4EUUA

Structure of bx-795 complexed with human tbk1 kinase domain phosphorylated on ser172
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
308
structure length
307
Chain Sequence
GSQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase TBK1
publication title Molecular basis of Tank-binding kinase 1 activation by transautophosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 307
sequence length 308
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4euuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4euuA01
4YJSA 3I81A 5CY3A 4EQMA 5IEXA 4EWQA 5CEMA 1WZYA 2YERA 1IAHA 3SV0A 5KZ0A 1L8TA 3UBDA 4MXOA 4FIHA 4CVAA 5IQBA 2J6MA 2BAKA 3II5A 4QQ5A 4WIHA 5EH0A 5HO6A 3P7BA 2SRCA 3CTHA 2YZAA 4IJ9A 4FSYA 3TV4A 3TWJA 4L43A 1R0EA 2QOQA 3NUNA 2OXYA 2E9VA 5KKRC 5EDRA 2C47A 4PDPA 4WUAA 4KAOA 2BAJA 3BHTA 3G15A 5J9LA 3P7CA 2ZMCA 4H1MA 2W99B 2XEYA 4WNOA 2OKRA 4IWOA 3IW8A 5M55A 3W18A 4KBKA 4BN1A 4QP8A 3MBLA 4O6LA 4EKKA 5HKMA 5K9IA 4J8NA 2RG6A 2A0CX 5KZIA 1XH5A 4FKRA 4RIYA 3PPKA 1B6CB 3CXWA 4UALA 4CV9A 1JAMA 2UW6A 1VR2A 2R3RA 2JDOA 1NA7A 3BQCA 3GU5A 3MY5A 4HGSA 4JDKA 4R7IA 3V04A 3KCFA 3KRRA 1A48A 4BYIA 5M08A 3DDPA 3OVVA 5CU4A 5KKRB 3BCEA 2VX0A 4FIJA 1BLXA 3HRCA 4JL9A 4FTCA 4F7LA 2IJMA 3EWHA 3H3CA 5BYYA 2WQNA 4AE6A 3FMDA 4GCJA 3UG1A 3T9IA 4HZRA 4FV2A 4O7RA 1OZ1A 5CVHA 2PE2A 2XNMA 1NXKA 1BMKA 3L9NA 4IDTA 3BU6A 3HNGA 4BWKA 2XM8A 1ZOGA 5LMKC 1Y6AA 2QODA 3LPBA 4IZYA 1AD5A 4KIPA 3EFJA 4MF0A 4RIXB 5AMNA 3GCUA 4IC8A 5I9ZA 5CEOA 4ANNA 2C5XA 2WMRA 4C61A 1GZNA 1QPEA 4XNEA 2O3PA 3LFSA 5E8VA 4DN5A 3FE3A 4USEA 2GFCA 3EQDA 5ETCA 3AG9A 1SVEA 4BCOA 1WBVA 3D9VA 4TYHA 5AR3A 2V22A 3RWPA 1XKKA 3O71A 2BZHB 2W7XA 2W1IA 4L3JA 4PDSA 3VN9A 4AA4A 4DEBA 1Q3DA 1SVGA 1XH9A 2PVKA 2PWLA 4LRMA 2E9UA 3PG3A 3DQXA 3ORMA 2ITTA 4GK3A 4MXXA 4ASXA 1FVTA 3O7LD 3QHWA 2YJRA 4FKSA 3UNZA 4XUFA 3MH1A 3COIA 5AP6A 4MWHA 2C69A 3ALOA 3COHA 2UW3A 1KOBA 3MFUA 3O96A 2E2BA 4FF8A 2B1PA 4IVAA 4MH7A 3UIUA 1YHWA 1YOLA 4TL0A 3FKLA 1U46A 2C0TA 4RJ5A 2O64A 3NYNA 2RFEA 3QUPA 5HOAA 2OJJA 3FL5A 3R9OA 3D5UA 3NUYA 4PMSA 4RWIA 4V0GA 3MS9A 2WTKB 3VS1A 3A7HA 3BGZA 4F1TA 2DS1A 4NKSA 4UMUA 1I44A 1H26A 2JFMA 3IKAA 4TWNA 1UA2A 1OKWA 3MI9A 1LUFA 1VYZA 4NM7A 3DK6A 5EM5A 4Y46A 5IEVA 3LOKA 2NNWB 3WI6A 2IW6A 4IWPA 5AV1A 3WZEA 1GZKA 2NRUA 1WMKA 3TKIA 3MDYA 4EC8A 2XA4A 5T68A 4O82A 3EIDA 2PUIA 2ZOQA 4O38A 1FMKA 3MVMA 4F08A 2X9FA 4IZAA 3PTGA 4LV5A 2XIZA 4C7TA 4EK5A 2OSCA 3ORPA 2P55A 4O83A 1ZARA 1GOLA 4ZEGA 3F3ZA 3PIXA 3FPMA 5A9UA 5KHWA 3QFVA 2G2HA 3NYXA 3JY0A 3NGAA 4AACA 1L3RE 4PV0A 3KC3A 4JR3A 5EM6A 3Q52A 3R7OA 4HCVA 1WBSA 4LUEA 4QP1A 4U41A 1U54A 1FQ1B 4I23A 4E5WA 4L9IA 5HQ0A 2C5NA 1P4FA 3V01A 2XIXA 4CG8A 2DUVA 2QU6A 2WELA 4FTIA 1HCLA 3DFAA 3SHEA 4ENYA 1YVJA 4CT1A 3HRFA 4IB5A 1W98A 4O7VA 4J53A 3TG1A 4CD0A 4O2ZA 3TZ7A 3QZIA 4FBXA 3MV5A 2OGVA 5FG8A 1PXKA 3TM0A 2UW5A 2WB8A 2WU6A 3UQFA 2WOUA 3D0EA 3SQQA 2O63A 3PXZA 1PYEA 3NX8A 4K1BA 2GHLA 5HVYA 3NDMA 3JYAA 4D9UA 1H01A 3FUPA 4M69B 4A9SA 3BZ3A 4M68A 3POOA 3CR0A 4AFJA 2VTNA 4ZSAA 3ETAA 4C59A 4ORKA 4WNPA 4X3FA 4I94A 3CSVA 2V55A 1OKVA 2G2IA 3KK9A 4R3PA 1RQQA 2R3NA 4XG8A 5B2KA 4IMYA 3EQGA 1KE8A 4BIEA 3WOWA 3UODA 2V7AA 2BKKA 5L8LA 4JDIA 5D1JA 3IW5A 1UKHA 1O6YA 2JKMA 3NIZA 4FV1A 4NJ3A 4BR3A 3RBWA 4G2FA 5DBXA 3SD0A 4EYJA 4JG6A 3ORLA 3AMBA 3D7TB 3MESA 4QYEA 2IPXA 2C3KA 2GS7A 4BDHA 1OIRA 4OAVB 3AMAA 3FHIA 3IECA 5E90A 4E1ZA 3KFAA 3L9MA 3WBLA 4NT4A 2YISA 1IEPA 4ANQA 2FSMX 2OW3A 2BIKB 2C68A 2PMOX 2QKWB 3QGYA 4BDJA 5BMSA 5IA2A 4O7YA 4D28A 3JVSA 4CQEA 4IDVA 4HVSA 3TIYA 4TN6A 1PXJA 3TKHA 3E8EA 3HV7A 3UZRA 5GIOE 4FYNA 5FD2A 4UBAA 3ID6C 3ALNA 4CTBA 3P1AA 2IW9A 1MRYA 5C4LA 3DK7A 2YIXA 2IZRA 4KBAA 2VWWA 3GUBA 3DNEA 3AT4A 4EH3A 2XYUA 4HGTA 4OTIA 2IZTA 2X6DA 4EEVA 1IG1A 5A46A 5CXZA 1XWSA 4XBUA 4ZS0A 4H3BA 2UZOA 2WIHA 2C1BA 3R9RA 3UDBA 4DAWA 3PWDA 3QU0A 4O0YA 4QMWA 3OTVA 4O7TA 1A9UA 2X6EA 2WFYA 5IQGA 3HX4A 1J1CA 4R7BA 3K5VA 4I5MA 3ULIA 4BZOA 2OFVA 5CF4A 1Y6BA 4HPTE 1M52A 5DGZA 4L00A 4JBVA 2YDKA 1M2RA 4H05A 1EH4A 3PP1A 5E8YA 4M67A 5I9UA 4DLJA 4ZLYA 2XK3A 4O0SA 2J2IB 4J96A 4LMNA 4BDDA 3ET7A 3N4VA 4F7JA 4R3CA 1J7UA 3ORXA 3QTUA 2EU9A 4RZWA 3W33A 3DJ6A 1W8CA 4NU1A 2P33A 3CJGA 1H25A 1IAJA 4JQEA 3TT0A 1YWVA 3PDTA 2OIDA 3IO7A 3FI4A 5AP7A 3QLFA 4PNIA 2JC6A 3EQHA 3C51A 3OCSA 3ZZEA 4FTKA 5F4NA 3W8QA 3GB2A 3E88A 4I6QA 3OOGA 3R1YA 4QMLA 2UUEA 3ZO3A 3JS2A 5AUTA 3FKNA 4MD9E 4ANBA 5EQYA 4FZFB 3FLSA 4BICA 2OJ9A 3GOPA 3ZDIA 4UX9A 3BV2A 5HD4A 2UZNA 1GIJA 3QRTA 4BZNA 3ANRA 3AD4A 3M2WA 4WG3A 4OT5A 3BEGA 4OGRA 3VUDA 4IB3A 5AR2A 3FLYA 5H2UA 3R1QA 1YDSE 2FSTX 2UZUE 3TEIA 2G1TA 4RIOA 1CKJA 3OUNB 4C4GA 3KRLA 3D5XA 4CFVA 4DF3A 2YLEA 5C8NA 4LFIA 3H0YA 5J7BA 4RA4A 2UW0A 3NWWA 4LMUA 4RZVA 3ZRLA 1ZYCA 4L53A 3AQVA 4EC9A 3K2LA 4YC3A 3TNWA 4F0GA 4W4VA 4YNOA 2C4GA 2WMQA 3G9NA 4BWPA 3TDVA 2C3IB 3QKKA 4QTAA 5HEZA 3DZOA 2OO8X 3OW3A 5BNJA 2V7OA 3EOCA 2OIBA 4QMSA 3G51A 3UVRA 2JIUA 4I21A 3R0TA 3FMHA 4HVHA 3E93A 3MWUA 4A9YA 4ENXA 2W1ZA 3HV3A 3HECA 5F94A 3BYMA 4IAFA 4BVUA 2UZDA 4M66A 4IFCA 5C8MA 3CQUA 2R2PA 1FVVA 4CT2A 4EZ3A 5AAEA 5DEWA 5HLNA 5EI8A 5GZAA 5I9XA 4ALUA 3FC2A 2R4BA 4QD6A 2B0QA 2OJIA 5AFVA 3KRXA 4XCUA 4M8TA 2R3GA 4AW5A 2I0VA 5L6OA 4WRSA 3BYOA 2HW7A 3SXFA 4XG2A 3OUKA 5ANEA 3JY9A 4MXZA 3MFRA 2WTCA 4FT5A 3PRIA 4G5JA 5DI1A 3TIZA 5L2TA 4V05A 3U4WA 5LVMA 4UMRA 4ZIMA 5H8BA 3VUIA 2OIQA 2I1MA 2C6TA 3GVUA 4K33A 1H1QA 4EOOA 4IFGA 4IACA 4ZSEA 5TOZA 5HIBA 4FG9A 2VAGA 4CYIA 4TNDA 2UVYA 3DBEA 4ZZMA 3ULZA 4CZYB 4F63A 2YM5A 3OROA 5HTIA 3MIYA 3QCYA 5AUVA 3WYYA 3VBWA 3TUBA 5KNJA 4E6AA 2GHMA 4QTCA 2VV9A 2ERZE 4AN2A 5AA8A 3SVVA 3FQSA 2PE0A 3FMEA 2OG8A 4WNKA 4YSJA 2OXDA 3C7QA 3PLAE 4D1SA 4TYHB 5KMNA 2PK9A 2YZLA 3UTOA 1OL7A 5AP2A 4QMMA 4P2KA 2XJ2A 2JDSA 1RE8A 4XV2A 2RL5A 4A7CA 5JMSA 1KOAA 2OH0E 4FIGA 1RJBA 4W9XA 4XV3A 4H3QA 5BMMA 3CJFA 3WF6A 2J50A 5E8UA 4S2ZA 3ZU7A 4GS6A 2XKCA 5FWKK 5IG1A 4HGLA 1H00A 3D5WA 2XYNA 2C6EA 3Q5ZA 3D7ZA 2WTIA 2IW8A 2J5FA 4MQ2A 4FOBA 5DT3A 3V5LA 2X81A 1Z9XA 2G01A 3PJCA 5CVFA 4ZP5A 2QD9A 3R83A 4AZEA 4FTNA 4F1MA 4YURA 3LQ3A 4FI1A 1LEWA 2VTHA 3DXQA 2UZWE 1PXOA 4DEHA 4J99A 4DINA 5HU9A 2Z7RA 5FDXA 3TUDA 4FIEA 4RFYA 2W4KA 4GH2A 3C5UA 1W82A 4HYUA 5EDQA 3UOHA 3QKLA 4J7BA 2PVMA 4V04A 4YHJA 3CC6A 5HE2A 2WD1A 4OTRA 4GG7A 4C57A 4W8EA 2JAMA 4MK0A 4GUBA 2VX3A 3R63A 1XJDA 3SAYA 3OC1A 5JH6A 3HMOA 1ZYSA 5D10A 4C02A 5AADA 1MRUA 2BDJA 5JSMA 4E93A 4LGHA 4FEVA 2XIYA 4QPAA 3NMUF 1P14A 3DA6A 2F7XE 4X7QA 1GNGA 4R8QA 1DI9A 4U8ZA 2CSNA 2UW4A 3ZMMA 2OLCA 1WAKA 4FVRA 4TKSA 4IXPA 4D0WA 4RPVA 4N6YA 4X3FC 4FODA 5AUYA 1H0VA 2VNWA 5GINE 2V62A 3WZJA 2P2IA 3O8TA 2ITUA 2B7AA 2YN8A 3K3JA 3DU8A 4KIQA 4NH1A 4Z3VA 1QMZA 3HLLA 3PSCA 4FT3A 3ZSGA 2CGWA 5IA4A 4AG8A 4J1RA 3QGWA 4Y83A 3GP0A 5DG5A 5JQ5A 3QHRA 3A2CA 4D0XA 3UO5A 2XEZA 3U9NA 2W4JA 5IA1A 4DG0E 2OBJA 1MQBA 4RX9A 5HCXA 3ANQA 3GEQA 3VUTA 5EYCA 4ZK5A 5CXHA 4CRSA 2GQSA 3VBXA 4FKJA 1ZLTA 5I9VA 4PNKA 3BELA 3ZO2A 3TTJA 4YO6A 4DA5A 2VWZA 5CAOA 4Y85A 4F64A 4F9WA 5JZNA 4DFYA 4QMYA 3VS0A 4BDFA 3NUPA 4WA9A 3CQWA 5D7AA 3TNPC 2F7EE 2ITVA 3VULA 5KX8A 3PVUA 4Y8DA 3ITZA 1QL6A 3G90X 4EHEA 2WQEA 2VWVA 4RGJA 5EM7A 4BC6A 3VBQA 4KABA 3H9FA 3I1AA 2VD5A 5D9HA 5A4EA 4PTCA 2WEIA 3OT3A 2QO2A 4OBQA 5F1ZA 3VRZA 1XBBA 3L8XA 1TKIA 3UIXA 4EHGA 2Z7SA 5IMEA 2Y6MA 2R9SA 4XOZA 3VUMA 4EH9A 3E92A 4FV9A 2E9PA 5E7RA 4ZTQA 3BGPA 1GAGA 4AX8A 3BHHA 4BCGA 1JVPP 2NP8A 3BLHA 2OZAA 5HCYA 2H8HA 2EXEA 3WF9A 4EBVA 5KMKA 3PA3A 3EH9A 4BGQA 3JVRA 2XK7A 2CLQA 3KXZA 2GS6A 4WG4A 4GT4A 2WMWA 5JK3A 4RWLA 3PY0A 5IDPA 3LM0A 2YIQA 2OK1A 3BRBA 3UOJA 3C1XA 1UU7A 2YAAA 4L45A 4KA3A 2YEXA 1PXIA 2WKMA 5JGDA 3FYKX 3S0OA 5LMBA 3DKGA 3N51A 5ANKA 4NL0A 3VRYA 1OKYA 3QRUA 4AZFA 3RWQA 3Q6UA 1NVQA 5CAVA 3KQ7A 4CGAA 5HO7A 4EUTA 2RIOA 4YHFA 4O91A 3TTIA 4GK2A 5GJDA 2EB3A 4QMQA 2BRHA 3VF9A 2IVSA 2VTIA 4JLCA 3V5JA 2VWBA 4PPBA 4GL9A 3R7IA 4Q5EA 5CU0A 3MA6A 4QMOA 3C50A 2WU7A 4KIKA 3AD5A 4BYJA 3K3IA 4B6LA 4U40A 3I7CA 1IR3A 3GU4A 4HZSA 3GENA 3LCDA 1YOMA 1XR1A 4OUCA 4QP7A 4QNAA 3R7UA 4XG7A 3FHRA 5GJFA 1FBNA 4E8AA 4UZHA 3SDJA 5DNRA 1G8SA 3ORIA 2UW9A 2YLFA 2ZDTA 4OLIA 3R01A 4EYMA 1H0WA 2XK4A 4CEGA 3MB7A 4S32A 3HYHA 3EKKA 3NIEA 5AJQA 4GFGA 2BRNA 4JI9A 5LCKA 4KUJA 3CD8A 1OL6A 2YDIA 2CDZA 2OZOA 2C6MA 4IM2A 5EYDA 3ZFMA 2QQ7A 5LVOA 4FKIA 3CS9A 2VZ6A 5J7HA 3KXXA 1YRPA 3GU8A 4L68A 3BHUA 3ELJA 5EHYA 3RHKA 4ANMA 1J3HA 4A4LA 3LJ2A 2QO9A 2HZ4A 3FMNA 3R8MA 3UQCA 4NFMA 4C8BA 4FUXA 3W10A 4FOCA 2F2UA 4ZXTA 1U5RA 3FXWA 2C6KA 4YZ9A 2C5YA 4IADA 3F5XA 4PL5A 4MD8E 5DPVA 2XK6A 5J79A 5FXSA 1BX6A 1OIUA 3NCZA 3VS5A 3FAAA 4EZ7A 4Z9LA 4FX3A 1F0QA 3ZBFA 5FTGA 2PMIA 1KSWA 2Z8CA 4II5A 4IH8A 2WQBA 5FQDC 1M7NA 3KRWA 2PL0A 3MPMA 2HW6A 4AOTA 4NM5A 4X2KA 3CCNA 4XYFA 1PRYA 4GW8A 3PVGA 3HMMA 1PMEA 4TYGA 5F95A 4AW2A 5CF5A 5B2LA 1Q61A 4I0SA 1OPLA 5AM7A 5LOHA 4ZY4A 3LFEA 4S33A 4AGDA 3QXPA 3RK7A 2X0GA 1PXLA 4Y5QA 1FGIA 2R3IA 3OWKA 3KXGA 3L8PA 3UQGA 3Q4UA 5BVWA 3RALA 3I6WA 3VNTA 3UO4A 4OAUC 2QG7A 3QALE 5CAUA 3MA3A 3PE2A 4FR4A 4F70A 2FO0A 3F7WA 5E1SA 1PXNA 3RKBA 2QNJA 4JAJA 3CQEA 1O6LA 5FP6A 3R22A 4RQVA 5IH6A 4FL3A 1R78A 2CGVA 2PSQA 4L6QA 4H1JA 2EXCX 2XNGA 3RPYA 5IPJA 4E20A 3LXPA 3FJQE 5EK7A 3OXZA 3GXLA 4I6FA 4JG7A 1R3CA 4ZLZA 1H1SA 4K0YA 4RG0A 4FTQA 1H8FA 4MX9A 4BTMA 5IUIA 4EOIA 2R5TA 5C8KA 4FTAA 5JFSA 1H1WA 2GSFA 3EQPA 3TZ9A 2PZIA 1CM8A 3U6JA 3DBCA 1PMNA 2C1AA 2JKQA 5LMAA 2PVRA 3HP5A 5HTCA 4EOKA 3EL7A 3RPOA 4ANOA 4DTAA 1YI3A 5DVRA 4M3QA 3UMXA 3ZFXA 1PKGA 3KCKA 5DRDA 5GZ9A 4DTKA 1Q3WA 1ZXEA 2G9XA 3U4UA 5HG9A 3I79A 5BVDA 5HNIX 1CMKE 3PFQA 1SYKA 4FZ6A 3BBWA 2PVYA 2XMYA 2O65A 4ZTHA 5CZHA 1YOJA 2R3HA 4H58A 4DGGA 3FC1X 5DA3A 5HVJA 3OXIA 4EOSA 3LFDA 4ASEA 3LJ1A 2J51A 2FSOX 1REKA 4BZDA 2BKZA 3R30A 3RPVA 4FVQA 3IW4A 3ZLSA 3NCGA 5A14A 2WZJA 4O0UA 4EH7A 3L1SA 4WSQA 1YWRA 4FNYA 4IAZA 4O1OA 3Q5IA 4FKVA 5E1EA 4GJ3A 4ITJA 3RM7A 2IZSA 3DLSA 3THBA 1B38A 1UVRA 1Q8ZA 2BFXA 2I40A 3O50A 4EH6A 5M4CA 2WO6A 4RC3A 5CEPA 2PMLX 3PSBA 1H27A 2J0KA 4IWQA 3Q6WA 3CPCA 5ETIA 2PYWA 2YITA 2QOHA 3PXYA 2X4ZA 4PPAA 1GY3A 3PPJA 3ZBXA 4C2VA 5AUUA 4BCHA 2QCSA 3HRBA 3ATSA 2B53A 5CNOA 2Y4IC 4K11A 4XLIA 3G9LX 3IG7A 3WIKA 1XO2B 4FSMA 1Y57A 3O8PA 1VJYA 4AU8A 4AP7A 4BTKA 4DFUA 2HELA 3BYVA 3DXNA 1YDTE 3NUXA 3DK3A 4FL1A 4NUSA 3KULA 5EYMA 4BL1A 5CF8A 4U45A 3F61A 3ENHA 3DBDA 4PTGA 3VQUA 3EFWA 5JN2A 4EJ7A 2VO3A 5BVEA 4D4VA 3RMFA 4FKTA 3Q04A 4HYHA 3C5IA 5CT0A 3H9RA 4IJPA 1T46A 2XNOA 4YPDA 4F65A 3KVXA 4I1ZA 4YJOA 4NEUA 4RLLA 3A61A 4O2PA 1H1PA 3DGKA 5AP4A 3ZSIA 5DMZA 3VJOA 2X1NA 2Y4IB 1PXPA 2VO6A 2XUUA 3EN6A 4FTRA 3DAJA 3NUAA 4USDA 3W2OA 3AC2A 1OL2A 3PXQA 4JBPA 3BLRA 3IOKA 4FTMA 4FV8A 4LI5A 4NFNA 3DPKA 1J7LA 4FSQA 4CKJA 2VN9A 5FXRA 4RJ3A 5TF9A 4B0GA 4QTDA 5CWZA 5EHLA 3DY7A 1ZWSA 2VU3A 4ZTSA 3NYVA 3VHKA 4AA0A 2CGUA 3KGAA 3DFCB 4UMPA 3AC5A 4D58A 3PSDA 4Q2AA 3PP0A 4W8DA 3D4QA 3KXHA 3R2YA 2X2LA 3IS5A 4YPSA 4CZTA 1PHKA 2IVVA 4FSTA 2WMAA 3LFFA 2BZJA 5AX3A 4O0TA 2DQ7X 3EQIA 4P4CA 5AR7A 3DKFA 4YP8A 4FNZA 1GJOA 2EVAA 3ZRMA 4BDAA 2JLDA 2YWPA 3LFAA 3TL8A 4A07A 5E8WA 4D9TA 4ACHA 3PWYA 4R6VA 2HCKA 3ORNA 4I92A 3PXFA 1LR4A 5G1XA 5ICPA 5HU3A 3Q2JA 2W17A 2CLXA 4QMUA 4MNEA 3PXRA 2GS2A 5B7VA 4EHVA 4FEQA 3RHXA 3TNQB 5BUIA 3UVPA 4DITA 3WZDA 2JDVA 4RJ8A 1PY5A 4UYAA 3GCSA 4GVAA 4F9AA 1YXUA 4XMOA 1JKKA 3HEGA 3QX4A 4C4JA 3O0GA 4TPTA 3QTSA 2ITYA 1J1BA 3EL8A 3OP5A 3C4WA 3R04A 2HZNA 3F5GA 5A4QA 4ZJVA 4MWIA 3OCBA 1JKTA 4LOPA 5JRSA 4BHNA 1Q41A 4L01A 2YCQA 2PUPA 4M97A 3TI1A 1OITA 1OBDA 3DBFA 4MAOA 5KMIA 3UG2A 1DAWA 3AC1A 2B9IA 3I60A 5I9YA 3RM6A 3TACA 3CTQA 4E3CA 4ZY5A 2BILB 4M12A 5HORA 2C0IA 5DN3A 3T3UA 3CY2A 4U7ZA 4YLKA 3FY0A 3DZQA 5EOLA 1Q62A 3R9DA 2WMSA 1I09A 4YC8A 4G17A 1TQPA 5CSVA 4XV9A 3R8LA 2GHGA 5TKDA 4CRLA 4D1ZA 4JIAA 2BROA 4E7WA 2RFSA 4USFA 5HTBA 5GIPE 4JRVA 1FOTA 3K5UA 2RG5A 4D2VA 4JDHA 5AIRA 4DEGA 5KMMA 4I22A 4DEIA 5FM3A 4FE2A 3HVCA 3V8TA 3A60A 4JOAA 1M7QA 3U6IA 2XK8A 3Q60A 4BCPA 3EYGA 4BCMA 3OWPA 4BHZA 2BDFA 3GQLA 1NT2A 3AT3A 2GFSA 1SM2A 3POZA 3R1SA 4YTHA 2JFLA 2RSVA 4YTIA 3Q9ZA 1H07A 3ZEPA 3BIZA 4LG4A 2PZ5A 4XHKB 3HA8A 4ITHA 2JDTA 5J5TA 2HZIA 4FT0A 4XRJA 1H08A 2HXLA 5AP1A 4M13A 1UKIA 1UU3A 1Q8WA 1WVWA 4HCTA 2YM6A 3QQLA 3KREA 5LVLA 3VBVA 3FL4A 4N0SA 2A2AA 3E3BX 3QRJA 2EUFB 4YUQA 2QOOA 1BI7A 4ITIA 1BYGA 4G31A 4W4XA 1WBOA 5EI6A 4EHZA 3GFWA 3CD3A 2X4FA 3HMPA 3VS6A 3UIBA 3IW7A 3T3VA 4DE4A 4RWJA 3SXRA 2WXVA 4EI4A 4FYOA 1S9JA 4GFMA 5ETFA 2HAKA 4S34A 5HE1A 4CXAA 4DBXA 3R7EA 3MGYA 5IA3A 4DEAA 2ETKA 2W9ZB 4L52A 5A4LA 5CU6A 1RW8A 2PTKA 2QHNA 2VO0A 2ZDUA 2I6LA 4QMZA 5CENA 2WNTA 2JBOA 5T6KA 3ATTA 2VTTA 4K2RA 4PDOA 5B2MA 4IVCA 5L8JA 1M2QA 4DGMA 3QD2B 3P4KA 4BB4A 1Q24A 3R8ZA 3TZMA 4X2NA 3IPHA 5CASA 3BU5A 3JR1A 4O81A 2JD5A 2Y6OA 3LXNA 4DH1A 5L3AA 4GFOA 3OS3A 2PE1A 2O5KA 1ZZ2A 4BCKA 2VNYA 2PVNA 2Y4PA 3SGCA 4TZRA 4TT7A 1H28A 4YZNA 4G3GA 4WKQA 2GCDA 3R8PA 4Z55A 1F3MC 2X39A 3LW0A 1AQ1A 3VQHA 3UNKA 2OF4A 4F6SA 3CP9A 3EZRA 4EOLA 4YU2A 5L2SA 4FG8A 5E9EA 4DEDA 3NW5A 4ANLA 4IVBA 3PUPA 4BDGA 1G5SA 1PYXA 3ZXZA 3GC9A 4O0XA 4FSZA 2BTRA 5HE3A 3E7OA 1OMWA 3AGMA 3QZGA 5DT0A 5ANOA 2BALA 5C27A 3BV3A 2W1CA 5IQDA 4GIHA 3EQBA 2W5HA 4ZMFA 4ZOGA 3LAUA 3GGFA 3KL8A 3HGKA 4IAIA 3HZTA 4R3RA 3HMNA 5GJGA 5A6NA 1CSNA 4PX6A 2B4SB 1CDKA 2E9NA 3OG7A 2RFNA 5DHJA 4IVDA 3LFQA 3LQ5A 4OTQA 5E4HA 1GIHA 2FSLX 3LFCA 2DWBA 5BUJA 4YBJA 4FKLA 3MFSA 4JG8A 4HW7A 4PRJA 5G6VA 5HG8A 3F2AA 2JKOA 3QTQA 5CLPA 3W1FA 3QXOA 3OWJA 3WILA 5LVPA 2JIVA 3UYSA 1U59A 4WRGA 3FSFA 3R00A 3VS4A 3O8UA 4FNWA 4IHPA 2VTAA 3VHEA 3VUGA 2C6IA 4IEBA 4CFUA 3RJCA 1KE5A 3MFTA 3OY3A 3UE4A 3VS7A 2YIRA 4JVGA 4XEYA 2UW8A 4ANSA 5FM2A 4PPCA 3QUEA 4GYGA 4RIYB 2PU8A 3E87A 3MTLA 4E5AX 4DCAA 1KUTA 3DS6A 5ITAA 2XKEA 4AT3A 4EK6A 4ZS4A 1KV1A 2IWIA 3E8NA 2BVAA 4PQNA 3I5ZA 4EKLA 3UJGA 5ACBC 4L8MA 3MVJA 3PVBA 2R3JA 5C1QB 3FBVA 3MB6A 5CYIA 5IZFA 4A9UA 1ZMWA 3QKMA 4L7SA 4UY9A 5CTPA 3ZO4A 2C6LA 5EQPA 4BBMA 2BFYA 4DCEA 3LFBA 3EHAA 3HDMA 3NNWA 5CAPA 2HENA 5KBRA 2QO7A 2AC5A 2BHEA 3SLSA 2XB7A 5HBJA 4CKRA 1KE6A 2JDRA 3P5KA 3QAME 3KMUA 3UPXA 1REJA 4FZAB 4CTCA 2F57A 3FMKA 4YJRA 2XBAA 3QF9A 4I93A 3P08A 4M0YA 3RPRA 4ZY6A 3TZ8A 5AAGA 4FVPA 5KUPA 3BLQA 3AXWA 3ZLXA 5M06A 2ITQA 2WMVA 3F69A 4UEUA 1ZAOA 3RCDA 3G0FA 2XNBA 2G15A 4G6OA 1OVEA 3NAXA 1GIIA 5EW9A 4YC6A 2VGPA 3NW6A 3CBLA 3F5PA 2XJ1A 2XCHA 3FMLA 4PDYA 3G6HA 4QP3A 4E4XA 4UMTA 4RIWA 1PKDA 2ZM3A 3CTJA 4M15A 2ITOA 3KULB 4JT3A 5IKWA 5HX6A 4WUNA 2PULA 2QR7A 3RAWA 4DG3E 4GU6A 4TYEA 3IOPA 3G6GA 1LP4A 4J71A 4BFMA 3ODYX 3R7VA 4JS8A 3B8QA 2BRMA 3F7ZA 2GMXA 3W2PA 3BPRA 1TVOA 3FEGA 2VWUA 2B54A 4QPMA 3TJDA 1OPKA 2Y0AA 4KINA 4ONAA 5HBHA 3KK8A 3EN5A 3RZFA 1G3NA 4G9RA 5BVFA 4Z7HA 2WMUA 3FLNC 3LCTA 5IUGA 4DH8A 4WD5A 2PVHA 4V0GB 3MN3A 3SX9A 5EKNA 2A27A 2Y8OA 1ZMVA 1Z5MA 2YCSA 3N4UA 4NYEA 4Z16A 5CF6A 3NRMA 4XS2A 5I0BA 3FLQA 3RAIA 4XP3A 5AV0A 4B4LA 3F2NA 3GOKA 3QRKA 2IVUA 2R3LA 3H30A 3OFMA 4DFBA 4NIFA 1WBWA 3R2BA 2UVZA 3M42A 3PXKA 4QOXA 3AC8A 2WTVA 4FV5A 4GU9A 4AF3A 4HCUA 5EKOA 1YQJA 3VBTA 2W1GA 3TNIA 3B2TA 3IONA 4HVIA 2VUWA 1RDQE 1Y8GA 3FSKA 4OR5A 5FUTA 2WMBA 4RIXA 5AV3A 3IDCA 1WVXA 4ZTNA 5HZNA 3F3WA 1ZOHA 4TWOA 3S95A 3WYXA 3S4QA 4PWNA 4FMQA 4RVTA 1V0PA 4FK3A 3GT8A 4FNXA 4NKAA 3UO6A 1U54B 1JSUA 4GV1A 4RRVA 3JXWA 3ROYA 3AC4A 3BHYA 3R7YA 1U4DA 3ZS5A 4C37A 3MY0A 4OTGA 2X7GA 4R5SA 5FP5A 4DH3A 5IUHA 5JGBA 4YTFA 2CNVA 3Q9XA 5C03A 4XV1A 5AV2A 4FV6A 3SRVA 5IA5A 4I20A 2B52A 3BE2A 3EN7A 4HJOA 5EOBA 5A3XA 3L9LA 4YSMA 2B55A 5BVKA 5IDNA 5EFQA 2UVXA 3PJ8A 1Q8UA 2UW7A 2WPAA 4O27B 4Y5HA 5FGKA 2FYSA 3MPTA 4OBOA 3DOGA 5E8TA 2UZVA 4BDCA 2A1AB 5H8GA 4TRLA 3MW1A 2EB2A 2VX1A 5EQEA 2ETRA 1XBAA 3A8WA 2IVTA 4X3FB 2PUNA 2WGJA 4E73A 2IO6A 2BRBA 5BYZA 5J9ZA 3QQKA 3EKNA 4GT5A 5E8XA 4DT9A 3AMYA 3QCQA 1Y8YA 3QLGA 3BBTB 3B8RA 3TKUA 1V0OA 4JXFA 4EQCA 4R1VA 3RINA 3OCGA 2YIWA 3DB6A 5JRQA 1ZZLA 2HIWA 2R0UA 5GNKA 4AN9A 1JSVA 2BCJA 3CGOA 4FKWA 5FBOA 5AP5A 2W1HA 2I7QA 5IISA 4LM5A 3ACJA 4TTHB 1HOWA 4RJ6A 5HVKA 5I4NA 5K3YA 5IA0A 3F9NA 5I3OA 3A62A 4JX3A 4J95A 3HL7A 4WBBB 3F88A 1BL7A 1OL1A 1LPUA 2KULA 3PJ1A 4UWBA 4WO5A 5CVGA 4C38A 2ACXA 4QYYA 3E63A 4KSPA 4X6RA 5HNGA 3SC1A 4BIBA 2F7ZE 4U43A 2OH4A 4AGCA 1Q4LA 2VTOA 5LXMA 3IDBA 2GNJA 4XLVA 4RBLA 1UNLA 4XP0A 2LGCA 3FWQA 4O22A 3PPZA 4YLLA 2NO3A 3S3IA 2CN5A 3V5WA 5JKGA 5AUWA 4FTOA 2J5EA 3HV4A 5D41A 5CEIA 2BMCA 4IX6A 3GCQA 3SW7A 3FYJX 4M0ZA 4M69A 3D2KA 5HGIA 3R21A 2YFXA 4G6LA 3V5PA 3WE8A 5E92A 5IQAA 2W5AA 2ZYBA 1BKXA 4FIIA 4UWYA 3P9JA 3UVQA 1NY3A 3KF7A 5ANGA 1ZMUA 2WTDA 4FKOA 2ZJWA 3FI8A 4EH8A 3O23A 3M1SA 4RLKA 2VTLA 3BE9A 4BRXA 4LYNA 5LVNA 3VVHA 4D2WA 4EH5A 3U8WA 2DYLA 3RI1A 3E3PA 4LOQA 4B7TA 2C3LA 4XH6A 5CSXA 3ZHPC 5M4UA 4UXQA 5HO8A 4F7NA 2IG7A 4BGHA 1K2PA 4IAAA 4L7FA 3SOCA 1Q8TA 4UN0C 4C62A 4YJUA 1YXSA 2OWBA 2A4LA 4I24A 4L46A 2PPQA 3D7TA 3KXNA 4M7IA 1YXXA 3Q4ZA 3A4OX 4ID7A 4IW0A 5L8KA 3RZBA 3C4CA 1KE7A 2XRUA 4RVLA 4BI2A 5AR8A 2H34A 4MTAA 4AZSA 3MSSA 5BVOA 3ROCA 3W2RA 5I3RA 3REPA 1URCA 4LOOA 4CMUA 4QNYA 2XKFA 1XH4A 5K0XA 2B9HA 2VWIA 3BQRA 4GEOA 4AW1A 4EOPA 4PUZA 4EOJA 2GDOA 3CKWA 5BPYA 1Q5KA 2A19B 2I0YA 3P23A 4MEDA 5DT4A 2XNEA 5BX0A 3ZRKA 3P78A 3QA8A 5HX8A 3H10A 5H8EA 3NVKI 2JIIA 3KU2A 2YM7A 5HIDA 4YO4A 3O17A 1R1WA 3EFLA 2J0LA 3F5UA 3F3VA 1U5QA 4RX5A 5J95A 1R39A 4MD7E 1VYWA 4QP6A 3WF5A 4EWHA 4WHZA 1J91A 5FEEA 5HESA 5A54A 3NZ0A 4KD1A 1M17A 4ZZOA 4APPA 4CMOA 3ZM4A 2R3KA 3C0IA 3ENMA 3MH3A 3R28A 3Q9YA 4I0TA 1FVRA 5ANJA 4O7ZA 3LMIA 2CGXA 3RTPA 1PF8A 4UWCA 4MKCA 3OMVA 2BDWA 2WOTA 1OIQA 2I0EA 2ZV9A 2X8EA 4S31A 3U6HA 5M56A 2QOBA 5BYLA 4IX5A 3L8VA 4EK4A 4DBNA 2UZEA 2X2KA 2XS0A 3C4FA 3OBGA 4FV3A 1E1VA 4GRBA 4IQ6A 4AE9A 3QBNA 4RJ7A 5M4FA 3R6XA 2AUHA 4EOQA 4TYJA 1BUHA 2XJ0A 3TXOA 4YTCA 2QVSE 5DR2A 3ZUUA 1OPJA 4GKHA 3FZRA 4BCQA 4FL2A 2G2FA 3P7AA 4S30A 2CJMA 2QU5A 1W0XC 5HLPA 5CT7A 2GNHA 4G3CA 4I4FA 2OF2A 1UU8A 4K9YA 2CNUA 2B9JA 3F3UA 4XRLA 3HMIA 3A99A 3N9XA 5M07A 3GCVA 2VWYA 4YLJA 5KCVA 4RMZA 4B8MA 4IAYA 3VW6A 3FI2A 4U97A 2XKDA 2F2CB 5HI2A 4DGOA 3NLBA 4CG9A 2W5BA 2YWVA 2JEDA 3QC4A 3ZUTA 4D4RA 4Y73A 5E8SA 3U51A 4KKHA 5FDPA 2XVDA 2CCHA 4IM3A 2NPQA 4K8AA 4XP2A 4O96A 3VS3A 3MJ2A 4K18A 3EQCA 3VO3A 4FC0A 1WBPA 3FZ1A 4ZJJA 3CLYA 1YHSA 3ZSHA 2Z02A 3QTXA 3F6XA 3ORKA 4EORA 3BX5A 3DTCA 3GCPA 2C0OA 3EMGA 3EN9A 1UNHA 4QP4A 4Z7GA 3I0QA 4OTDA 4F6UA 3BKBA 2HY0A 3NNVA 3KF4A 4GMYA 4QP9A 4I5HA 4H3PA 2RFDA 4RC2A 3WF8A 1IA9A 2BZIB 4D55A 1ZYDA 1MRVA 4RIWB 2C6OA 4JDJA 4CLIA 5M53A 3TDWA 1YDRE 1UU9A 1JBPE 4RQKA 5GHVA 3WZUA 4YR8A 5DLSA 4YJTA 4IZ5A 3UMWA 4BKJA 4BCNA 1DAYA 4L44A 3V8WA 3W32A 5CQWA 2C6DA 3FQEA 3QRIA 5L6PA 3OBJA 1T45A 3DKOA 3QZHA 4IE9A 1K3AA 1OB3A 4Q5HA 5IMXA 3RCJA 3NSZA 4JIKA 1XHAA 4C4EA 4JQ8A 4N57A 4O86A 1APME 2GNLA 4GT3A 3ZLWA 4KB8A 5CSHA 3R9HA 4C0TA 4IB0A 4PTEA 2W9FB 4A06A 1GZ8A 3C9WA 4UB7A 4QYHA 1Q8YA 2PY3A 4C3PA 2CHLA 1F5QA 2Q0NA 3CPBA 3V5QA 3DCVA 3QL8A 4PP9A 5KMJA 1Y91A 2X8IA 4QTBA 4UMQA 4NIFB 3ZOSA 2HY81 3A7GA 1MQ4A 4JR7A 4EJNA 3HUCA 4TNBA 4BIDA 2PVJA 2BAQA 4BTJA 4ZZNA 2V0DA 2J7TA 2BZKB 4UZDA 5DE2A 5ANDA 2ZMDA 5CI7A 2JBPA 2XNNA 1BL6A 3UZPA 5F9EA 5LJJA 4G34A 5HCZA 4KIOA 3KVWA 1UNGA 3NEWA 3OF0A 4GG5A 3VWAA 4F7SA 3UP7A 4Q9ZA 3S2PA 5JEBA 4PMTA 4IC7A 5M44A 4QMTA 3D15A 2UZTA 1URWA 4BWXA 4IM0A 4TYIA 4TY1A 4EK8A 4G3EA 5J1VA 5D11A 2NRYA 3C4ZA 2O2UA 3OOMA 3FMJA 5DWRA 3MTFA 2LAVA 3MJ1A 3VUKA 3LJ0A 4MXYA 4O1PA 4O7SA 4RA5A 2WTKC 5M57A 3EQFA 5KE0A 4EONA 3TUCA 2ZVAA 4HOKA 4YZMA 3TN8A 5HNBA 1PJKA 3EFKA 4UV0A 5M09A 4AW0A 3IW6A 5EG3A 3M11A 3SRVB 1P4OA 3HDNA 4FEXA 3ZM9A 3OD6X 3BWFA 1YWNA 2QLUA 2XZSA 5FEDA 3UOKA 5ACKA 2VTMA 4IZ7A 2XBJA 2F4JA 2QLQA 4FV7A 3UYTA 4P5ZA 5ANIA 3QWJA 2JAVA 3TNHA 1KE9A 2YDJA 4W4YA 4P90A 4FSRA 4ZTRA 4L3PA 2Y9QA 4QP2A 2AYPA 4ARKA 4RX8A 3BYSA 2XIRA 2R7IA 2JKKA 3ZH8A 5AA9A 5DRBA 3Q96A 3DXPA 1VZOA 1X8BA 4MHAA 4XG4A 3ZEWA 4F1OA 3AT2A 2ZM4A 1NVSA 3DAEA 5AIKA 3TJCA 3QYZA 4R5YA 1ND4A 3SW4A 2Z2WA 2P0CA 3LKMA 5LWMA 1MP8A 2P2HA 3E62A 2JITA 4LRJA 4NCTA 3DTWA 2AC3A 4UYNA 1YI4A 2UZBA 3BGQA 3P0MA 4LUDA 3C13A 3C4XA 3FZPA 4OTPA 3QCXA 4IAKA 4FZ7A 4AA5A 1ZRZA 2V5QA 3QQHA 4EH4A 5CNNA 3P79A 3K54A 3LMGA 3DAKA 5AAFA 4BDBA 1G8AA 3NR9A 5DH3A 2RF9A 2B9FA 5CU2A 4J97A 4D5KA 4QMPA 5CX9A 2ZV2A 5CI6A 4HVDA 3PYYA 3T9TA 1QPDA 3QQGA 3LZBA 1H1RA 4GKIA 3ZO1A 5C4KA 2QC6A 3QZFA 4ZTMA 4ACDA 2OZAB 4P5QA 2R3MA 2FB8A 2OXXA 3COKA 3ERKA 4PL3A 3RVGA 5KO1A 4BKZA 5IF1A 4RVMA 4EUUA 1OBGA 4H39A 4LL5A 5AV4A 2P4IA 4J98A 3D83A 4RVKA 3U54A 2C5OA 4F09A 3QD4A 4YJVA 3T8OA 4X2JA 2HK5A 5FLFA 3QD3A 1QPJA 5FBNC 4G16A 1ZYJA 3A7IA 5CZIA 3RNYA 4QTEA 2GNFA 3CGFA 4DGNA 4QMVA 1TQMA 4DC2A 3TCPA 5IEYA 1KV2A 5K4IA 4B9DA 4YMJA 5LWNA 5B0XA 1WVYA 5E91A 3CY3A 2CKEA 5GZ8A 4C4HA 3RAHA 4JBOA 4BKYA 2QHMA 4JNWA 4FG7A 4U6RA 4FEWA 2QKRA 1IA8A 3QTZA 4NWMA 4C35A 4CQGA 3SG9A 3MVLA 4KIKB 2W1FA 4I4EA 4ALWA 3KN5A 4OTWA 5L2QA 2Y7JA 3LMHA 4DH5A 4MBJA 3JUHA 1OI9A 3A7FA 3PZHA 4D1XA 4GK4A 5DEYA 4IANA 5JZJA 4RT7A 2BHHA 4O7NA 3H0ZA 5E8ZA 4MBIA 2R0IA 4AAAA 3I4BA 3PJ3A 3SG8A 4BGGA 3QQUA 4F0FA 1VEBA 4DFZE 4R78A 5KMOA 2QOKA 3EN4A 5IU2A 3ODZX 4FTJA 3QTWA 4IX3A 2OJGA 3UC4A 1ZYLA 4J8MA 3BHVA 4B8LA 3ZLYA 4RFMA 5HICA 3U87A 3V51A 4APCA 3C0GA 3NUUA 1ZY4A 2ITXA 3R7GA 1NW1A 2ETMA 3UNJA 2WAJA 4FKGA 4NZWB 2EWAA 4GUEA 3I0OA 1QCFA 1W84A 2P3GX 3FQHA 3LIJA 4MXCA 3WE4A 1ZY5A 3CIKA 4E4LA 3WZKA 2YCRA 3ORZA 2VTSA 2OICA 3NS9A 3GQIA 5J87A 5KBQA 2R64A 3QA0A 3BWJA 3LHJA 3BYUA 4EBWA 3G2FA 4JQ7A 4DYMA 4N6ZA 4R7HA 5K0KA 4U3ZA 3AC3A 4KKEA 4WSYA 5H3QA 3Q4CA 3LCOA 2CPKE 4PMMA 3BU3A 1P2AA 3FXXA 4NJDA 4DEEA 5EYKA 5JFVA 5T3QA 4O0RA 3D14A 3PY3A 4KS7A 5CEQA 3UIMA 3BEAA 4I41A 4LGDA 3ZXTA 5L2IA 4HVGA 4G1WA 4BY9E 3KA0A 4E5BA 4XG6A 1ZOEA 3R1NA 4V01A 4O7WA 4WNMA 3NAYA 5K5XA 2QI8A 4U81A 3DV3A 4TWCA 1Q99A 4GIIA 3VBYA 2PMNX 2R3PA 5CSWA 1M14A 4X2GA 1FPUA 2O0UA 4HYIA 3NNXA 4BDEA 4G3FA 3WIGA 3V5TA 2FGIA 4WG5A 3SOAA 4EH2A 2OFUA 3QTRA 4C58A 4PMPA 3HA6A 4FA2A 4RFZA 3LE6A 5DFPA 2GNGA 2W05A 5JQ8A 4AOJA 4BCFA 4NTTA 4R77A 4HPUE 2OJFE 3MPAA 3VS2A 3R02A 5IQIA 5DYJA 2HOGA 3PG1A 2J4ZA 2H96A 2VTPA 5C26A 2PHKA 3LCKA 4KNBA 3WARA 3GBZA 4XG3A 4G9CA 1H4LA 4YBKA 1JPAA 2YCFA 2YM3A 3DJ7A 2OU7A 3FZSA 5M4IA 4JRNA 4X2FA 4YGAA 3W8LA 3SA0A 4DT8A 3R9NA 2BTSA 1XH7A 2ONLA 3ZFYA 4X0MA 3LM5A 5A6OA 3D5VA 2W96B 3FDNA 4CCUA 1PMUA 4D2SA 1OUKA 4XBRA 5IQHA 3E64A 3DDQA 3PY1A 3Q3BA 4FGBA 3VJNA 1W83A 3VIDA 1O6KA 2ITWA 5CQUA 2VGOA 2VRXA 4KBCA 5IQEA 2YA9A 1CKIA 4A9TA 5AR4A 2WEVA 5BVNA 2QURA 5HLWA 3RNIA 3A4PA 4HNIA 4DH7A 4JBQA 2PVLA 3BI6A 4AGUA 2ESMA 2O8YA 4HNFA 5J1WA 5LARA 4F6WA 4OTHA 4N4SA 4NTSA 3VW8A 5FXQA 3UGCA 4YZCA 4DHFA 5KHXA 3GNIB 4OBPA 3O7LB 4U42A 4LGGA 1XH6A 2BIYA 2Z7LA 4OTFA 2GQGA 4F9YA 2CN8A 4FSUA 5TO8A 5BQ0A 4WOVA 4E4MA 3RP9A 3W2QA 1QPCA 2I0HA 4L3LA 3G5DA 2UV2A 4H36A 3IK3A 2VWXA 4MBLA 3NPCA 2FUMA 5K4JA 2ITZA 5HG5A 1HCKA 1UWJA 5TR6A 4FEUA 4X21A 4D4SA 3VAPA 4A4OA 2HXQA 2E9OA 4N70A 3PJ2A 2FH9A 4NW6A 4F9BA 2XF0A 4NSTA 5IH4A 2XRWA 1YI6A 3LLTA 1OGUA 4FV0A 4A9RA 5I9WA 3Q9WA 3KB7A 3LXLA 5JT2A 2X7FA 3NNUA 3QYWA 2W06A 4I6BA 3ORTA 1S9IA 2CCIA 5DR6A 2GNIA 5L6WL 4U0IA 3UP2A 4C36A 3AGLA 1SNXA 2F49A 3I7BA 4NM0A 4C33A 4FKUA 3COMA 2X2MA 3E8CA 3FV8A 5AUXA 4NK9A 4EZ5A 3S00A 4QQCA 4XJ0A 3LVPA 5CSPA 4FKPA 4DLIA 4YJNA 1A06A 1OL5A 2W1EA 4I0RA 5AR5A 3H4JA 4W4WA 2PZRA 4U5JA 3B2WA 3VC4A 4CV8A 3ACKA 2GQRA 3OWLA 4BBFA 5IH5A 1KWPA 2YABA 3GC0A 4KS8A 4O21A 4E6QA 4QQJA 5CAQA 4O6EA 4I5CA 4B99A 4GVJA 4ZSLA 3GC8A 4AT5A 1K9AA 3IGGA 2ZV8A 2YAKA 4ZSGA 1SZMA 2W1DA 5K5NA 4F9CA 2W0JA 4AS0A 3FKOA 4D5HA 3PIZA 3ZDUA 4W9WA 5AP3A 4DTBA 1OECA 3ZZWA 4I5PA 1V1KA 2QG5A 4EOMA 3H9OA 4NCTC 3PE1A 4TWPA 4CYJA 2WHBA 4ACGA 3ZC5A 4AFEA 4QQTA 1WBTA 4FTUA 3FZTA 4K77A 2WTWA 3RPSA 3ZUVA 4BF2A 4O0WA 1ATPE 4D2TA 3FXZA 5FEQA 2J0IA 1DS5A 2REIA 3AD6A 4ASDA 1UWHA 5JFXA 3CKXA 2PZPA 3JPVA 4FV4A 4MVFA 3ZYAA 3P86A 3ZONA 5A4TA 2GTNA 3DBQA 2XNPA 3UOLA 2YJSA 2HZ0A 1JKSA 4YHTA 4AT4A 5CANA 2Q83A 4DFNA 3C4EA 5TE0A 3L8SA 5F20A 2QOIA 3Q4TA 5HIEA 4XX9A 2FVDA 2ZV7A 1PW2A 3Q53A 3KMWA 4MNEB 3OT8A 4DGLC 3E7VA 3QTIA 3HV5A 2IN6A 3FMMA 1FINA 2UZLA 4FZDB 2QR8A 5BUEA 4A4XA 3QUDA 3OTUA 4K6ZA 2XP2A 5FRIA 4ZLOA 3ZC6A 5LMKA 4F4PA 1YXVA 3DNDA 4YNEA 5AUZA 4CFFA 1CKPA 4QRCA 1WCCA 1SNUA 3DKCA 5D7VA 2ZM1A 2QOCA 4PY1A 1NVRA 1YW2A 3KN6A 2XCKA 5J8IA 4U3YA 4E6DA 5LCJA 5CU3A 5AX9A 5KMLA 4FGRA 3NW7A 3HP2A 4I3ZA 4ERWA 3W55A 4BCJA 3SXSA 4QO9A 4D2PA 3DT1A 1JWHA 4RX7A 2WIPA 4X3JA 2Z7QA 4JJRA 4GSBA 2QOLA 4C4FA 3UPZA 2CMWA 2RKUA 3IQ7A 3GI3A 4FKQA 4FTTA 4GYIA 4NW5A 4P7EA 4AN3A 5IQCA 4IX4A 5J5SA 4CNHA 3OEZA 4U9AA 3PZEA 4O7LA 5CALA 4ERKA 4FSNA 2JGZA 4CFWA 4KRDA 3Q32A 4BDIA 3R71A 3FPQA 4PF4A 3W16A 3HAMA 5HBEA 2VTRA 4FSWA 3E8DA 3FY2A 3TV7A 4CKIA 5AEPA 2YIYA 4DG2E 4O0VA 4HYSA 4C3RA 2H9VA 2OI4X 5AP0A 1YHVA 1YKRA 2J0JA 1JOWB 1MUOA 4Y72A 3TV6A 2YM8A 2ZAZA 1CTPE 4L42A 3RK9A 1XQZA 3MH0A 3MVHA 5M51A 1JQHA 3LXKA 2J0MB 3HUBA 4MNFA 2PZYA 4CSVA 3MY1A 3EYHA 5EHOA 4G3DA 4MQ1A 3V3VA 2CNQA 3I5NA 1XH8A 1SVHA 4LQMA 4YZBA 1Z57A 1R0PA 4M14A 4BDKA 5C9CA 4G6NA 4RJ4A 3GU6A 3PA5A 5C01A 2W4OA 4XOYA 1Q97A 4F0IA 3S1HA 5AM6A 4FT9A 4HGEA 5CS6A 2CKPA 1OUYA 5LQFA 3W2SA 4YJPA 5HD7A 1W7HA 4G5PA 1ERKA 1B39A 2BUJA 2X8DA 3C0HA 3IDPA 4KKGA 4QYFA 4OW8A 3DLZA 4RWKA 3R8UA 4FTLA 3QQJA 4FT7A 4AXAA 4RC4A 1H24A 1IRKA 1E1XA 3A8XA 1JNKA 1LEZA 2R3QA 3EJ1A 3IGOA 4D2RA 4D4YA 5AWMA 4E6CA 4ASZA 3O51A 4AZVA 4BI1A 4O84A 3F66A 4MYGA 2BRGA 3PVWA 2HWOA 4OT6A 4CLJA 3U55A 3CE3A 2RGPA 2BR1A 3LCSA 3OY1A 4ZTLA 3EZVA 5L4QA 4QT1A 3OHTA 4KSQA 1GZOA 3KEXA 1E9HA 2J9MA 4AZTA 3UZTA 3Q2MA 4X6QC 3EQRA 2HWPA 4C34A 4YJQA 3AOXA 4U80A 4AWIA 1V0BA 1J7IA 2ITPA 4L67A 5EW3A 1JKLA 4WT6A 2R7BA 3V8SA 1AGWA 2PVFA 3WF7A 3KXMA 2C30A 4C4IA 3ZCLA 3F82A 5J9YA 4F99A 2VTQA 3QQFA 5DOSA 4CFXA 2H6DA 2WTJA 3GU7A 3ZTXA 5FTQA 4CCBA 3OEFX 3W2CA 5IQFA 1DM2A 4PL4A 4U79A 4FK6A 4E26A 2GTMA 3NVMB 3KRJA 2CKQA 3V6RA 5H9BA 3N4TA 4C3FA 3A7JA 2ZB0A 3HV6A 3O2MA 3RK5A 2ZB1A 4FICA 1XBCA 2EXMA 3KY2A 2GU8A 4Q9SA 2HYYA 4TW9A 5ETAA 4BBEA 3V6SA 3LFNA 3R73A 2C3JA 2ONLC 3FLWA 2WQOA 2XM9A 3I6UA 5DR9A 4R1YA 4QYGA 3R8VA 2R3OA 1IASA 4QMNA 1JLUE 3OXTA 3RGFA 4EK3A 4GJ2A 1JSTA 4I6HA 2ERKA 2VO7A 4IIRA 4M84A 5FTOA 5CEKA 3MH2A 3MYGA 2Z60A 3PRFA 2BPMA 3GC7A 4ZMEA 3G0EA 4BI0A 3F3TA 5EDPA 1YXTA 3QD0A 3HAVA 3OZ6A 5TT7A 4U44A 2WMXA 4J52A 3DQWA 1SMHA 4JX7A 5HHWA 4XG9A 3FZOA 3QX2A 4JAIA 5JFWA 1UV5A 5EM8A 2C5VA 3DB8A 4C2WA 4CZUA 1OKZA 2IZUA 1FGKA 3KKVA 1PMVA 1OM1A 2VTJA 3G33A 2XIKA 4IWDA 4WBOA 4FUYA 3EB0A 2CKOA 3F2RA 2Q0BA 1WFCA 5EI2A 4UXLA 2J90A 4MCVA 1FMOE 3KMMA 4ZSJA 3SKCA 3QC9A 4MF1A 3NUSA 5DIAA 3NYOA 2GPHA 3CEKA 4QMXA 4ACMA 4DFXE 2QONA 5HG7A 5A4CA 5JGAA 2X9EA 2F9GA 4MXAA 2KTYA 2X7OA 3PA4A 4AUAA 4QPSA 3UC3A 4AQCA 2YM4A 3LLAA 1PXMA 3PLSA 4IB1A 2PUUA 3FLZA 4AGWA 3D2IA 3L9PA 4YZDA 1STCE 2FA2A 3U9CA 3PIYA 3QWKA 4FIFA 1O9UA 3DJ5A 3OCTA 4CMTA 4LV8A 5D12A 4E4NA 4TXCA 5I5ZA 3VF8A 2ITNA 3D94A 4LL0A 1WBNA 4AZWA 4BTFA 2QOFA 5HE0A 4EQUA 2YHVA 4ZAUA 1OIYA 2WQMA 2XH5A 4KWPA 2R3FA 3RAKA 4DFLA 1TQIA 1BI8A 2WMTA 1M2PA 4Y95A 5EW8A 4ALVA 4ACCA 2YACA 4ZJIA 3VUHA 4AOIA 4BCIA 3HKOA 3MIAA 4CFMA 4LRKA 1P5EA 3E5AA 4RSSA 4EL9A 4PP7A 3LQ8A 3QCSA 5L2WA 4NM3A 4IBMA 1DI8A 3GFEA 4CFNA 3FI3A 3OW4A 4KRCA 2XK9A
chains in the Genus database with same CATH superfamily
4YJSA 3I81A 5CY3A 4EQMA 5IEXA 4EWQA 5CEMA 1WZYA 2YERA 1IAHA 3SV0A 5KZ0A 1L8TA 3UBDA 2AEGA 4MXOA 4FIHA 4CVAA 5IQBA 2J6MA 2BAKA 3II5A 4QQ5A 4WIHA 5EH0A 5HO6A 3P7BA 2SRCA 3CTHA 2YZAA 4IJ9A 4FSYA 3TV4A 3TWJA 4L43A 1R0EA 2QOQA 3NUNA 2OXYA 2E9VA 5KKRC 5EDRA 2C47A 4PDPA 4WUAA 4KAOA 2BAJA 3BHTA 3G15A 5J9LA 3P7CA 2ZMCA 4H1MA 2W99B 2XEYA 4WNOA 2OKRA 4IWOA 3IW8A 5M55A 3W18A 4KBKA 4BN1A 4QP8A 3MBLA 4O6LA 4EKKA 5HKMA 5K9IA 4J8NA 2RG6A 2A0CX 5KZIA 1XH5A 4FKRA 4RIYA 3PPKA 1B6CB 3CXWA 4UALA 5BV3A 4CV9A 1JAMA 2UW6A 1VR2A 2R3RA 2JDOA 1NA7A 3BQCA 3GU5A 3MY5A 4HGSA 4JDKA 4R7IA 3V04A 3KCFA 3KRRA 1A48A 4BYIA 5M08A 3DDPA 3OVVA 5CU4A 5KKRB 3BCEA 2VX0A 4FIJA 1BLXA 3HRCA 4JL9A 4FTCA 4F7LA 2IJMA 4AQKA 3EWHA 3H3CA 4QDEA 5BYYA 2WQNA 4AE6A 3FMDA 4GCJA 3UG1A 3T9IA 4HZRA 4FV2A 4O7RA 1OZ1A 5CVHA 2PE2A 2XNMA 1NXKA 1BMKA 3L9NA 4IDTA 3BU6A 3HNGA 4BWKA 2XM8A 1ZOGA 5LMKC 1Y6AA 2QODA 3LPBA 4IZYA 1AD5A 1XMMA 4KIPA 3EFJA 4MF0A 4RIXB 5AMNA 3GCUA 4IC8A 5I9ZA 5CEOA 4ANNA 2C5XA 2WMRA 4C61A 1GZNA 1QPEA 4XNEA 2O3PA 3LFSA 5E8VA 4DN5A 3FE3A 4USEA 2GFCA 3EQDA 5ETCA 3AG9A 1SVEA 4BCOA 1WBVA 3D9VA 4TYHA 5AR3A 2V22A 3RWPA 1XKKA 3O71A 2BZHB 2W7XA 2W1IA 4L3JA 4PDSA 3VN9A 4AA4A 4DEBA 1Q3DA 1SVGA 1XH9A 2PVKA 2PWLA 4LRMA 2E9UA 3PG3A 3DQXA 3ORMA 2ITTA 4GK3A 4MXXA 4ASXA 1FVTA 3O7LD 3QHWA 2YJRA 4FKSA 3UNZA 4XUFA 3MH1A 3COIA 5AP6A 4MWHA 2C69A 3ALOA 3COHA 2UW3A 1KOBA 3MFUA 3O96A 2E2BA 4FF8A 2B1PA 4IVAA 4MH7A 3UIUA 1YHWA 1YOLA 4TL0A 3FKLA 1U46A 2C0TA 4RJ5A 2O64A 3NYNA 2RFEA 3QUPA 5HOAA 2OJJA 3FL5A 3R9OA 3D5UA 3NUYA 4PMSA 4RWIA 4V0GA 3MS9A 2WTKB 3VS1A 3A7HA 3BGZA 4F1TA 2DS1A 4NKSA 4UMUA 1I44A 1H26A 2JFMA 3IKAA 4TWNA 1UA2A 1OKWA 3MI9A 1LUFA 1VYZA 4NM7A 3DK6A 5EM5A 4Y46A 5IEVA 3LOKA 2NNWB 3WI6A 2IW6A 4IWPA 5AV1A 3WZEA 1GZKA 2NRUA 1WMKA 3TKIA 3MDYA 4EC8A 2XA4A 5T68A 4O82A 3EIDA 2PUIA 2ZOQA 4O38A 1FMKA 3MVMA 4F08A 2X9FA 4IZAA 3PTGA 4LV5A 2XIZA 4C7TA 4EK5A 2OSCA 4O4CA 3ORPA 2P55A 4O83A 1ZARA 1GOLA 4ZEGA 3F3ZA 3PIXA 3FPMA 5A9UA 5KHWA 3QFVA 2G2HA 3NYXA 3JY0A 3NGAA 4AACA 1L3RE 4PV0A 3KC3A 4JR3A 5EM6A 3Q52A 3R7OA 4HCVA 1WBSA 4LUEA 4QP1A 4U41A 1U54A 1FQ1B 4I23A 4E5WA 4L9IA 5HQ0A 2C5NA 1P4FA 3V01A 2XIXA 4CG8A 2DUVA 2QU6A 2WELA 4FTIA 1HCLA 3DFAA 3SHEA 4ENYA 1YVJA 4CT1A 3HRFA 4IB5A 1W98A 4O7VA 4J53A 3TG1A 4CD0A 4O2ZA 3TZ7A 3QZIA 4FBXA 3MV5A 2OGVA 5FG8A 1PXKA 3TM0A 2UW5A 2WB8A 2WU6A 3UQFA 2WOUA 3D0EA 3SQQA 2O63A 3PXZA 1PYEA 3NX8A 4K1BA 2GHLA 5HVYA 3NDMA 3JYAA 4D9UA 1H01A 3FUPA 4M69B 4A9SA 3BZ3A 4M68A 3POOA 3CR0A 4AFJA 2VTNA 4ZSAA 3ETAA 4C59A 4ORKA 4WNPA 4X3FA 4I94A 3CSVA 2V55A 1OKVA 2G2IA 3KK9A 4R3PA 1RQQA 2R3NA 4XG8A 5B2KA 4IMYA 3EQGA 1KE8A 4BIEA 3WOWA 3UODA 2V7AA 2BKKA 5L8LA 4JDIA 5D1JA 3IW5A 1UKHA 1O6YA 2JKMA 3NIZA 4FV1A 4NJ3A 4BR3A 3RBWA 4G2FA 5DBXA 3SD0A 4EYJA 4JG6A 3ORLA 3AMBA 3D7TB 3W0RA 3MESA 4QYEA 2IPXA 2C3KA 2GS7A 4BDHA 1OIRA 4OAVB 3AMAA 3FHIA 3IECA 5E90A 4E1ZA 3KFAA 3L9MA 3WBLA 4NT4A 2YISA 1IEPA 4ANQA 2FSMX 2OW3A 2BIKB 2C68A 2PMOX 2QKWB 3QGYA 4BDJA 5BMSA 5IA2A 4O7YA 4D28A 2X0QA 3JVSA 3W0NA 4CQEA 4IDVA 4HVSA 3TIYA 4TN6A 1PXJA 3TKHA 3E8EA 3HV7A 3UZRA 5GIOE 4FYNA 5FD2A 4UBAA 3ID6C 3ALNA 4DHJA 4CTBA 3P1AA 2IW9A 1MRYA 5C4LA 3DK7A 2YIXA 2IZRA 4KBAA 2VWWA 3GUBA 3DNEA 3AT4A 4EH3A 2XYUA 4HGTA 4OTIA 2IZTA 2X6DA 4EEVA 1IG1A 5A46A 5CXZA 1XWSA 4XBUA 4ZS0A 4H3BA 2UZOA 2WIHA 2C1BA 3R9RA 3UDBA 4DAWA 3PWDA 3QU0A 4O0YA 4QMWA 3OTVA 4O7TA 1A9UA 2X6EA 2WFYA 5IQGA 3HX4A 1J1CA 4R7BA 3K5VA 4I5MA 3ULIA 4BZOA 2OFVA 5CF4A 1Y6BA 4HPTE 1M52A 5DGZA 4L00A 4JBVA 2YDKA 1M2RA 4H05A 1EH4A 3PP1A 5E8YA 4M67A 5I9UA 4DLJA 4ZLYA 2XK3A 4O0SA 2J2IB 4J96A 4LMNA 4BDDA 3ET7A 3N4VA 4F7JA 4R3CA 1J7UA 3ORXA 3QTUA 2EU9A 4RZWA 3W33A 3DJ6A 1W8CA 4NU1A 2P33A 3CJGA 1H25A 1IAJA 4JQEA 3TT0A 1YWVA 3PDTA 2OIDA 3IO7A 3FI4A 5AP7A 3QLFA 4PNIA 2JC6A 3EQHA 3C51A 3OCSA 3ZZEA 4FTKA 5F4NA 3W8QA 3GB2A 3E88A 4I6QA 3OOGA 3R1YA 4QMLA 2UUEA 3ZO3A 3JS2A 5AUTA 3FKNA 4MD9E 4ANBA 5EQYA 4FZFB 3FLSA 4BICA 2OJ9A 3GOPA 3ZDIA 4UX9A 3BV2A 5HD4A 2UZNA 1GIJA 3QRTA 4BZNA 3ANRA 3AD4A 3M2WA 4WG3A 4OT5A 3BEGA 4OGRA 3VUDA 4IB3A 5AR2A 3FLYA 5H2UA 3R1QA 1YDSE 2FSTX 2UZUE 3TEIA 2G1TA 4RIOA 1CKJA 3OUNB 4C4GA 3KRLA 3D5XA 4CFVA 4DF3A 2YLEA 5C8NA 4LFIA 3H0YA 5J7BA 4RA4A 2UW0A 3NWWA 4LMUA 4RZVA 3ZRLA 1ZYCA 4L53A 3AQVA 4EC9A 4QEBA 3K2LA 4YC3A 3TNWA 4F0GA 4W4VA 4YNOA 2C4GA 3W0OA 2WMQA 3G9NA 4BWPA 3TDVA 2C3IB 3QKKA 4QTAA 5HEZA 3DZOA 2OO8X 3OW3A 5BNJA 2V7OA 3BL7A 3EOCA 2OIBA 4QMSA 3G51A 3UVRA 2JIUA 4I21A 3R0TA 3FMHA 4HVHA 3E93A 3MWUA 4A9YA 2XAMA 4ENXA 2W1ZA 3HV3A 3HECA 5F94A 3BYMA 4IAFA 4BVUA 2UZDA 4M66A 4IFCA 5C8MA 3CQUA 2R2PA 1FVVA 4CT2A 4EZ3A 5AAEA 5DEWA 5HLNA 5EI8A 5GZAA 5I9XA 4ALUA 3FC2A 2R4BA 4QD6A 2B0QA 2OJIA 5AFVA 3KRXA 4XCUA 4M8TA 2R3GA 4AW5A 2I0VA 5L6OA 4WRSA 3BYOA 2HW7A 3SXFA 4XG2A 3OUKA 5ANEA 3JY9A 4MXZA 3MFRA 2WTCA 4FT5A 3PRIA 4G5JA 5DI1A 3TIZA 5L2TA 4V05A 3U4WA 5LVMA 4UMRA 4ZIMA 5H8BA 3VUIA 2OIQA 2I1MA 2C6TA 3GVUA 4K33A 1H1QA 4EOOA 4IFGA 4IACA 4ZSEA 5TOZA 5HIBA 4FG9A 2VAGA 4CYIA 4TNDA 2UVYA 3DBEA 4ZZMA 3ULZA 4CZYB 4F63A 2YM5A 3OROA 5HTIA 3MIYA 3QCYA 5AUVA 3WYYA 3VBWA 3TUBA 5KNJA 4E6AA 2GHMA 4QTCA 2VV9A 2ERZE 4AN2A 5AA8A 3SVVA 3FQSA 2PE0A 3FMEA 2OG8A 4WNKA 1W2DA 4YSJA 2OXDA 3C7QA 3PLAE 4D1SA 4TYHB 5KMNA 2PK9A 2YZLA 3UTOA 1OL7A 5AP2A 4QMMA 4P2KA 2XJ2A 2JDSA 1RE8A 4XV2A 2RL5A 4A7CA 5JMSA 1KOAA 2OH0E 4FIGA 1RJBA 4W9XA 4XV3A 4H3QA 5BMMA 3CJFA 3WF6A 2J50A 5E8UA 4S2ZA 3ZU7A 4GS6A 2XKCA 5FWKK 5IG1A 4HGLA 1H00A 3D5WA 2XYNA 2C6EA 3Q5ZA 3D7ZA 1ST0A 2WTIA 2IW8A 2J5FA 4MQ2A 4FOBA 5DT3A 3V5LA 2X81A 1Z9XA 2G01A 3PJCA 5CVFA 4ZP5A 2QD9A 3R83A 4AZEA 4FTNA 4F1MA 4YURA 3LQ3A 4FI1A 1LEWA 2VTHA 3DXQA 2UZWE 1PXOA 4DEHA 4J99A 4DINA 5HU9A 2Z7RA 5FDXA 3TUDA 4FIEA 4RFYA 2W4KA 4GH2A 3C5UA 1W82A 4HYUA 5EDQA 3UOHA 3KIOC 3QKLA 4J7BA 2PVMA 4V04A 4YHJA 3CC6A 5HE2A 2WD1A 4OTRA 4GG7A 4C57A 4W8EA 2JAMA 4MK0A 4GUBA 2VX3A 4BJJA 3R63A 1XJDA 3SAYA 3OC1A 5JH6A 3HMOA 1ZYSA 5D10A 4C02A 5AADA 1MRUA 2BDJA 5JSMA 4E93A 4LGHA 4FEVA 2XIYA 4QPAA 3NMUF 1P14A 3DA6A 2F7XE 4X7QA 1GNGA 4R8QA 1DI9A 4U8ZA 2CSNA 2UW4A 2NYAA 3ZMMA 2OLCA 1WAKA 4FVRA 4TKSA 4IXPA 4D0WA 4RPVA 4N6YA 4X3FC 4FODA 5AUYA 1H0VA 2VNWA 5GINE 2V62A 3WZJA 2P2IA 3O8TA 2ITUA 2B7AA 2YN8A 3K3JA 3DU8A 4KIQA 4NH1A 4Z3VA 1QMZA 3HLLA 3PSCA 4FT3A 3ZSGA 2CGWA 5IA4A 4AG8A 4J1RA 3QGWA 4Y83A 3GP0A 5DG5A 5JQ5A 3QHRA 3A2CA 4D0XA 3UO5A 2XEZA 3U9NA 2W4JA 5IA1A 4DG0E 2OBJA 1MQBA 4RX9A 5HCXA 3ANQA 3GEQA 3VUTA 5EYCA 4ZK5A 5CXHA 4CRSA 2GQSA 3VBXA 4FKJA 1ZLTA 5I9VA 4PNKA 3BELA 3ZO2A 3TTJA 4YO6A 4DA5A 2VWZA 5CAOA 4Y85A 4F64A 4F9WA 5JZNA 4DFYA 4QMYA 3VS0A 4BDFA 3NUPA 4WA9A 3CQWA 5D7AA 3TNPC 2F7EE 2ITVA 3VULA 5KX8A 3PVUA 4Y8DA 3ITZA 1QL6A 3G90X 4EHEA 2WQEA 2VWVA 4RGJA 5EM7A 4BC6A 3VBQA 4KABA 3H9FA 3I1AA 2VD5A 5D9HA 5A4EA 4PTCA 3P5JC 2WEIA 3OT3A 2QO2A 4OBQA 5F1ZA 3VRZA 1XBBA 3L8XA 1TKIA 3UIXA 4EHGA 2Z7SA 5IMEA 4O4DA 2Y6MA 2R9SA 4XOZA 3VUMA 4EH9A 3E92A 4FV9A 2E9PA 5E7RA 4ZTQA 3BGPA 1GAGA 4AX8A 3BHHA 4BCGA 1JVPP 2NP8A 3BLHA 2OZAA 5HCYA 2H8HA 2EXEA 3WF9A 4EBVA 5KMKA 3PA3A 3EH9A 4BGQA 3JVRA 2XK7A 2CLQA 3W0QA 3KXZA 2GS6A 4WG4A 4GT4A 2WMWA 5JK3A 4RWLA 3PY0A 5IDPA 3LM0A 2YIQA 1ST4A 2OK1A 3BRBA 3UOJA 3C1XA 1UU7A 2YAAA 4L45A 4KA3A 2YEXA 1PXIA 2WKMA 5JGDA 3FYKX 3S0OA 5LMBA 3DKGA 3N51A 5ANKA 4NL0A 3VRYA 1OKYA 3QRUA 4AZFA 3RWQA 3Q6UA 1NVQA 5CAVA 3KQ7A 4CGAA 5HO7A 4EUTA 2RIOA 4YHFA 4O91A 3TTIA 4GK2A 5GJDA 2EB3A 4QMQA 2BRHA 3VF9A 2IVSA 2VTIA 4JLCA 3V5JA 2VWBA 4PPBA 4GL9A 4I6LA 3R7IA 4Q5EA 5CU0A 2X0OA 3MA6A 4QMOA 3C50A 2WU7A 4KIKA 3AD5A 3VONA 4BYJA 3K3IA 4B6LA 4U40A 3I7CA 1IR3A 3GU4A 4HZSA 3GENA 3LCDA 1YOMA 1XR1A 4OUCA 4QP7A 4QNAA 3R7UA 4XG7A 3FHRA 5GJFA 1FBNA 4E8AA 4UZHA 3SDJA 5DNRA 3UDSA 1G8SA 3ORIA 2UW9A 2YLFA 2ZDTA 4OLIA 3R01A 4EYMA 1H0WA 2XK4A 4CEGA 3MB7A 4S32A 3HYHA 3EKKA 3NIEA 5AJQA 4GFGA 2BRNA 4JI9A 5LCKA 4KUJA 3CD8A 1OL6A 2YDIA 4DDIA 2CDZA 2OZOA 2C6MA 4IM2A 5EYDA 3ZFMA 2QQ7A 5LVOA 4FKIA 3CS9A 2VZ6A 5J7HA 3KXXA 1YRPA 3GU8A 4L68A 3BHUA 3ELJA 5EHYA 3RHKA 4ANMA 1J3HA 4A4LA 3LJ2A 2QO9A 2HZ4A 3FMNA 3R8MA 3UQCA 4NFMA 4C8BA 4FUXA 3W10A 2XANA 4FOCA 2F2UA 4ZXTA 1U5RA 3FXWA 2C6KA 4YZ9A 2C5YA 4IADA 3F5XA 4PL5A 4MD8E 5DPVA 2XK6A 5J79A 5FXSA 1BX6A 1OIUA 3NCZA 3VS5A 3FAAA 4EZ7A 4Z9LA 4FX3A 1F0QA 3ZBFA 5FTGA 2PMIA 1KSWA 2Z8CA 4QDVA 4II5A 4IH8A 2WQBA 5FQDC 1M7NA 3KRWA 2PL0A 3MPMA 2HW6A 4AOTA 4NM5A 4X2KA 3CCNA 4XYFA 1PRYA 4GW8A 3PVGA 3HMMA 1PMEA 4TYGA 5F95A 4AW2A 5CF5A 5B2LA 1Q61A 4I0SA 1OPLA 5AM7A 5LOHA 4ZY4A 3LFEA 4S33A 4AGDA 3QXPA 3RK7A 2X0GA 1PXLA 4Y5QA 1FGIA 2R3IA 3OWKA 3KXGA 3L8PA 3UQGA 3Q4UA 5BVWA 3RALA 3I6WA 3VNTA 3UO4A 4OAUC 2QG7A 3QALE 5CAUA 3MA3A 3PE2A 4FR4A 4F70A 2FO0A 3F7WA 5E1SA 1PXNA 3RKBA 2QNJA 4JAJA 1O6LA 3CQEA 5FP6A 3R22A 4RQVA 5IH6A 4FL3A 1R78A 2CGVA 2PSQA 4L6QA 4H1JA 2EXCX 2XNGA 3RPYA 5IPJA 4E20A 3LXPA 3FJQE 5EK7A 3OXZA 3GXLA 4I6FA 4JG7A 1R3CA 4ZLZA 1H1SA 4K0YA 4RG0A 4FTQA 1H8FA 4MX9A 4BTMA 1OGYA 5IUIA 4EOIA 2R5TA 5C8KA 4FTAA 5JFSA 1H1WA 2GSFA 3EQPA 3TZ9A 2PZIA 1CM8A 3U6JA 3DBCA 1PMNA 2C1AA 2JKQA 4FRFA 5LMAA 2PVRA 3HP5A 5HTCA 4EOKA 3EL7A 3RPOA 4ANOA 4DTAA 1YI3A 5DVRA 4M3QA 3UMXA 3ZFXA 1PKGA 3KCKA 5DRDA 5GZ9A 4DTKA 1Q3WA 1ZXEA 2G9XA 3U4UA 5HG9A 3I79A 5BVDA 5HNIX 1CMKE 3PFQA 1SYKA 4FZ6A 3BBWA 3AKKA 2PVYA 2XMYA 2O65A 4ZTHA 5CZHA 1YOJA 2R3HA 4H58A 4DGGA 3FC1X 5DA3A 5HVJA 3OXIA 4EOSA 3LFDA 4ASEA 3TYKA 3LJ1A 2J51A 2FSOX 1REKA 4BZDA 2BKZA 3R30A 3RPVA 4FVQA 3IW4A 3ZLSA 3NCGA 5A14A 2WZJA 4O0UA 4EH7A 3L1SA 4WSQA 1YWRA 4FNYA 4IAZA 4O1OA 3Q5IA 4FKVA 5E1EA 4GJ3A 4ITJA 3RM7A 2IZSA 3DLSA 3THBA 1B38A 1UVRA 1Q8ZA 2BFXA 2I40A 3O50A 4EH6A 5M4CA 2WO6A 4RC3A 5CEPA 2PMLX 3PSBA 1H27A 2J0KA 4IWQA 3Q6WA 3CPCA 5ETIA 2PYWA 2YITA 2QOHA 3PXYA 2X4ZA 4PPAA 1GY3A 3PPJA 3ZBXA 4C2VA 5AUUA 4BCHA 2QCSA 3HRBA 3ATSA 2B53A 5CNOA 2Y4IC 4K11A 4XLIA 3G9LX 3IG7A 3WIKA 1XO2B 4FSMA 1Y57A 3O8PA 1VJYA 4AU8A 4AP7A 4BTKA 4DFUA 2HELA 3BYVA 3DXNA 1YDTE 3NUXA 3DK3A 4FL1A 4NUSA 3KULA 5EYMA 4BL1A 5CF8A 4U45A 4BJJB 3F61A 3ENHA 3DBDA 4O4BB 4PTGA 3EFWA 3VQUA 5JN2A 4EJ7A 2VO3A 5BVEA 4D4VA 3RMFA 4FKTA 3Q04A 4HYHA 3C5IA 5CT0A 3H9RA 4IJPA 1T46A 2XNOA 4YPDA 4F65A 3KVXA 4I1ZA 4YJOA 4NEUA 4RLLA 3A61A 4O2PA 1H1PA 3DGKA 5AP4A 3ZSIA 5DMZA 2XAOA 3VJOA 2X1NA 2Y4IB 1PXPA 2VO6A 2XUUA 3EN6A 4FTRA 3DAJA 3NUAA 4USDA 3W2OA 3AC2A 1OL2A 3PXQA 4JBPA 3BLRA 3IOKA 4FTMA 4FV8A 4LI5A 4NFNA 3DPKA 1J7LA 4FSQA 4CKJA 2VN9A 5FXRA 4RJ3A 5TF9A 4B0GA 4QTDA 5CWZA 5EHLA 3DY7A 1ZWSA 2VU3A 4ZTSA 3NYVA 3VHKA 4AA0A 2CGUA 3KGAA 3DFCB 4UMPA 3AC5A 4D58A 3PSDA 4Q2AA 3PP0A 4W8DA 3D4QA 3KXHA 3R2YA 2X2LA 3IS5A 4YPSA 4CZTA 1PHKA 2IVVA 4FSTA 2WMAA 3LFFA 2BZJA 5AX3A 4O0TA 2DQ7X 3EQIA 4P4CA 5AR7A 3DKFA 4YP8A 4FNZA 1GJOA 2EVAA 3ZRMA 4BDAA 2JLDA 2YWPA 3LFAA 3TL8A 4A07A 5E8WA 4D9TA 4ACHA 3PWYA 4R6VA 2HCKA 3ORNA 4I92A 3PXFA 1LR4A 5G1XA 5ICPA 5HU3A 3Q2JA 2W17A 2CLXA 4QMUA 4MNEA 3PXRA 2GS2A 5B7VA 4EHVA 4FEQA 3RHXA 3TNQB 5BUIA 3UVPA 4DITA 3WZDA 2JDVA 4RJ8A 1PY5A 4UYAA 3GCSA 4GVAA 4F9AA 1YXUA 4XMOA 1JKKA 3HEGA 3QX4A 4C4JA 3O0GA 4TPTA 3QTSA 2ITYA 1J1BA 3EL8A 3OP5A 3C4WA 3R04A 2HZNA 3F5GA 5A4QA 3BL9A 4ZJVA 4MWIA 3OCBA 1JKTA 4LOPA 5JRSA 4BHNA 1Q41A 4L01A 2YCQA 2PUPA 4M97A 3TI1A 1OITA 1OBDA 3DBFA 4MAOA 5KMIA 3UG2A 1DAWA 3AC1A 2B9IA 3I60A 5I9YA 3RM6A 3TACA 3CTQA 4E3CA 4ZY5A 2BILB 4M12A 5HORA 2C0IA 5DN3A 3T3UA 3CY2A 4U7ZA 4YLKA 3FY0A 3DZQA 5EOLA 1Q62A 3R9DA 2WMSA 1I09A 4YC8A 4G17A 1TQPA 5CSVA 4XV9A 3R8LA 2GHGA 5TKDA 4CRLA 4D1ZA 4JIAA 2BROA 4E7WA 2RFSA 4USFA 5HTBA 5GIPE 4JRVA 1FOTA 3K5UA 2RG5A 4D2VA 4JDHA 5AIRA 4DEGA 5KMMA 4I22A 4DEIA 5FM3A 4FE2A 3HVCA 3V8TA 3A60A 4DHZA 4JOAA 1M7QA 3U6IA 2XK8A 1TFFA 3Q60A 4BCPA 3EYGA 3W0SA 4F78A 4BCMA 3OWPA 4BHZA 2BDFA 3GQLA 1NT2A 3AT3A 2GFSA 1SM2A 3POZA 3R1SA 4YTHA 2JFLA 2RSVA 4YTIA 3Q9ZA 1H07A 3ZEPA 3BIZA 4LG4A 2PZ5A 4XHKB 3HA8A 4ITHA 2JDTA 5J5TA 2HZIA 4FT0A 4XRJA 1H08A 2HXLA 5AP1A 4M13A 1UKIA 1UU3A 1Q8WA 1WVWA 4HCTA 2YM6A 3QQLA 3KREA 5LVLA 3VBVA 3FL4A 4N0SA 2A2AA 3E3BX 3QRJA 2EUFB 4YUQA 2QOOA 1BI7A 4ITIA 1BYGA 4G31A 4W4XA 3PFYA 1WBOA 5EI6A 4EHZA 3GFWA 3CD3A 2X4FA 3HMPA 3VS6A 3UIBA 3IW7A 3T3VA 4DE4A 4RWJA 3SXRA 2WXVA 4EI4A 4FYOA 1S9JA 4GFMA 5ETFA 2HAKA 4S34A 5HE1A 4CXAA 4DBXA 3R7EA 3MGYA 5IA3A 4DEAA 2ETKA 2W9ZB 4L52A 5A4LA 5CU6A 1RW8A 2PTKA 2QHNA 2VO0A 2ZDUA 2I6LA 4QMZA 5CENA 2WNTA 2JBOA 5T6KA 3ATTA 2VTTA 4K2RA 4PDOA 5B2MA 4IVCA 5L8JA 1M2QA 4DGMA 3QD2B 3P4KA 4BB4A 1Q24A 3R8ZA 3TZMA 4X2NA 3IPHA 5CASA 3BU5A 3JR1A 4O81A 2JD5A 2Y6OA 3LXNA 4DH1A 5L3AA 4GFOA 3OS3A 2PE1A 2O5KA 1ZZ2A 4BCKA 2VNYA 2PVNA 2Y4PA 3SGCA 4TZRA 4TT7A 1H28A 4YZNA 4G3GA 4WKQA 2GCDA 3R8PA 4Z55A 1F3MC 2X39A 3LW0A 1AQ1A 3VQHA 3UNKA 2OF4A 4F6SA 3CP9A 3EZRA 4EOLA 4YU2A 5L2SA 4FG8A 5E9EA 4DEDA 3NW5A 4ANLA 4IVBA 3PUPA 4BDGA 1G5SA 1PYXA 3ZXZA 3GC9A 4O0XA 4FSZA 2BTRA 5HE3A 3E7OA 1OMWA 3AGMA 3QZGA 5DT0A 5ANOA 2BALA 5C27A 3BV3A 2W1CA 5IQDA 4GIHA 3EQBA 3W0PA 2W5HA 4ZMFA 4ZOGA 3NFFB 3LAUA 3GGFA 3KL8A 3HGKA 4IAIA 3HZTA 4R3RA 3HMNA 5GJGA 5A6NA 1CSNA 4PX6A 2B4SB 1CDKA 2E9NA 3OG7A 2RFNA 5DHJA 4IVDA 3LFQA 3LQ5A 4OTQA 5E4HA 1GIHA 2FSLX 3LFCA 2DWBA 5BUJA 4YBJA 4FKLA 3O5AA 3MFSA 4JG8A 4HW7A 4PRJA 5G6VA 5HG8A 3F2AA 2JKOA 3QTQA 5CLPA 3W1FA 3QXOA 3OWJA 3WILA 5LVPA 2JIVA 3UYSA 1U59A 4WRGA 3FSFA 3R00A 3VS4A 3O8UA 4FNWA 4IHPA 2VTAA 3VHEA 3VUGA 2C6IA 4IEBA 4CFUA 3RJCA 1KE5A 3MFTA 3OY3A 3UE4A 3VS7A 2YIRA 4JVGA 4XEYA 2UW8A 4ANSA 5FM2A 4PPCA 3QUEA 4GYGA 4RIYB 2PU8A 3E87A 3MTLA 4E5AX 4DCAA 1KUTA 3DS6A 5ITAA 2XKEA 4AT3A 4EK6A 4ZS4A 1KV1A 2IWIA 3E8NA 2BVAA 4PQNA 3I5ZA 4EKLA 1G8KA 3UJGA 5ACBC 4L8MA 3MVJA 3PVBA 2R3JA 5C1QB 3FBVA 3MB6A 5CYIA 5IZFA 4A9UA 1ZMWA 3QKMA 4L7SA 4UY9A 5CTPA 3ZO4A 2C6LA 5EQPA 4BBMA 2BFYA 4DCEA 3LFBA 3EHAA 3HDMA 3NNWA 5CAPA 2HENA 5KBRA 2QO7A 2AC5A 2BHEA 3SLSA 2XB7A 5HBJA 4CKRA 1KE6A 2JDRA