3W55A

The structure of erk2 in complex with fr148083
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
347
structure length
335
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Role of a cysteine residue in the active site of ERK and the MAPKK family
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 335
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3w55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w55A01
2Y6MA 3D5XA 4HNFA 2UZOA 3EQFA 2J51A 4JLCA 1OUKA 3ETAA 1YDSE 4ALVA 4GKIA 2OFUA 4GYGA 4KBCA 4CYIA 3FKNA 5K9IA 3R8LA 1VYWA 2WIHA 1JVPP 4XS2A 3DBCA 5IQIA 5CNOA 5ITAA 4P5ZA 4XNEA 4FG9A 3U54A 4OW8A 5AX3A 1XR1A 4WNKA 4GEOA 4MEDA 3GXLA 5M51A 4IC7A 2O5KA 4FUXA 4II5A 2PHKA 1JOWB 2PMIA 2YISA 5FP6A 3FXZA 3S3IA 2JFMA 3H0ZA 2W1HA 4YR8A 2QOLA 4I1ZA 5KNJA 4O7LA 2WNTA 4BY9E 1PMNA 1U54B 3QTZA 5CF5A 4ENXA 4TNDA 1W0XC 3NRMA 5FLFA 4NCTA 4PNKA 5BUIA 3UOJA 2GDOA 2R3NA 4Q9ZA 4O1PA 3DNDA 3TXOA 3E3BX 4GIHA 3TZ8A 4W4YA 4TYIA 4A7CA 3BGPA 2YM3A 4EHEA 3O51A 2XB7A 2HW6A 3R22A 1BKXA 4FICA 3BI6A 4EH9A 4ZLZA 2CDZA 4FKPA 4FZAB 4R3RA 3BCEA 3EN5A 4YZDA 3ZYAA 4I92A 4XG4A 4IIRA 2RFEA 3RK7A 3HMIA 4DITA 4CXAA 3CIKA 4A06A 4YJQA 3WF6A 2X8DA 3ODYX 3EN6A 4O0WA 4BCJA 5DLSA 3L9NA 3FZRA 4GJ3A 3COKA 3NUNA 4D2TA 5J95A 4QOXA 4CMOA 3R28A 4BDBA 3O8TA 5JFVA 1RJBA 2O65A 4D4YA 2ERKA 2XH5A 3RINA 2XIRA 4JOAA 4MQ2A 3S4QA 3QRJA 2HIWA 3VC4A 3QC4A 2V55A 4AT3A 1WBPA 5KX8A 3Q52A 2GTNA 1ZYJA 1UNHA 3AG9A 4L01A 5LCKA 1OKWA 1CKPA 3ANQA 4KB8A 5E7RA 3T3UA 3V04A 4ENYA 3W1FA 4UBAA 2W7XA 3UYSA 3ZM9A 4Q5EA 5LQFA 4MYGA 2CKOA 4F1MA 4Z55A 2ACXA 3BPRA 4CFUA 4KS8A 4FT3A 3W18A 3QCYA 4IE9A 3UVQA 2C5OA 3NEWA 4UWBA 4OBQA 4E4XA 3QTSA 1ZYDA 2XF0A 5K0KA 4QMWA 4PL3A 3CD8A 4IAAA 1YW2A 1LEWA 4TWPA 1M52A 3WF7A 3IG7A 2WTWA 4ZEGA 3PVBA 4KUJA 2C6OA 3VJNA 5AUUA 4D9TA 5AP4A 4XCUA 5CLPA 2BDFA 3RPVA 1UU8A 3C4FA 4KIQA 2XNNA 3B8RA 4YJSA 5IKWA 5EG3A 2I40A 4WA9A 3R7OA 2QG7A 4X21A 3H3CA 2WU6A 3I6UA 5AMNA 4AZSA 2IWIA 2VWXA 1XH9A 4ZTMA 4CFXA 1H26A 4IB0A 4O96A 2WQBA 4XYFA 2VN9A 3G51A 2Y8OA 4JG8A 1PMUA 4I21A 3LAUA 4AA5A 3F3TA 2KULA 2WOTA 4O1OA 1X8BA 3KRXA 4I0RA 3G5DA 4QYYA 4XP3A 3UIXA 4BHZA 5KBQA 2R7BA 3DBEA 3V5PA 1IEPA 4C61A 2O0UA 2H9VA 4EZ5A 3FSFA 5GZ9A 2OZAB 4GU6A 3A4PA 3TJCA 4EJ7A 4MX9A 4QP6A 2R5TA 1VYZA 2J9MA 3Q9ZA 4RIXB 3R83A 3TNPC 4D2RA 3VVHA 5IA0A 2JDOA 3PWYA 4RC4A 4CLIA 4EJNA 2VO3A 5KMOA 4QP2A 4S31A 3S1HA 4WKQA 4MXCA 3IW8A 3CQWA 4YHJA 4IZ5A 5HLNA 4IB5A 3I5ZA 3OUNB 5HE1A 2WXVA 2DUVA 3Q9YA 4HGEA 3SXRA 3VWAA 3CSVA 3ZHPC 4EHZA 5IDPA 2ITTA 5AUZA 4BF2A 4G1WA 5CASA 5JGBA 2Q83A 2FB8A 3OHTA 5J1VA 3N4UA 3VS3A 5K5XA 4HPTE 4I6BA 1WFCA 2XNMA 4FKOA 4FVRA 2UZBA 4UMRA 3KVXA 3LFQA 4X7QA 2C4GA 4FIEA 4GW8A 2GMXA 4TW9A 4IX4A 1JSTA 4YP8A 4LV8A 4WNOA 2ZYBA 2WTJA 3MIAA 2QR7A 3NGAA 3TG1A 4KBKA 1OPLA 1FGKA 4Q2AA 5HCXA 1J7IA 2WMQA 3OY3A 4FKWA 4IX5A 4PL5A 3FQHA 4EKLA 4G3CA 3C1XA 4QMOA 5DOSA 1MRYA 4XG8A 4O7SA 3QBNA 4NWMA 5AR5A 2CGXA 4AN2A 3AXWA 3JR1A 5CAPA 3A62A 5LWNA 2R3MA 3UIUA 3MGYA 1W98A 3QTWA 2ZV7A 5M4FA 3CEKA 1FBNA 3F5UA 4O7WA 4OBOA 5H9BA 5EHYA 3A4OX 4AW0A 4S2ZA 3QD4A 2G01A 2OW3A 4MXOA 4O7TA 4RJ3A 4TNBA 4LRJA 1URCA 4PDOA 1JQHA 4WO5A 5HVYA 3EL8A 4BDCA 3R04A 4FOCA 4ZJVA 4GUEA 1PHKA 4QPMA 4PWNA 4WSQA 3E88A 3OROA 3CCNA 2LAVA 4CZYB 4PTCA 1WZYA 1OIRA 3EFKA 3GU7A 4YLLA 3E7VA 4FMQA 2JKMA 3BBWA 3HZTA 1HOWA 1XWSA 2J7TA 1E1XA 5J1WA 2R0UA 2VV9A 5ANOA 3KXMA 4EZ7A 3E64A 3IQ7A 4QTBA 2OWBA 3RPOA 4C4JA 4CFFA 1ZAOA 4NSTA 4NKAA 4YNOA 2XIZA 1CM8A 1EH4A 1WBNA 3QWJA 5FM2A 5B2MA 5M06A 3G0FA 5BVKA 3V8TA 1Q41A 1SM2A 2DS1A 4B9DA 3SRVB 5DPVA 3LLTA 5C1QB 5ANGA 3DV3A 2BCJA 2CSNA 3GC7A 4ORKA 4U97A 3BLRA 4Y5QA 5E8UA 4DEHA 3HV4A 4CRLA 1MRVA 4PMPA 2PVHA 3TL8A 2X2KA 3L8PA 2W1FA 4HVIA 4UX9A 4O27B 2JGZA 1ZY5A 2E9VA 3PSBA 3RAKA 2HZ0A 5FXRA 1L8TA 4FGRA 3IS5A 2ZV8A 1LPUA 3EQHA 3FMKA 3DZOA 4NM3A 4A9RA 5CEKA 1OKZA 4HNIA 3C7QA 4ZTHA 3COHA 3KF4A 2Y0AA 4L6QA 3U6IA 4ASZA 2CGVA 2GS2A 3UO5A 5M55A 2VD5A 1ZYCA 1JPAA 5EHOA 3ZSIA 1O6LA 5KMKA 5DR6A 1O6YA 3E62A 1YI4A 3PJ8A 5D1JA 5L6OA 3TNWA 4C8BA 3E8DA 4IVCA 3NNUA 3LM0A 3BX5A 2QOKA 4U0IA 4KIKA 5C8KA 3CGOA 4D1XA 4X2FA 2P33A 2GTMA 4EH6A 3WYXA 5DFPA 1GZ8A 3PRIA 4TXCA 3HUCA 4QMZA 4CQGA 3R7YA 2ZMDA 4WUAA 4RGJA 4FTIA 1E1VA 5H8BA 1OGUA 4QNYA 3ZC5A 4XG7A 4AS0A 3TNHA 4ZSEA 2ITWA 5FTQA 2A4LA 5TOZA 1JSUA 3NNXA 5JK3A 1Q4LA 3UMXA 3DJ6A 3D5VA 4CZTA 3DDPA 2QO2A 4YURA 4CKIA 3CTHA 4LRMA 4DEDA 2QODA 4O21A 1OMWA 2JDTA 3UGCA 3UODA 3BHHA 2PYWA 1Q62A 2WMXA 2AC3A 2HENA 4UV0A 4QYGA 4FTMA 4EH8A 3HMPA 2OI4X 3WZDA 4FSMA 4EORA 2QKWB 2ERZE 3VF9A 4WG4A 4G2FA 4OBPA 3CJFA 4ZSJA 3PY3A 5IMEA 1GZOA 1GNGA 2W4JA 3UZRA 2UZLA 3TZ9A 2BKZA 2YM6A 3WYYA 4HYIA 4M0YA 1HCKA 1URWA 4DLIA 2EXCX 5L2IA 2C6EA 3AGLA 3GP0A 4F70A 4IAKA 4FKGA 5DEWA 2C6IA 1U5RA 2BTSA 2CKEA 5CI7A 1ND4A 4WNMA 5E8XA 4RWJA 3JUHA 2YZLA 2IVTA 3FI2A 4A9YA 4RJ7A 5LARA 3F2RA 2ZDTA 2XS0A 4R1VA 3HGKA 2OBJA 4UALA 5DEYA 2A27A 4XBUA 5IH4A 3S00A 3IONA 5AV3A 4EUUA 4LMUA 2OXYA 4RX8A 2BZKB 3EQCA 4Q9SA 3FJQE 4CD0A 4L53A 4I5PA 2B9JA 4U79A 4YTFA 4I6HA 3CE3A 2UZEA 3KGAA 4TWNA 1FVVA 2G9XA 5AM6A 4QT1A 3FZ1A 4O2PA 3P5KA 2PVNA 4CVAA 2X2MA 3D7TA 5IDNA 1U4DA 1YXUA 3SX9A 3BLHA 3BYVA 3EKKA 2HXLA 2GNGA 3I1AA 5I4NA 2XIKA 2QOQA 5EW8A 3BGQA 3R7GA 3MY5A 3TTJA 4AF3A 5HE2A 4NIFA 3V5JA 3ORPA 4MQ1A 3NYXA 3OCGA 1T46A 4G16A 4BZOA 4D2WA 3DU8A 5AP7A 4DGGA 5GINE 1STCE 5CTPA 4PTGA 3PG1A 2ZDUA 5FG8A 2GNIA 5EDRA 1H08A 3D5UA 1J91A 3R8ZA 4TY1A 4L8MA 2XRWA 3UVRA 3FQEA 3QLGA 2UVXA 3GBZA 4BICA 3QRTA 5BYLA 3OCSA 1XH7A 4U41A 3W8LA 5HCYA 4ONAA 3MESA 3EMGA 3QD3A 4AN3A 2I0YA 2PVRA 1F5QA 4H05A 2Z7SA 4AE9A 3QZHA 4ITJA 4B8LA 3OOGA 3OFMA 4JR3A 4O84A 3AC4A 1NW1A 4XLVA 4UY9A 3R2YA 4YC8A 1H27A 3IKAA 4UYNA 4O7YA 1H1PA 4W4WA 5CAOA 1KUTA 2QR8A 1PYXA 4QMVA 3S0OA 5CWZA 1AD5A 3F61A 4FNYA 2ZV2A 4E3CA 5TKDA 4G6OA 3FMJA 4M8TA 4QP7A 5CYIA 4M69A 4DG0E 3SVVA 1GIIA 2E9PA 3Q4UA 4JS8A 4H3PA 3FMNA 2UW9A 3DNEA 2BAQA 2PMNX 5F1ZA 4YC6A 4YTHA 1Y91A 5D9HA 5HE0A 5AP5A 5E8SA 3LCKA 5D41A 4ZY4A 1P14A 4XX9A 3DK3A 5HZNA 5AR4A 3LW0A 2V5QA 4FKJA 4QMQA 5JN2A 4FSTA 4FTUA 1BI7A 2EUFB 3QQKA 4FV7A 4DFLA 4BZNA 3Q6UA 4WBBB 3QQLA 3IW6A 4IWQA 3KCFA 1PY5A 3QTRA 1Q5KA 3CS9A 4NK9A 4BCQA 1OECA 3MBLA 4XG2A 4YLKA 4BR3A 2G2HA 3LQ3A 3D14A 5CSVA 2ONLA 2E9OA 2YJRA 4O22A 4FKIA 1WBSA 5HBHA 5C9CA 2PUIA 3NYNA 2ZB0A 3ZBFA 4P2KA 4TT7A 3ZSHA 4GCJA 3PZHA 4EK5A 1WAKA 2X0GA 3QQGA 2VWVA 3OWPA 2OXXA 4G3EA 3BU5A 3QQFA 4NU1A 1JSVA 1PJKA 3DBDA 2QU6A 4C4GA 4O0RA 4DFUA 3SV0A 4FA2A 3DLSA 2BILB 2XP2A 5E92A 4ZXTA 4BCKA 4O38A 1K9AA 1NVQA 5DVRA 1JNKA 4XH6A 4AAAA 3QKKA 4BBFA 3PWDA 4R7IA 1QPCA 4MNEA 2WKMA 3T9IA 2J5EA 2NP8A 4QQCA 3G15A 4FTNA 1WVWA 3O2MA 4KWPA 2FVDA 1H0WA 4I6QA 1K2PA 2F9GA 2UW3A 4O7RA 1VZOA 2BMCA 3R1YA 4FTKA 5AIKA 5HKMA 1H1RA 4KKEA 2IVVA 4NL0A 5C4LA 1W83A 4KSPA 3T8OA 2C6KA 5IEXA 2R64A 2W9FB 4L46A 1PKDA 2GNFA 4H58A 1KE6A 3Q32A 3R30A 3OEZA 4QMPA 4BIEA 4DEIA 3P4KA 4KA3A 3P7BA 1FPUA 3HV5A 4U43A 5ANKA 4AZVA 3ZSGA 2J5FA 3LJ1A 3FE3A 3NVMB 4PF4A 1YKRA 1G5SA 4J98A 3ZXTA 4IANA 3HYHA 4UWCA 3W8QA 3PXYA 3QALE 3FXWA 1IAHA 2W0JA 4RIYB 2UV2A 1Q24A 2W9ZB 4NCTC 4FTOA 2XVDA 3FI3A 2RL5A 2YZAA 2H8HA 3CC6A 4LGHA 5T6KA 4XHKB 4E8AA 2FSMX 4EK8A 3PLAE 3OVVA 2Y7JA 4KBAA 2GQSA 4EK4A 4F0FA 3NAYA 3IW5A 3HRFA 3N51A 3THBA 4AT5A 3V8WA 3NPCA 5A14A 3COIA 4W4XA 3W55A 1XBBA 5HVKA 1ZARA 5B7VA 2VX0A 3MH3A 3P78A 1YXSA 4NW6A 3OC1A 4TYEA 3PVWA 3RGFA 4DHFA 5EK7A 1Q99A 3ORNA 4I0TA 1ZOHA 2PE1A 3ZO3A 5IEYA 3ALOA 4G34A 4MNEB 3VUTA 3NDMA 1MQ4A 1FINA 1PXJA 3AD6A 3G0EA 5I9VA 2G2IA 2E9NA 2WMTA 2XBJA 4LOOA 4EBWA 3KRWA 5BVDA 4KSQA 5EKNA 3KL8A 1UKHA 2UZUE 4MBJA 4YJPA 4NFNA 3TNIA 3QQUA 4CKRA 5L2TA 3RI1A 3H9FA 1YVJA 3OXTA 4EH2A 1XH6A 4KIPA 3DXQA 4U7ZA 3R9OA 2YITA 3FY0A 4UZDA 2JDRA 3O50A 1YXVA 4OTFA 5E90A 1V1KA 3R7EA 5CU3A 3QA0A 3UNZA 2X39A 4HYSA 2P55A 2Y4PA 3LCOA 5KHWA 3UIBA 4GYIA 4L7SA 4LGDA 3C13A 4JX3A 2C5YA 4XV3A 5EYDA 4ZY6A 3DQXA 1ZMWA 3C9WA 3VS4A 4C38A 4C3RA 2PZRA 1WMKA 4EH4A 1LUFA 4DH3A 3RPYA 4I4FA 4YJVA 2GHMA 1R39A 3O8PA 2W05A 2GNLA 2UZTA 4D58A 4YHTA 5BUEA 1SVHA 2XKCA 4QP8A 3V5WA 4B8MA 4OTRA 2XJ0A 2VTTA 4HYHA 3QXOA 3NR9A 5EDPA 3OWJA 2CKPA 4ZMEA 4F08A 3KMUA 3EJ1A 4RQVA 3HMOA 5LVOA 2J4ZA 4G9CA 4G6NA 5FD2A 2IW6A 2JLDA 2RF9A 3D5WA 5HNBA 1Z9XA 3AT3A 3EZRA 3O17A 3FMEA 3FI4A 2IVUA 4EC9A 2WPAA 3AQVA 1BLXA 3FYKX 3ZRMA 3H4JA 5CX9A 3I4BA 3PFQA 1ZOEA 2WMUA 2DWBA 1M7NA 3F69A 4DTBA 3EHAA 5D10A 4FKUA 3MB6A 4AZWA 2C6TA 3ZFMA 3OWLA 4R3CA 5CEIA 4FIFA 1K3AA 3AOXA 4MD9E 2WHBA 2B53A 2YCFA 3TV6A 4A9SA 4PP7A 5GJFA 1DM2A 4APPA 3HKOA 3D2KA 3PSCA 3UNKA 2BRGA 4YSMA 3RAIA 3RAWA 4QP3A 1DAWA 2YJSA 5HTBA 5LCJA 4O6LA 1Q8UA 3VBQA 5AAEA 3JS2A 5HEZA 5EKOA 3KQ7A 1S9JA 2I6LA 4FNXA 5LMAA 3IO7A 2YDJA 3F66A 4D55A 4QMNA 5L8JA 3VUHA 3MFSA 4AN9A 3VAPA 5DE2A 4CG8A 4YZCA 3OP5A 2VTLA 5JRQA 2BFYA 3SGCA 5GIPE 2GCDA 3FYJX 4IJPA 3KC3A 4AU8A 3JVSA 1OKYA 4BTMA 3LLAA 2W4OA 4YJNA 3VUIA 4NFMA 3O23A 4EH5A 3AT4A 4B6LA 3R8VA 3UPXA 3FZSA 3L8XA 4GK4A 2H6DA 2WMRA 3MSSA 4YLJA 4RJ6A 3K54A 4X6RA 4C2WA 4O81A 4IX6A 4CG9A 4X3JA 2YIWA 4IWOA 4DCAA 3BHYA 3E92A 3CPBA 3GC0A 2UW0A 3HV6A 3BHVA 3PPZA 3Q6WA 3QCQA 3Q5ZA 4RA4A 3BGZA 5EI2A 2W17A 2YHVA 3EYHA 2OSCA 3I6WA 4I20A 3UJGA 1P4OA 3KEXA 4FIIA 2PUPA 4F0IA 4DAWA 3COMA 4ASEA 5KHXA 5M4IA 3HA6A 1XH8A 4FODA 2XCKA 4ZMFA 3ACJA 3QQJA 4CFMA 4J53A 3KXHA 2OH4A 2P3GX 4YJOA 4JQ7A 4I4EA 4FG8A 5FEDA 3LXPA 2ETRA 2C6DA 2CHLA 2R2PA 5HCZA 2BAJA 4BWPA 5CT7A 2OH0E 2R3OA 3A7IA 1SYKA 2JITA 4E6QA 4ZSGA 1GZKA 2YCSA 5DR2A 1NA7A 3TZMA 1E9HA 2I0VA 2R9SA 3CP9A 4ZP5A 4JBQA 5FRIA 3KFAA 4FZFB 4BDGA 3EIDA 2WQMA 2X7FA 3MJ1A 4DYMA 4JDKA 3W16A 1NY3A 5BMSA 4XG6A 5E1EA 1BL7A 3TKIA 4A07A 4C37A 2G1TA 4JDIA 5C8MA 4IAZA 2OF2A 3S2PA 4EI4A 2F4JA 2I1MA 1Y6AA 2GHLA 3VO3A 4ZSLA 5IU2A 3BHTA 1UU7A 4PQNA 2CN5A 2B0QA 5AP6A 3UZTA 4K11A 4CYJA 3CR0A 3NUAA 5AUWA 4U3YA 4X6QC 1Q8TA 2BHEA 4MNFA 3R1NA 3TKHA 5H8EA 3WZUA 4O91A 4F7SA 4I5CA 2FO0A 2XRUA 2R7IA 2UZDA 3L9LA 4Z9LA 3BYSA 3C4XA 5KZ0A 1OM1A 2GQGA 3JXWA 2BIYA 2HW7A 2CLQA 2VTRA 1REKA 5AV1A 4O82A 5H8GA 4EOOA 1YHSA 4QPAA 4PY1A 2WIPA 3ZO1A 2VTQA 1TQIA 5IQCA 4BDJA 3AC2A 3VUMA 3WBLA 4ANQA 5HD7A 2Y4IC 1SMHA 4NH1A 5IPJA 2X4ZA 3KXGA 3PA3A 3WILA 4QTCA 3UDBA 1KE7A 2IPXA 2YACA 3UE4A 1Y8GA 5IISA 4J52A 3AMAA 4KABA 3L8SA 3U4UA 4OT6A 4CT1A 2CNQA 5BPYA 3MFUA 1OKVA 2YDKA 5D12A 4FV0A 4J1RA 2BZIB 2QKRA 3KULA 2PZ5A 5EYMA 3MW1A 4NM7A 5E8ZA 3JY0A 4RFMA 5FXSA 3DKCA 4DGLC 5FDPA 4MH7A 3HP2A 4BDDA 1RQQA 3FZPA 2RGPA 5ANEA 3ZOSA 2UW8A 5GNKA 4YO6A 5BQ0A 3G6GA 4O6EA 4FKRA 4ZAUA 3KMWA 4AW5A 1A9UA 4JIAA 2HELA 2J90A 3KKVA 3RM7A 4AZEA 5A4TA 2R3RA 4I6FA 2PE2A 1H24A 2Z7QA 4L45A 3PLSA 4MXAA 4YPSA 4BTJA 1Q61A 3OT8A 4PDYA 5CY3A 5HG9A 3QYZA 4BRXA 1UWHA 4IEBA 4YPDA 4Z16A 4IVBA 3CTQA 1VJYA 2PZIA 5JMSA 2EB2A 4FZDB 3K3JA 5L2SA 1KE8A 2G15A 2JD5A 2RKUA 2X81A 2Z7LA 3IDCA 4RQKA 3SC1A 4BDFA 2Z2WA 1W8CA 2JBPA 2XYUA 1OITA 3A7JA 1PKGA 4ID7A 3F3WA 4Y72A 4FF8A 4RLKA 1F0QA 2WMBA 1UWJA 2H34A 2W1DA 3H30A 4ZLYA 2X6DA 3TUDA 1XBCA 3QCXA 4KD1A 4O7ZA 3NUUA 2O3PA 1QPEA 3PY1A 4K2RA 2PVYA 5CF8A 3BE9A 4QD6A 4JR7A 4G6LA 3P1AA 4RWLA 4BTKA 1IR3A 3BIZA 5DRBA 4DH8A 5CU4A 3IW4A 3D83A 4I41A 4MWIA 1CSNA 1KE5A 2WMAA 3KN6A 2OICA 4X3FA 3FPQA 4Y8DA 4MXZA 2DQ7X 5F20A 2W1ZA 4I5HA 4IAIA 3E8EA 1PXPA 1YQJA 3AMYA 5A46A 1H1WA 1YXTA 4G5JA 2GHGA 3UC3A 3W32A 3CKWA 3DKFA 3SD0A 3O0GA 4QTAA 3TT0A 4LRKA 3VBXA 3TDWA 1R1WA 1ZZ2A 4D0XA 1ZY4A 3UBDA 4ZZOA 2WQEA 4G3GA 4RX5A 4KKGA 3RTPA 3SXSA 5J7HA 1TKIA 4LV5A 5K4IA 5M53A 3BLQA 4Z3VA 3E3PA 1OPKA 2BFXA 2WQOA 3DA6A 3DAEA 2OKRA 3GT8A 4GFGA 3HEGA 4HCUA 2YIYA 1VEBA 4C0TA 2QVSE 3DPKA 4ZLOA 3PXKA 4ZS4A 2F57A 4XUFA 4ZS0A 3GUBA 4F6WA 5IF1A 2R0IA 2VO7A 3LCDA 5AJQA 1QPJA 3SKCA 4CV9A 3MVHA 1YDRE 3PJ2A 4FT7A 3UP2A 4GFOA 3GNIB 4I94A 3VUDA 2XBAA 4BKZA 2PMLX 5E8YA 1V0BA 5ACKA 4BB4A 4FEUA 1KOBA 2F7XE 3CD3A 3UP7A 2PZYA 4O0TA 3LJ2A 5FTOA 4JNWA 5A4EA 1FMKA 4O0YA 3E7OA 4YGAA 3FKLA 2PVLA 4RWIA 4TKSA 3I7BA 5DT0A 1JLUE 2UW4A 3ORKA 4XP0A 1TVOA 1IASA 2C5VA 1FOTA 2UW5A 2BUJA 4QNAA 4F09A 4K18A 2R3IA 5EOBA 5IUGA 5IQHA 2VWWA 3P7AA 3MH1A 4U9AA 4X3FB 3QAME 3DAJA 5EM8A 4M66A 2XCHA 3JVRA 5BYZA 3W2OA 5BVOA 2JDSA 1KSWA 2WOUA 3C5UA 3KRRA 5CU0A 3LKMA 3PPKA 4DE4A 1FVTA 3OBJA 2C0OA 3PIZA 4WIHA 4BKJA 5KMLA 4USEA 2NPQA 3V5TA 4EUTA 3QHWA 3NUYA 4KIOA 5HI2A 4O0VA 4QP9A 5JZJA 2E9UA 5TE0A 4FI1A 3AC3A 4HPUE 3PE2A 3M42A 3MWUA 4JRNA 4YZNA 5CEQA 2C68A 3VW6A 4ACDA 2WMVA 4B99A 1MP8A 4DEAA 1Q3DA 3RJCA 4EQMA 4J99A 1Y8YA 3ORTA 4ACCA 4QYHA 2VRXA 3MFTA 4UB7A 4YHFA 1JAMA 2R3GA 2OK1A 4ZZMA 4PX6A 4EYJA 4L00A 4XLIA 4RX7A 4CKJA 2WZJA 3A61A 4LFIA 2OIDA 4KS7A 4BCNA 1SNXA 4E6AA 5JH6A 3DFAA 2ONLC 4QYEA 4RJ8A 4EOPA 3LFAA 4MAOA 4U81A 3VS7A 4RMZA 5CSXA 2VTHA 2C0TA 4TTHB 3NNVA 4XOYA 5CU2A 3TNQB 4BCMA 2XIYA 2C1BA 3NS9A 2XK4A 3E63A 1G8SA 3F2AA 3ATSA 3KK9A 4WD5A 3N4VA 3A8WA 3P08A 5FQDC 1XH5A 1Y57A 2RFSA 4LI5A 4LYNA 3OD6X 1DI8A 1OL7A 3V5QA 3FC2A 3KXXA 4AOJA 4UMUA 5CEOA 2ETMA 5E8VA 2OZOA 3FZTA 4JBPA 4KAOA 4LMNA 4L68A 2ITVA 3VF8A 3FDNA 3ORZA 3Q9XA 3DTCA 4R1YA 5CI6A 4FT0A 3OTVA 4FOBA 4L3JA 2V0DA 5FXQA 4RT7A 4GG7A 2JBOA 4ZTSA 3WF5A 3JYAA 5A4QA 4A4XA 2EU9A 3LIJA 3SOCA 3QA8A 3GFEA 3F3VA 5IQFA 1GY3A 3AD5A 3PUPA 4H1MA 2PUUA 2XEZA 4RZWA 4JQ8A 4O7VA 3I79A 3Q96A 3RP9A 3WE4A 4OT5A 2XK9A 1QPDA 4ZTQA 1W84A 4AA4A 2IZSA 5D7AA 4D5HA 4XG3A 3UQGA 2KTYA 4O0SA 5EH0A 4M3QA 4DEBA 2Y4IB 5CT0A 3C50A 4IDTA 3K5VA 3PVGA 2YERA 5AUVA 4IADA 3SXFA 3UC4A 2NNWB 4OTPA 2Z60A 4YO4A 5ANJA 3PRFA 4R7BA 1IRKA 4H1JA 3IOKA 4LUEA 3MA6A 5CEMA 2F2CB 5E91A 2HWPA 2XK6A 3TV4A 4KRCA 2Q0BA 2X9FA 3QZIA 2CCHA 2YLEA 2BPMA 4GV1A 3VHEA 2GFCA 3ZTXA 4DCEA 3D15A 4KIKB 1FGIA 2GNHA 4BTFA 5E4HA 4GUBA 2BZJA 3I5NA 3MN3A 4HCVA 4P90A 3TV7A 5I5ZA 4BI2A 3D4QA 4IFCA 4E4LA 3PIYA 5E9EA 3LMGA 2QHNA 4PMSA 4J8MA 4L52A 2C47A 5IQDA 3R21A 4ERWA 4OTGA 2X1NA 4BBMA 3BBTB 4CRSA 4I22A 4C36A 3CBLA 5CQUA 4F9BA 3D7ZA 4DC2A 4WG5A 1MQBA 3HP5A 3L9MA 2YABA 4IHPA 1APME 4R6VA 1B38A 4BGHA 1M2QA 4BDIA 3C5IA 2PY3A 3BYMA 3NSZA 4GG5A 4Y95A 1M14A 3QFVA 4N4SA 4L7FA 3W2RA 5EW9A 4TYHA 5L2WA 4BL1A 2FA2A 3CJGA 2HZIA 3F5GA 4LOPA 3TN8A 3R71A 3R7IA 3H10A 4K1BA 4C4IA 3PJ3A 4EWQA 4RIOA 2W4KA 4BI0A 3Q2JA 4FSWA 1RW8A 3RK9A 5TF9A 4CV8A 4E4MA 4YNEA 4BWKA 4G3DA 1OL5A 2JAVA 3ELJA 4IDVA 5DRDA 3C4ZA 5F95A 3Q9WA 3KRLA 3DXNA 5CXHA 3ZONA 2F2UA 4EH7A 2VTPA 2YLFA 3A2CA 1WBWA 3QD2B 2PPQA 1O9UA 5L8LA 3CQEA 2ZM3A 1UNLA 4P5QA 3BV2A 1KOAA 4IWPA 4PP9A 4F1OA 5I9WA 2QO9A 1ZLTA 2C30A 2VGOA 4M0ZA 3C4CA 5BVFA 2VWUA 4Z7HA 3BU3A 5HO7A 4BVUA 4RLLA 3BQRA 4EEVA 5BUJA 5T68A 3Q2MA 3RZBA 4FUYA 3ALNA 3CPCA 3POOA 3A7GA 4NM0A 4G3FA 3OBGA 5BNJA 3SLSA 3CLYA 3KU2A 2UVYA 4XV9A 2W1GA 4ANOA 1PXKA 4IBMA 4TYJA 4TPTA 4KKHA 1YXXA 3QTIA 4AUAA 2YM8A 3DS6A 3D7TB 2XEYA 4FNZA 2ZM1A 2QG5A 4RA5A 3ORIA 3GB2A 4C62A 3EQDA 5AA9A 4FSRA 4B4LA 5AADA 2YEXA 3U87A 4C34A 5L6WL 3TUBA 1H28A 2I0HA 3EOCA 4EOQA 4E5BA 2XJ1A 4NIFB 5DR9A 1YDTE 4D2VA 3WIGA 5JKGA 2IZUA 4TYHB 4GT3A 4QRCA 4YZ9A 1XHAA 3P79A 2ITUA 3HX4A 3NLBA 3ZM4A 2ITNA 4JXFA 1BUHA 1O6KA 2V62A 3DFCB 4RPVA 5DWRA 3GU6A 4G5PA 2B54A 4TL0A 5AX9A 3REPA 2NRUA 1VR2A 4OTQA 4CCBA 5A54A 4C35A 4WG3A 4U80A 5IA2A 1LP4A 4RIWA 2PZPA 2XK3A 3D0EA 4AOTA 5EDQA 1OVEA 4C57A 3V6RA 3K3IA 4C58A 1B6CB 3P7CA 1M2RA 4NZWB 4MF0A 4EK6A 5HU3A 1BMKA 3G33A 5CAVA 5FTGA 4L3LA 5KZIA 3H0YA 4DFYA 3BYUA 3NZ0A 4FKQA 2ZB1A 2DYLA 4M69B 3R9NA 5AAGA 5D11A 3RWQA 3QWKA 3FMHA 3FHIA 5ETAA 2VX3A 2WMWA 3R01A 4MCVA 1V0PA 3KREA 3HL7A 3ZLYA 4RVKA 4FTQA 5CSWA 4D4SA 1KWPA 2H96A 2Y9QA 2J0IA 5M07A 4QMLA 4ASDA 4IH8A 2I7QA 3MH0A 3KRJA 4DBXA 3QKMA 5LVLA 4FKVA 2BDWA 2C3LA 4V01A 4ACGA 3TIZA 2YM4A 3QZFA 4OTDA 1OUYA 4DINA 2O8YA 4G17A 4DT8A 1DAYA 4FIHA 3F5XA 3GU5A 2V7AA 3ZDUA 4ZJJA 3VIDA 4BCPA 2WGJA 4HVHA 1W82A 3PP0A 5KCVA 3PYYA 3P9JA 3F9NA 4HGSA 5AR2A 3RPRA 4MBLA 1JKSA 5IZFA 2QOCA 3LM5A 3P0MA 3U51A 5EQEA 2BZHB 5I9ZA 1JKKA 4XJ0A 3VQUA 2PWLA 1GJOA 3LFFA 2WQNA 4N6YA 3RHKA 4JDJA 3Q4TA 4TWOA 4RIWB 5HNIX 4EOLA 4U8ZA 5EM7A 2V22A 4YBKA 3TUCA 1H25A 1SVGA 2SRCA 4ZY5A 2B4SB 1M2PA 4IXPA 4K77A 2YIQA 3KMMA 3PP1A 4MKCA 3MTLA 1JKTA 2CKQA 5EYCA 4L43A 3FPMA 3KB7A 4PV0A 4W9WA 4E7WA 1YWRA 4IACA 3RKBA 4AGWA 4TN6A 4C4EA 1XKKA 5IH6A 4BYJA 4ZIMA 5M09A 2QO7A 3ZFXA 1U59A 4QMXA 4AOIA 3EFJA 4JG6A 3TDVA 3IGOA 2GS6A 3N4TA 4A9TA 4F9YA 3O7LD 5IQBA 1PMEA 4ZTLA 3EYGA 3QUDA 5CVFA 5DNRA 4ANNA 4DH7A 3R9RA 1YRPA 4PPBA 4Y73A 3R7UA 3T9TA 4FR4A 2VTNA 3QYWA 3FMMA 1WBOA 3PJCA 4BCIA 2CGWA 2XYNA 3MH2A 2GPHA 5DH3A 2YWVA 3R1SA 3RAHA 2X2LA 5JQ8A 4CNHA 3W10A 3Q4CA 4AACA 5M4CA 3UG2A 3NMUF 1H1QA 3C4WA 3TM0A 3E8CA 5C4KA 1ZXEA 3NX8A 3ZU7A 4ARKA 2YM7A 3MB7A 2EXEA 4DGMA 3LPBA 3CQUA 4J7BA 2FSOX 4G31A 2VWYA 4U3ZA 2UZVA 4YTIA 3F3UA 3CTJA 2PL0A 2JEDA 4BZDA 4D2PA 5LJJA 5L3AA 4GJ2A 3MIYA 2W1EA 4AA0A 4XOZA 3IECA 3RNIA 4CMTA 4CT2A 1PXLA 1V0OA 2W5AA 2WTVA 3PA4A 4D28A 3HAMA 4ZSAA 3F7ZA 4YTCA 4GK3A 4QP4A 5ANDA 3ZO4A 5LOHA 4M97A 3SW7A 2F49A 3EQGA 3LZBA 3EN7A 4FNWA 2QQ7A 4AP7A 1OBGA 2OIBA 2Z02A 4EWHA 3GEQA 2J50A 3DAKA 3QXPA 4A4OA 3ODZX 1ZWSA 4HJOA 4JI9A 5CZHA 3R02A 2NO3A 3FHRA 4WUNA 3II5A 5G1XA 3SOAA 4W8EA 4C02A 2BHHA 3DKOA 2IO6A 2VTMA 2VNYA 4JVGA 2XKFA 4FK3A 2C3IB 4WRGA 5C03A 3MFRA 3GOKA 2CPKE 2XJ2A 5FUTA 4XV2A 4KINA 2LGCA 1UA2A 4C4FA 4G9RA 2CN8A 1J7UA 2YIRA 3HNGA 3BQCA 1SZMA 3NCZA 2BAKA 3IW7A 4FL1A 4TWCA 5HNGA 3GVUA 5B2KA 2CCIA 3NW7A 4C7TA 1I44A 4XMOA 4MWHA 3EN9A 3TWJA 4BYIA 4BHNA 3ATTA 4D2SA 2R3LA 3OW4A 3UQCA 2CMWA 2ZV9A 3F5PA 5IEVA 3GQIA 1OZ1A 3LXLA 4XG9A 5BVEA 2VWZA 5M4UA 2R3JA 3UG1A 5EQPA 4X3FC 3QCSA 4RJ5A 1G3NA 4HVSA 4IB3A 4FYNA 3DLZA 3BRBA 4ZZNA 3DOGA 4C33A 4AX8A 3SW4A 1BL6A 2VTSA 3FKOA 3P86A 3KY2A 2CNVA 3FC1X 3BKBA 3HECA 1UNGA 4U5JA 2JKKA 2UUEA 3HV7A 3IK3A 5ANIA 5J87A 3ZEWA 2X8EA 1U54A 5A9UA 2J0KA 3GFWA 3L1SA 5AR8A 4I24A 3AC8A 2WAJA 3MPTA 4EC8A 2WTCA 1PF8A 4QMTA 2X4FA 3HA8A 3NUXA 5D7VA 3FUPA 2B9FA 2C6MA 4BCFA 3LFCA 3EQPA 4X2JA 5E8WA 3VJOA 1OBDA 1UU3A 4RC2A 3ERKA 3LQ5A 2RFNA 5HORA 1YOJA 1J3HA 3N9XA 3I60A 3R2BA 4Q5HA 1H0VA 1OI9A 2R4BA 5K4JA 3BV3A 3U6JA 4FV4A 5J5SA 1GIJA 2PVFA 3DB8A 3A7FA 5AUYA 3RWPA 4UZHA 4DFBA 2W99B 5IMXA 2C3JA 2VAGA 3PXFA 2E2BA 4NT4A 3ROCA 4FV1A 4GRBA 4ZOGA 1YOMA 5EFQA 5HVJA 3E5AA 2RFDA 4FVQA 4B0GA 2XIXA 4FL3A 3TJDA 3QGWA 4BC6A 4E5AX 2X7GA 1MRUA 4FG7A 3DT1A 3QTUA 4OLIA 4DEGA 3QC9A 2VU3A 3IGGA 4JAJA 3ZLXA 1H4LA 5LMKA 2X9EA 2VWBA 3NAXA 3SG8A 1OL6A 4FV3A 4YJRA 2XNOA 5BYYA 4LG4A 1AGWA 4EOIA 2QURA 4AQCA 4CMUA 3V5LA 4UMPA 4CFNA 3R1QA 4UEUA 3HDNA 2IVSA 3GGFA 4R8QA 2PE0A 2QOIA 1TQMA 3A7HA 3FLYA 3UNJA 3DXPA 4Y83A 4GT5A 4FEXA 5J7BA 4A9UA 1XH4A 2HZ4A 2RG5A 3PVUA 2X6EA 1UV5A 2OIQA 2YAKA 5I3RA 4PUZA 5DYJA 3RM6A 4IC8A 3VN9A 4NTTA 2C3KA 4JQEA 5HG8A 2WB8A 2VX1A 3MY1A 4ALUA 3QRKA 4M68A 1Q8ZA 1OL2A 3UPZA 1TQPA 4CZUA 4XBRA 2HZNA 2J0LA 3QLFA 4GU9A 4WBOA 3GCUA 4ZJIA 2OJGA 3QTQA 4PDSA 5FP5A 2OGVA 4P4CA 1FVRA 3HMNA 4W8DA 4IM3A 3WF9A 4F64A 4FTAA 4HGTA 1T45A 4F6UA 3DK6A 4N6ZA 3C0GA 2C6LA 4FT9A 2XZSA 3VRYA 2OF4A 1KV1A 2Z8CA 3E8NA 3OXZA 2HY0A 3F3ZA 2OJJA 3QKLA 5HIDA 5JSMA 4BKYA 2UZWE 3WZKA 4DLJA 4EOKA 4MXYA 5GJGA 2AUHA 4NW5A 3NYVA 5GIOE 4S34A 1JKLA 2VUWA 4U6RA 4L3PA 1I09A 5ETCA 3TCPA 2XNGA 3NW5A 3UVPA 4AFJA 3ZRKA 2OZAA 5AUXA 4CGAA 5A3XA 3EQIA 2A19B 4HOKA 3GI3A 5HD4A 4UXLA 3ZH8A 3HMMA 3VNTA 4RIXA 4E1ZA 4AFEA 3W33A 3MI9A 4EYMA 3FEGA 5IQGA 4QTDA 3RNYA 3FWQA 4F63A 1OB3A 5A4CA 1ZRZA 3LVPA 3F82A 4RFYA 3ET7A 4ANMA 2EWAA 2GSFA 2A1AB 2JIUA 2VTOA 3ZLWA 5G6VA 4E4NA 1UU9A 3OW3A 2ZOQA 3OWKA 5CAQA 1OIYA 5AAFA 1J1BA 4AZFA 4FSUA 2I0EA 2VTJA 3F2NA 3FXXA 1UKIA 4HZSA 1IA8A 3VRZA 2AC5A 4H36A 3HRBA 3RCJA 4ZTRA 2JFLA 2Z7RA 4MHAA 3SG9A 5L2QA 4FE2A 4RWKA 3S95A 1U5QA 2HCKA 3FZOA 3IPHA 5IA5A 1Z5MA 3WE8A 2FUMA 4V0GA 3ZC6A 5KKRC 4BCGA 1PXMA 2CNUA 3MV5A 4X2KA 4MD8E 4LM5A 4YBJA 4EH3A 4I5MA 4R5SA 3Q4ZA 5CXZA 3DBQA 4FTCA 3KULB 4DEEA 4R77A 3I7CA 4MVFA 2VO6A 4NKSA 4PPCA 2YWPA 4H3QA 4RBLA 2WD1A 3GU4A 1H1SA 3QUEA 3ANRA 4BN1A 4F1TA 3ACKA 2J2IB 4AGDA 1YHWA 4HCTA 3MPMA 1XBAA 4N57A 2VWIA 4R7HA 5EHLA 4E5WA 5DBXA 2WMSA 5C26A 1ZOGA 2GS7A 3BELA 2YCRA 4FX3A 5B2LA 5IH5A 5TO8A 4N70A 4PDPA 4C59A 2QLQA 4FK6A 4UMQA 5HBJA 2W5BA 1NT2A 2UW6A 5CF6A 5EOLA 5KBRA 1S9IA 3C4EA 2BIKB 3LE6A 4IFGA 1LEZA 2F7EE 3O96A 3A60A 2O63A 3VBVA 4D0WA 4ZTNA 2FGIA 3GC8A 1RE8A 3EL7A 4DN5A 3VS2A 1HCLA 4QPSA 1PXOA 3C0IA 4XEYA 1MUOA 3ENHA 4NJDA 4IM2A 1Z57A 3BWFA 4CTCA 2ZM4A 5GHVA 5H2UA 4GVAA 3ZCLA 5J9ZA 3QU0A 3PE1A 4HVDA 1FMOE 4X2NA 2C69A 5J79A 3U55A 2O2UA 5C27A 3DGKA 5FBNC 4GKHA 4V0GB 3POZA 4FZ6A 4L44A 4F99A 2JAMA 3G2FA 1H07A 3QRIA 4EONA 4EK3A 4HVGA 2JC6A 1QMZA 2OJIA 2WTIA 3SRVA 3BHUA 4FC0A 4M84A 1YWVA 2YAAA 4ACHA 4AGCA 3ID6C 4JIKA 4BBEA 4CLJA 4K6ZA 2G2FA 2WELA 5HG7A 1PXIA 4F9AA 3DCVA 5HIBA 3U8WA 2OG8A 5HBEA 1GIHA 2OFVA 4EHGA 2IN6A 3KN5A 1QL6A 1PMVA 3LFNA 1W7HA 1WBVA 3ORLA 4IWDA 1ZYLA 5E1SA 2A0CX 3PY0A 5C01A 5IUHA 4BGGA 5AP0A 1YI6A 2YA9A 2ITXA 1YHVA 5ACBC 4FEVA 1SNUA 1U46A 3OZ6A 5E8TA 3KXZA 4IAYA 5I3OA 2WEVA 4UN0C 3VHKA 4EBVA 3HRCA 3DQWA 3NIZA 3QTXA 2IJMA 4M14A 2GFSA 4I93A 5TT7A 5M08A 2VTIA 3ZZWA 4JX7A 2ITOA 3UOKA 3GCPA 5JRSA 3OEFX 3V3VA 3UYTA 3ZUVA 3NYOA 4AXAA 2ITYA 5K0XA 5M56A 3DJ7A 4AG8A 2UVZA 5EQYA 2IW8A 4C2VA 4QQ5A 3ZDIA 4QQJA 4EQUA 3VS5A 3HV3A 4JBOA 4FYOA 4W9XA 4DG2E 1DI9A 1WVYA 4FBXA 2BRNA 4UMTA 5CS6A 4IQ6A 5CANA 4N0SA 4RZVA 4DG3E 4RVLA 4DGNA 4ERKA 4OAVB 4PTEA 3TIYA 4FSNA 3U4WA 5FBOA 1FQ1B 1BX6A 2BALA 1WVXA 2BTRA 2GNJA 4F65A 1ZYSA 4WRSA 2W5HA 2X7OA 2Y6OA 3DZQA 1UVRA 2R3HA 1DS5A 3LCTA 3W2QA 4EOMA 4QQTA 4DF3A 3GENA 1JBPE 3RBWA 3DB6A 3WF8A 4F7NA 5I9XA 2IW9A 4MK0A 4PPAA 3TACA 1M7QA 4ANBA 5AP3A 2OJ9A 1CKIA 5ETIA 3ZO2A 2ZMCA 3DKGA 3LFBA 3QHRA 3TI1A 4DA5A 3ZRLA 2PTKA 3KVWA 2PVMA 1GZNA 3E93A 5IA3A 3MS9A 4FT5A 2HY81 5DGZA 1REJA 3V01A 3SQQA 4WT6A 3DK7A 4FSYA 4JJRA 5T3QA 1B39A 5JZNA 3RHXA 3RPSA 5C8NA 2B7AA 3ITZA 4FL2A 2QOFA 3BEAA 1OIUA 3AT2A 4FKSA 1XQZA 3EH9A 3QUPA 3UOHA 3WIKA 3OMVA 2BVAA 5FDXA 3ZUTA 4BDAA 3JPVA 4FIGA 2QOOA 3KCKA 3O7LB 3ORMA 2W96B 4S32A 3UIMA 4AW1A 4FKLA 5KE0A 5DMZA 4CFVA 2ETKA 5DT4A 4I3ZA 2R3KA 4MTAA 4IAFA 1PXNA 5L8KA 2P2HA 3R9DA 1OPJA 2QOHA 3LXNA 3OY1A 4ITIA 3UO6A 4YUQA 4H3BA 3WZJA 2JDVA 4FIJA 3EN4A 4K9YA 1ERKA 4DFNA 2J0MB 1Q8WA 1CMKE 4JG7A 4IVAA 5M44A 4JL9A 2JKQA 3MA3A 3RALA 3LFEA 3FL4A 4GS6A 4XRJA 3Q5IA 3RMFA 2ESMA 2VNWA 3OCTA 2AYPA 4R78A 4O83A 1NVRA 4HZRA 2PULA 3PJ1A 5JFXA 3ULZA 1GAGA 2UW7A 2REIA 3TEIA 4EL9A 4PL4A 4U44A 3FSKA 4M67A 4U42A 2IG7A 3EWHA 4XRLA 1G8AA 2FSTX 5JEBA 3R8MA 5CEPA 4APCA 3PXZA 1YWNA 4TYGA 4MXXA 4NM5A 4LL5A 2OJFE 3ZXZA 2QOBA 1A48A 3FV8A 5CF4A 5BVNA 3K5UA 3FI8A 2C0IA 4M15A 2ZAZA 2FH9A 3NWWA 4P7EA 5CVGA 3NW6A 5KMIA 5AIRA 5JGAA 3I0OA 3D9VA 4FV6A 5HO8A 4D1SA 5EW3A 3FLZA 3EKNA 4IZYA 5JT2A 2EVAA 5HX6A 5KUPA 2XUUA 4S30A 3NNWA 3F7WA 4IVDA 4JRVA 2B55A 4KNBA 4O2ZA 5AEPA 4GMYA 1KE9A 5HHWA 5IQAA 4QMSA 4BFMA 2X8IA 2ZJWA 4GSBA 2JIVA 4QMUA 1CDKA 5BVWA 3LCSA 3RVGA 5F4NA 5AM7A 3C51A 2B52A 3BE2A 3DDQA 5HG5A 2W06A 4WOVA 4C3PA 5KKRB 4O86A 3GCVA 5ICPA 5CSPA 2GQRA 3LHJA 3GC9A 4I23A 3PG3A 5DIAA 3UOLA 5AUTA 3FQSA 4IJ9A 4YZMA 3L8VA 3NCGA 4PNIA 3OF0A 4DFZE 2BRMA 4RJ4A 4ANLA 3DTWA 4FEQA 4BI1A 4F7LA 4GL9A 3LOKA 5I9UA 5JFWA 4R5YA 3VBTA 4EHVA 3HUBA 3Q04A 2QD9A 2BKKA 5IUIA 4DH5A 3QX4A 4O0UA 2PUNA 2IZTA 4MD7E 4YU2A 1H01A 2QI8A 4MF1A 3U9NA 1R0EA 3B2WA 3GQLA 4BCHA 3R6XA 1A06A 2QC6A 4EOSA 1J1CA 2YIXA 5JQ5A 5LVNA 3R7VA 4DT9A 5ETFA 2WTKC 4NYEA 3NUSA 3B2TA 5LVMA 2CJMA 5EI8A 4PRJA 4IMYA 3MPAA 3D2IA 3V8SA 2XKDA 4FKTA 4YJUA 3PDTA 1L3RE 3G6HA 1ZMUA 4LOQA 3SA0A 2CGUA 2EB3A 3W2SA 4CTBA 3EB0A 3TZ7A 5KO1A 2QLUA 4D9UA 1CKJA 4WSYA 4BDKA 4J96A 4L9IA 3CXWA 3AGMA 4OTHA 3PPJA 2PVJA 2XKEA 3OT3A 3VULA 3OOMA 3O71A 4M12A 3UQFA 2XA4A 5GJDA 2XNEA 4YJTA 1ZMVA 2R3QA 3D94A 5HESA 2PSQA 5AP2A 4EZ3A 3A8XA 1NXKA 3R8PA 3EFLA 2WEIA 1PW2A 3GCSA 4LL0A 1WBTA 4FV9A 3GU8A 5HLPA 2XNPA 4FVPA 3Q60A 3LMIA 2WU7A 3ZMMA 5EM6A 1CTPE 3BEGA 4GH2A 4FV8A 3KXNA 4UYAA 4ZK5A 3QQHA 3RZFA 3TKUA 1XJDA 4CQEA 5IA1A 4YSJA 3F88A 4QYFA 3O8UA 3UO4A 2PVKA 3R0TA 2VO0A 4XP2A 3G90X 2R3FA 4ITHA 3BYOA 3QD0A 4NEUA 5F94A 3UMWA 4C3FA 5BMMA 4RIYA 5FWKK 5HE3A 3VS6A 4DTAA 5HTCA 4LUDA 1BI8A 1BYGA 4FGBA 3ULIA 3BU6A 3FAAA 3BWJA 3H9OA 4DFXE 3LFSA 3HVCA 3ZUUA 4EOJA 2OU7A 2BRBA 3OCBA 4J97A 3QL8A 4USFA 2HWOA 5DI1A 3M2WA 4H39A 4RSSA 2XK7A 4FSQA 2J0JA 2ITZA 3DY7A 3AC1A 3G9LX 4Y85A 4F4PA 5AP1A 4IX3A 3FBVA 2OO8X 4YC3A 4S33A 3I0QA 4BGQA 3DJ5A 3WARA 5HX8A 4D5KA 5JGDA 1P4FA 2HXQA 5LXMA 3U9CA 3CY3A 3M1SA 1P2AA 2RSVA 5GZ8A 4M7IA 4K0YA 3NIEA 4ACMA 3DBFA 3ZEPA 5AWMA 4DTKA 4EQCA 2QHMA 4YMJA 4LGGA 4OR5A 5EI6A 2C1AA 4DGOA 3FLSA 5LMKC 4D1ZA 4I0SA 3NVKI 4FSZA 3R8UA 2VZ6A 4GFMA 3UTOA 3AMBA 3P23A 3ZLSA 4E6DA 3C0HA 4F6SA 2QONA 4M13A 4E26A 5LWMA 3QGYA 3VUGA 3UZPA 4F7JA 2HAKA 2C5XA 3IDBA 4QMMA 2C5NA 4AW2A 5L6PA 4QP1A 3FMDA 2P4IA 4Z7GA 4FZ7A 3CKXA 4V05A 3FMLA 4QO9A 3EFWA 4L42A 4OUCA 2OXDA 4UWYA 2WTDA 3ZZEA 2PU8A 5M57A 3TTIA 1Q97A 5CSHA 3SHEA 4WNPA 3ZBXA 2RIOA 4L67A 3PZEA 4IM0A 4AE6A 5KMJA 4FEWA 2NRYA 2QNJA 5AV0A 4ASXA 5J8IA 5DT3A 5GZAA 1LR4A 3QX2A 1RDQE 4FV2A 5HOAA 4O7NA 4CSVA 2B9HA 2XK8A 5DG5A 3OS3A 3R73A 4FV5A 4J71A 2B1PA 4YZBA 3IDPA 5I0BA 3VQHA 5F9EA 5IQEA 3IOPA 3LFDA 4IW0A 5IG1A 3LMHA 4ALWA 4W4VA 1GOLA 4XV1A 4D4VA 1Y6BA 2HOGA 4QMYA 2OLCA 4GT4A 1R3CA 4CEGA 5J9YA 3KA0A 2PK9A 3SAYA 3EQRA 3FLQA 3VS0A 5EM5A 4E20A 2BR1A 4X2GA 4AT4A 4BWXA 2P0CA 2QU5A 3PXRA 3VBYA 4BDHA 3Q3BA 4IZAA 3PTGA 1J7LA 4K33A 2WFYA 2PMOX 1M17A 2IZRA 4BCOA 3PA5A 5CZIA 1PRYA 3VUKA 5H3QA 3OXIA 3OUKA 1R78A 5AR3A 3ZS5A 4RRVA 2BDJA 1NVSA 3VBWA 1IA9A 4BIDA 2ITPA 4PMTA 3VS1A 1SVEA 2B9IA 2HYYA 2XNBA 3W2CA 4AGUA 2YFXA 3FLWA 3QF9A 4F9WA 4OTWA 5A4LA 4HGLA 4RG0A 4HW7A 2GU8A 2ITQA 3WZEA 1QCFA 5AV4A 5AV2A 3Q53A 1YOLA 3T3VA 5BX0A 4F0GA 2XMYA 2BROA 2YN8A 4OTIA 3G9NA 2R3PA 5LMBA 5HTIA 5HU9A 2RG6A 4NUSA 4U40A 3HAVA 3MJ2A 3E87A 4E6CA 4AZTA 3FY2A 3LQ8A 4RFZA 3SDJA 3MYGA 5CAUA 3CY2A 1P5EA 5A6NA 5I9YA 3GOPA 5L4QA 3CGFA 3R63A 1R0PA 3ENMA 3KF7A 4RVMA 4LQMA 4Y46A 5HIEA 2XM8A 4K8AA 4FTTA 4F9CA 2W1CA 3WOWA 4E73A 5K3YA 4X0MA 4UXQA 3B8QA 3OG7A 4RVTA 2ZVAA 1H8FA 4ANSA 4B7TA 4D4RA 4BDEA 4DH1A 3PIXA 2QCSA 2J6MA 3QRUA 4JT3A 3JY9A 4AWIA 3GCQA 3KK8A 3WI6A 3ZFYA 4JDHA 1PYEA 5J5TA 2YCQA 1AQ1A 2YM5A 2XM9A 5CALA 3K2LA 3F6XA 1H00A 5CVHA 4USDA 5A6OA 2FSLX 3NUPA 4FTJA 4PMMA 5HLWA 4JBVA 3HLLA 3MTFA 1WCCA 3FL5A 3PXQA 3AC5A 4U45A 5K5NA 1KV2A 3A99A 2W1IA 3QZGA 4RC3A 3FLNC 4Y5HA 4QTEA 5AA8A 3LXKA 1IG1A 3HDMA 1JWHA 5AFVA 3LJ0A 3VW8A 3RCDA 5HGIA 3V51A 2VGPA 1Q8YA 5CU6A 3EQBA 2JKOA 3U6HA 5CNNA 4IZ7A 1ATPE 4E93A 3W2PA 1XO2B 5HQ0A 3R00A 2EXMA 5FEEA 4J8NA 2A2AA 2CLXA 2V7OA 3V6SA 4EKKA 2Q0NA 1Q3WA 3M11A 3MVMA 3PSDA 3RK5A 3OTUA 5CQWA 4JAIA 4BIBA 5LVPA 4NTSA 4TRLA 2WO6A 3ROYA 5HICA 4J95A 2UZNA 2WTKB 2BRHA 3MVJA 5J9LA 2P2IA 3EZVA 3MVLA 4RX9A 4KRDA 4NJ3A 2F7ZE 3R9HA 5DA3A 1YI3A 4V04A 5IA4A 5FGKA 3BZ3A 5EYKA 4R3PA 4OGRA 5DHJA 4FTLA 4OAUC 2FYSA 4WHZA 1ZZLA 3AD4A 5AR7A 5B0XA 5HO6A 3ORXA 2O64A 4C4HA 2HK5A 4GVJA 1F3MC 4CFWA 3H9RA 1OL1A 3L9PA 3I81A 4HYUA 5TR6A 4A4LA 3MY0A 5DN3A 1IAJA 3MDYA 4O0XA 2VTAA 4MBIA 4CCUA 1OIQA 4FTRA 2JIIA 4GIIA 4IB1A 5FEQA 4DBNA 5KMMA 5FM3A 5CENA 5KMNA 4GK2A 4TZRA 5JFSA 2YDIA
chains in the Genus database with same CATH superfamily
2Y6MA 3D5XA 4HNFA 2UZOA 3EQFA 2J51A 4JLCA 1OUKA 3ETAA 1YDSE 4ALVA 4GKIA 2OFUA 4GYGA 4KBCA 4CYIA 3FKNA 5K9IA 3R8LA 1VYWA 2WIHA 1JVPP 4O4CA 4XS2A 3DBCA 2ZFYA 5IQIA 5CNOA 5ITAA 4P5ZA 4XNEA 4FG9A 3U54A 4OW8A 5AX3A 1XR1A 4WNKA 4GEOA 4MEDA 3GXLA 5M51A 4IC7A 2O5KA 4FUXA 4II5A 2PHKA 1JOWB 2PMIA 2YISA 5FP6A 3FXZA 3S3IA 2JFMA 3H0ZA 2W1HA 4YR8A 2QOLA 4I1ZA 5KNJA 4O7LA 2WNTA 4BY9E 1PMNA 1U54B 3QTZA 5CF5A 4ENXA 4TNDA 1W0XC 3NRMA 5FLFA 4NCTA 4PNKA 5BUIA 3UOJA 2GDOA 2R3NA 4Q9ZA 4O1PA 3DNDA 3TXOA 3E3BX 4GIHA 3TZ8A 4W4YA 4TYIA 4A7CA 3BGPA 2YM3A 4EHEA 3O51A 2XB7A 2HW6A 3R22A 1BKXA 4FICA 3BI6A 4EH9A 4ZLZA 2CDZA 4FKPA 4FZAB 4R3RA 3BCEA 3EN5A 4YZDA 3ZYAA 4I92A 4XG4A 4IIRA 2RFEA 3RK7A 3HMIA 4DITA 4CXAA 3CIKA 4A06A 4YJQA 3WF6A 2X8DA 3ODYX 3EN6A 4O0WA 4BCJA 5DLSA 3L9NA 3FZRA 4GJ3A 3COKA 3NUNA 4D2TA 5J95A 4QOXA 4CMOA 3R28A 4BDBA 3O8TA 5JFVA 1RJBA 2O65A 4D4YA 2ERKA 2XH5A 3RINA 2XIRA 4JOAA 4MQ2A 3S4QA 3QRJA 2HIWA 3VC4A 3QC4A 2V55A 4AT3A 1WBPA 5KX8A 3Q52A 2GTNA 1ZYJA 1UNHA 4FJVA 3AG9A 4L01A 5LCKA 1OKWA 1CKPA 3ANQA 4KB8A 5E7RA 3T3UA 3V04A 4ENYA 3W1FA 4UBAA 2W7XA 3UYSA 3ZM9A 4Q5EA 5LQFA 4MYGA 2CKOA 4F1MA 4Z55A 2ACXA 3BPRA 4CFUA 4KS8A 4FT3A 3W18A 3QCYA 4IE9A 3UVQA 2C5OA 3NEWA 4UWBA 4OBQA 4E4XA 3QTSA 1ZYDA 2XF0A 5K0KA 4QMWA 4PL3A 3CD8A 4IAAA 1YW2A 1LEWA 4TWPA 1M52A 3WF7A 3AKKA 3IG7A 2WTWA 4ZEGA 3PVBA 4KUJA 2C6OA 3VJNA 5AUUA 4D9TA 5AP4A 4XCUA 5CLPA 2BDFA 3RPVA 1UU8A 3C4FA 4KIQA 2XNNA 3B8RA 4YJSA 5IKWA 5EG3A 2I40A 4WA9A 3R7OA 2QG7A 4X21A 3H3CA 2WU6A 3I6UA 5AMNA 4AZSA 2IWIA 2VWXA 1XH9A 4ZTMA 4CFXA 1H26A 4IB0A 4O96A 2WQBA 4XYFA 2VN9A 3G51A 2Y8OA 4JG8A 1PMUA 4I21A 3LAUA 4AA5A 3F3TA 2KULA 2WOTA 4O1OA 1X8BA 3KRXA 4I0RA 3G5DA 4QYYA 4XP3A 3UIXA 4BHZA 5KBQA 2R7BA 3DBEA 3V5PA 1IEPA 4C61A 2O0UA 2H9VA 4EZ5A 3FSFA 5GZ9A 2OZAB 4GU6A 3KIOC 3A4PA 3TJCA 4EJ7A 4MX9A 4QP6A 2R5TA 1VYZA 2J9MA 3Q9ZA 4RIXB 3R83A 3TNPC 4D2RA 3VVHA 5IA0A 2JDOA 3PWYA 4RC4A 4CLIA 4EJNA 2VO3A 5KMOA 4QP2A 4S31A 3S1HA 4WKQA 4MXCA 3IW8A 3CQWA 4YHJA 4IZ5A 5HLNA 4IB5A 3I5ZA 3OUNB 5HE1A 2WXVA 2DUVA 3Q9YA 4HGEA 3SXRA 3VWAA 3CSVA 3ZHPC 4EHZA 5IDPA 2ITTA 5AUZA 4BF2A 4G1WA 5CASA 5JGBA 2Q83A 2FB8A 3OHTA 5J1VA 3N4UA 3VS3A 5K5XA 4HPTE 4I6BA 1WFCA 2XNMA 4FKOA 4FVRA 2UZBA 4UMRA 3KVXA 3LFQA 4X7QA 2C4GA 4FIEA 4GW8A 2GMXA 4TW9A 4IX4A 1JSTA 4YP8A 4LV8A 4WNOA 2ZYBA 2WTJA 3MIAA 2QR7A 3NGAA 3TG1A 4KBKA 1OPLA 1FGKA 4Q2AA 5HCXA 1J7IA 2WMQA 3OY3A 4FKWA 4IX5A 4PL5A 3FQHA 4EKLA 4G3CA 3C1XA 4QMOA 5DOSA 1MRYA 4XG8A 4O7SA 3QBNA 4NWMA 5AR5A 2CGXA 4AN2A 3AXWA 3JR1A 5CAPA 3A62A 5LWNA 2R3MA 3UIUA 3MGYA 1W98A 3QTWA 2ZV7A 5M4FA 3CEKA 1FBNA 3F5UA 4O7WA 4OBOA 5H9BA 5EHYA 3A4OX 4AW0A 4S2ZA 3QD4A 2G01A 2OW3A 4MXOA 4O7TA 4RJ3A 4TNBA 4LRJA 1URCA 4PDOA 1JQHA 4WO5A 5HVYA 3EL8A 4BDCA 3R04A 4FOCA 4ZJVA 4GUEA 1PHKA 4QPMA 4PWNA 4WSQA 3E88A 3OROA 3CCNA 4O4FA 2LAVA 4CZYB 4PTCA 1WZYA 1OIRA 3EFKA 3GU7A 4YLLA 3E7VA 4FMQA 2JKMA 3BBWA 3HZTA 1HOWA 1XWSA 2J7TA 1E1XA 5J1WA 2R0UA 2VV9A 5ANOA 2AQXA 3KXMA 4EZ7A 3E64A 3IQ7A 4QTBA 2OWBA 3RPOA 4C4JA 4CFFA 1ZAOA 4NSTA 4NKAA 4YNOA 2XIZA 1CM8A 1EH4A 1WBNA 3QWJA 5FM2A 5B2MA 5M06A 3G0FA 5BVKA 3V8TA 1Q41A 1SM2A 2DS1A 4B9DA 3SRVB 5DPVA 3LLTA 5C1QB 5ANGA 3DV3A 2BCJA 2CSNA 3GC7A 4LV7A 4U97A 3BLRA 4ORKA 4Y5QA 5E8UA 4DEHA 3HV4A 4CRLA 1MRVA 4PMPA 2PVHA 3TL8A 2X2KA 3L8PA 2W1FA 4HVIA 4UX9A 4O27B 2JGZA 1ZY5A 2E9VA 3PSBA 3RAKA 2HZ0A 5FXRA 1L8TA 4FGRA 3IS5A 2ZV8A 1LPUA 3EQHA 3FMKA 3DZOA 4NM3A 4A9RA 5CEKA 1OKZA 4HNIA 3C7QA 4ZTHA 3COHA 3KF4A 2Y0AA 4L6QA 3U6IA 4ASZA 2CGVA 2GS2A 3UO5A 5M55A 2VD5A 1ZYCA 1JPAA 5EHOA 3ZSIA 1O6LA 5KMKA 5DR6A 1O6YA 3E62A 1YI4A 3PJ8A 5D1JA 5L6OA 3TNWA 4C8BA 3E8DA 4IVCA 3NNUA 3LM0A 3BX5A 2QOKA 4U0IA 4KIKA 5C8KA 3CGOA 4D1XA 4X2FA 2P33A 2GTMA 4EH6A 3WYXA 5DFPA 1GZ8A 3PRIA 4TXCA 3HUCA 4QMZA 4CQGA 3R7YA 2ZMDA 4WUAA 4RGJA 4FTIA 1E1VA 5H8BA 1OGUA 4QNYA 3ZC5A 4XG7A 4AS0A 3TNHA 4ZSEA 2ITWA 5FTQA 2A4LA 5TOZA 1JSUA 3NNXA 5JK3A 1Q4LA 3UMXA 3DJ6A 3D5VA 4CZTA 3DDPA 2QO2A 4YURA 4CKIA 3CTHA 4LRMA 4DEDA 2QODA 4O21A 1OMWA 2JDTA 3UGCA 3UODA 3BHHA 2PYWA 1Q62A 2WMXA 2AC3A 2HENA 4UV0A 4QYGA 4FTMA 4EH8A 3HMPA 2OI4X 3WZDA 4FSMA 4EORA 2QKWB 2ERZE 3VF9A 4WG4A 4G2FA 4OBPA 3CJFA 4ZSJA 3PY3A 5IMEA 1GZOA 1GNGA 2W4JA 3UZRA 2UZLA 3TZ9A 2BKZA 2YM6A 3WYYA 4HYIA 4M0YA 1HCKA 1URWA 4DLIA 2EXCX 5L2IA 2C6EA 3AGLA 3GP0A 4F70A 4IAKA 4FKGA 5DEWA 2C6IA 1U5RA 2BTSA 2CKEA 4QDVA 5CI7A 1ND4A 4WNMA 5E8XA 4RWJA 3JUHA 2YZLA 2IVTA 3FI2A 4A9YA 4RJ7A 5LARA 3F2RA 2ZDTA 2XS0A 4R1VA 3HGKA 2OBJA 4UALA 5DEYA 2A27A 4XBUA 5IH4A 3S00A 3IONA 5AV3A 4EUUA 4LMUA 2OXYA 4RX8A 2BZKB 3EQCA 4Q9SA 3FJQE 4CD0A 3NFGB 4L53A 4QEBA 4I5PA 2B9JA 4U79A 4YTFA 4I6HA 3CE3A 2UZEA 3KGAA 4TWNA 1FVVA 2G9XA 5AM6A 4QT1A 3FZ1A 4O2PA 3P5KA 2PVNA 4CVAA 2X2MA 3D7TA 5IDNA 1U4DA 1YXUA 3SX9A 3BLHA 3BYVA 3EKKA 2HXLA 2GNGA 3I1AA 5I4NA 2XIKA 2QOQA 5EW8A 3UDTA 3BGQA 3R7GA 3MY5A 3TTJA 4AF3A 5HE2A 4NIFA 3V5JA 3ORPA 4MQ1A 3NYXA 3OCGA 1T46A 4G16A 4BZOA 4D2WA 3DU8A 5AP7A 4DGGA 3W0MA 5GINE 1STCE 5CTPA 4PTGA 3PG1A 2ZDUA 5FG8A 2GNIA 5EDRA 1H08A 3D5UA 1J91A 4DDGA 3R8ZA 4TY1A 4L8MA 2XRWA 3UVRA 3FQEA 3QLGA 2UVXA 3GBZA 4BICA 3QRTA 5BYLA 3OCSA 1XH7A 4U41A 3W8LA 5HCYA 4ONAA 3MESA 3EMGA 3QD3A 4AN3A 2I0YA 2PVRA 1F5QA 4H05A 2Z7SA 4AE9A 3QZHA 4ITJA 4B8LA 3OOGA 3OFMA 4JR3A 4O84A 3AC4A 1NW1A 4XLVA 4UY9A 3R2YA 4YC8A 1H27A 3IKAA 4UYNA 4O7YA 1H1PA 4W4WA 3BLAA 5CAOA 1KUTA 2QR8A 1PYXA 4QMVA 3S0OA 5CWZA 1AD5A 3F61A 4FNYA 2ZV2A 4E3CA 5TKDA 4G6OA 3FMJA 4M8TA 4QP7A 5CYIA 4M69A 4DG0E 3SVVA 1GIIA 2E9PA 3Q4UA 4JS8A 4H3PA 3FMNA 2UW9A 3DNEA 2BAQA 2PMNX 5F1ZA 4YC6A 4YTHA 1Y91A 5D9HA 1VLRA 5HE0A 5AP5A 5E8SA 3LCKA 5D41A 4ZY4A 1P14A 4XX9A 3DK3A 5HZNA 5AR4A 3LW0A 2V5QA 4FKJA 4QMQA 5JN2A 4FSTA 4FTUA 1BI7A 2EUFB 3QQKA 4FV7A 4DFLA 4BZNA 3Q6UA 4WBBB 3QQLA 3IW6A 4IWQA 3KCFA 1PY5A 3QTRA 1Q5KA 3CS9A 4NK9A 4BCQA 1OECA 3MBLA 4XG2A 4YLKA 4BR3A 2G2HA 3LQ3A 3D14A 5CSVA 2ONLA 2E9OA 2YJRA 4O22A 4FKIA 1WBSA 5HBHA 5C9CA 2PUIA 3NYNA 2ZB0A 3ZBFA 4P2KA 4TT7A 3ZSHA 4GCJA 3PZHA 4EK5A 1WAKA 2X0GA 3QQGA 2VWVA 4O4DA 3OWPA 2OXXA 4G3EA 3BU5A 3QQFA 4NU1A 1JSVA 1PJKA 3DBDA 2QU6A 4C4GA 4O0RA 4DFUA 3SV0A 4FA2A 3DLSA 2BILB 2XP2A 5E92A 4ZXTA 4BCKA 4O38A 1K9AA 1NVQA 5DVRA 1JNKA 4XH6A 4AAAA 3QKKA 4BBFA 3PWDA 4R7IA 1QPCA 4MNEA 2WKMA 3T9IA 2J5EA 2NP8A 4QQCA 3G15A 4FTNA 1WVWA 3O2MA 4KWPA 2FVDA 1H0WA 4I6QA 1K2PA 2F9GA 2UW3A 4O7RA 1VZOA 2BMCA 3R1YA 4FTKA 5AIKA 5HKMA 1H1RA 4KKEA 2IVVA 4NL0A 5C4LA 1W83A 4KSPA 3T8OA 2C6KA 5IEXA 2R64A 2W9FB 4AXCA 4L46A 1PKDA 2GNFA 4H58A 1KE6A 3Q32A 3R30A 3OEZA 4QMPA 4BIEA 4DEIA 3P4KA 4KA3A 3P7BA 1FPUA 3HV5A 4U43A 5ANKA 4AZVA 3ZSGA 2J5FA 3LJ1A 3FE3A 3NVMB 4PF4A 1YKRA 1G5SA 4J98A 3ZXTA 4IANA 3HYHA 4UWCA 3W8QA 3PXYA 3QALE 3FXWA 1IAHA 2W0JA 4RIYB 2UV2A 1Q24A 2W9ZB 4NCTC 4FTOA 2XVDA 3FI3A 2RL5A 2YZAA 2H8HA 3CC6A 4LGHA 5T6KA 3UDZA 4XHKB 4E8AA 2FSMX 4EK8A 3PLAE 3OVVA 2Y7JA 4KBAA 2GQSA 4EK4A 4F0FA 3NAYA 3IW5A 2IF8A 3HRFA 3N51A 3THBA 4AT5A 3V8WA 3NPCA 5A14A 3COIA 4W4XA 3W55A 1XBBA 5HVKA 1ZARA 5B7VA 2VX0A 3MH3A 3P78A 1YXSA 4NW6A 3OC1A 4TYEA 3PVWA 3RGFA 4DHFA 5EK7A 1Q99A 3ORNA 4I0TA 1ZOHA 2PE1A 3ZO3A 5IEYA 2X0OA 3ALOA 4G34A 4MNEB 3VUTA 3NDMA 1MQ4A 1FINA 1PXJA 3AD6A 3G0EA 5I9VA 2G2IA 2E9NA 2WMTA 2XBJA 4LOOA 4EBWA 3KRWA 5BVDA 4KSQA 5EKNA 3KL8A 1UKHA 2UZUE 4MBJA 4YJPA 4NFNA 3TNIA 3QQUA 4CKRA 5L2TA 3RI1A 3H9FA 1YVJA 3OXTA 4EH2A 1XH6A 4KIPA 3DXQA 3O5AA 4U7ZA 3R9OA 2YITA 3FY0A 4UZDA 2JDRA 3O50A 1YXVA 4OTFA 5E90A 1V1KA 3R7EA 5CU3A 3QA0A 3UNZA 2X39A 4HYSA 2P55A 2Y4PA 3LCOA 5KHWA 3UIBA 4GYIA 4L7SA 4LGDA 3C13A 4JX3A 2C5YA 4XV3A 5EYDA 4ZY6A 3DQXA 1ZMWA 3C9WA 3VS4A 4C38A 4C3RA 2PZRA 1WMKA 4EH4A 1LUFA 4DH3A 3RPYA 4I4FA 4YJVA 2GHMA 1R39A 3O8PA 2W05A 2GNLA 2UZTA 4D58A 4YHTA 5BUEA 1SVHA 2XKCA 4QP8A 3V5WA 4B8MA 4OTRA 2XJ0A 2VTTA 4HYHA 3QXOA 3NR9A 5EDPA 3OWJA 2CKPA 4ZMEA 4F08A 3KMUA 3EJ1A 4RQVA 3HMOA 5LVOA 3AKJA 2J4ZA 4G9CA 4G6NA 5FD2A 2IW6A 2JLDA 2RF9A 3D5WA 5HNBA 1Z9XA 3AT3A 3EZRA 3O17A 3FMEA 3FI4A 2XAOA 2IVUA 4EC9A 2WPAA 3AQVA 1BLXA 3FYKX 3ZRMA 3H4JA 5CX9A 3I4BA 3PFQA 1ZOEA 2WMUA 2DWBA 1M7NA 3F69A 4DTBA 3EHAA 5D10A 4FKUA 3MB6A 4AZWA 2C6TA 3ZFMA 3OWLA 4R3CA 5CEIA 4FIFA 1K3AA 3AOXA 4MD9E 4LDTA 2WHBA 2B53A 2YCFA 3TV6A 4A9SA 4PP7A 5GJFA 1DM2A 2X0QA 3HKOA 4APPA 3D2KA 3PSCA 3UNKA 2BRGA 4YSMA 3RAIA 3RAWA 4QP3A 1DAWA 2YJSA 5HTBA 5LCJA 4O6LA 1Q8UA 3VBQA 5AAEA 3JS2A 5HEZA 5EKOA 3KQ7A 1S9JA 2I6LA 4FNXA 5LMAA 1TZDA 2YDJA 3F66A 3IO7A 4D55A 4QMNA 5L8JA 3VUHA 3MFSA 4AN9A 3VAPA 5DE2A 4CG8A 4YZCA 3OP5A 2VTLA 5JRQA 2BFYA 3SGCA 5GIPE 2GCDA 3FYJX 4IJPA 3KC3A 4AU8A 3JVSA 1OKYA 4BTMA 3LLAA 2W4OA 4AXDA 4YJNA 3VUIA 4NFMA 3O23A 4EH5A 3AT4A 4B6LA 3R8VA 3UPXA 3FZSA 3L8XA 4GK4A 2H6DA 2WMRA 3W0SA 3MSSA 4YLJA 4RJ6A 3K54A 4X6RA 4C2WA 4O81A 4IX6A 4CG9A 4X3JA 2YIWA 4IWOA 4DCAA 3BHYA 3E92A 3CPBA 3GC0A 2UW0A 3HV6A 3BHVA 3PPZA 3Q6WA 3QCQA 3Q5ZA 4RA4A 3BGZA 5EI2A 2W17A 2YHVA 3EYHA 2OSCA 3I6WA 4I20A 3UJGA 1P4OA 3KEXA 4FIIA 2PUPA 4F0IA 4DAWA 3COMA 4ASEA 5KHXA 5M4IA 3HA6A 1XH8A 4FODA 2XCKA 4ZMFA 3ACJA 3QQJA 4CFMA 4J53A 3KXHA 2OH4A 2P3GX 4YJOA 4JQ7A 4I4EA 4FG8A 5FEDA 3LXPA 2ETRA 2C6DA 2CHLA 2R2PA 5HCZA 2BAJA 4BWPA 5CT7A 2OH0E 2R3OA 3A7IA 1SYKA 2JITA 4E6QA 4ZSGA 1GZKA 2YCSA 5DR2A 1NA7A 3TZMA 1E9HA 2I0VA 2R9SA 3CP9A 4ZP5A 4JBQA 5FRIA 3KFAA 4FZFB 4BDGA 3EIDA 2WQMA 2X7FA 3MJ1A 4DYMA 4JDKA 3W16A 1NY3A 5BMSA 4XG6A 5E1EA 1BL7A 3TKIA 4A07A 4C37A 2G1TA 4JDIA 5C8MA 4IAZA 2OF2A 3S2PA 4EI4A 2F4JA 2I1MA 1Y6AA 2GHLA 3VO3A 4ZSLA 5IU2A 3BHTA 1UU7A 4PQNA 2CN5A 2B0QA 5AP6A 3UZTA 4K11A 4CYJA 3CR0A 3NUAA 5AUWA 4U3YA 4X6QC 1Q8TA 2BHEA 4MNFA 3R1NA 3TKHA 5H8EA 3WZUA 4O91A 4F7SA 4I5CA 2FO0A 2XRUA 2R7IA 2UZDA 3L9LA 4Z9LA 3BYSA 3C4XA 5KZ0A 1OM1A 2GQGA 3JXWA 2BIYA 2HW7A 2CLQA 2VTRA 1REKA 5AV1A 4O82A 5H8GA 4EOOA 1YHSA 4QPAA 4PY1A 2WIPA 3ZO1A 2VTQA 1TQIA 5IQCA 4BDJA 3AC2A 3VUMA 3WBLA 4ANQA 5HD7A 2Y4IC 1SMHA 4NH1A 5IPJA 2X4ZA 3KXGA 3PA3A 3WILA 4QTCA 3UDBA 1KE7A 2IPXA 2YACA 3UE4A 1Y8GA 5IISA 4J52A 3AMAA 4KABA 3L8SA 3U4UA 4OT6A 4CT1A 2CNQA 5BPYA 3MFUA 1OKVA 2YDKA 5D12A 4FV0A 4J1RA 2BZIB 2QKRA 3KULA 2PZ5A 5EYMA 3W0RA 3MW1A 4NM7A 5E8ZA 3JY0A 4RFMA 5FXSA 4FRFA 3DKCA 4DGLC 5FDPA 4MH7A 3HP2A 4BDDA 1RQQA 3FZPA 2RGPA 5ANEA 3ZOSA 2UW8A 5GNKA 4YO6A 5BQ0A 3G6GA 4O6EA 4FKRA 4ZAUA 3KMWA 4AW5A 1A9UA 4JIAA 2HELA 2J90A 3KKVA 3RM7A 4AZEA 5A4TA 2R3RA 4I6FA 3ML1A 2PE2A 1H24A 2Z7QA 4L45A 3PLSA 4MXAA 4YPSA 4BTJA 1Q61A 3OT8A 4PDYA 5CY3A 5HG9A 3QYZA 4BRXA 1UWHA 4IEBA 4YPDA 4Z16A 4IVBA 3CTQA 1VJYA 2PZIA 5JMSA 2EB2A 4FZDB 3K3JA 5L2SA 1KE8A 2G15A 2JD5A 5BV3A 2RKUA 2X81A 2Z7LA 3IDCA 4RQKA 3SC1A 4BDFA 2Z2WA 1W8CA 2JBPA 2XYUA 1OITA 3A7JA 1PKGA 4ID7A 3F3WA 4Y72A 4FF8A 4RLKA 1F0QA 2WMBA 1UWJA 2H34A 2W1DA 3H30A 4ZLYA 2X6DA 3TUDA 1XBCA 3QCXA 1W2DA 4KD1A 4O7ZA 3NUUA 2O3PA 1QPEA 3PY1A 4K2RA 2PVYA 5CF8A 3BE9A 4QD6A 4JR7A 4G6LA 3P1AA 4RWLA 4BTKA 1IR3A 3BIZA 5DRBA 4DH8A 5CU4A 3IW4A 3D83A 4I41A 4MWIA 1CSNA 1KE5A 2WMAA 3KN6A 2OICA 4X3FA 3FPQA 4Y8DA 4MXZA 2DQ7X 5F20A 2W1ZA 4I5HA 4IAIA 3E8EA 1PXPA 1YQJA 3AMYA 5A46A 1H1WA 3NFFB 1YXTA 4G5JA 2GHGA 3UC3A 3W32A 3CKWA 3DKFA 3SD0A 3O0GA 4QTAA 3TT0A 4LRKA 3VBXA 3TDWA 1R1WA 1ZZ2A 4D0XA 1ZY4A 3UBDA 4ZZOA 2WQEA 4G3GA 4RX5A 4KKGA 3RTPA 3SXSA 5J7HA 1TKIA 4LV5A 5K4IA 5M53A 3BLQA 4Z3VA 3E3PA 2XAMA 1OPKA 2BFXA 2WQOA 3DA6A 3DAEA 2OKRA 3GT8A 4GFGA 3HEGA 4HCUA 2YIYA 1VEBA 4C0TA 2QVSE 3DPKA 4ZLOA 3PXKA 4ZS4A 2F57A 4XUFA 4ZS0A 3GUBA 4F6WA 5IF1A 2R0IA 2VO7A 3LCDA 5AJQA 1QPJA 3SKCA 4CV9A 3MVHA 1YDRE 3PJ2A 4FT7A 3UP2A 4GFOA 3GNIB 4I94A 3VUDA 2XBAA 4BKZA 2PMLX 5E8YA 1V0BA 5ACKA 4BB4A 4FEUA 1KOBA 2F7XE 3CD3A 4AQKA 3UP7A 2PZYA 4O0TA 3LJ2A 5FTOA 4JNWA 5A4EA 1FMKA 4O0YA 3E7OA 4YGAA 3FKLA 2PVLA 4RWIA 4TKSA 3I7BA 5DT0A 1JLUE 2UW4A 3ORKA 4XP0A 2XANA 1TVOA 1IASA 2C5VA 1FOTA 2UW5A 2BUJA 4QNAA 4F09A 4K18A 2R3IA 5EOBA 5IUGA 5IQHA 2VWWA 3P7AA 3MH1A 4U9AA 4X3FB 3QAME 3DAJA 5EM8A 4M66A 2XCHA 3JVRA 5BYZA 3W2OA 5BVOA 2JDSA 1KSWA 2WOUA 3C5UA 3KRRA 5CU0A 3LKMA 3PPKA 4DE4A 1FVTA 3OBJA 2C0OA 3PIZA 4WIHA 4BKJA 5KMLA 4USEA 2NPQA 3V5TA 4EUTA 3QHWA 3NUYA 4KIOA 5HI2A 1W2FA 4O0VA 4QP9A 5JZJA 2E9UA 5TE0A 4FI1A 3AC3A 4HPUE 3PE2A 3M42A 3MWUA 4JRNA 4YZNA 5CEQA 2C68A 3VW6A 4ACDA 2WMVA 4B99A 1MP8A 4DEAA 1Q3DA 3RJCA 4EQMA 4J99A 1Y8YA 3ORTA 4ACCA 4QYHA 2VRXA 3MFTA 4UB7A 4YHFA 1JAMA 2R3GA 2OK1A 4ZZMA 4PX6A 4EYJA 4L00A 4XLIA 4RX7A 4CKJA 2WZJA 3A61A 4LFIA 2OIDA 4KS7A 4BCNA 1SNXA 4E6AA 5JH6A 3DFAA 2ONLC 4QYEA 4RJ8A 1ST4A 4EOPA 3LFAA 4MAOA 4U81A 3VS7A 4RMZA 5CSXA 2VTHA 2C0TA 4TTHB 3NNVA 4XOYA 5CU2A 3TNQB 4BCMA 2XIYA 2C1BA 3NS9A 2XK4A 3E63A 1G8SA 3F2AA 3ATSA 3KK9A 4WD5A 3N4VA 3A8WA 3P08A 5FQDC 1XH5A 1Y57A 2RFSA 4LI5A 4LYNA 3OD6X 1DI8A 1OL7A 3V5QA 3FC2A 3KXXA 4AOJA 4UMUA 5CEOA 2ETMA 5E8VA 2OZOA 3FZTA 4JBPA 4KAOA 4LMNA 4L68A 2ITVA 3VF8A 3FDNA 3ORZA 3Q9XA 3DTCA 4R1YA 5CI6A 4FT0A 3OTVA 4FOBA 4L3JA 2V0DA 5FXQA 4RT7A 4GG7A 2JBOA 4ZTSA 3WF5A 3JYAA 5A4QA 4A4XA 2EU9A 3LIJA 3SOCA 3QA8A 3GFEA 3F3VA 5IQFA 1GY3A 3AD5A 3PUPA 4H1MA 2PUUA 2XEZA 4RZWA 4JQ8A 4O7VA 3I79A 3Q96A 3RP9A 3WE4A 4OT5A 2XK9A 1QPDA 4ZTQA 1W84A 4AA4A 2IZSA 5D7AA 4D5HA 4XG3A 3UQGA 2KTYA 4O0SA 5EH0A 4M3QA 4DEBA 2Y4IB 5CT0A 3C50A 4IDTA 3K5VA 3PVGA 2YERA 5AUVA 4IADA 3SXFA 3UC4A 2NNWB 4OTPA 2Z60A 4YO4A 5ANJA 3PRFA 4R7BA 1IRKA 4H1JA 3IOKA 4F78A 4LUEA 3MA6A 5CEMA 2F2CB 5E91A 2HWPA 2XK6A 3TV4A 4KRCA 2Q0BA 2X9FA 3QZIA 2CCHA 2YLEA 2BPMA 4GV1A 3VHEA 2GFCA 3ZTXA 4DCEA 3D15A 4KIKB 1FGIA 2GNHA 4BTFA 5E4HA 4GUBA 2BZJA 3I5NA 3MN3A 4HCVA 4P90A 3TV7A 5I5ZA 4BI2A 3D4QA 4IFCA 4E4LA 3PIYA 5E9EA 3LMGA 2QHNA 4PMSA 4J8MA 4L52A 2C47A 5IQDA 3R21A 4ERWA 4OTGA 2X1NA 4BBMA 3BBTB 4CRSA 4I22A 4C36A 3CBLA 5CQUA 4F9BA 3D7ZA 4DC2A 4WG5A 1MQBA 2IEWA 3HP5A 3L9MA 2YABA 4IHPA 1APME 4R6VA 1B38A 4BGHA 1M2QA 4BDIA 3C5IA 2PY3A 3BYMA 3NSZA 4GG5A 4Y95A 1M14A 3QFVA 4N4SA