 4AQCA 4S30A 5L2SA 3LCOA 3GCVA 2RFSA 4E4NA 3CQWA 3FI4A 2PSQA 3LFSA 4HGLA 2C6KA 2UW4A 4YP8A 4CRLA 3ORNA 5JGAA 3NLBA 4TWCA 3E5AA 2OG8A 3A4PA 4CQEA 1PXKA 3W8QA 4EQUA 2W17A 4C4EA 3BYUA 4EZ5A 5D41A 2C5NA 1OL2A 3O2MA 1MQBA 5KMNA 3C0HA 3FWQA 1LEZA 4FV3A 4AW0A 4BTFA 4YBKA 5ETCA 4QMYA 3R30A 5AV4A 5ANKA 2JBOA 1OPJA 3HV3A 4GV1A 3EIDA 3OXTA 1XR1A 3PPZA 2YWPA 2X0GA 2GHMA 3REPA 4XJ0A 3VS0A 1A06A 3TDWA 2FB8A 3PIXA 3D7ZA 4KB8A 3CTQA 3NDMA 1PXPA 4FKGA 3HRFA 5FEDA 3PA4A 1E1VA 4QMLA 4BZOA 3RK5A 4Z7HA 1NVQA 2Y6OA 3PIZA 3Q9WA 2UW9A 3H9OA 3Q5ZA 4ANBA 3T9TA 4DGNA 5D10A 3QTWA 4O0YA 2XS0A 3F88A 2VWUA 2WTIA 4LQMA 3RK9A 3U8WA 4UX9A 4KIPA 4CNHA 3R9RA 3GI3A 3TZ8A 2R3PA 4W4WA 4FKTA 1U5QA 2P0CA 4HW7A 2OIQA 1APME 3R8LA 4QP6A 2W06A 4OLIA 5FP5A 5LARA 2B53A 4FTLA 1Q8YA 1YHWA 4RWLA 4F0IA 2C47A 2GS7A 3ACJA 3PJ8A 3S0OA 4CFNA 2OXDA 3OP5A 4G16A 5E8SA 3QTXA 4JMQA 5JT2A 2WQNA 4LOQA 4UWYA 4FICA 3SVVA 3HRCA 2CCIA 4FI1A 4IADA 1NY3A 2PE1A 4J71A 4ZZNA 5HHWA 3PLSA 3OBGA 5CEOA 2F57A 4CFWA 4FSQA 2XH5A 3QCXA 4UZHA 4GJ2A 1OI9A 2FH9A 4BIBA 5KHXA 3W0SA 4FV0A 4J98A 3MJ2A 2W1ZA 4X2NA 4AGUA 2X2MA 2F7EE 4O6EA 5TR6A 3UOLA 1YWNA 2BVAA 5EYMA 4G3DA 4C57A 4EONA 4ASDA 3EYHA 1V0BA 2ITZA 3I79A 3Q52A 4HYUA 3OWKA 3RHXA 1ZYSA 3ROYA 4CG8A 4TYIA 5L8JA 4F0GA 5E8WA 4D4YA 2YIXA 1OM1A 3DB6A 2Z8CA 3Q9ZA 5E92A 2WOTA 5JEBA 4ANQA 3FMKA 3LFCA 3P78A 5CQWA 5H2UA 5J95A 2ZMDA 3IGGA 4O4BB 1H8FA 4X2FA 5IUHA 3AKKA 3DB8A 3KL8A 2J9MA 3GNIB 4C4HA 2FYSA 4FSUA 2YLFA 3NNUA 1YXVA 5F20A 5BVWA 3F7WA 2IZTA 3QQLA 5C9CA 4AGCA 5CXHA 5TE0A 2XJ2A 5KO1A 2QOKA 4YLKA 2Z60A 3VUMA 4KSPA 5IH5A 4AT3A 1XH7A 2RKUA 4X7QA 5FXQA 3QD0A 1H27A 4NCTA 5DIAA 3MTLA 2OFUA 2XCHA 4R3RA 4TWOA 2J50A 3TCPA 3B2WA 4MD8E 3QALE 4BWKA 3PXQA 2CKEA 3BCEA 2UZDA 5I9WA 2O65A 4TYHA 2XNEA 3R01A 2JKKA 3F61A 3RP9A 1OKYA 2IO6A 2Q0BA 2VO3A 2CGWA 4FYNA 4MYGA 5H8GA 2BALA 1R0PA 5CVFA 4F09A 5FM3A 4Y85A 3UQCA 2YZLA 4WNMA 4TYEA 3WIKA 2G9XA 1TFFA 4J52A 1ZOGA 1Z57A 2XMYA 1OL1A 4XLIA 4CSVA 2H8HA 3PXRA 3D7TA 3OT3A 3LW0A 4ZY4A 5E8XA 2JD5A 4E4MA 4J95A 1IAHA 1SZMA 3P08A 4FF8A 4ZSGA 4AF3A 4BDDA 3MJ1A 5HTIA 2V62A 1HCLA 4YLLA 4NSTA 3VULA 4FYOA 3LPBA 5EI2A 2X4ZA 3LQ8A 3QZFA 5CEQA 4DFUA 3BE2A 5IQFA 5IDPA 1AQ1A 2PZRA 3POZA 4XH6A 1JPAA 3K3JA 5L3AA 4M13A 4AT5A 3QCQA 1H08A 4E6DA 4E93A 5IEYA 4DGMA 4QDVA 4N0SA 4M67A 4N57A 4ENYA 3OROA 4FIGA 3RAWA 4J8NA 4JRNA 2WB8A 1JKLA 3DKOA 5J87A 4BDKA 2JIUA 2VWZA 4NK9A 2VO6A 3ROCA 4EOSA 4F1OA 4AXCA 5A54A 4ID7A 3TUDA 4KA3A 3GC7A 4D4VA 1BYGA 2I0EA 3CLYA 2BZKB 2YERA 1O6KA 3CTHA 3MVMA 4BDFA 4D2PA 5BVEA 4IB5A 5AAEA 2XM9A 3W0PA 1OITA 4E5BA 4C4IA 4DFLA 3VHKA 4DH5A 2G2HA 2AEGA 5LCJA 5IH6A 5FBOA 3LVPA 2YJRA 1M17A 5HVYA 3NYVA 3KCKA 4AZWA 2OF4A 1J1CA 4FL3A 4RWKA 3BL9A 1J91A 3TIYA 4ZZMA 3VAPA 3C0GA 1BLXA 3EZVA 5JFWA 2YM5A 3FSKA 3TNIA 5CASA 1XJDA 4FSTA 2F7ZE 1FGKA 1Y6AA 3NAXA 4D0WA 5IQHA 5HG8A 4DFNA 4YU2A 4O7NA 4B8MA 1UNGA 5DE2A 3BGQA 4TNBA 4C33A 4F65A 2FA2A 4EZ3A 4FOCA 1P14A 4IVAA 4QMTA 3ANQA 5CEPA 2ACXA 3POOA 1I44A 1QCFA 4L43A 4WG4A 2DYLA 4RC2A 3T9IA 4NM5A 4FUYA 1OGUA 4LYNA 4QP1A 1SNXA 1CKPA 4JXFA 3DLSA 4RIWA 4I4EA 2ZB1A 3TKUA 3JPVA 3MH1A 5DFPA 1Q8WA 4E5AX 3NVKI 3ORZA 2QG7A 5DRBA 3P7CA 3D0EA 4S34A 4AE9A 3NRMA 3O5AA 1GZ8A 4O7LA 1DI8A 2GHGA 4QQCA 3KULA 2W7XA 4RVMA 1ZAOA 4IB1A 5FD2A 4H05A 4BJJA 4ZS0A 4HPTE 4PP7A 2C3JA 3AC8A 3CKWA 4L01A 4U44A 1OGYA 3GC0A 4FTMA 4A06A 4C59A 5IMEA 3EQDA 2BDJA 2Z2WA 4EOOA 4EH6A 1E9HA 2HZIA 3IECA 3VF9A 5DN3A 3K2LA 2PVRA 5GJGA 1F3MC 1MP8A 4DN5A 3GFEA 5BYZA 4NFNA 4WRSA 3UOJA 5EM6A 3FI2A 2QC6A 5EHOA 4B99A 4CGAA 5HOAA 4BL1A 3DJ6A 4FTQA 5HKMA 1XMMA 3D5UA 2X7FA 4GT3A 4FEVA 2VTTA 3DNEA 2NYAA 4N4SA 4EORA 4IIRA 4BCJA 1NT2A 2HWOA 4F9YA 2A4LA 2IZSA 3UYTA 3BBTB 4X3FC 5DEWA 2YZAA 4XRJA 1GIIA 3V5QA 1UVRA 3FQHA 3NGAA 4TXCA 3NEWA 2UZUE 4EL9A 2B54A 2HZ4A 3EQIA 2IW9A 3R1NA 4FV5A 4LGGA 3VBTA 4TW9A 1JBPE 1SNUA 4C0TA 4EOPA 4GUBA 3VVHA 1X8BA 3G33A 4I93A 4LOPA 3I5ZA 3PRFA 4U81A 3ZLYA 4EEVA 1Y8GA 4ACHA 4FV6A 3W33A 4B0GA 2X7OA 4EUTA 4FV8A 4EHEA 1ND4A 1LUFA 5HCYA 1J7UA 5HD7A 2ITOA 2C4GA 3R9OA 2WMSA 3MIAA 3VC4A 1WBWA 3GU5A 3HRBA 4BBFA 3MESA 4IFGA 4DDGA 4V01A 1PXIA 3IK3A 4W8DA 1Y91A 4HGSA 5J5SA 4IWOA 3QWJA 3TM0A 4KKEA 4O4CA 3SDJA 2JC6A 3ZO3A 2FSTX 4P7EA 2XYUA 3UQFA 5EQEA 3P23A 5J8IA 3R9HA 2AQXA 4BZDA 4ZLZA 4LMNA 2W4OA 1UKHA 1KE6A 4ZJJA 5HE2A 5ITAA 2OBJA 4QMUA 4BDGA 3LCKA 5DPVA 5M56A 4G6NA 5HD4A 4RIOA 4BKZA 5IMXA 1OIUA 3GQIA 4R3PA 2IG7A 4DCAA 3PXYA 1UNHA 3AT4A 3GP0A 2BFXA 4I3ZA 2WEIA 4R7IA 4BN1A 3KU2A 1ZZLA 2W1HA 5HU3A 2F49A 4O0VA 3O8UA 5M51A 4O0SA 2R3JA 1OKWA 2O63A 4RQVA 4F7LA 3FAAA 3QA0A 4TTHB 2C3IB 3NNVA 3UNJA 1DM2A 3ENHA 5BYLA 2EUFB 4RG0A 2NO3A 4JBVA 5HESA 1UU8A 3COKA 2ZV7A 5IQAA 3MYGA 4GU6A 3LQ5A 5GIOE 2PUNA 3TN8A 5DWRA 3BHYA 4OR5A 1XMLA 3R7UA 3G5DA 4DH8A 3MVJA 2QOBA 3NCGA 3LMGA 4AX8A 3KIOC 3MH2A 2YITA 3RWQA 3R83A 4CXAA 3HV4A 4R1YA 4ZTNA 3UVPA 2QR7A 1ZYLA 5EYKA 2UZWE 1K2PA 4RJ4A 2VX1A 4YPDA 3RPVA 3UP7A 3OCGA 3LXLA 3NUSA 1Q24A 3ET7A 2A0CX 2QHNA 3V6SA 3JR1A 4L8MA 3FV8A 5HX8A 3LLTA 5HICA 4FKPA 2XJ1A 3CY3A 5CX9A 3F82A 1YVJA 4BWPA 4P5QA 5F9EA 2ZFYA 1M2RA 5ANDA 2CLXA 3DJ7A 4GIHA 2WHBA 4LRKA 1J7IA 1OBDA 4G34A 5CF6A 3R8PA 4FX3A 3E8DA 1QPEA 4CEGA 2QU6A 2XCKA 2ITTA 2WU6A 4FK3A 3GUBA 4AOIA 4NJDA 5AR4A 3VUHA 1ERKA 3C9WA 5HCZA 4HVSA 5JFSA 4MQ2A 3COMA 3DQXA 4I5PA 5HZNA 1T45A 3OWLA 2GDOA 5AIRA 5DT3A 5ANEA 3TT0A 3B8RA 2VD5A 5D7VA 2J7TA 2E9NA 3F2AA 5BMMA 1DAWA 4I92A 4UYAA 5AV2A 4V05A 5B2LA 2WGJA 4FV9A 4IZ7A 3ULIA 4CYJA 4LL5A 1ZYJA 3PA3A 4UZDA 4I6LA 5IQDA 3ZLWA 4ITHA 2C0IA 2C5OA 3R7OA 1W82A 4RA4A 4YZMA 4DHJA 2AC3A 5C8MA 1ZOEA 3CBLA 3MSSA 3LOKA 1JAMA 3P7BA 3BKBA 3QTUA 1M7NA 4ASEA 2VTJA 4MNFA 4C4GA 4FG7A 2R64A 4RFZA 3ZSGA 3DA6A 3ZO2A 3ZYAA 3I81A 4RMZA 4QMNA 2BTSA 3D9VA 2CGUA 1UKIA 4GG5A 1KUTA 3PJCA 2HOGA 4G3EA 3UDBA 2E9VA 2Z7LA 4EOLA 4G6OA 1YWRA 5AR3A 1G8JA 3ZUUA 2ERZE 3QUPA 1J1BA 4ZTHA 4FUXA 1H1SA 3ZU7A 4E20A 4CKJA 2YACA 5CXZA 4WG5A 5HVKA 5CYIA 1H01A 2UVYA 4BCGA 1Z5MA 3Q2MA 4G3GA 1E1XA 3UNZA 2IZRA 2PVKA 4TWNA 4NM7A 5ANIA 2C1BA 1M52A 3QWKA 4ASZA 4IWDA 4EOKA 4ASXA 1XH6A 4JNWA 5B0XA 4L67A 5CNOA 3W0MA 4C8BA 5E8TA 5JZNA 3WYXA 2B9HA 5BYYA 1XBBA 2CLQA 4I6FA 3VUTA 4CV8A 4DTBA 3TEIA 4G9CA 3TJDA 4QTEA 4O7VA 2C6TA 2ZM3A 3VBYA 4ACGA 3LCSA 4IM0A 4X2JA 2ITXA 4OGRA 5KMJA 3E64A 3JY0A 5ICPA 3KGAA 4M84A 3W32A 4QPSA 4RVLA 2UW7A 4R6VA 2XUUA 3EJ1A 4MD9E 4QP9A 2IW6A 4R5YA 4TKSA 4CFFA 4YMJA 5KCVA 3UO5A 3PZEA 4DT9A 2OZAA 3COIA 3AMAA 2XKEA 5CEIA 4AZTA 3LXPA 3ZDIA 4OTWA 3IOPA 3DK6A 3VBWA 4XG8A 2YCFA 3NUPA 2J51A 3V51A 4C3PA 3ANRA 4E8AA 5LXMA 4BCQA 3DDPA 4DEIA 1Q5KA 2JITA 3G2FA 4M8TA 3PSCA 3AQVA 2JKOA 3EZRA 4FNZA 4EH2A 4UWBA 4G5JA 4PPAA 4XG9A 3BHUA 4O1OA 4HVHA 3MFUA 3HDMA 4DGOA 3IDPA 5AV1A 5KBRA 4Z9LA 2F9GA 4HCVA 4EBWA 3A7IA 2FSOX 3QX4A 4RJ8A 5CI6A 3L8VA 3BV2A 3FI3A 3FLWA 2C6OA 4IHPA 2R4BA 2IVSA 3DTCA 4EH3A 1HCKA 3VS5A 4X3FA 1RQQA 3ERKA 4TN6A 3SQQA 3EKKA 2ITVA 3T8OA 4GVJA 2AUHA 4QP7A 5K0XA 3KXMA 3ZLSA 3GU6A 5DMZA 5D11A 3W2OA 5FBNC 4RX5A 3SOCA 2X6DA 3MH0A 2W99B 2XB7A 4FZ6A 3NFFB 5JK3A 3QC9A 2XK7A 4CT1A 3FXXA 1IR3A 3UOKA 3RMFA 4Z16A 2PUIA 2YDKA 5GIPE 1B39A 3QQFA 4TWPA 4XP0A 2FSMX 2HK5A 3O50A 1WMKA 2I6LA 4FSYA 1OIQA 3ORIA 4PPCA 2Z02A 2ZOQA 4YZBA 2GS2A 4YZNA 2GPHA 4KKGA 3NIZA 3QGYA 4NW5A 4RFMA 2G15A 4RWIA 3ATSA 2EXCX 3FMJA 3R1SA 3GEQA 4Q9SA 4HNFA 5CAPA 4O0WA 5ACKA 3Q4CA 1ZMUA 3EHAA 3EQCA 4U6RA 4IX4A 2GU8A 3RZFA 3QRIA 3OCSA 4AN2A 3KRRA 2WFYA 3R7YA 2WAJA 3R1YA 4AZFA 4B6LA 4PMPA 2ETMA 5A9UA 3H0ZA 3KRWA 4GFMA 4HNIA 3BBWA 4K9YA 4PDSA 4TYHB 1YKRA 1QL6A 3NCZA 1F5QA 2HZNA 3JYAA 5AMNA 3DZQA 4ITIA 5IQIA 4AXFA 4FTNA 2B0QA 3RBWA 3RAHA 4O2ZA 3QZIA 3Q96A 4ANOA 5KMOA 5AP4A 1Q8ZA 3RI1A 4S32A 4AXAA 1U46A 4S2ZA 4U8ZA 3TTIA 4B7TA 3D7TB 1W84A 4OTIA 3I0QA 4YJNA 2JDTA 2B9JA 5AWMA 3ZBFA 4B8LA 4FKJA 2GMXA 3QKMA 4O7RA 4K18A 3KXHA 4FZAB 5JKGA 1PXMA 4KAOA 3CPCA 4WA9A 3DS6A 2OLCA 1STCE 2UVXA 4XOYA 4Q9ZA 5J1VA 2BZJA 3LFAA 3AT3A 3KVWA 3L8PA 3BE9A 4IM3A 4BDBA 1VYWA 1VZOA 3PY0A 3C4XA 3U9CA 5FXSA 3VQUA 2G1TA 3GCSA 3R7GA 2H6DA 1LP4A 1REKA 3KF7A 1FINA 4ZLOA 1S9IA 3QUEA 3WE8A 1PKDA 2O64A 4WG3A 1W2FA 1QMZA 4MK0A 4U3YA 3LLAA 1LR4A 2Y9QA 3D15A 3UIUA 4QQJA 3W0OA 5M08A 3ZSIA 5K3YA 3W1FA 5KMMA 3TV7A 2QLUA 2Q0NA 5EG3A 4KIOA 5LVOA 1JSVA 3E8CA 3NUAA 2CSNA 4LM5A 5C03A 4AA5A 5I3RA 5EDPA 3I6UA 5JH6A 5L4QA 4WHZA 4Q5EA 5KNJA 2WU7A 2R0IA 2OK1A 3NAYA 2X9EA 3IO7A 1PY5A 4QNAA 4O82A 5L8KA 5KUPA 2YCRA 3DAJA 4EK4A 3KVXA 1Y57A 2WIPA 4QOXA 3RWPA 2WELA 2WTKC 3O8TA 5BV3A 1DI9A 4FEXA 5AX9A 3L9MA 3SXFA 1BL7A 4ACCA 4I0RA 4E1ZA 3AC1A 5I9VA 1M2PA 4IW0A 1K3AA 2FO0A 2QCSA 3QHWA 1BX6A 2Y4IC 4QD6A 4XLVA 3UVRA 1GAGA 3W10A 4MCVA 4FOBA 4CD0A 4GJ3A 2UW8A 4IZAA 4H1MA 1I09A 4QYGA 1ZY4A 4QP2A 1PRYA 2H96A 3HECA 5A4QA 3RPSA 3CSVA 4QPMA 1IG1A 3BYSA 4LFIA 5K0KA 4IACA 4EK6A 4II5A 2VTAA 4RIWB 3U54A 2PPQA 3NR9A 4YJQA 4PTGA 5FDXA 4BVUA 1OZ1A 2XIKA 1PYEA 4DEHA 5AADA 2HWPA 4UYNA 4WSQA 4O2PA 4AQKA 2R7IA 2VTQA 4A7CA 2VWWA 2BHHA 2XBAA 2BKKA 3KULB 3SC1A 3TV4A 4JBQA 4NJ3A 1GY3A 3TTJA 4BJJB 5HBHA 4O0TA 5ANJA 3OS3A 2R3RA 3F7ZA 4L52A 4ERWA 3RK7A 4F08A 3VS3A 3OWPA 3PWYA 5FRIA 3V5WA 5M4IA 4AN3A 4E4XA 3D2IA 5AUYA 4U80A 4QO9A 4J1RA 4G2FA 1NXKA 4U43A 1H1PA 4ACDA 4IAYA 4BDEA 4IEBA 2JAMA 4BKJA 3R8VA 5E91A 3GENA 3R28A 3FZ1A 2B4SB 3AC5A 4RX7A 1PXNA 2B55A 3G9LX 4UMUA 2WTVA 4YZDA 3U55A 3RZBA 1BI8A 3BHVA 4BTJA 5HORA 4JG7A 5DI1A 5E4HA 5GJFA 4R7HA 2PZIA 2ZVAA 2VAGA 4PMTA 4DYMA 4LV7A 3PFYA 3ZUTA 2PVYA 2OJ9A 3RKBA 4WSYA 3NW7A 1G3NA 3WARA 1ZLTA 1YOJA 3EL8A 3MFRA 4F7NA 4F7SA 2XK3A 4D2VA 4PP9A 4F9BA 4Y5QA 1MRYA 2VTRA 4X2GA 1O6LA 3DK7A 1GZOA 4I24A 3QXOA 3OXIA 4EKLA 1SYKA 2YM6A 4BBEA 2REIA 3PJ1A 4JIAA 5DR2A 4CTCA 2R0UA 5CT7A 1RW8A 1DAYA 3SXRA 4XG4A 4D2WA 2GQSA 3MA6A 5BUEA 4O6LA 2IVUA 3VO3A 4RT7A 3HMIA 4EC8A 5GZ8A 4DCEA 4EK5A 2HXLA 3OCTA 4QTBA 5EM5A 5IG1A 4LGHA 3UDTA 2OSCA 2X2LA 1SVHA 3ACKA 4IB0A 5CWZA 3R63A 1H25A 4I23A 3PPJA 3FL4A 2WPAA 1PMNA 5CF5A 2XNGA 4BCKA 4M0ZA 4D1ZA 4Z7GA 4FSNA 4F0FA 4FTIA 4NU1A 3KXNA 3OF0A 5I9ZA 5AAFA 3AT2A 3DQWA 4ANLA 4AS0A 4MQ1A 2WMTA 4PF4A 4XG7A 1YDSE 3UG2A 2E2BA 4U41A 5I0BA 5EKOA 4AW2A 4ZTMA 3MFSA 2V5QA 2F4JA 4L9IA 1OUKA 1PMVA 3AGMA 4O86A 4GT4A 3VW6A 4NTTA 2BCJA 5JQ8A 3L9LA 4GKHA 3CJGA 5BMSA 1XKKA 3CKXA 3U9NA 2J2IB 4FZDB 3KMWA 1AGWA 2XIRA 4QMMA 3P4KA 3DY7A 4RJ6A 2HENA 5CU2A 4W4VA 2ITYA 5E9EA 3OY1A 4NUSA 4WBBB 4XHKB 3U6IA 4O7TA 4LMUA 4MXZA 3EH9A 2ESMA 3EN7A 3ZZWA 3W2SA 3DBEA 4J8MA 3UMXA 3VRZA 3FUPA 4IAAA 4YTFA 3CEKA 5DH3A 3PPKA 4CVAA 1RE8A 4GFOA 1YXUA 4QPAA 5CSVA 4ERKA 5EOBA 3UMWA 4WNPA 2IEWA 2OIBA 4FT7A 2R3LA 4O96A 1MUOA 4KKHA 5BVKA 3U4UA 4DH7A 4Z3VA 5EDRA 4K8AA 5CQUA 3LFEA 3ORXA 2R3FA 3PVWA 2RFNA 3CP9A 4MBLA 3AC3A 3WF7A 3ZXTA 4U0IA 3ZOSA 4AOTA 1KE5A 2C6MA 4EH9A 5GZ9A 3DXNA 3KRLA 5CS6A 4BCHA 2PMIA 3CQEA 4C3FA 2QOHA 2AYPA 4RX9A 2ONLC 1YDRE 3VBXA 4BDCA 3DBFA 3O7LB 4J96A 3U51A 4OTDA 3L9NA 3TG1A 3MY1A 1FMKA 3H4JA 3COHA 4D4SA 4U97A 4O0RA 2E9OA 4BYIA 4BCNA 5DR9A 1CKJA 4BCFA 4YUQA 2UV2A 3QUDA 4ZMEA 2V22A 3ZM9A 3W2QA 2BRNA 5HE3A 4BI0A 4IDVA 3NS9A 3GC9