1ATPE

2.2 angstrom refined crystal structure of the catalytic subunit of camp-dependent protein kinase complexed with mnatp and a peptide inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
336
structure length
334
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase(phosphotransferase)
molecule keywords cAMP-DEPENDENT PROTEIN KINASE
publication title 2.2 A refined crystal structure of the catalytic subunit of cAMP-dependent protein kinase complexed with MnATP and a peptide inhibitor.
pubmed doi rcsb
source organism Mus musculus
total genus 105
structure length 334
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1993-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1atpE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1atpE02
5AAGA 3MDYA 2V0DA 2C3KA 4TL0A 3CY3A 3W2RA 3CJGA 4XX9A 4OAVB 3UYSA 2WO6A 5IUIA 4NIFB 2UVYA 3MY5A 4WRGA 2X8DA 4YU2A 5TKDA 4BCGA 1TQPA 3BQRA 3E63A 3FLNC 3FPQA 4KRDA 4JG6A 1O9UA 4YJQA 5CEIA 3F3ZA 4DGOA 5FUTA 3DB8A 5KZIA 2W1HA 4O22A 3BBTB 3TZ7A 4AZTA 4DAWA 3CR0A 3HVCA 3QCQA 4E5WA 5GIPE 2VWYA 4FKGA 2ITQA 4WD5A 5C8NA 3E88A 2YM7A 3DQXA 2P3GX 3ZDUA 1VYZA 3V3VA 4QRCA 5HZNA 4PUZA 5AV1A 3UPXA 4IX4A 4RC2A 5D41A 4QP3A 4DCEA 1W7HA 2BILB 5FDPA 4H36A 3C4CA 3QKLA 3DKOA 4D28A 4D9TA 3LVPA 4FTKA 3ZC6A 4L3PA 4K33A 2HY81 4HW7A 2C6LA 4A4OA 3I7BA 4FT9A 3CTJA 4DGLC 3KN5A 5DRDA 1M17A 3SG9A 4LUDA 4GFMA 3L8VA 2B54A 3HP2A 3U6HA 1PKGA 4BDDA 2EXEA 4NKAA 3FAAA 3R9NA 4WUNA 3RPOA 1Y8GA 4WHZA 3HECA 3UODA 2OK1A 1M2PA 2WQOA 3QHRA 2J7TA 4FSNA 3ZXTA 2YCQA 3Q4UA 4FOBA 5CXZA 3NIZA 5JH6A 4C3RA 3LMIA 3KGAA 5FXQA 4KIQA 5FEEA 1OL1A 1PXIA 2F2CB 4FIEA 1M7NA 2HYYA 4NWMA 3ZS5A 4D58A 1IR3A 2CPKE 2WOTA 2VWZA 2WTWA 3FKOA 4HPUE 3GC9A 2JBPA 5M4UA 4RZWA 1OUKA 1OB3A 2CCHA 3C7QA 5J9LA 3HRFA 1H1QA 1P4FA 2ZJWA 4GVJA 2WQEA 3TJDA 1LEWA 3LFDA 4FSQA 3WE4A 2O64A 2XIZA 2IJMA 4BDCA 5F20A 5EM6A 3LFEA 4DH3A 1DAWA 3CQEA 3DJ5A 3D2KA 3O8PA 4IJ9A 4FC0A 2W1GA 3MFRA 3VUDA 3SOAA 1PRYA 3NCZA 3WF6A 5JQ8A 4JAIA 4NM7A 5EFQA 4J97A 5ANOA 2Q83A 2HZIA 4YJNA 5J95A 4ANBA 4WG3A 4ACDA 5HORA 2FUMA 2JFMA 2WQBA 4JI9A 4MHAA 2X4FA 3P7BA 1OECA 4X3JA 4ZMEA 4G9CA 3GCQA 4YJOA 5FEQA 5FG8A 5DNRA 4C8BA 2O0UA 4X2KA 2GNHA 4LL0A 4FF8A 1J7LA 4QMUA 4O7RA 2WNTA 3DZOA 3TZ9A 3HA8A 4J71A 4CFVA 5A54A 3PSBA 4TRLA 4A9TA 3VRZA 3ANRA 4UBAA 2UZLA 3WF9A 4O7ZA 4E6QA 2C5VA 4WG5A 3HMPA 2VRXA 4CRSA 3DPKA 4TWOA 4KBAA 4M13A 3AD6A 4FTNA 3QALE 4Q9ZA 3BI6A 1FGIA 4KB8A 3U9NA 5LCJA 3ALOA 1UNGA 4YLLA 5EQYA 4JQ8A 4G16A 2EB3A 1YXSA 4DCAA 3KEXA 5DEWA 1ZMWA 1A9UA 4JIKA 4EOLA 5J7BA 2CGVA 2QLUA 2Y8OA 3C1XA 4R7IA 3CQUA 3PXYA 4BWXA 3GGFA 3RK7A 4ZLZA 2GSFA 4AT3A 4ZSEA 2VUWA 1PHKA 4JAJA 4NW5A 3ZC5A 4D4SA 1ZMVA 2YABA 2XIYA 4K2RA 4V0GA 3EN9A 5JMSA 4I41A 1XJDA 2Z02A 4LRJA 4LL5A 3Q53A 2AC5A 4ERWA 4IB5A 3F61A 4YSMA 3DY7A 5AUWA 4BCMA 3JR1A 2WU6A 2PVRA 3O8UA 4H3QA 4APPA 3O7LD 3IW7A 4G6LA 2YDIA 3A2CA 3OEFX 3IW4A 3NYXA 4LOQA 5AFVA 4JR3A 4RX5A 2DQ7X 2R3LA 3FYKX 4HPTE 4XHKB 3RHKA 2PU8A 5F9EA 4ZAUA 3CPBA 5EI6A 5FLFA 4O0UA 3PE1A 3WF8A 5KMMA 4EOSA 2OICA 2VWBA 3QRJA 4RLKA 5CF5A 4PY1A 5LMKC 4FYOA 2YLEA 1LUFA 2F4JA 1KE8A 2ITUA 2GHLA 2XNBA 3LLAA 4XOZA 3FZOA 4KS8A 3KXNA 1QCFA 4KAOA 4QMOA 4ZS0A 4BGHA 4FEWA 1QL6A 4PMSA 3QQKA 4L01A 4JOAA 3G6GA 4I5CA 4EOJA 1WVYA 3PSCA 2XNNA 4U7ZA 4F1OA 4ZY4A 4FK3A 5C27A 3TACA 4DINA 4IANA 3O96A 4XV1A 2BZKB 4W9WA 4R77A 4F7JA 1DI9A 2X7OA 4ZZOA 3IW6A 3KB7A 3FUPA 2C3LA 4YO6A 1APME 1K3AA 4W4VA 3VUTA 3ULIA 3ZLWA 4EZ7A 3BBWA 3MWUA 2GQSA 2PUPA 4TYJA 3C5IA 3JYAA 3HRCA 3BU3A 4FBXA 5FM3A 1BX6A 3N4VA 3BWFA 4U43A 2OJIA 3R83A 4BYIA 2UW8A 2UW7A 3QUEA 5CEKA 2BRGA 4R6VA 3QCSA 2Z7SA 1YWNA 4ZJIA 4BBEA 3R1QA 2CLQA 1KSWA 3JVSA 1PXMA 2A1AB 4FTJA 3ZSIA 4E93A 4F4PA 2E9OA 2WB8A 1H07A 2ZVAA 4E26A 2QVSE 4F65A 4WNPA 2YM8A 2C3IB 3D94A 4BZDA 1CDKA 4C4JA 3QX2A 4LOOA 4G5PA 4QYEA 4AOJA 1PXOA 3R7VA 3CPCA 3KXXA 3QTZA 4NYEA 4M0YA 4BI2A 4KRCA 4Q9SA 5AAFA 5IEYA 3DB6A 1QPCA 1H1SA 5A46A 4AGWA 2YIQA 4PRJA 2OJ9A 2O65A 4DFXE 2WXVA 3VBVA 3MA3A 2PVNA 3ATSA 1Q8YA 3BYMA 1YQJA 1KV2A 4FUYA 3QTQA 1MQBA 2BR1A 2XS0A 5HICA 3RINA 5GIOE 2J0JA 2J50A 1TKIA 3EQFA 4BIBA 4LMUA 1G5SA 4DG0E 3W33A 1Q8WA 3P86A 3A7JA 4UZDA 3AC3A 2CMWA 2EB2A 4PDSA 3S4QA 2VNYA 3ZONA 4EQMA 1WZYA 3AG9A 3MPTA 3DLSA 4WBOA 1KE9A 3EYHA 1MRYA 3F2AA 5HIDA 3U4WA 3G9NA 3PWDA 5E8TA 1SVGA 2RG6A 3N4UA 4GIIA 5KKRB 4AQCA 1WVWA 3RPVA 2OF2A 4PF4A 5IQAA 5IG1A 3CTHA 2W9ZB 2B53A 5EHYA 3NX8A 3DK3A 1GOLA 4KBKA 2UZNA 2QO9A 3I7CA 2IPXA 2J4ZA 3D2IA 3QD3A 5AEPA 3BLHA 5K4IA 4Z7GA 2WFYA 2X7FA 5DLSA 5FGKA 1BKXA 1E9HA 1YHVA 4M97A 5LXMA 4F9BA 4EI4A 3PDTA 4NTTA 3GXLA 4I1ZA 3R7YA 1XH7A 4DYMA 4G5JA 3R22A 4F7SA 2I0VA 5IEVA 3LFBA 1IAHA 2W1IA 5E4HA 2B9HA 3NMUF 4A9UA 1K2PA 3S2PA 4S30A 4XRLA 4QP9A 2UV2A 5KKRC 1GJOA 3DU8A 4UXQA 3O23A 5H3QA 2DS1A 5HLPA 4DEEA 2W7XA 2WIPA 4EORA 3UNKA 1H00A 2CN5A 4O0SA 5E8UA 4LM5A 4PDOA 5E8YA 3GI3A 3ZUVA 5I9VA 4WRSA 3R8UA 4FR4A 3O2MA 4TT7A 1GNGA 4F0FA 5KBRA 3JXWA 5L2TA 2XM9A 3HUCA 5ANGA 2OG8A 4WO5A 4JG7A 3KMMA 3ZZWA 4JDKA 1K9AA 3LCOA 4H3BA 2H34A 5KMIA 3D7TB 5LVNA 4HGEA 4LV8A 2XMYA 2BUJA 4KBCA 4LGDA 3TJCA 4BVUA 2BIKB 3D9VA 4FIFA 4TXCA 3OD6X 3CD8A 5GINE 3KFAA 3QTXA 3FPMA 4D1ZA 1QPJA 3O8TA 5B2LA 4RBLA 4YHJA 4FEUA 5M08A 5CI7A 3Q2MA 5KMNA 2QOFA 4ARKA 3UO4A 1Q3DA 2YAAA 2WHBA 4UXLA 4QP1A 2QKWB 2Y0AA 5EK7A 3WOWA 4ENXA 3W2CA 1H4LA 1JKLA 3ENHA 1BI7A 4AOIA 3KF7A 5T6KA 4R7HA 3UNJA 2IZTA 5DGZA 4RGJA 4E1ZA 4CVAA 2C69A 5KNJA 3QHWA 2GQRA 3A4PA 1M7QA 4RIOA 2OKRA 1YDRE 4IB0A 3EQDA 3FJQE 4M66A 1OIYA 5C1QB 5HE0A 5KMKA 4YZNA 2UZUE 5EYKA 5FTQA 5K0XA 2WOUA 5AR4A 3VUGA 4JR7A 3H10A 5AIRA 3QBNA 3MIAA 3E92A 2HELA 2W1DA 4RWKA 5E8VA 5I9UA 4D2VA 2A0CX 3UG2A 1JVPP 4FV3A 4BDHA 3BYUA 3VW6A 5DHJA 2OXXA 3CLYA 3PXZA 5IQFA 3V8SA 4EWHA 5ANJA 1MQ4A 4GT4A 4P5ZA 4F1TA 1JKTA 4RJ3A 3VJOA 1OKVA 4TN6A 3I4BA 4O86A 4JT3A 2YWVA 3FLWA 3PJ3A 3QUPA 4C3FA 3BU6A 4L7SA 3V04A 1YXTA 2OU7A 2XUUA 2CN8A 4GU9A 4RA4A 4D5HA 4FTOA 5A4QA 5C8MA 3JY9A 4HCTA 3OS3A 5CF6A 5K5XA 1AGWA 3BGZA 3W8LA 3Q2JA 1REJA 1YDTE 2I40A 3FL5A 5H9BA 4RWJA 2VU3A 5LMBA 2EWAA 4L53A 2C5OA 5IA3A 3R9OA 4BBMA 2PMOX 3DXPA 4ONAA 4MAOA 3U87A 4O7LA 3ODYX 1KOBA 4QTAA 3OCSA 3ERKA 4DF3A 5FTGA 1Z9XA 4FG9A 4FUXA 5CEQA 3Q52A 3B8QA 4QPAA 4JBVA 4MF0A 3MVHA 4HVSA 4O0YA 4BCNA 3WARA 2ZMCA 4DG2E 4AW1A 4MD8E 4EH7A 4X0MA 5CAVA 3I5NA 3BHUA 4NCTA 3LMGA 3LQ5A 3Q6UA 4EL9A 1B38A 2XIRA 3OF0A 3UP2A 4CFUA 3NUYA 4IADA 5BVFA 4OT5A 4X3FB 4ASXA 4EHVA 2YN8A 4DFZE 4Y46A 4O6EA 2OH4A 4C34A 4DEAA 2B7AA 4GIHA 4YJVA 3ZM4A 1G8SA 4YJPA 4F0GA 2HAKA 3I81A 3OUNB 4NM3A 5GZAA 3Q60A 3EKKA 4IAYA 4MXYA 4HNFA 4YZBA 4D4VA 1YXVA 3MFUA 3QWJA 5AR2A 2CNVA 2CSNA 2ZAZA 4YC6A 5BX0A 3NVMB 2PYWA 5CU4A 2BFXA 4M68A 3PY3A 2OO8X 4AXAA 3EWHA 4B9DA 4DT8A 2GFSA 1R39A 4PL5A 2F2UA 4B99A 4MH7A 3CCNA 4IAFA 3IW8A 4QQTA 1XH5A 4L52A 5M51A 4GYIA 5GJDA 5EM5A 3UGCA 3DDQA 3DGKA 5EKOA 3SX9A 3LCSA 3REPA 4FODA 5DRBA 3TNHA 2R3IA 5FRIA 4FSMA 2QD9A 2IN6A 3A7FA 3KULB 3FZTA 3ID6C 3DTCA 4X3FC 5JRSA 3AC2A 2H6DA 3GU6A 4G1WA 4FKIA 4K9YA 4D55A 2ITVA 1KE7A 4UV0A 1WBTA 2PE1A 3H0YA 4NSTA 2ETMA 4CFWA 3QKMA 4DGGA 4FKVA 2PVFA 4FTAA 4CQEA 4XBRA 2J5FA 2YIWA 3HV6A 3P0MA 1WBPA 4B8MA 2QQ7A 5AP7A 4IJPA 3UZTA 4G9RA 5CALA 3V01A 4FIIA 1JKKA 3SLSA 2XK7A 3RAHA 4MXAA 2F9GA 3HZTA 4F09A 1CMKE 2R64A 4ZTMA 4FIGA 3CGOA 3OFMA 3OXIA 3PA4A 2XKDA 3PIZA 4CMTA 3NW5A 3SOCA 3PXKA 2IG7A 2J9MA 2ZV8A 3TKIA 1RJBA 4PL4A 4BWKA 4O7TA 2VTJA 5EQPA 5H8EA 4PPAA 3DKGA 5GZ8A 5JSMA 5KCVA 3VUMA 4C2VA 2WIHA 4UWCA 3VBTA 1P5EA 5DT3A 5BVKA 3CC6A 3QQFA 2RGPA 2R3MA 3FLSA 3G6HA 5AP0A 3UNZA 4FX3A 2ERKA 5EW8A 2C5NA 4ANQA 4ZY6A 2C0IA 3VHKA 4M15A 2YM3A 4ASZA 2B9IA 2OXDA 3QZIA 3B2WA 3KN6A 4RJ8A 2ZM1A 3FWQA 2IVTA 3I60A 3R00A 3R8MA 3FLQA 2VTTA 2J90A 2IO6A 1IRKA 3NUNA 4OBOA 2XF0A 3ZO1A 4FSUA 4BRXA 2H96A 4ZSJA 3GQLA 4E4NA 1P4OA 1F0QA 2V55A 3WZEA 1VEBA 3KC3A 3M11A 4RT7A 4JBQA 4KA3A 4A4LA 1PF8A 2FGIA 2YERA 2PSQA 2UW0A 3G0EA 2B0QA 3VO3A 3TIYA 4QMNA 4FKPA 4O84A 4KS7A 2X2LA 4MX9A 3EQPA 3WBLA 4MBIA 1OBGA 1J3HA 2KULA 2ZV2A 3EQIA 3OY1A 5ANIA 4FV9A 2SRCA 2HY0A 2UW5A 2PVKA 5L3AA 3BIZA 3MPMA 1H1RA 4J8NA 4D1SA 2QODA 5CLPA 2I0YA 4HGLA 3OP5A 2I1MA 2JLDA 4RQKA 2PZIA 3ZYAA 4BGQA 2R3GA 4C37A 4NU1A 4XEYA 3R28A 1YDSE 3POOA 1TVOA 2V22A 3VS1A 3T9TA 1WAKA 4HGSA 3UJGA 3ORIA 3NYVA 4C2WA 4FEXA 3EB0A 4IZ7A 4LYNA 4TYGA 3P5KA 4LG4A 4YC3A 2Y6MA 2R7BA 2O2UA 4QYYA 2HW6A 2QOOA 3ANQA 3R02A 2PVMA 2XNMA 3DFCB 4J99A 2F7EE 4PPBA 3TV4A 4K0YA 3GC7A 3I0QA 2X9EA 4J52A 4H3PA 3FXWA 3QXPA 4C35A 5ITAA 4RWLA 2BTSA 3I5ZA 1FVRA 3W2OA 4FV0A 3I0OA 1GZNA 1OL2A 4JNWA 1MRVA 3AC8A 4U79A 5L2WA 3OUKA 4GCJA 5CSXA 3C4FA 3DAEA 2FSMX 1Q61A 3IDCA 3BELA 3UOLA 4MK0A 5HX8A 3ZUUA 3ORZA 2BRBA 3ODZX 1JNKA 4E4LA 5CAPA 4OTFA 4C4EA 2VO0A 3MH3A 2GPHA 2IZRA 2NP8A 4MXZA 3K3JA 4IH8A 4ZOGA 5HCXA 5IA4A 5L4QA 3KVWA 3QX4A 4IM3A 4EC8A 4ZMFA 3EKNA 4EBVA 5J1WA 5JGDA 3JY0A 4E6AA 4PP7A 2C6KA 1XBBA 2BKZA 5J7HA 4HOKA 3WF7A 5LWMA 5CQWA 2IWIA 3ZU7A 4R8QA 3VUKA 3GQIA 3QLFA 4MEDA 3LFCA 2XEYA 4PMTA 4USDA 5DEYA 5EM7A 3V5TA 4AZSA 3DNDA 5EKNA 3KK8A 3PIYA 3EQHA 2ITYA 4IAKA 3TXOA 2J0IA 4UZHA 4BCIA 3EN4A 2RFDA 3EL7A 5CEPA 2UZEA 4F63A 3E8EA 1TQMA 4PTGA 4XG2A 4QMYA 2WMSA 2WTIA 2Z7LA 4D2SA 4GUBA 3RPSA 2BDWA 4A9YA 5JRQA 1MP8A 5DOSA 5CSWA 2HENA 2QLQA 1VYWA 3OW4A 3FI8A 3NSZA 5E8ZA 4CFXA 5JT2A 3RZFA 4E7WA 3DKFA 4AA0A 5BPYA 1Q24A 4H58A 2IVVA 3VBWA 5CZHA 1HCKA 3OXZA 3W18A 4FKLA 3OT8A 3UOJA 3UC4A 3MB6A 2J51A 2XEZA 4NUSA 2C1BA 2VX0A 4G2FA 4IM0A 4JRVA 5AUVA 5E8WA 3S1HA 1FMOE 2QR7A 3NRMA 2GS2A 3QXOA 2QU6A 4UYNA 4AFJA 3T3UA 2YDKA 2F7ZE 5GJFA 3G90X 4M7IA 4XG6A 5J79A 3I1AA 1QPEA 3BYOA 4RIYB 5J5TA 3DFAA 3FZPA 3PVUA 3R1YA 5IQIA 4IX6A 1Y57A 2EVAA 5EYMA 4ZIMA 4DH8A 1Q8ZA 4ORKA 2ZDUA 3LFSA 4KKHA 4XG4A 1AQ1A 3KQ7A 4NL0A 1FQ1B 5IQGA 3F7WA 2BHEA 5HI2A 2J0LA 4OBQA 5IQEA 2ZMDA 4XLVA 4QMVA 2GU8A 4FZ6A 2WPAA 3VUIA 4EH4A 3P79A 2G1TA 3PJCA 4OTDA 3R7UA 4BGGA 5CAQA 3BGPA 4F6WA 1H25A 4A06A 4KKGA 4QMLA 1FBNA 5IQCA 3FXXA 5DT0A 4NM5A 4D4YA 4E4XA 4L67A 3UIXA 3MTFA 4JG8A 4QT1A 3F7ZA 3PIXA 3ZLXA 1ZXEA 5HE1A 4FNZA 1E1XA 3DA6A 4CD0A 2OGVA 3D83A 2XNOA 4U45A 1ZYCA 3RMFA 5AA9A 2Z60A 4IX3A 4EH3A 4MKCA 3QRTA 4MYGA 4AE9A 3QYWA 5CNNA 3BQCA 2JBOA 3E3BX 2NPQA 4RIXB 4E73A 4AFEA 3S00A 4D5KA 3FHRA 2NRYA 3D5VA 3ZLYA 1H0VA 5J9ZA 2E9NA 1XH4A 2Y6OA 4JDHA 5FBOA 4HZSA 2WMRA 4R1VA 2IVUA 5AWMA 3VQHA 2I6LA 4KWPA 4IDVA 4F0IA 4HYIA 2JKMA 3KRXA 3KXZA 3R2BA 4GFOA 3LCKA 1JQHA 2OIBA 5CXHA 3S95A 5A6OA 2CKOA 2WMUA 4PWNA 2R3JA 4GUEA 4LGGA 5FM2A 4BB4A 1OITA 4FEQA 5M09A 2QI8A 3NDMA 5M4FA 2QHNA 3FC1X 3W32A 5EYDA 4BDJA 3AT2A 5E92A 4FV2A 3ROYA 3SC1A 1O6LA 4F9CA 4EK5A 2W4KA 3HMNA 3V51A 4O0XA 5E8SA 3K5UA 3OROA 2FVDA 1NVRA 4XMOA 3C4EA 3AC4A 4AN2A 2JC6A 4FVQA 1YVJA 2LGCA 2OZAB 4GSBA 3SHEA 4BCKA 4F64A 5LQFA 2I0EA 3MVLA 4KKEA 5BYZA 2YIXA 2OW3A 3VS4A 4CYJA 4PDPA 5HD4A 4G17A 3MS9A 1AD5A 4RC4A 4FTRA 1BYGA 4BDAA 4CKJA 3R30A 4XS2A 2VGPA 3LQ3A 5DR6A 3GBZA 2YM6A 3HV4A 4AG8A 4BDIA 4EKLA 4Y5HA 4XV2A 5EG3A 2PUUA 3MA6A 5KO1A 3EJ1A 2YDJA 1ZRZA 1W83A 4IZ5A 3ZLSA 4AACA 3WYXA 4BIDA 3PTGA 3EN7A 4UWBA 5HNBA 3V8WA 4FSWA 3V5JA 5HVKA 3LW0A 4QP2A 3UO6A 4YGAA 4YBKA 3RNIA 4CCUA 3UO5A 1SVEA 5M44A 1O6YA 4DEIA 5IUGA 3ENMA 2G2IA 4MXXA 2OBJA 4O2PA 3ORTA 2W99B 4IW0A 3TM0A 3OZ6A 3P7AA 4JX3A 5G6VA 3UOHA 4NTSA 5A4CA 2XBAA 5HIEA 3KMUA 3OVVA 3TV7A 4DH1A 4WG4A 4DE4A 5DI1A 5DMZA 2XH5A 1OVEA 3ACJA 4FOCA 4QTDA 4U6RA 5BUEA 4C4FA 2CGXA 4NZWB 5IMXA 4F99A 3SG8A 3P78A 5DVRA 3FMEA 1X8BA 3RM6A 3R1SA 4N6YA 2VTMA 2PMNX 3QD4A 4HCVA 4XV3A 5CT7A 4G3CA 2PL0A 5L8LA 4RPVA 2VN9A 3QC4A 4GMYA 2C0TA 2VTPA 3ZM9A 3K2LA 2WMBA 3K3IA 4RG0A 1CM8A 2WMAA 3LXNA 5J87A 3VW8A 3ZHPC 1YI3A 4DBXA 5AIKA 3HDNA 4FVRA 4GJ3A 2PPQA 2YZLA 4EEVA 4UALA 1Y6BA 2PZRA 3A7HA 4YJTA 3VS3A 4CTCA 4FMQA 5FDXA 2OXYA 2UZWE 1OM1A 4IX5A 5HVYA 4IVBA 3SXFA 4UMUA 4RWIA 1IG1A 1U54B 4MWHA 2RFEA 4QPSA 4WNOA 3WZUA 3VS2A 4CLJA 3N4TA 4WSYA 5TE0A 3MH2A 4KINA 2BRHA 4C0TA 3QGYA 4EOQA 4CG8A 2X7GA 4AT4A 2G9XA 5M07A 2GNJA 5E9EA 5IKWA 3FMMA 4RIYA 4YSJA 2QURA 1F5QA 4OAUC 4NIFA 2QU5A 4FT0A 2B1PA 2ITXA 5K0KA 4EUUA 4CZUA 4N57A 4IC8A 1G3NA 3OW3A 3R01A 4OGRA 3ZO4A 5HGIA 3BHTA 4Y83A 3TG1A 2FH9A 2C4GA 3CKXA 3VJNA 4HNIA 4ANOA 4LQMA 3EN6A 4ZJVA 2XNGA 4ITJA 5L8JA 3SKCA 5CVHA 1Q8TA 3PVWA 4XRJA 3RNYA 1Y8YA 3GU8A 3FY2A 1RDQE 4F08A 1MRUA 4FG7A 4U3YA 2QOBA 3F9NA 4F6UA 4CCBA 4TYHB 5BUJA 3A8XA 3TCPA 4NT4A 5HO7A 4F70A 3ZSGA 3O71A 1RE8A 4C36A 2VAGA 4DH5A 4U41A 1PYXA 3L8PA 5AP2A 2ZDTA 4RIXA 5BVEA 3JVRA 4ACHA 5J5SA 2XRUA 2XKCA 1R0PA 2PVHA 2WZJA 4ZXTA 4Y8DA 1HCLA 3A99A 1BL7A 2WGJA 3FMNA 2XIXA 3VIDA 3P23A 3VULA 3RCJA 2IW9A 5JFVA 5FEDA 3FKNA 4OW8A 4FKOA 4RX8A 4AE6A 4CEGA 2QC6A 1UNLA 3NYOA 4BKYA 4J8MA 1SZMA 1WMKA 4M84A 5DT4A 2ERZE 2YA9A 3R04A 1XWSA 3TKHA 3HAMA 2XNPA 3KMWA 5JGBA 4XCUA 3T3VA 4RVTA 2ACXA 4FTUA 4V04A 3BEAA 4FTMA 2F7XE 4O0VA 3TUBA 5HX6A 2DYLA 3BCEA 2OZAA 5I9WA 2ONLC 3NNUA 4IVDA 3UVPA 4NJ3A 2IW6A 3I79A 2WU7A 2YIYA 3FMJA 5FWKK 4XYFA 2OFUA 5CYIA 4Y73A 3UP7A 2XYNA 4TYEA 3U6JA 4O1PA 4W8EA 5EW3A 5FBNC 4HVDA 5CAUA 3OWKA 1I09A 3AMYA 3DNEA 4NM0A 1J91A 4I92A 3LE6A 4V01A 5HE3A 4EOIA 4EONA 4DFUA 3R7OA 3MY0A 3L9MA 4RVLA 2BTRA 2ZV9A 2KTYA 4FKWA 4UY9A 3SW4A 1WBSA 4FTTA 4ZTQA 4BCJA 3OTUA 4KUJA 2AUHA 3MH1A 4C57A 5A4LA 5AP4A 4LMNA 1KUTA 3FE3A 3Q32A 4O0WA 3BYSA 4O1OA 5D11A 3UG1A 4I20A 3CJFA 3OY3A 3U4UA 2BDJA 5IEXA 3D4QA 2QCSA 3LCDA 4AS0A 5AX9A 3QTRA 3UQGA 4EYJA 4OTQA 4CLIA 1NXKA 4KABA 3H9RA 3UC3A 3HMOA 3FHIA 3IDPA 4HYHA 3FQHA 3NAXA 4UN0C 4QO9A 4PL3A 1WBOA 4G3GA 3FSFA 2UZDA 3IS5A 3PP0A 3ZZEA 5IPJA 3SRVB 3FLZA 2QHMA 5D10A 2C6TA 5L6WL 3UMXA 4G31A 2XBJA 4AW2A 5CY3A 4BWPA 4MCVA 2BFYA 1QMZA 1CTPE 4M69B 2B9JA 2X2MA 5ACKA 4AP7A 3P1AA 1YW2A 3KRJA 2VWWA 3F3WA 3F3TA 3VWAA 5LVPA 4Q2AA 3Q96A 2VO3A 5E90A 5EDRA 5LMKA 2W5BA 4TPTA 3Q4CA 5AV2A 3WF5A 1IAJA 1OIQA 3E8NA 3EOCA 5H8BA 1UU8A 3PXFA 2PZYA 3R21A 2EXMA 2WTKC 1H0WA 3R7GA 4FA2A 4ZY5A 2CDZA 3GOPA 4IWDA 4X7QA 1PMNA 1U54A 2QNJA 3F69A 4JDIA 4DTKA 3QZFA 5BNJA 2H8HA 4BCOA 4IM2A 4ANMA 2XKEA 3TWJA 2OFVA 4K6ZA 5I9YA 2UW9A 4EHEA 2R9SA 1ZZLA 2HW7A 4MXOA 4EH6A 1YI4A 2R0UA 5CU0A 4PTCA 3M1SA 2WQMA 3G33A 4DEBA 3KK9A 4PPCA 3QAME 3IG7A 2W1ZA 3OXTA 4FSRA 3BGQA 4P2KA 1UWJA 2FB8A 5AP3A 5HBJA 5KHXA 1ZYLA 5M4IA 1OMWA 4D0XA 4KIKB 3TZ8A 3SDJA 5EW9A 2JKOA 2CLXA 3FYJX 4MF1A 1PKDA 2YM4A 4ASDA 1YXUA 3RHXA 3THBA 4B6LA 3GU5A 3HEGA 1XHAA 2BAQA 2AYPA 2PVLA 4X6RA 3G2FA 3IOPA 4QMZA 4S34A 2R2PA 3LMHA 2ITNA 4JBPA 3KVXA 3QWKA 3F66A 1GAGA 4PV0A 4YZDA 5FQDC 5I3RA 3TUDA 4QMMA 3CD3A 4IC7A 3OCBA 2VWXA 4O27B 4BTKA 5JK3A 4FZAB 3UPZA 2YWPA 4HJOA 4N4SA 5A4TA 3U9CA 4FT3A 3F6XA 4MQ1A 4NJDA 5BVDA 3KRWA 4N0SA 1V0OA 3U55A 2BZHB 3GB2A 5CSVA 5AM7A 4L9IA 4XP2A 3RGFA 4FSYA 4BN1A 5IMEA 3PE2A 4ZP5A 3Q9ZA 4CMUA 4ANNA 4F7NA 4YJRA 4ZTSA 3HGKA 5CU6A 5HU9A 4O7YA 1M2RA 4EHZA 1Q97A 2QKRA 4CT1A 2A4LA 4EK4A 3A8WA 5JN2A 4YTCA 3VS5A 3LZBA 4E5AX 3FLYA 2YM5A 1WCCA 4XG9A 5ETIA 2FYSA 4O83A 3KA0A 4FZFB 2VWVA 3C50A 5DH3A 5HLNA 2VWIA 1ZYJA 4UMQA 3L9NA 4M8TA 4FG8A 4I22A 4P5QA 1SYKA 4QYHA 4D2TA 5IISA 5ACBC 5FTOA 5HCZA 4EBWA 3WZJA 1BLXA 4RX7A 2J2IB 2WELA 3TN8A 4UMPA 3N51A 3PVBA 3W1FA 4O81A 3NCGA 5CF8A 3Q9YA 4BI0A 4D9UA 4FTLA 1PMVA 2WMQA 2ZM3A 4ACCA 3FC2A 4XP0A 2GFCA 4ZEGA 4V05A 2QOCA 1IEPA 3KU2A 4L3LA 5HIBA 3KCKA 4UX9A 5AR8A 4I0SA 4C58A 4PDYA 1B6CB 3O50A 1JWHA 3FXZA 4F1MA 4CTBA 1J7IA 1OKZA 4IIRA 1M14A 3I6WA 3QCYA 4KSQA 1BI8A 3KF4A 4CT2A 3BV2A 4IWPA 5F4NA 2W4JA 3ZTXA 1V1KA 1BMKA 2YEXA 3ULZA 1IA8A 3DBCA 3VRYA 2J6MA 3R9DA 4DN5A 2JIVA 2VTLA 3AC5A 1XH8A 3NAYA 3W2PA 2ITWA 4GRBA 1CKJA 4RJ4A 4E3CA 5LVOA 2W05A 5AP6A 3HV7A 2B4SB 4AT5A 3PP1A 1JLUE 2E9PA 3QFVA 3HV5A 4CKIA 5KMJA 3TUCA 1NW1A 2PHKA 4LFIA 2JDOA 2QR8A 2ZB1A 1UA2A 3ZBXA 2ITZA 5FXSA 2F57A 5BMSA 2E9UA 4MBLA 4U44A 1PXPA 3R7IA 1UVRA 4NH1A 3D14A 3MYGA 4CFFA 1PY5A 4DLIA 2FSTX 4YR8A 2VTAA 3W16A 5I4NA 4OBPA 5DFPA 5KUPA 4I4EA 4ZTHA 2WMVA 3FQEA 2PMLX 4R5YA 1PW2A 5EDQA 4AZFA 2XK4A 4A4XA 4CFMA 1R78A 4CSVA 4QMXA 4DTAA 3NUXA 4EOKA 3LJ2A 4FV5A 2HK5A 5E1EA 2B52A 5AR3A 3WZKA 4S31A 4FTCA 2BCJA 5LARA 2PZ5A 3NNVA 3EQCA 3L9LA 3NW6A 5DG5A 4JQ7A 4PQNA 5HBEA 5KMLA 4YC8A 3IONA 3MTLA 4XUFA 2XIKA 4DHFA 5L6OA 1A48A 2PMIA 3QL8A 2WEIA 4I6QA 4TNDA 4YLJA 4MWIA 5HVJA 3WIGA 3R8ZA 5ANKA 3Q5ZA 4ALVA 3NW7A 4EK3A 3D7TA 3QQGA 3QTWA 4FV4A 4G6OA 4RFMA 4Z7HA 3FMDA 5D9HA 4CV8A 1ZZ2A 2JITA 3HL7A 4TYIA 1NA7A 2J5EA 2X0GA 3NUUA 2R3HA 4U81A 3HP5A 4FL3A 4YZCA 3WYYA 4ANLA 4BHNA 3R0TA 4DITA 4R3CA 2Y4IB 2G15A 1JOWB 3BKBA 4CG9A 3IO7A 4IWQA 4E5BA 1XKKA 3DKCA 3BE2A 3HYHA 4AGDA 3II5A 2DUVA 3ZMMA 2E2BA 4O96A 3EQGA 5ETAA 2BALA 2C5YA 4FL2A 3MFTA 4MD9E 4S32A 3ZO2A 3EZVA 4C4GA 3PZHA 4XNEA 5AP1A 5IH5A 2GS6A 4FKQA 2RL5A 4AOTA 4DFBA 2O63A 3BU5A 1B39A 3ETAA 3GP0A 3ORPA 3CBLA 4MQ2A 4XG7A 3IPHA 3RVGA 3HNGA 3EQBA 2P55A 4YO4A 4L45A 3ZRMA 4TZRA 3WZDA 3GVUA 3F5XA 1KE6A 1GZ8A 3MFSA 3O51A 4RRVA 4GKIA 5LVMA 5F95A 4EK6A 1PXJA 1NY3A 3LHJA 4QMWA 5HNGA 3V5PA 3COIA 1T45A 2Y4IC 1YXXA 2V7OA 2CKPA 4ZSAA 1J7UA 5GHVA 4IAIA 3R6XA 4CKRA 2YCFA 3PLAE 2GNLA 1UU9A 5H8GA 5JZNA 2P2IA 2ZYBA 2FSLX 5ETCA 1H27A 2GTNA 3ALNA 3NS9A 4TY1A 5ETFA 3TI1A 3VN9A 3VS6A 3GCSA 3DZQA 3ZXZA 4WUAA 5A9UA 1ZARA 4BDEA 3FV8A 3HV3A 3CEKA 4I5MA 2QO2A 3D7ZA 2X8EA 5HHWA 3K54A 4FT7A 3QZHA 1TQIA 2JDSA 1NVSA 4R3PA 4XBUA 3OCGA 1GZKA 5CU2A 4BTMA 5C9CA 4PP9A 4C61A 4O7VA 5CEOA 2BROA 4GG7A 4QP8A 3LJ0A 2XJ2A 3C0GA 3A60A 4JBOA 2C6DA 4A9SA 3OTVA 4AN9A 1P2AA 1W84A 4BDFA 1Q41A 4O7NA 3DOGA 3PPJA 4J53A 5DN3A 2VTIA 1GIHA 2BRNA 2XM8A 4R5SA 4W4XA 4C59A 3ZOSA 3MVJA 1UU7A 3EFKA 2WKMA 2VO7A 2Z8CA 3PSDA 4MBJA 3NEWA 3TIZA 4JS8A 4QD6A 3AD4A 3LFAA 5FD2A 4O38A 4X3FA 2YJRA 3HAVA 3KL8A 5AP5A 5AM6A 3RZBA 3EL8A 3LXKA 3SV0A 1ZYSA 4BTFA 5IZFA 3QRUA 5AADA 3NNWA 2REIA 2BMCA 2GHGA 1OUYA 3D5UA 3BLRA 3DAKA 3LCTA 4O6LA 3LFNA 5E7RA 5I5ZA 4RX9A 2R4BA 5EI2A 2BHHA 4IBMA 2W06A 4IAAA 4I5PA 5EHOA 1Q8UA 3PVGA 2JAVA 4RSSA 4OR5A 3H9FA 2C1AA 3MBLA 4FIJA 3PA3A 3BHYA 3R7EA 2HXQA 3TDWA 4I5HA 1H26A 2ETRA 3E8DA 2YISA 2C6EA 5CI6A 3D5XA 3MSSA 4I24A 4Y5QA 4LV5A 3KULA 3OG7A 2OWBA 5AV3A 2W1CA 3KXMA 4GKHA 4L42A 2OF4A 5IDNA 4FSZA 3MJ1A 4J96A 4YPSA 2NNWB 4HGTA 3BPRA 3TZMA 4N70A 4U97A 3W55A 1UV5A 5E91A 4MD7E 5F94A 4R78A 2RIOA 1XH6A 2WMWA 2XK3A 1EH4A 2V62A 2Y9QA 1E1VA 3QUDA 4I6HA 1UNHA 1W82A 4XG3A 4ZTNA 3ZBFA 1DM2A 1KOAA 3PLSA 5G1XA 2YLFA 3PWYA 3C4XA 3LXPA 3ZEWA 3BLQA 5HG9A 2VWUA 5J8IA 4L46A 3R8VA 1JBPE 4GK3A 1DAYA 3PPZA 2YFXA 5EI8A 3UE4A 2F49A 1R3CA 2XKFA 1ZYDA 4EOMA 2HZ0A 4MTAA 4RZVA 2ZV7A 3NIEA 4GG5A 2JD5A 3C9WA 2CCIA 4LOPA 3HMMA 1ZOEA 1DI8A 5M06A 4IE9A 4V0GB 3Q3BA 4FI1A 2XJ1A 3BE9A 4FGBA 4DEGA 3UQCA 1XBCA 3F3VA 3ZFYA 1OKYA 4LUEA 4WNKA 2A19B 3VNTA 4DEHA 2G01A 3UZRA 3NR9A 5I9XA 5KX8A 3PY1A 4BZNA 5J1VA 3BX5A 3S0OA 3DJ7A 4BC6A 3C4ZA 3LOKA 3QZGA 3MIYA 5D1JA 4E6DA 4WA9A 5I0BA 2VV9A 4X2NA 3ZUTA 1KE5A 2YCRA 3OC1A 4A7CA 5L2SA 4MNEB 2YITA 5CVGA 4F9YA 4TNBA 2W1EA 4R1YA 5HG8A 4K77A 5ICPA 4H1MA 3RWPA 3B8RA 5BYLA 1ATPE 2HWOA 2X6EA 4QPMA 5KBQA 2OIQA 5AUZA 4ZSLA 1XO2B 1CSNA 4B7TA 4FYNA 4CQGA 3FSKA 2ESMA 3JS2A 5CQUA 1V0BA 3RP9A 4RVMA 3AXWA 2C3JA 4DGNA 1JSUA 1VJYA 5EDPA 3Q4ZA 5M53A 3TDVA 1CKPA 3AT3A 4XH6A 3AOXA 3W2QA 3WE8A 2UVZA 3NWWA 4EH9A 2CNUA 3UDBA 2VTRA 3H4JA 1LPUA 4X21A 3ORLA 3CY2A 3A4OX 1GY3A 1OZ1A 1R1WA 3AGMA 3B2TA 2RG5A 2YJSA 3GCPA 3GT8A 4I0RA 3RJCA 4Y72A 2V5QA 2NRUA 4RC3A 5JFWA 3R71A 3DCVA 3GOKA 4HYUA 1DS5A 2VTQA 3I6UA 3OCTA 4FKUA 4D4RA 5LOHA 4I4FA 2QG7A 3W8QA 3NLBA 3A7IA 4M3QA 2B55A 3QQJA 1J1BA 4M67A 3TEIA 1YOLA 3PFQA 4AZWA 2GCDA 3R2YA 4JJRA 3LQ8A 3D15A 4PNKA 5GNKA 2I0HA 4ITIA 3HMIA 4J95A 3IDBA 3UQFA 4OTWA 2XYUA 3F2NA 1YWRA 5CVFA 3ATTA 5TOZA 2LAVA 1PXKA 3UVQA 2O5KA 4L00A 3ZRLA 1L8TA 3DS6A 4GK4A 3TL8A 4BBFA 4FKSA 1ZWSA 3R73A 2HOGA 4TWNA 4ITHA 3EFLA 3FZRA 3L9PA 3GCUA 4BCQA 5FXRA 4O7SA 2CHLA 2J0MB 3EHAA 2Z7QA 2BDFA 3V8TA 4Z16A 4KNBA 3MI9A 3R9HA 4DC2A 2R3NA 5IQBA 3R8PA 4AW5A 2JGZA 3C5UA 5D7VA 3LM5A 4I6BA 3LXLA 3Q5IA 5IUHA 1RQQA 5HG7A 4QTEA 5JFSA 3DXNA 3DV3A 2OZOA 3OBGA 5DR2A 3H3CA 5JGAA 1H24A 4AA4A 2B9FA 2PK9A 1PJKA 4U8ZA 2RFSA 3CP9A 2VZ6A 4BCFA 3UTOA 2EU9A 3AGLA 5GZ9A 1YOJA 3QD0A 3HKOA 4IB1A 5JEBA 2JFLA 2HIWA 1OBDA 2YHVA 1ZOHA 3PZEA 3O7LB 3ZFMA 4YLKA 3NVKI 1JPAA 3MGYA 1SNXA 1Z57A 2IVSA 1WVXA 4TW9A 3PY0A 2IZSA 2R3FA 2Z7RA 3MVMA 3Q4TA 5GJGA 4BZOA 3FEGA 3NYNA 4ZK5A 3W2SA 3HLLA 5KE0A 4RJ5A 4I93A 5AR5A 3ELJA 3GFEA 3RWQA 4O91A 1H8FA 3RCDA 5IU2A 3SVVA 3PUPA 4Z55A 3NNXA 4FV1A 4IWOA 4A9RA 4DA5A 1FINA 1FVVA 4L6QA 3CSVA 3ET7A 5I9ZA 3RTPA 4ZZNA 2R3OA 2JDRA 4P4CA 4M14A 3ORNA 1YHWA 4Z3VA 2HXLA 2Q0NA 3L8SA 5C4KA 2WMXA 3EYGA 3UOKA 5K9IA 3BWJA 4TWCA 5JFXA 3FI4A 2VNWA 4FNXA 4Y85A 1UKHA 4G3FA 1WBNA 4C7TA 3SXRA 2C0OA 3OMVA 4U40A 3R63A 4FKTA 4IFCA 3CQWA 3EN5A 4G3EA 1YKRA 2VGOA 4USFA 4GT3A 2RSVA 4L3JA 4OUCA 3SAYA 2G2FA 4OT6A 3RK5A 1YOMA 4FL1A 3VBXA 1PXLA 4KD1A 4U3ZA 1H1PA 5AX3A 1U46A 3F2RA 3EZRA 4KIPA 2GMXA 3PG1A 2ETKA 3DBDA 2XVDA 3ZSHA 4QTCA 5CANA 3U54A 3KXHA 5HO6A 3S3IA 3FZSA 4BKZA 5AA8A 3MB7A 3GC8A 3RM7A 3P9JA 3LAUA 3AT4A 4FZDB 3LPBA 4YZMA 2W9FB 4MNEA 4DGMA 2A27A 3PXRA 5L6PA 5B2MA 3DTWA 4XLIA 1CKIA 4AU8A 5IA1A 4GV1A 3UMWA 3WILA 2XK6A 3RAWA 5CZIA 4UMTA 3SXSA 2FSOX 5M57A 5DWRA 2ITOA 4AZVA 4QOXA 4GYGA 5KMOA 3NUAA 2H9VA 1Y6AA 4FT5A 1Q99A 3TTIA 4DTBA 2JEDA 3VQUA 3IECA 4PMPA 5CF4A 4F7LA 2NO3A 2FA2A 1Z5MA 3ZO3A 2QO7A 3PA5A 2R7IA 4RQVA 5HE2A 2W5HA 4EWQA 2WTDA 3PPKA 4AAAA 4QTBA 3VVHA 3D5WA 3LFFA 5LMAA 2G2HA 3QGWA 5T68A 4J1RA 3QF9A 3DBEA 2HCKA 4ZJJA 3FMHA 4BFMA 3AD5A 3F88A 3FDNA 4YUQA 1R0EA 4QMPA 2XCKA 4I0TA 1FOTA 4BCHA 5CU3A 2WEVA 2YCSA 2A2AA 3VS0A 4QYFA 3A62A 4FKJA 4EC9A 3FY0A 4FGRA 1PMEA 2ZB0A 2QONA 2UW3A 3BEGA 4W4YA 4IXPA 4K11A 2JAMA 5DE2A 5ANEA 4UMRA 1GIIA 2X6DA 3DJ6A 4JQEA 4ZLOA 4BCPA 4FV6A 1ERKA 5CNOA 4JVGA 4QNYA 4H39A 3GUBA 5B2KA 3UIMA 4X2GA 1UU3A 3AQVA 1NVQA 1IA9A 4WKQA 1SNUA 3VBYA 2JKQA 5HEZA 4CRLA 2X8IA 1PYEA 3O0GA 4CFNA 4BDKA 4TWPA 1S9JA 2R3PA 3JPVA 3QCXA 2QG5A 2CKEA 1H01A 1BUHA 5CASA 3VC4A 1A06A 2WTKB 4BF2A 4WOVA 4NFNA 2YAKA 4HZRA 5D7AA 3MN3A 3P7CA 2QOKA 4FE2A 3F5UA 5L2IA 3CE3A 2Y4PA 5DYJA 3AMBA 1V0PA 3RBWA 4AX8A 1GIJA 4DLJA 5EOLA 2UZVA 4AA5A 4D0WA 1YHSA 2IZUA 3L8XA 3QRKA 4DFLA 3DK6A 3H9OA 2QOHA 2DWBA 3QTUA 4CGAA 2R3KA 4NK9A 4EQCA 2OJGA 4IZYA 3DQWA 2ZOQA 2X39A 3LM0A 5LVLA 3TNWA 3PYYA 4RFYA 4U5JA 2X2KA 3GC0A 4GFGA 4YHFA 3IK3A 4ERKA 4XJ0A 3IGGA 2PZPA 3IW5A 3CIKA 4RA5A 4FSTA 2UW6A 3PRFA 5DPVA 3ORKA 3PRIA 4GH2A 5AUYA 3UIBA 4AGUA 2WMTA 4U80A 4ACMA 4GL9A 3FKLA 4B8LA 4ENYA 1WBWA 4B4LA 5BYYA 1ZLTA 4X6QC 4ZTLA 4L44A 3T9IA 5CSHA 3Q04A 1IASA 4K18A 4EOOA 4NCTC 1RW8A 2HWPA 1URCA 1OI9A 2C47A 1XH9A 2HZ4A 4DG3E 4EUTA 5EYCA 2BAJA 2VTNA 5C03A 4AGCA 1ZY4A 5CT0A 4HVHA 5HO8A 1OKWA 4ID7A 2XCHA 1PMUA 4NEUA 4TKSA 4B0GA 4ZS4A 2W96B 2XZSA 4EKKA 4Q5HA 3LIJA 2BVAA 4O82A 5D12A 5AUUA 5B7VA 4IDTA 5CTPA 4RIWB 2UZBA 3EFJA 3POZA 3KRRA 5AR7A 5HD7A 3U8WA 2PE0A 3QC9A 1Q62A 4GVAA 1F3MC 5CS6A 3ZH8A 2P33A 4I23A 1NT2A 5M56A 1HOWA 4ANSA 1I44A 2PTKA 1FGKA 2RKUA 3V5WA 3MH0A 2JIUA 3C0IA 3A7GA 5IA0A 5HBHA 4C4HA 1ZAOA 2X9FA 4BDBA 2WTCA 4OLIA 2XJ0A 3Q6WA 3NPCA 3GENA 3KKVA 4WT6A 3RAKA 5IH4A 3ACKA 4GT5A 1REKA 2E9VA 4TYHA 2QOLA 1U5QA 4KIOA 4YMJA 3EQRA 1Q3WA 4ASEA 5F1ZA 3FBVA 2XB7A 3LKMA 4Y95A 3D0EA 5EOBA 3Q9WA 2CGWA 2C6OA 2XA4A 3COHA 3GFWA 4IHPA 4AWIA 2ONLA 4C38A 4E6CA 4PTEA 5LCKA 2P0CA 2PY3A 4UWYA 3M2WA 2I7QA 3QYZA 4FV8A 3C4WA 3RKBA 4FICA 4YPDA 2RF9A 4O0RA 3PJ2A 4DH7A 3CXWA 2CGUA 1KWPA 4I94A 1YRPA 4WBBB 1OIUA 3E5AA 2BZIB 2GNIA 5EHLA 3TTJA 3QQUA 4FIHA 2XK8A 4EH8A 4E8AA 3HX4A 2VD5A 3OBJA 4TTHB 4I21A 1OL7A 2C6IA 1H28A 1W8CA 4ZTRA 5T3QA 4DFNA 5IQDA 3MPAA 4RLLA 4CZYB 3NUPA 4CV9A 5FP6A 2VX3A 4YJSA 4QQJA 5HTBA 5A3XA 2W5AA 3SD0A 4YNEA 3UIUA 1H08A 4EZ5A 4RMZA 2BKKA 3R9RA 4QMQA 2UUEA 2PUNA 4E4MA 5M55A 3VBQA 5CAOA 4I3ZA 5I3OA 4JL9A 2X81A 4ACGA 3SGCA 3HRBA 2ZM4A 3E93A 4UYAA 4OTGA 2CNQA 3DXQA 4MVFA 4XG8A 3ZDIA 4QNAA 2BZJA 2PVJA 4CYIA 5IH6A 3MJ2A 2JKKA 3MW1A 3PXQA 3CKWA 1Y91A 4GU6A 4K1BA 3P08A 4FEVA 4IZAA 3ITZA 2VTHA 3ORXA 4LI5A 3OHTA 2AC3A 2PWLA 4FNWA 5EM8A 4BDGA 3IKAA 5HOAA 3G0FA 3RPYA 2R3QA 1STCE 3TNIA 4D2WA 5E1SA 3QQLA 4P7EA 3R8LA 3FQSA 2CJMA 3COKA 5CEMA 1S9IA 2V7AA 5KHWA 4G34A 4CZTA 4GEOA 4YP8A 4DFYA 3GCVA 2BPMA 4JX7A 2XNEA 5B0XA 3LLTA 3WI6A 3QKKA 2RFNA 5AUXA 2BRMA 4IMYA 5HLWA 2PE2A 3GEQA 2BAKA 4QMSA 4QMTA 3EFWA 5HTIA 1PXNA 3OOMA 1UWHA 4YHTA 3E7OA 3EIDA 4OTRA 3ZRKA 4EH5A 4OTPA 3SQQA 1ZMUA 3SRVA 4BIEA 4K8AA 3WIKA 5AV4A 3V6RA 4M69A 3GU7A 2WQNA 4LRMA 4CNHA 2VTSA 5IA5A 5C26A 4C62A 4XP3A 5JKGA 3BV3A 4DEDA 2C5XA 3L1SA 4WSQA 2BIYA 5C4LA 3G5DA 5HCYA 2OLCA 2XRWA 3M42A 3VF8A 2W4OA 4HYSA 5AAEA 5BQ0A 4U42A 4X2JA 3TNPC 2UVXA 4R3RA 5HNIX 1JSTA 4OTHA 4G6NA 4IVAA 1J1CA 4AW0A 1KV1A 4BHZA 5E8XA 2R3RA 4PMMA 3C0HA 3IOKA 3NUSA 5J9YA 4FKRA 4JXFA 4IACA 3FMKA 5KZ0A 3W10A 4L7FA 3PJ1A 2UZTA 1OIRA 1QPDA 2EXCX 2WTJA 1JSVA 3TKUA 4C4IA 4EOPA 5AUTA 4ALUA 5IQHA 4A07A 4FTIA 4EZ3A 4ZLYA 4F6SA 3HUBA 4JIAA 1SVHA 4S33A 5DA3A 3RI1A 3FI3A 4CMOA 2J0KA 1GZOA 3ZEPA 1VZOA 5AJQA 3HA6A 3Q9XA 3FI2A 5ANDA 4AN3A 4EK8A 5M4CA 5DR9A 3AMAA 5HKMA 4RIWA 4W9XA 5L2QA 2OIDA 3BZ3A 2C30A 3VAPA 4KIKA 3QD2B 3BHVA 4AZEA 3PG3A 5CX9A 1MUOA 4I6FA 2QOIA 4YBJA 4BL1A 4NKSA 4L68A 4QP7A 4ZSGA 1P14A 2VX1A 4BI1A 3QLGA 4YTIA 5A4EA 4EQUA 2O8YA 3T8OA 4YTHA 1LEZA 3U51A 2VO6A 3KRLA 1Q5KA 2JDVA 4O0TA 1W0XC 2GTMA 1H1WA 1U4DA 3KY2A 4JRNA 5EH0A 1UKIA 2Y7JA 2EUFB 4HVIA 5CWZA 5K5NA 3FMLA 4KSPA 4U0IA 4UB7A 5BMMA 3VHEA 4FTQA 4AUAA 3QTIA 2WTVA 1XBAA 3E8CA 4QYGA 3SA0A 4ZZMA 1VR2A 3HDMA 4Q5EA 2P4IA 2OSCA 3UYTA 4BYJA 2QOQA 4IQ6A 1OL6A 3KCFA 2P2HA 4J98A 5FP5A 5HQ0A 2OJJA 3F5GA 4L8MA 3CGFA 3P4KA 4D2PA 3AC1A 3RK9A 2OH0E 4PX6A 3V5QA 3KREA 1M2QA 3F82A 4EH2A 4F9WA 3E64A 2UZOA 3MV5A 3H30A 4HCUA 2YZAA 3RAIA 3TV6A 4D1XA 3OEZA 1M52A 3CTQA 4J7BA 3G9LX 4XV9A 4C3PA 2YIRA 3N9XA 1FVTA 3VF9A 5HESA 4C33A 4FV7A 3IGOA 5CSPA 3G15A 3DAJA 1OPJA 4QQ5A 2JIIA 1L3RE 4P90A 1O6KA 2X1NA 1SM2A 4WIHA 5BVOA 1T46A 3GNIB 3O17A 4RFZA 5H2UA 3MESA 3F3UA 4RVKA 4APCA 4DBNA 4HVGA 5CENA 5TO8A 2VTOA 2ITPA 4FVPA 4NFMA 4MXCA 5TR6A 5L8KA 3ROCA 3C51A 1SMHA 3H0ZA 4FZ7A 2GNGA 1JKSA 4BICA 3ZFXA 1WFCA 1URWA 4DT9A 4IVCA 3QQHA 4W4WA 3NZ0A 4GW8A 3V5LA 2UW4A 4G3DA 1W98A 2W1FA 2XP2A 5K3YA 3ZCLA 2GQGA 3OOGA 4U9AA 4BY9E 1LP4A 1WBVA 5JQ5A 4L43A 3TNQB 3QTSA 4BKJA 5HTCA 2ITTA 1ND4A 2JDTA 4GJ2A 4UEUA 3ORMA 1BL6A 5C01A 3QA0A 4BTJA 3KXGA 4CXAA 2PULA 1LR4A 1ZY5A 3UBDA 4FNYA 2Q0BA 2XK9A 3NGAA 2R0IA 3QRIA 2CKQA 2IW8A 5AV0A 4OTIA 4YZ9A 4LRKA 3UVRA 1G8AA 2FO0A 3QU0A 1XQZA 3BHHA 2Z2WA 3DBQA 4IFGA 4PNIA 3DK7A 3R1NA 1XR1A 4Z9LA 3A61A 4FK6A 4EJNA 3C13A 2WAJA 5AMNA 4USEA 4M12A 4H1JA 3SW7A 3RPRA 4BR3A 5IDPA 2GNFA 3VS7A 3OWJA 2C6MA 3COMA 4YJUA 5A14A 1YI6A 2R5TA 3DDPA 3LJ1A 4EHGA 2X4ZA 4JLCA 1U59A 1OL5A 4O2ZA 3MY1A 4ALWA 2W0JA 3CS9A 2PUIA 3RALA 4RJ6A 3DBFA 4D2RA 5BVWA 3OWLA 3QA8A 4O21A 4QP6A 1ZOGA 5LWNA 4E20A 1OPKA 5BVNA 3LFQA 1Q4LA 5A6NA 4H05A 4QP4A 3BYVA 4LGHA 3EH9A 4GK2A 5HU3A 3UZPA 3K5VA 1FMKA 3EMGA 4YURA 4N6ZA 5DIAA 3E87A 4QQCA 5BUIA 3OT3A 5HG5A 4M0ZA 3V6SA 4IB3A 4W8DA 5TF9A 2OJFE 5K4JA 5TT7A 3E7VA 5IA2A 4YNOA 5EQEA 4NW6A 1YWVA 2HZNA 2O3PA 2W17A 4X2FA 4XOYA 4EJ7A 4EYMA 4II5A 4RJ7A 3BRBA 2PVYA 4F9AA 4R7BA 2GDOA 2GS7A 3VUHA 4MNFA 2GHMA 2YACA 3IQ7A 3GU4A 1OGUA 2C68A 4YTFA 3F5PA 3E62A 1U5RA 1FPUA 4JDJA 4C02A 3OWPA 5LJJA 1JAMA 4IAZA 4O7WA 3G51A 5IF1A 4S2ZA 3DLZA 3DT1A 3E3PA 5DBXA 2WD1A 3FL4A 4AF3A 5C8KA 5JZJA 3U6IA 3JUHA 4WNMA 1OPLA 3TT0A 4IEBA 3FZ1A 3PJ8A 2OI4X 4GS6A
chains in the Genus database with same CATH superfamily
5AAGA 3MDYA 2V0DA 2C3KA 4TL0A 3CY3A 3W2RA 3CJGA 4XX9A 4OAVB 3UYSA 2WO6A 5IUIA 4NIFB 2UVYA 3MY5A 4WRGA 2X8DA 4YU2A 5TKDA 4BCGA 1TQPA 3BQRA 3E63A 3FLNC 3FPQA 4KRDA 4JG6A 1O9UA 4YJQA 5CEIA 3F3ZA 4DGOA 5FUTA 3DB8A 5KZIA 2W1HA 4O22A 3BBTB 3TZ7A 4AZTA 4DAWA 3CR0A 3HVCA 3QCQA 4E5WA 5GIPE 2VWYA 4FKGA 2ITQA 4WD5A 5C8NA 3E88A 2YM7A 3DQXA 2P3GX 4O4DA 3ZDUA 1VYZA 3V3VA 4QRCA 5HZNA 4PUZA 4F78A 5AV1A 3UPXA 4IX4A 4RC2A 4QDVA 5D41A 4QP3A 4DCEA 1W7HA 2BILB 5FDPA 4H36A 3C4CA 3QKLA 3DKOA 4D28A 4D9TA 3LVPA 4FTKA 3ZC6A 4L3PA 4K33A 2HY81 4HW7A 2C6LA 4A4OA 3I7BA 4FT9A 3CTJA 4DGLC 3KN5A 5DRDA 1M17A 3SG9A 4LUDA 4GFMA 3L8VA 2B54A 3HP2A 3U6HA 1PKGA 4BDDA 2EXEA 4NKAA 3FAAA 3R9NA 4WUNA 3RPOA 1Y8GA 4JMQA 4WHZA 3HECA 3UODA 2OK1A 1M2PA 2WQOA 3QHRA 2J7TA 4FSNA 3ZXTA 2YCQA 3Q4UA 4FOBA 5CXZA 3NIZA 5JH6A 4C3RA 3LMIA 3KGAA 5FXQA 4KIQA 5FEEA 1OL1A 1PXIA 2F2CB 1XMMA 4FIEA 1M7NA 2HYYA 4NWMA 3ZS5A 4D58A 1IR3A 2CPKE 2WOTA 2VWZA 2WTWA 3FKOA 4HPUE 3GC9A 2JBPA 5M4UA 4RZWA 1OUKA 1OB3A 2CCHA 3C7QA 5J9LA 3HRFA 1H1QA 1P4FA 2ZJWA 4GVJA 2WQEA 3TJDA 1LEWA 3LFDA 4FSQA 3WE4A 2O64A 2XIZA 2IJMA 4BDCA 5F20A 5EM6A 3LFEA 4DH3A 1DAWA 3CQEA 3DJ5A 3D2KA 3O8PA 4IJ9A 4FC0A 4QDEA 2W1GA 3MFRA 3VUDA 3SOAA 1PRYA 3NCZA 3WF6A 5JQ8A 4JAIA 4NM7A 5EFQA 4J97A 5ANOA 3TMOA 2Q83A 2HZIA 4YJNA 5J95A 4ANBA 4WG3A 4ACDA 5HORA 2FUMA 2JFMA 2WQBA 4JI9A 4MHAA 2X4FA 3P7BA 1OECA 4X3JA 4ZMEA 4G9CA 3GCQA 4YJOA 5FEQA 5FG8A 5DNRA 4C8BA 2O0UA 4X2KA 2GNHA 4LL0A 4FF8A 1J7LA 4QMUA 4O7RA 2WNTA 3DZOA 3TZ9A 3HA8A 4J71A 4CFVA 5A54A 3PSBA 4TRLA 4A9TA 3VRZA 3ANRA 4UBAA 2UZLA 3WF9A 4O7ZA 4E6QA 2C5VA 4WG5A 3HMPA 2VRXA 4CRSA 3DPKA 4TWOA 4KBAA 4M13A 3AD6A 4FTNA 3QALE 4Q9ZA 3BI6A 1FGIA 4KB8A 3U9NA 5LCJA 3ALOA 1UNGA 4YLLA 5EQYA 4JQ8A 4G16A 2EB3A 1YXSA 4DCAA 3KEXA 5DEWA 1ZMWA 1A9UA 4JIKA 4EOLA 5J7BA 2CGVA 2QLUA 2Y8OA 3C1XA 4R7IA 3CQUA 3PXYA 4BWXA 3GGFA 3RK7A 4ZLZA 4QEBA 3ML1A 2GSFA 4AT3A 4ZSEA 2VUWA 1PHKA 4JAJA 4NW5A 3ZC5A 4D4SA 1ZMVA 2YABA 2XIYA 4K2RA 4V0GA 3EN9A 5JMSA 4I41A 1XJDA 2Z02A 4LRJA 4LL5A 3Q53A 2AC5A 4ERWA 4IB5A 3F61A 4YSMA 3DY7A 5AUWA 4BCMA 3JR1A 2WU6A 2PVRA 3O8UA 4H3QA 4APPA 3O7LD 3IW7A 4G6LA 2YDIA 3A2CA 3OEFX 3IW4A 3NYXA 4LOQA 5AFVA 4JR3A 4RX5A 2DQ7X 2R3LA 3FYKX 4HPTE 4XHKB 3RHKA 1W2FA 2PU8A 5F9EA 4ZAUA 3CPBA 4LDTA 5EI6A 5FLFA 4O0UA 3PE1A 3WF8A 5KMMA 4EOSA 2OICA 2VWBA 3QRJA 4RLKA 5CF5A 4PY1A 5LMKC 3BL9A 4FYOA 2YLEA 1LUFA 2F4JA 3W0SA 1KE8A 2ITUA 2GHLA 2XNBA 3LLAA 4XOZA 3FZOA 4KS8A 3KXNA 1QCFA 4KAOA 4QMOA 4ZS0A 4BGHA 4FEWA 1QL6A 4PMSA 3QQKA 4L01A 4JOAA 3G6GA 4I5CA 4EOJA 1WVYA 3PSCA 2XNNA 4U7ZA 4F1OA 4ZY4A 4FK3A 5C27A 3TACA 4DINA 4IANA 3O96A 4XV1A 2BZKB 4W9WA 4R77A 4F7JA 1DI9A 2X7OA 4ZZOA 3IW6A 3KB7A 3FUPA 2C3LA 4YO6A 1APME 1K3AA 4W4VA 3VUTA 3ULIA 3ZLWA 4EZ7A 3BBWA 3MWUA 2GQSA 2PUPA 4TYJA 3C5IA 3JYAA 3HRCA 3BU3A 4FBXA 5FM3A 1BX6A 3N4VA 3BWFA 4U43A 2OJIA 3R83A 4BYIA 2UW8A 2UW7A 3QUEA 5CEKA 2BRGA 4R6VA 3QCSA 2Z7SA 1YWNA 4ZJIA 4BBEA 3R1QA 2CLQA 1KSWA 3JVSA 1PXMA 2A1AB 4FTJA 3ZSIA 4E93A 4F4PA 2E9OA 2WB8A 1H07A 2ZVAA 4E26A 2QVSE 4F65A 4WNPA 2YM8A 2C3IB 3D94A 4BZDA 1CDKA 4C4JA 3QX2A 4LOOA 4G5PA 4QYEA 4AOJA 1PXOA 3R7VA 3CPCA 3KXXA 3QTZA 4NYEA 4M0YA 4BI2A 4KRCA 4Q9SA 5AAFA 5IEYA 3DB6A 1QPCA 1H1SA 5A46A 4AGWA 2YIQA 4PRJA 2OJ9A 2O65A 4DFXE 2WXVA 3VBVA 3MA3A 2PVNA 3ATSA 1Q8YA 3BYMA 1W2CA 1YQJA 1KV2A 4FUYA 3QTQA 1MQBA 2BR1A 2XS0A 5HICA 3RINA 5GIOE 2J0JA 2J50A 1TKIA 3EQFA 4BIBA 4LMUA 1G5SA 4DG0E 3W33A 1Q8WA 3P86A 3A7JA 4UZDA 3AC3A 2CMWA 2EB2A 4PDSA 3S4QA 2VNYA 3ZONA 4EQMA 1WZYA 3AG9A 3MPTA 3DLSA 4WBOA 1KE9A 3EYHA 1MRYA 3F2AA 5HIDA 3U4WA 3G9NA 3PWDA 5E8TA 1SVGA 2RG6A 3N4UA 4GIIA 5KKRB 4AQCA 1WVWA 3RPVA 2OF2A 4PF4A 5IQAA 5IG1A 3CTHA 2W9ZB 2B53A 5EHYA 4DHIB 3NX8A 3DK3A 1GOLA 4KBKA 2UZNA 2QO9A 3I7CA 2IPXA 2J4ZA 3D2IA 3QD3A 5AEPA 3BLHA 5K4IA 4Z7GA 2WFYA 2X7FA 5DLSA 5FGKA 1BKXA 1E9HA 1YHVA 4M97A 5LXMA 4F9BA 4EI4A 3PDTA 4NTTA 3GXLA 4I1ZA 3R7YA 1XH7A 4DYMA 4G5JA 3R22A 4F7SA 2I0VA 5IEVA 3LFBA 1IAHA 2W1IA 5E4HA 2B9HA 3NMUF 4A9UA 1K2PA 3S2PA 4S30A 4XRLA 4QP9A 2UV2A 5KKRC 1GJOA 2IEWA 3DU8A 4UXQA 3O23A 5H3QA 2DS1A 5HLPA 4DEEA 2W7XA 2WIPA 4EORA 3UNKA 1H00A 2CN5A 4O0SA 5E8UA 4LM5A 4PDOA 5E8YA 3W0NA 3GI3A 3ZUVA 5I9VA 4WRSA 3R8UA 4FR4A 3O2MA 4TT7A 1GNGA 4F0FA 5KBRA 3JXWA 5L2TA 2XM9A 3HUCA 5ANGA 3W0OA 2OG8A 4WO5A 4JG7A 3KMMA 3ZZWA 4JDKA 1K9AA 3LCOA 4H3BA 2H34A 5KMIA 3D7TB 4DDGA 5LVNA 4HGEA 4LV8A 2XMYA 2BUJA 4KBCA 4LGDA 3TJCA 4BVUA 2BIKB 3D9VA 4FIFA 4TXCA 3OD6X 3CD8A 5GINE 3KFAA 3QTXA 3FPMA 4D1ZA 1QPJA 3O8TA 5B2LA 4RBLA 4YHJA 4FEUA 5M08A 5CI7A 3Q2MA 5KMNA 2QOFA 4ARKA 3UO4A 1Q3DA 2YAAA 2WHBA 4DHJA 4UXLA 4QP1A 2QKWB 2Y0AA 5EK7A 3WOWA 4ENXA 3AKLA 3W2CA 1H4LA 1JKLA 3ENHA 1BI7A 4AOIA 3KF7A 5T6KA 4R7HA 3UNJA 2IZTA 5DGZA 4RGJA 4E1ZA 4CVAA 2C69A 5KNJA 3QHWA 2GQRA 3A4PA 1M7QA 4RIOA 2OKRA 1YDRE 4IB0A 3EQDA 3FJQE 4M66A 1OIYA 5C1QB 5HE0A 5KMKA 4YZNA 2UZUE 5EYKA 5FTQA 5K0XA 2WOUA 5AR4A 3VUGA 4JR7A 3H10A 5AIRA 3QBNA 3MIAA 3E92A 2HELA 2W1DA 4RWKA 5E8VA 5I9UA 4D2VA 2A0CX 3UG2A 1JVPP 4FV3A 4BDHA 3BYUA 3VW6A 5DHJA 2OXXA 3CLYA 3PXZA 5IQFA 3V8SA 1W2DA 4EWHA 5ANJA 1MQ4A 4GT4A 4P5ZA 4F1TA 1JKTA 4RJ3A 3VJOA 1OKVA 4TN6A 3I4BA 4O86A 4JT3A 2YWVA 3FLWA 3PJ3A 3QUPA 4C3FA 3BU6A 4L7SA 3V04A 1YXTA 2OU7A 2XUUA 2CN8A 4GU9A 4RA4A 4D5HA 4FTOA 5A4QA 5C8MA 3JY9A 4HCTA 3OS3A 5CF6A 5K5XA 1AGWA 3BGZA 3W8LA 3Q2JA 1REJA 1YDTE 2I40A 3FL5A 5H9BA 4RWJA 2VU3A 5LMBA 2EWAA 4L53A 2C5OA 5IA3A 3R9OA 4BBMA 2PMOX 3DXPA 4ONAA 4MAOA 3U87A 4O7LA 3ODYX 1KOBA 4QTAA 3OCSA 3ERKA 4DF3A 5FTGA 1Z9XA 4FG9A 4FUXA 5CEQA 3Q52A 3B8QA 4QPAA 4JBVA 4MF0A 3MVHA 4HVSA 4O0YA 4BCNA 3WARA 2ZMCA 4DG2E 4AW1A 4MD8E 4EH7A 4X0MA 5CAVA 3I5NA 1TFFA 3BHUA 4NCTA 3LMGA 3LQ5A 3Q6UA 4EL9A 1B38A 2XIRA 3OF0A 3UP2A 4CFUA 3NUYA 4IADA 5BVFA 4OT5A 4X3FB 4ASXA 4EHVA 2YN8A 4DFZE 4Y46A 4O6EA 2OH4A 4C34A 4DEAA 2B7AA 4GIHA 4YJVA 3ZM4A 4O4CA 1G8SA 4YJPA 4F0GA 2HAKA 3I81A 3OUNB 4NM3A 5GZAA 3Q60A 3EKKA 4IAYA 4MXYA 4HNFA 4YZBA 4D4VA 1YXVA 3MFUA 3QWJA 5AR2A 2CNVA 2CSNA 2ZAZA 4YC6A 5BX0A 3NVMB 2PYWA 5CU4A 2BFXA 4M68A 3PY3A 2OO8X 4AXAA 3EWHA 4B9DA 4DT8A 2GFSA 1R39A 4PL5A 2F2UA 4B99A 4MH7A 3CCNA 4IAFA 3IW8A 4QQTA 1XH5A 4L52A 5M51A 4GYIA 5GJDA 5EM5A 3UGCA 3DDQA 3DGKA 5EKOA 3SX9A 3LCSA 3REPA 4FODA 5DRBA 3TNHA 2R3IA 5FRIA 4FSMA 2QD9A 2IN6A 3A7FA 3KULB 3FZTA 3ID6C 3DTCA 4X3FC 5JRSA 3AC2A 2H6DA 3GU6A 4G1WA 4FKIA 4K9YA 4D55A 2ITVA 1KE7A 4UV0A 1WBTA 2PE1A 3H0YA 4NSTA 2ETMA 4CFWA 3QKMA 4DGGA 4FKVA 2PVFA 4FTAA 4CQEA 4XBRA 2J5FA 2YIWA 3HV6A 3P0MA 1WBPA 4B8MA 2QQ7A 5AP7A 4IJPA 3UZTA 4G9RA 5CALA 3V01A 4FIIA 1JKKA 3SLSA 2XK7A 3RAHA 4MXAA 2F9GA 3HZTA 4F09A 1CMKE 2R64A 4ZTMA 4FIGA 3CGOA 3OFMA 3OXIA 3PA4A 2XKDA 3PIZA 4CMTA 3NW5A 3SOCA 3PXKA 2IG7A 2J9MA 2ZV8A 3TKIA 1RJBA 4PL4A 4BWKA 4O7TA 2VTJA 5EQPA 5H8EA 4PPAA 3DKGA 5GZ8A 5JSMA 5KCVA 3VUMA 3W0PA 4C2VA 2WIHA 4UWCA 3VBTA 1P5EA 5DT3A 5BVKA 3CC6A 3QQFA 2RGPA 2R3MA 3FLSA 3G6HA 5AP0A 3UNZA 4FX3A 2ERKA 5EW8A 2C5NA 4ANQA 4ZY6A 2C0IA 3VHKA 4M15A 2YM3A 4ASZA 2B9IA 2OXDA 3QZIA 2AEGA 3B2WA 3KN6A 4RJ8A 2ZM1A 3FWQA 2IVTA 3I60A 3R00A 3R8MA 3FLQA 2VTTA 2J90A 2IO6A 1IRKA 3NUNA 4OBOA 2XF0A 3ZO1A 4FSUA 4BRXA 2H96A 4ZSJA 3GQLA 4E4NA 1P4OA 1F0QA 2V55A 3WZEA 1VEBA 3KC3A 3M11A 4RT7A 4JBQA 4KA3A 4A4LA 1PF8A 2FGIA 2YERA 2PSQA 2UW0A 3G0EA 2B0QA 3VO3A 3TIYA 4QMNA 4FKPA 4O84A 4KS7A 2X2LA 4MX9A 3EQPA 3WBLA 4MBIA 1OBGA 1J3HA 2KULA 2ZV2A 3EQIA 3OY1A 5ANIA 4FV9A 2SRCA 2HY0A 2UW5A 2PVKA 5L3AA 3BIZA 3MPMA 1H1RA 4J8NA 4D1SA 2QODA 5CLPA 2I0YA 4HGLA 3OP5A 2I1MA 2JLDA 4RQKA 2PZIA 3ZYAA 4BGQA 2R3GA 4C37A 4NU1A 4XEYA 3R28A 1YDSE 3POOA 1TVOA 2V22A 3VS1A 3T9TA 1WAKA 4HGSA 3UJGA 3ORIA 3NYVA 4C2WA 4FEXA 3EB0A 4IZ7A 4LYNA 3BLAA 4TYGA 3P5KA 4LG4A 4YC3A 2Y6MA 2R7BA 2O2UA 4QYYA 2HW6A 2QOOA 3ANQA 3R02A 2PVMA 2XNMA 3DFCB 4J99A 2F7EE 4PPBA 3TV4A 4K0YA 3GC7A 3I0QA 2X9EA 4J52A 4H3PA 3FXWA 3QXPA 4C35A 5ITAA 4RWLA 2BTSA 3I5ZA 1FVRA 3W2OA 4FV0A 3I0OA 1OGYA 1GZNA 1OL2A 4JNWA 1MRVA 3AC8A 4U79A 5L2WA 3OUKA 4GCJA 5CSXA 3C4FA 3DAEA 2FSMX 1Q61A 3IDCA 3BELA 3UOLA 4MK0A 5HX8A 3ZUUA 3ORZA 2BRBA 3ODZX 1JNKA 4E4LA 5CAPA 4OTFA 4C4EA 2VO0A 3MH3A 2GPHA 2IZRA 2NP8A 4MXZA 3K3JA 4IH8A 4ZOGA 5HCXA 5IA4A 5L4QA 3KVWA 3QX4A 4IM3A 4EC8A 4ZMFA 3EKNA 4EBVA 5J1WA 5JGDA 3JY0A 4E6AA 4PP7A 2C6KA 1XBBA 2BKZA 5J7HA 4HOKA 3WF7A 5LWMA 5CQWA 2IWIA 3ZU7A 4R8QA 3VUKA 3GQIA 3QLFA 4MEDA 3LFCA 2XEYA 4PMTA 4USDA 5DEYA 5EM7A 3V5TA 4AZSA 3DNDA 5EKNA 3KK8A 3PIYA 3EQHA 2ITYA 4IAKA 3TXOA 2J0IA 4UZHA 4BCIA 3EN4A 2RFDA 3EL7A 5CEPA 2UZEA 4F63A 3E8EA 1TQMA 4PTGA 4XG2A 4QMYA 2WMSA 2WTIA 2Z7LA 4D2SA 4GUBA 3RPSA 2BDWA 4A9YA 5JRQA 1MP8A 5DOSA 5CSWA 2HENA 2QLQA 1VYWA 3OW4A 3FI8A 3NSZA 5E8ZA 4CFXA 5JT2A 3RZFA 4E7WA 3DKFA 4AA0A 5BPYA 1Q24A 4H58A 2IVVA 3VBWA 5CZHA 1HCKA 3OXZA 3W18A 4FKLA 3OT8A 3UOJA 3UC4A 3MB6A 2J51A 2XEZA 4NUSA 2C1BA 2VX0A 4G2FA 4IM0A 4JRVA 5AUVA 5E8WA 3S1HA 1FMOE 2QR7A 3NRMA 4BJJA 2GS2A 3QXOA 2QU6A 4UYNA 4AFJA 3T3UA 2YDKA 2F7ZE 5GJFA 3G90X 4M7IA 4XG6A 5J79A 3I1AA 1QPEA 3BYOA 4RIYB 5J5TA 3DFAA 3FZPA 3PVUA 3R1YA 5IQIA 4IX6A 1Y57A 2EVAA 5EYMA 4ZIMA 4DH8A 1Q8ZA 4ORKA 2ZDUA 3LFSA 4KKHA 4XG4A 1AQ1A 3KQ7A 4NL0A 1FQ1B 5IQGA 3F7WA 2BHEA 5HI2A 2J0LA 4OBQA 5IQEA 2ZMDA 4XLVA 4QMVA 2GU8A 4FZ6A 2WPAA 3VUIA 4EH4A 3P79A 2G1TA 3PJCA 4OTDA 3R7UA 4BGGA 5CAQA 3BGPA 4F6WA 1H25A 4A06A 4KKGA 4QMLA 1FBNA 5IQCA 1G8KA 3FXXA 5DT0A 4NM5A 4D4YA 4E4XA 4L67A 3UIXA 3MTFA 4JG8A 4QT1A 3F7ZA 3PIXA 3ZLXA 1ZXEA 5HE1A 4FNZA 1E1XA 3DA6A 4CD0A 2OGVA 3D83A 2XNOA 4U45A 1ZYCA 3RMFA 5AA9A 2Z60A 4IX3A 4EH3A 4MKCA 3QRTA 4MYGA 4AE9A 3QYWA 5CNNA 3BQCA 2JBOA 3E3BX 2NPQA 4RIXB 4E73A 4AFEA 3S00A 4D5KA 1XMLA 3FHRA 2NRYA 3D5VA 3ZLYA 1H0VA 5J9ZA 2E9NA 1XH4A 2Y6OA 4JDHA 5FBOA 4HZSA 2WMRA 4R1VA 2IVUA 5AWMA 3VQHA 2I6LA 4KWPA 4IDVA 4F0IA 4HYIA 2JKMA 3KRXA 3KXZA 3R2BA 4GFOA 3LCKA 1JQHA 2OIBA 5CXHA 3S95A 5A6OA 2CKOA 2WMUA 4PWNA 2R3JA 4GUEA 4LGGA 5FM2A 4BB4A 1OITA 4FEQA 5M09A 2QI8A 3NDMA 5M4FA 2QHNA 3FC1X 3W32A 4AXDA 5EYDA 4BDJA 3AT2A 5E92A 4FV2A 3ROYA 3SC1A 1O6LA 4F9CA 4EK5A 2W4KA 3HMNA 3V51A 4O0XA 5E8SA 3K5UA 3OROA 2FVDA 1NVRA 4XMOA 3C4EA 3AC4A 4AN2A 2JC6A 4FVQA 1YVJA 2LGCA 2OZAB 4GSBA 3SHEA 4BCKA 4F64A 5LQFA 2I0EA 3MVLA 4KKEA 5BYZA 2YIXA 2OW3A 3VS4A 4CYJA 4PDPA 5HD4A 4G17A 4FJVA 3MS9A 1AD5A 4RC4A 4FTRA 1BYGA 4BDAA 4CKJA 3R30A 4XS2A 2VGPA 3LQ3A 5DR6A 3GBZA 2YM6A 3HV4A 4AG8A 4BDIA 4EKLA 4Y5HA 4XV2A 5EG3A 2PUUA 3MA6A 5KO1A 3EJ1A 2YDJA 1ZRZA 1W83A 4IZ5A 3ZLSA 4AACA 3WYXA 4BIDA 3PTGA 3EN7A 4UWBA 5HNBA 3V8WA 4FSWA 3V5JA 5HVKA 3LW0A 4QP2A 3UO6A 4YGAA 4YBKA 3RNIA 4CCUA 3UO5A 1SVEA 5M44A 1O6YA 4DEIA 5IUGA 3ENMA 2G2IA 4MXXA 2OBJA 4O2PA 3ORTA 2W99B 4IW0A 3TM0A 3OZ6A 3P7AA 4JX3A 5G6VA 3UOHA 4NTSA 5A4CA 2XBAA 5HIEA 3KMUA 3OVVA 3TV7A 4DH1A 4WG4A 4DE4A 5DI1A 5DMZA 2XH5A 1OVEA 3ACJA 4FOCA 4QTDA 4U6RA 5BUEA 4C4FA 2CGXA 4NZWB 5IMXA 4F99A 3SG8A 3P78A 5DVRA 3FMEA 1X8BA 3RM6A 3R1SA 4N6YA 2VTMA 2PMNX 3QD4A 4HCVA 4XV3A 5CT7A 2NYAA 4G3CA 2PL0A 5L8LA 4RPVA 2VN9A 3QC4A 4GMYA 2C0TA 2VTPA 3ZM9A 3K2LA 2WMBA 3K3IA 4RG0A 1CM8A 2WMAA 3LXNA 5J87A 3VW8A 3ZHPC 1YI3A 4DBXA 5AIKA 3HDNA 4FVRA 4GJ3A 2PPQA 2YZLA 4EEVA 4UALA 1Y6BA 2PZRA 3A7HA 4YJTA 3VS3A 4CTCA 4FMQA 5FDXA 2OXYA 2UZWE 1OM1A 4IX5A 5HVYA 4IVBA 3SXFA 4UMUA 4RWIA 1IG1A 1U54B 4MWHA 2RFEA 4QPSA 4WNOA 3WZUA 3VS2A 4CLJA 3N4TA 4WSYA 5TE0A 3MH2A 4KINA 2BRHA 4C0TA 3QGYA 4EOQA 4CG8A 2X7GA 4AT4A 2G9XA 5M07A 2GNJA 5E9EA 5IKWA 3FMMA 4RIYA 4YSJA 2QURA 1F5QA 4OAUC 4NIFA 2QU5A 4FT0A 2B1PA 2ITXA 5K0KA 4EUUA 4CZUA 4N57A 4IC8A 1G3NA 3OW3A 3R01A 4OGRA 3ZO4A 5HGIA 3BHTA 4Y83A 3TG1A 2FH9A 2C4GA 3CKXA 3VJNA 4HNIA 4ANOA 4LQMA 3EN6A 4ZJVA 2XNGA 3AKKA 4ITJA 5L8JA 3SKCA 2ZFYA 5CVHA 4DHZA 1Q8TA 3PVWA 3W0QA 4XRJA 3RNYA 1Y8YA 3GU8A 3FY2A 1RDQE 4F08A 1MRUA 4FG7A 4U3YA 2QOBA 3F9NA 4F6UA 4CCBA 4TYHB 5BUJA 3A8XA 3TCPA 4NT4A 5HO7A 4F70A 3ZSGA 3O71A 1RE8A 4C36A 2VAGA 4DH5A 4U41A 1PYXA 3L8PA 5AP2A 2ZDTA 4RIXA 5BVEA 3JVRA 4ACHA 5J5SA 2X0PA 2XRUA 2XKCA 1R0PA 2PVHA 2WZJA 4ZXTA 4Y8DA 1HCLA 3A99A 1BL7A 2WGJA 3FMNA 2XIXA 3VIDA 3P23A 3VULA 3RCJA 2IW9A 5JFVA 5FEDA 3FKNA 4OW8A 4FKOA 4RX8A 4AE6A 4CEGA 2QC6A 1UNLA 3NYOA 4BKYA 4J8MA 1SZMA 1WMKA 4M84A 5DT4A 3NFGB 2YA9A 2ERZE 3R04A 1XWSA 3TKHA 3HAMA 2XNPA 2XANA 3KMWA 5JGBA 4XCUA 3T3VA 4RVTA 2ACXA 4FTUA 4V04A 3BEAA 4FTMA 2F7XE 4O0VA 3TUBA 5HX6A 2DYLA 3BCEA 2OZAA 5I9WA 2ONLC 3NNUA 4IVDA 3UVPA 4NJ3A 2IW6A 3I79A 2WU7A 2YIYA 3FMJA 5FWKK 4XYFA 2OFUA 5CYIA 4Y73A 3UP7A 2XYNA 4TYEA 3U6JA 4O1PA 4W8EA 5EW3A 5FBNC 4HVDA 5CAUA 3OWKA 1I09A 3AMYA 3DNEA 4NM0A 1J91A 4I92A 3LE6A 4V01A 5HE3A 4EOIA 4EONA 4DFUA 3R7OA 3MY0A 3L9MA 4RVLA 2BTRA 2ZV9A 2KTYA 4FKWA 4UY9A 3SW4A 1WBSA 4FTTA 4ZTQA 4BCJA 3OTUA 4KUJA 2AUHA 3MH1A 4C57A 5A4LA 5AP4A 4LMNA 1KUTA 3FE3A 3Q32A 4O0WA 3BYSA 4O1OA 5D11A 3UG1A 4I20A 3CJFA 3OY3A 3U4UA 2BDJA 5IEXA 2XAOA 3D4QA 2QCSA 3LCDA 4AS0A 5AX9A 3QTRA 3UQGA 4EYJA 4OTQA 4CLIA 1NXKA 4KABA 3H9RA 3UC3A 3HMOA 3FHIA 3IDPA 4HYHA 3FQHA 3NAXA 4UN0C 4QO9A 4PL3A 1WBOA 4G3GA 3FSFA 2UZDA 3IS5A 3PP0A 3ZZEA 5IPJA 3SRVB 3FLZA 2QHMA 5D10A 2C6TA 5L6WL 3UMXA 4G31A 2XBJA 4AW2A 5CY3A 4BWPA 4MCVA 2BFYA 1QMZA 1CTPE 4M69B 2B9JA 2X2MA 5ACKA 4AP7A 3P1AA 1YW2A 3KRJA 2VWWA 3F3WA 3F3TA 3VWAA 5LVPA 4Q2AA 3Q96A 2VO3A 5E90A 5EDRA 5LMKA 2W5BA 4TPTA 3Q4CA 5AV2A 3WF5A 1IAJA 1OIQA 3E8NA 3EOCA 5H8BA 1UU8A 3PXFA 2PZYA 3R21A 2EXMA 2WTKC 1H0WA 3R7GA 4FA2A 4ZY5A 2CDZA 3GOPA 4IWDA 4X7QA 1PMNA 1U54A 2QNJA 3F69A 4JDIA 4DTKA 3QZFA 5BNJA 2H8HA 4BCOA 4IM2A 4ANMA 2XKEA 3TWJA 2OFVA 3KIOC 4K6ZA 5I9YA 2UW9A 4EHEA 2R9SA 1ZZLA 2HW7A 4MXOA 4EH6A 1YI4A 2R0UA 5CU0A 4PTCA 3M1SA 2WQMA 3G33A 4DEBA 3KK9A 4PPCA 3QAME 3IG7A 3W0RA 2W1ZA 3OXTA 4FSRA 3BGQA 4P2KA 1UWJA 2FB8A 5AP3A 5HBJA 5KHXA 1ZYLA 5M4IA 1OMWA 4D0XA 4KIKB 3TZ8A 3SDJA 5EW9A 4AXCA 2JKOA 2CLXA 3FYJX 4MF1A 1PKDA 2YM4A 4ASDA 4AQKA