3W55A

The structure of erk2 in complex with fr148083
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
347
structure length
335
Chain Sequence
b'PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Role of a cysteine residue in the active site of ERK and the MAPKK family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 335
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3w55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w55A01
2VWVA 3T9TA 3S95A 2X4ZA 3HUCA 3IS5A 4ZTSA 2ONLA 5EDRA 3V6SA 4K6ZA 4KIKA 3BU3A 3ZONA 4ASDA 2WMWA 4QTAA 5IA0A 5IH4A 4ZMEA 2X6DA 3PRIA 1AD5A 3THBA 1SZMA 5DRBA 3RAKA 3KKVA 3W2CA 3ZYAA 1XO2B 3AGLA 3C0GA 3Q4UA 3VS5A 4M66A 4RC3A 4AU8A 4BYJA 3IW4A 3MB7A 3Q4CA 1J7IA 3TWJA 5CF4A 3VN9A 4EOLA 2IZRA 4GIIA 5L2IA 3TIZA 3MDYA 4EZ3A 2XNPA 4PMMA 5CXHA 3E8CA 3LM0A 5CEOA 4S33A 1BI8A 4X2KA 4PNIA 3C4ZA 2Y6OA 5L8JA 3FPQA 5CNNA 4D28A 4HCVA 2VTQA 4MBJA 4PMTA 5ETCA 2OLCA 4BZNA 3DBCA 5IEYA 5JGAA 2OF2A 3TZ8A 4M0YA 4PMPA 5AUTA 4ZLYA 2OBJA 4QMZA 4BWXA 2VX3A 3PP0A 3HUBA 4BGQA 5GZ8A 4IFGA 4DTAA 3F5GA 1UNGA 4AS0A 3DK6A 2WQMA 3KVXA 5TOZA 2O64A 4BYIA 3BI6A 5LVLA 3R7VA 4JR7A 2BUJA 1CSNA 3ET7A 3P4KA 4HZRA 4R6VA 4ZSLA 3IOKA 4J99A 3HMPA 4GCJA 5DVRA 2ZMDA 3W2PA 4J8NA 1OIQA 3CD8A 3W2RA 4X2NA 4DT8A 4FSNA 3E87A 5HG7A 3SW7A 4HGEA 2JIIA 2X39A 2QLQA 2ZV8A 4XH6A 3TNQB 4EK5A 3R8PA 5G6VA 2HCKA 4K8AA 1XKKA 4FNWA 3LIJA 3QF9A 3I60A 4CFMA 5ETFA 2RFNA 3NRMA 3OUKA 2R3QA 4ZAUA 3CCNA 1H00A 4XBRA 3ULZA 5BUEA 2UW7A 3ENMA 3RJCA 2E9OA 3LHJA 1QPCA 4FKOA 3NYVA 4DFBA 4DBNA 4HPTE 3BHTA 1APME 5AP7A 4QMUA 3QQJA 5BVKA 5JMSA 3O71A 1GOLA 2HK5A 4IBMA 4HZSA 1UU8A 2VTJA 4EEVA 3OXTA 4CFWA 2V22A 1YI6A 2WMTA 4UEUA 5CX9A 2W1EA 4EJNA 5IA2A 2CLQA 3EHAA 4QRCA 4FX3A 4QP2A 4X3JA 3L8PA 3OHTA 5HBEA 2VWXA 3F66A 2C6KA 4ZTMA 2F57A 3BYVA 5JZNA 3A8WA 3PY0A 3NIZA 3C1XA 4ZJJA 3RAHA 4DLJA 3SVVA 4ZZOA 3FAAA 2WTDA 2YIQA 1QPDA 3Q52A 4GL9A 3LOKA 3R7UA 1MRYA 4TN6A 3VBXA 2UZOA 3R7GA 1PRYA 3GXLA 3Q96A 5ITAA 5EW3A 5HICA 3AT4A 2QKRA 3TNIA 4R77A 3DKCA 5IKWA 4KSQA 3RKBA 5IQGA 4EK8A 5IH5A 2QLUA 5IQCA 3KC3A 4ANBA 5JGDA 4IZAA 5EOBA 4DN5A 3ORKA 4I93A 3AQVA 2JEDA 2VUWA 2A1AB 3ORXA 2YIRA 4BHZA 3LPBA 1Q8ZA 2DWBA 4E93A 3I5ZA 4B8MA 2ESMA 4MX9A 4IJPA 3EJ1A 3RPRA 5D41A 2NP8A 2ZOQA 2VO6A 3HKOA 3QD0A 4BDHA 4R5SA 5M4FA 2YCSA 5CU2A 2WMXA 1MP8A 4XG7A 5KE0A 1PXLA 4D0WA 4F65A 1UNLA 2F9GA 2XCHA 2XYUA 3BYMA 3FWQA 3R63A 4ITJA 3Q9XA 4NCTC 3BRBA 4UMQA 4FUXA 3HRFA 3DAKA 4FZ7A 4BCOA 3C0HA 3D5VA 4PL5A 3UGCA 3QTZA 1NT2A 2I0EA 3PPKA 3C51A 4FZDB 3ZBXA 4E4NA 2XEZA 3VRZA 5M51A 1VYZA 4OGRA 4ZS0A 4HGLA 2HWOA 3CTQA 4OTRA 2R3OA 4UZHA 3KREA 3JUHA 3OC1A 4IWDA 3HV6A 4MF0A 3TV6A 5GIOE 4ZTNA 4LL0A 1Q8WA 4HYUA 2YN8A 5BVFA 2FVDA 3UZPA 2UZDA 4EWQA 5HESA 4RQVA 5A14A 4MBIA 4EOQA 4AQCA 3O8UA 3FDNA 3E62A 3TKUA 1WCCA 5DGZA 1IA8A 4V0GB 3M1SA 2Z7SA 3OG7A 4KINA 1LR4A 4JBQA 2QO2A 4FG8A 4YC3A 1DM2A 2OFVA 2PK9A 4R8QA 4U42A 4CFNA 4F1OA 3HV4A 4YBKA 2J0JA 2WMVA 4TWOA 3H0ZA 4TTHB 2SRCA 2XK6A 3UQCA 2OXXA 4F6SA 2X2MA 4R7HA 2JKOA 4FTLA 4BCKA 5CI7A 4A7CA 3V01A 1S9JA 2W4KA 3LFQA 3OY3A 3MJ2A 5DFPA 1H08A 3DBEA 2BTRA 3KRWA 2O5KA 4B0GA 4F0GA 1BLXA 2UW5A 2P3GX 2XIRA 2YITA 3QD3A 4L46A 1U54B 3ZMMA 3R1NA 4NFNA 4CLJA 1YXVA 3QQUA 3M2WA 2QODA 5JFWA 5HE1A 3CQWA 3AC8A 3VHEA 4PDPA 4W9XA 3ODZX 3ZTXA 4U0IA 3EQPA 3VUIA 4DTKA 3TNWA 3W55A 3UIXA 1R1WA 4G31A 3KRRA 3DB8A 3PRFA 4FT0A 3VS2A 4CZYB 3C5UA 2PZRA 4TYIA 4FIGA 5L2QA 1OMWA 2UVXA 4CYIA 3G0FA 4IIRA 4V0GA 2WTKC 1PW2A 2R3LA 3BELA 3P7AA 5J95A 1F0QA 3D94A 4GKHA 4TNDA 2OJGA 5JQ5A 2W1ZA 3TJDA 3R73A 4F9YA 2G9XA 4W4WA 1PXIA 3F7ZA 3WYXA 2C5OA 5HLWA 3P0MA 4KAOA 4CG9A 5IEVA 3EFJA 5M4IA 2W7XA 5F94A 5GJDA 1H1SA 4IDVA 3VS7A 3QRKA 4FGBA 3KK9A 1Y8GA 2R3IA 2R2PA 3GC7A 4FT5A 3EN7A 4MD8E 2X9FA 4MXZA 2VTTA 3AOXA 3GU4A 5HHWA 3U9NA 3GCQA 5AV1A 4F09A 3D14A 3OEZA 4FGRA 2UW8A 3F2AA 2W1FA 5EHOA 3UP2A 4ASZA 1H07A 1U54A 2J50A 3OMVA 3BEGA 3EYGA 1Q5KA 3N9XA 4FV1A 3QAME 3ZFYA 4D2SA 3QZGA 2OK1A 3R83A 2CGVA 3W2OA 4IX3A 4NEUA 4RA4A 5C8MA 2QONA 4BDGA 3B2WA 1GZKA 3PWDA 5L2TA 4O7LA 2X2LA 3DJ5A 4ALWA 4D1ZA 3H9RA 4D2TA 2Y6MA 2WHBA 4KKGA 5DLSA 5AP6A 2ITVA 2VO0A 2XNEA 3P79A 4XG3A 4JXFA 3IW8A 5T68A 4PUZA 2ZM4A 4FKLA 3L8SA 4O86A 4IVCA 5ANGA 4I4FA 2WQOA 4U3ZA 3GU6A 5HCYA 5HO8A 4KD1A 5AUWA 5AM6A 4EH5A 3C9WA 5GJFA 2G15A 4D58A 5A4LA 3DK7A 1OVEA 4EBVA 3OROA 3WBLA 4B4LA 5E8YA 4GKIA 4WRSA 4AT3A 3UYTA 2WTWA 4YJNA 3CTHA 2V0DA 4AACA 3MVHA 5L2SA 3WZKA 4IVAA 3CQUA 4FT7A 3R8MA 5CASA 2A2AA 2YAKA 2PZPA 5CSVA 3A4PA 3HNGA 1XR1A 3MY5A 5K0KA 4AFEA 2BDJA 2FA2A 2PMOX 3HV5A 1ATPE 2QOIA 3CPBA 3DJ7A 2EB2A 3KU2A 3Q04A 4N0SA 5FTOA 3UODA 3ZHPC 3FI3A 3QQGA 4GJ2A 1V1KA 4X3FC 3DAJA 3FC1X 4YTFA 1SMHA 2WB8A 3G6HA 3BGQA 2R3NA 3SQQA 5BMSA 4U6RA 3TZ9A 3PZHA 5EYKA 1GZNA 5B7VA 2VTHA 5AJQA 5DG5A 3ZBFA 4BCNA 4EQCA 3NZ0A 5M4CA 4QYHA 5C4LA 2QOKA 2W1HA 4D2WA 4FV4A 4MXYA 5LOHA 3VBTA 2UZEA 2OICA 3MSSA 4DINA 1Q3WA 3D5WA 4XCUA 3ZSGA 5LWMA 2ITTA 1ZOHA 3ATSA 2QC6A 4LRKA 2PYWA 4KIPA 4O0WA 3H10A 3G15A 4QMNA 2BZHB 1WBNA 3JPVA 5I5ZA 5BYZA 5JFSA 3EKNA 3QGWA 4EJ7A 1OM1A 2XIXA 3KF7A 4FV0A 3IW6A 4RVKA 3MYGA 3T3UA 5L8LA 2RSVA 2BDWA 2VGPA 4G3FA 4QP9A 1T46A 3QTQA 4BHNA 3B2TA 3KMMA 4DH5A 4PX6A 2VV9A 2ZB0A 4XG2A 1GZOA 4GV1A 2ITNA 5HE0A 2JDSA 4IM3A 2XKDA 4DGMA 4QMWA 4JDJA 4RIYB 3KA0A 3BV3A 3T3VA 4CCBA 1H8FA 4DEIA 4KA3A 4C4EA 1U5RA 3S2PA 4XP3A 2DS1A 2RFEA 1QL6A 3MPAA 5AIKA 3AD4A 3PPZA 3R30A 3ANQA 3QZIA 3HLLA 5BVDA 2RKUA 4FV8A 3UC4A 4I4EA 3PXQA 3NR9A 4ANQA 4AX8A 5K4JA 2I1MA 3L8VA 5KCVA 1YWNA 4G3CA 4GH2A 4IZ5A 2GHLA 4PQNA 3IO7A 5BPYA 5AP3A 2P0CA 2XNMA 3VBWA 5DPVA 2C3IB 3LW0A 5HG8A 3QRJA 2W06A 5EQYA 4E1ZA 3Q4ZA 2ITWA 4RMZA 4S2ZA 4QP7A 2CDZA 1L8TA 4O1OA 4YJTA 1PXJA 2H34A 1AGWA 3COMA 4UWCA 5EYCA 4RVMA 4C62A 4IHPA 3OWKA 1YHWA 5ACKA 3R7EA 4F9BA 5AX9A 4FVRA 3UVPA 4DGLC 4JX3A 2RGPA 2BVAA 4BCPA 3SOAA 2YM5A 5LMBA 3D5UA 5M57A 4N6ZA 3MGYA 4FIHA 4RIYA 4WUNA 3PVWA 2XJ1A 1F5QA 3OD6X 5FWKK 1XWSA 3UYSA 3OWLA 2W9FB 1R0PA 4Y95A 5ANOA 1YI3A 5E8UA 3VQUA 1ZY5A 3F2NA 4NTTA 4MWIA 1OPLA 2YIYA 3BV2A 4QMPA 4WG3A 5HBHA 5L6WL 5DMZA 3QBNA 3MFTA 3SRVB 3NCZA 3TI1A 4M13A 4WIHA 4JQ8A 2QR8A 4ITHA 3O50A 1UU9A 4XP2A 5T6KA 2HY0A 1XJDA 4O6EA 4O7WA 5HLPA 1YXSA 5AR7A 2X6EA 1YQJA 1W83A 2BILB 2BRHA 3CBLA 3OT3A 3CLYA 3Q5ZA 4UYNA 4YJPA 5I3OA 4RIOA 4W8DA 2OZOA 4FE2A 3DAEA 4O7SA 2F4JA 3ALNA 3G2FA 2VX0A 2OZAB 1SNUA 5GHVA 3ZU7A 3ANRA 4H39A 1WBWA 5J8IA 3ZUVA 4D2VA 4DH8A 3PXFA 3G9NA 5E8TA 5JEBA 4WBOA 3WARA 2ITYA 2C6DA 3M42A 3NW7A 4K77A 2WEIA 5GJGA 3RP9A 2QHMA 3SOCA 5HU3A 5DNRA 3EKKA 3QQFA 1Q62A 3BHHA 4QMOA 5H8GA 4B7TA 4PTCA 4BCHA 1SYKA 3LXKA 4IQ6A 4UMRA 1E1VA 5HE2A 4D9TA 4BKYA 3EFWA 1RJBA 4ZP5A 4FV5A 4W9WA 1Z9XA 2GNHA 2YAAA 3WIKA 5LMKC 4CV9A 3QHRA 4V01A 4QYEA 4O0VA 4CXAA 3QTSA 3R6XA 5B2KA 4FTCA 3F3TA 3QD2B 3R1QA 2XK9A 3KN6A 3GC0A 4I21A 4O6LA 3QKLA 4TY1A 5CQWA 5FM2A 3ZM4A 4KUJA 5DYJA 3FQHA 3DKGA 4RWJA 4ERWA 4GFOA 3TIYA 3EZRA 2RFDA 1GZ8A 5C8NA 3UOJA 3SXFA 2CNQA 5AEPA 3BLHA 1KV1A 1CM8A 1MUOA 1JKKA 4I5CA 5FRIA 1KE5A 4O27B 3ZO4A 2BAJA 2OXDA 4K18A 2JFMA 4M97A 5FEDA 5JFXA 2X7FA 4QO9A 2BZIB 4C57A 2A4LA 2YIWA 3VW8A 4MKCA 4EBWA 3P08A 4IB3A 4EORA 3RK9A 4Y5HA 3KXNA 3LJ0A 5AR2A 4D2RA 1OIYA 3DLZA 4Z16A 3HP5A 4BKJA 1MRUA 4ANOA 5D12A 5KMNA 3PJCA 4OTIA 5LWNA 4PMSA 5FEEA 4XV3A 5FDXA 4B6LA 3DJ6A 2GNFA 4O0RA 4QTCA 1Y6BA 4FK6A 1ZMWA 4IE9A 4FSQA 4E6QA 3EQDA 3PSCA 3PP1A 5F95A 2Y4IC 2R7BA 3QC9A 4O7TA 3PIXA 4CT1A 3S0OA 4S34A 5IA5A 4DFUA 1NY3A 4DCAA 1YHVA 3TUDA 4FVQA 3HV7A 2J0IA 3H30A 2XZSA 2GFSA 3BWFA 2HELA 2CJMA 4L68A 1GIHA 2WTJA 2C5NA 3D7ZA 3OVVA 1JSVA 3BQCA 1ZZLA 3HX4A 4LRJA 2JD5A 3EQBA 3KMWA 2H9VA 3EFLA 2VAGA 4BTMA 4AOIA 5B2MA 4I6FA 2XF0A 2C0IA 3W32A 5AFVA 5EM5A 3II5A 4W4VA 2EXMA 2R7IA 2YZAA 4FTRA 3GP0A 1RQQA 4MCVA 3FJQE 3ZO3A 1LUFA 4DGOA 2Y9QA 4DFLA 3FZPA 4FT3A 4UMUA 2DUVA 5AUUA 3OCTA 2QI8A 1DI8A 3UP7A 3TL8A 3NDMA 3W2QA 3QZHA 4GUBA 3JS2A 2UVZA 4KIQA 2E9UA 4JG6A 4RRVA 4UYAA 2RG5A 3QRIA 2PPQA 3ZSIA 3GFEA 1O6YA 3IDPA 1E1XA 4UWBA 3VBQA 3AGMA 2BFYA 4FIEA 3ODYX 5CVGA 4AN9A 4EKKA 3FLSA 3AMYA 3ZRKA 3BEAA 1OUYA 3QFVA 3F61A 3P1AA 4FNYA 3U9CA 2BTSA 3A4OX 3GCSA 2JITA 2X2KA 3B8QA 3F5XA 5I9UA 2W1CA 2NO3A 2KULA 4ZSAA 3R21A 5BYYA 3COIA 3R7YA 3LXNA 4RWKA 3KXGA 3GOPA 3P9JA 3BLQA 2JIUA 1XQZA 4EI4A 1ZYJA 3Q6UA 2C4GA 2R3PA 4FKTA 4ZSEA 2O0UA 4XNEA 1ZY4A 3OW4A 4BDKA 4C8BA 3P5KA 5H8BA 3ZLSA 4C2WA 2QCSA 4YUQA 3PXYA 4M7IA 3WF5A 4OBOA 4F7JA 3AT2A 4ASXA 1GAGA 3GUBA 4FYOA 4QYGA 2I0HA 3LCDA 5IDNA 4BR3A 3LCKA 3FHIA 3EIDA 2GQSA 5CEMA 1W0XC 3QUEA 5LARA 3LE6A 4YBJA 5EM7A 4BB4A 1U5QA 5HCZA 3ORTA 3U4WA 1K2PA 1Q8UA 3DQXA 5CSHA 5CZHA 2CCIA 5IPJA 2LGCA 2O3PA 5KBQA 2QOFA 4M0ZA 1ZAOA 3PIYA 1REJA 3QA8A 3CGFA 3KMUA 4OUCA 3FLNC 3KULA 3FBVA 4NFMA 4ZTRA 5CNOA 5E92A 4K11A 4BWKA 4LOOA 3VNTA 3OCBA 3ZC6A 2WXVA 3SDJA 3C4FA 4QD6A 5EQPA 4USDA 4R3CA 4DFZE 4R1VA 3QCYA 2C0TA 5EM6A 4RA5A 3TV7A 2HW7A 2PSQA 1ZARA 5CVHA 5A4TA 3DU8A 3G51A 3LM5A 2UV2A 1ND4A 5AP2A 1REKA 3C5IA 4G5JA 4K9YA 2I7QA 1IR3A 4RGJA 2XKEA 3O2MA 3IG7A 5HNBA 2CKEA 4BCIA 5KO1A 5KHWA 4FVPA 4M67A 4UXQA 5TE0A 4FV7A 2CN5A 3HMOA 1NXKA 5AUYA 4NK9A 4FR4A 2FO0A 3GEQA 5D9HA 3I7CA 4AFJA 4ITIA 2YLFA 3N51A 3N4VA 4RZWA 2FSOX 3GOKA 3SXSA 5BX0A 4CTCA 2VN9A 1SVEA 4KB8A 3MV5A 2I40A 1LPUA 3FMLA 3LFFA 4LG4A 2YFXA 4LOQA 4GUEA 2OJIA 2OH0E 3NSZA 3UG2A 4E4LA 2HY81 4EH6A 3AT3A 4XP0A 3RK7A 5J7BA 2FYSA 2B9FA 3F69A 1B39A 1GNGA 5TT7A 4DT9A 1O6KA 2VWZA 2ZV7A 3FI2A 3W1FA 3RI1A 4EHGA 2CLXA 2XIZA 4XG8A 5HNGA 4KS8A 2R3RA 4LMUA 5K0XA 1PF8A 4EH9A 3I1AA 3CS9A 4QMVA 3D2IA 4CQEA 1OIUA 3NUYA 4NKSA 3RCDA 3SHEA 1R78A 2UVYA 2R3KA 4B8LA 4A9TA 1YWRA 4U9AA 5TKDA 2PHKA 4GK2A 4USFA 4UX9A 2VTOA 4PWNA 1FQ1B 5BUIA 3ACKA 4OTFA 2XJ2A 5AX3A 4W4YA 3VAPA 1OUKA 3NUSA 3NNUA 4JAJA 4KWPA 5EYDA 3W16A 4ANSA 4CTBA 2R3MA 4K1BA 1ZRZA 3T9IA 5IA3A 4E6DA 4F1TA 4NL0A 3P7CA 1XBAA 2OXYA 3IGOA 3OCSA 4WNMA 2Z7QA 4I6QA 2HENA 3WZDA 4DG0E 4LV5A 4UMPA 2EUFB 2QOCA 4LQMA 4FMQA 1DAWA 5JSMA 4PL3A 3KL8A 3RM7A 2YJRA 3LQ3A 4JG7A 4UV0A 5CANA 3KGAA 5BYLA 3QWJA 2BAQA 3ETAA 5GIPE 2OSCA 1P2AA 3QA0A 1MRVA 3PA4A 4YZMA 4ALUA 2BRBA 2VO3A 4JG8A 2HOGA 3FV8A 3KXXA 2ZMCA 4ZS4A 3D4QA 5IA1A 4D4VA 4ORKA 2NRUA 4JQ7A 3RZFA 4YO4A 2UUEA 2V55A 4R3PA 5ANKA 3ZCLA 1ZWSA 4JT3A 3SAYA 5J1WA 1H1PA 2BAKA 4AW5A 4J52A 3VUTA 2WQEA 4J96A 5CVFA 3LJ2A 4Q9ZA 1M2QA 3P78A 5DBXA 3VHKA 4LL5A 1LP4A 2EU9A 3PLSA 4I5MA 1J1CA 3ORPA 2C5XA 3OWPA 4FSMA 2YWVA 3RWPA 2PVMA 4L7FA 2OI4X 2RFSA 3QKKA 4QQ5A 4YHFA 3MH1A 1FOTA 3KQ7A 4PTGA 5AP0A 2ZVAA 1OL1A 1Q99A 4YR8A 2BDFA 4XX9A 2WTIA 5BQ0A 5CAPA 1JBPE 2VTPA 3RMFA 3UVQA 2ZYBA 3S00A 2XRWA 3F88A 2GMXA 2QVSE 4ZOGA 2WQNA 3LQ8A 3NW5A 2ZJWA 3F3VA 1KWPA 4YJRA 4QP6A 3TNHA 4A07A 5CU0A 2C5YA 2A19B 4FKGA 4J71A 4Q2AA 4FKWA 4YZNA 4H1JA 4I5PA 4F6UA 2J0MB 4BBMA 5AV2A 4U8ZA 4BC6A 3IKAA 3POOA 2O2UA 4JQEA 5ANDA 1YRPA 4NCTA 3GENA 5DEYA 5E4HA 3FC2A 5FXRA 1A9UA 2PE2A 3DZQA 3PG3A 4FKUA 4XLIA 3UMWA 3HA8A 3LAUA 3R9HA 5LVOA 2XS0A 2PL0A 3LFBA 4YJOA 2ETRA 4LGHA 4RJ3A 5HTIA 1BL7A 3G6GA 2GS2A 3KXMA 2GQRA 4I6HA 3GQLA 4MTAA 5EKOA 4EHEA 3DY7A 4PV0A 3QWKA 4L3JA 2VZ6A 2Z02A 4BY9E 3PSBA 5ICPA 3Q2MA 1XBBA 1XH5A 4FIFA 5FLFA 4AZTA 1ERKA 1JNKA 2OKRA 3O23A 2R5TA 2WIHA 4MQ2A 3OOGA 2W0JA 3LMIA 1SNXA 5EW9A 3ZFXA 2ACXA 3MN3A 5A46A 3BE2A 4YLKA 3WF6A 5IF1A 2V5QA 2VRXA 2PVRA 1YVJA 3JY9A 4RBLA 2GNIA 3TXOA 3D5XA 2WTKB 1M52A 1GJOA 4RJ8A 4U79A 5HIEA 4RIXA 3F3ZA 3ORIA 2RF9A 3QKMA 2R3FA 2OO8X 4J95A 3PLAE 1IASA 4R78A 3QTUA 4AT4A 5JRQA 4Q5EA 1I44A 3ZEWA 4BDFA 4LUDA 5FXSA 3MH0A 3MVJA 4TWPA 4CFVA 1BX6A 3Q4TA 4LMNA 4O83A 4BCMA 2ZM3A 3QZFA 2BKKA 1UV5A 3A2CA 3CKWA 2UZNA 3RPVA 4OW8A 2W5AA 4I0RA 5FTGA 4ZXTA 1F3MC 2CGUA 4FL3A 4TYJA 3WF8A 3VS4A 3DTCA 4TPTA 4F7SA 3COHA 3E64A 2VTRA 3DLSA 5DE2A 4A9YA 3IK3A 2G01A 2X7OA 3CTJA 4QYYA 4AW0A 1G8SA 2XK3A 4HYIA 3TN8A 4QMSA 4HOKA 1OI9A 4L01A 3RNIA 4CMUA 3UMXA 1LEZA 5F4NA 2BZJA 3P86A 3E8DA 3R8VA 1J3HA 4F64A 2E2BA 3HRBA 2WOTA 4U5JA 4CYJA 2YM7A 1JSUA 3GB2A 3LFEA 2P2IA 3NAYA 4BCFA 3DCVA 4H05A 1TQIA 2PZYA 4I94A 3TJCA 4LOPA 4OTDA 2GSFA 3MS9A 3QCXA 3DOGA 3F3UA 4YZ9A 1MQBA 5IUHA 4FSUA 2UW3A 5CQUA 3KN5A 3FQEA 3UPZA 4E5AX 3PE1A 4JLCA 4O0YA 5CENA 5TR6A 2XVDA 4ONAA 1OL5A 2W1DA 2WMUA 2YDIA 1OKWA 3GT8A 1STCE 2XMYA 3EZVA 3PJ1A 4IADA 4BN1A 3DKFA 1PJKA 3QRUA 4KIOA 1PYEA 4U80A 2C5VA 4WSQA 3A7FA 4P7EA 4R3RA 3GU7A 2CGXA 5J1VA 4BI1A 4YNOA 3AC2A 1QPEA 2GNGA 1ZYSA 2R0UA 2JKKA 2PUNA 3MI9A 2YCQA 3BHUA 4X3FB 1Q8YA 2G2FA 5JRSA 2ITPA 4MYGA 5D10A 2X8DA 3VUMA 5AV4A 4ZIMA 3QX4A 4FIIA 4RQKA 1XBCA 3FKNA 3E93A 5B2LA 4NW5A 2BFXA 2AC5A 3I6UA 1H27A 3FY0A 3H4JA 3ORLA 4H3BA 4I0SA 3KFAA 5FBOA 1KE7A 3UNJA 2FH9A 2JIVA 4HVGA 5EOLA 1OGUA 4X2GA 2HYYA 2PVJA 5DR6A 3HAMA 4F7LA 4O7ZA 3WE4A 4GVJA 4JR3A 4RJ6A 2OWBA 4JBVA 3VUHA 2J9MA 1OKYA 4Z7GA 4AW2A 4IFCA 5KHXA 4BRXA 2C6TA 1WMKA 2VD5A 4XRJA 5BVOA 2YISA 3WF9A 2YM6A 2H96A 1JWHA 2IJMA 3MVMA 4XG6A 5ACBC 5L2WA 3PXKA 3EN6A 1PKDA 3TTIA 2XYNA 3PY1A 1XH6A 3ZLWA 1OIRA 4M12A 1H24A 1BYGA 4H3PA 4OTWA 4E20A 4IAKA 3SW4A 5FUTA 4FT9A 4EZ5A 4X3FA 1UU3A 4IW0A 3EQCA 3HZTA 2C6LA 2PMNX 4HCTA 1KSWA 2IW9A 4HJOA 5FP5A 3PDTA 3VS3A 5J5SA 2YHVA 3FZSA 3SC1A 2AUHA 2V62A 3ERKA 3ZXTA 4EK4A 3DBFA 5CAQA 5HZNA 3FI4A 4I5HA 4NJ3A 5CZIA 4HGTA 4EH8A 4D4YA 5KMJA 2XK4A 4WG4A 4IDTA 2OU7A 3OBJA 4CFUA 3MBLA 2WNTA 4WSYA 4X0MA 4MHAA 4MF1A 2VWBA 4AGCA 2BMCA 4A9RA 3R2YA 4EYMA 5AADA 1UWHA 2WPAA 1V0PA 2YCRA 2YERA 2Z7LA 4HCUA 4I1ZA 2UW0A 3DFAA 4BZDA 1FGIA 3PA3A 4BCGA 2X9EA 1GIIA 2QKWB 5EI6A 2YIXA 4AT5A 3OEFX 4RC2A 4AZSA 3IW5A 3C4EA 4M3QA 3MB6A 2J5EA 4BVUA 4UXLA 3WZJA 5F9EA 5IQDA 1UWJA 3GCPA 2B9IA 4FTUA 2XBAA 3RK5A 3ROYA 2W05A 4CRSA 3VBYA 4DEGA 4I23A 2PU8A 2OG8A 4Z3VA 4GFMA 3U4UA 1OL6A 5I9WA 1YOJA 2JAVA 4AG8A 4ANNA 3EQFA 3LZBA 5HVJA 4FNXA 3QQLA 5E8SA 4Y46A 5M07A 2GU8A 3TDVA 1RW8A 3CJFA 1HOWA 4LM5A 5DA3A 2JFLA 3U87A 5JZJA 2WAJA 5A6OA 4UZDA 5M56A 3L9LA 1ZYLA 4QT1A 4BGHA 4OBPA 5AM7A 4AGUA 3U6JA 4A4OA 3TACA 2JDOA 5BVEA 4CQGA 4YLLA 4DH1A 5HIBA 3TDWA 3GBZA 1CTPE 5FG8A 4IANA 4L3LA 4L53A 4WO5A 4CKIA 4D5HA 1WBTA 3AMBA 1YDRE 3Q53A 3PJ2A 4RX9A 3TCPA 3VBVA 4UMTA 5I9YA 4L52A 3ORNA 4F1MA 2XNNA 3OT8A 4NM5A 4LGGA 4WD5A 2OGVA 4J7BA 4XS2A 4ZEGA 4CD0A 5CEPA 2QG7A 2PMIA 3V3VA 3UO6A 2BZKB 4WG5A 4B99A 1NVRA 3QXOA 4P2KA 4LGDA 4LRMA 4C2VA 4IAYA 4ANLA 4EUUA 2QU6A 5IMXA 4NM7A 4DLIA 3NPCA 2VTIA 3Q9WA 5D1JA 5DI1A 5BNJA 4IZYA 2J2IB 3O8PA 4QMXA 4YURA 3POZA 2J6MA 5A4EA 5J9ZA 3SGCA 2C69A 4P5QA 3A99A 3RTPA 2IW6A 1TKIA 5EG3A 3V8SA 3I4BA 2CKPA 3MY1A 4DGNA 1UU7A 2W4OA 4XV9A 5K5XA 1T45A 2UW9A 1YDTE 5DOSA 2PUPA 1FVTA 3ZOSA 4YP8A 5HTBA 4JS8A 1FPUA 3C4CA 1FINA 2E9VA 2ERKA 3IW7A 2UW6A 3OXIA 3WI6A 3D9VA 3ULIA 3FZTA 4JIAA 3NGAA 1SVHA 1U46A 2UZWE 4C4HA 3R1YA 3BX5A 3PYYA 2V7AA 3PXZA 1I09A 3AXWA 3QC4A 4JL9A 4C37A 3S1HA 4DBXA 2G2HA 3RPSA 4O96A 2Y4PA 1M7QA 1O6LA 3OF0A 2XM8A 3FMKA 3V5JA 4RX8A 3VS6A 3ZS5A 2NNWB 1Z5MA 4TWCA 2HIWA 3R8ZA 5KZ0A 3S4QA 4E8AA 1FMOE 4HNFA 4AOJA 3UVRA 5GINE 3QHWA 4IMYA 3RBWA 1VJYA 4ASEA 4O81A 3K54A 3LQ5A 2XIYA 4ZTHA 1KE6A 5HE3A 4PY1A 4NIFB 5A54A 5IQBA 2XM9A 4AZFA 4W8EA 2RG6A 2VTLA 3ZLXA 5IA4A 4TYHB 4RLKA 4FEWA 3NNXA 3E5AA 3QU0A 2PULA 4AWIA 1J1BA 4YTHA 4A9SA 4DH7A 1Q41A 2QO9A 3PVUA 5DEWA 5KMMA 2H6DA 1PXNA 2Z2WA 3CKXA 1BUHA 4F63A 2JC6A 4C59A 4MXXA 5CU4A 4BDJA 3CP9A 5AAFA 3W8QA 4L00A 3ZSHA 4N6YA 5DT4A 4C3RA 5I3RA 2UZBA 4QTEA 5LMKA 3OXZA 5H2UA 4ERKA 4F70A 3OY1A 2YLEA 1PY5A 4F0IA 3MFSA 3CIKA 1FVRA 4RVLA 4FKIA 2I0VA 2Y4IB 3NUNA 4FG9A 3D0EA 4RLLA 3LJ1A 4GRBA 3SKCA 1OBGA 2UZUE 5KZIA 4KSPA 1JLUE 2VTMA 3VJNA 4UN0C 1JPAA 3TKIA 1WBVA 3Q5IA 3R9RA 4CKRA 3ZLYA 4YPDA 4G2FA 4IAAA 3KY2A 4IM0A 4NIFA 4X7QA 3F5UA 2WD1A 2O8YA 1YW2A 2WEVA 4RT7A 5EYMA 5EDQA 2FSMX 3DXQA 4XEYA 3W2SA 4TYHA 4EQUA 5IU2A 3EQIA 4RFYA 4F4PA 3U6HA 4R1YA 2JKMA 3MH2A 4O7RA 1YOLA 1WVWA 5CU6A 3Q3BA 4L45A 5HQ0A 3D2KA 3MFRA 2YCFA 3AC4A 2WIPA 5HD7A 2OJFE 5TO8A 4EK6A 1DS5A 3PA5A 3VUKA 4BIDA 3NLBA 4E3CA 3CGOA 4RIWA 4BTKA 1M2PA 2FGIA 3W33A 4GT5A 1BL6A 4QP8A 4L3PA 2QQ7A 5E8ZA 5JFVA 5BVWA 5EI8A 5LVNA 4ENXA 1JVPP 3NX8A 1VZOA 1JKLA 3UBDA 3K3IA 3R7OA 3UOLA 3EB0A 4C3PA 4Q5HA 4YSJA 4IWQA 5LJJA 4A4LA 1V0OA 3K3JA 5CAOA 3TUCA 3GNIB 2CN8A 4E26A 3I79A 3CEKA 4FTQA 1OKVA 3QCQA 4H1MA 4MXOA 4BCJA 3MIYA 4ZZMA 4IAIA 5AP1A 3IOPA 3EN4A 4XYFA 3LMGA 4E5WA 4RSSA 3FSKA 2IVVA 3ACJA 3LLTA 2JKQA 5DT3A 3VF8A 2OIBA 3HAVA 2X4FA 3BYSA 2XNOA 3GC8A 4U97A 4CG8A 4J97A 5LMAA 2QOLA 4YZCA 2GHGA 2J0KA 4BDEA 4G16A 5L4QA 4JDKA 5IQEA 5HLNA 2BPMA 4G6NA 1Q3DA 2E9PA 3BLRA 4XUFA 3S3IA 2F7XE 3F9NA 4Y83A 4EWHA 3CJGA 5K9IA 3A61A 3FMMA 1YWVA 3VUGA 4EC9A 4IX5A 3ZM9A 3A8XA 5HD4A 4WHZA 2J5FA 5CXZA 2ZM1A 4L9IA 2WTVA 2XKFA 3FLZA 1W82A 4E7WA 5CY3A 4KRCA 2F7EE 3LCSA 2W96B 3DKOA 1NW1A 4C34A 5JQ8A 2ZDTA 4BZOA 2HZ0A 2CKQA 2W17A 2CMWA 3GI3A 4DGGA 5IG1A 3AC1A 4ACHA 4PDYA 2C1BA 3W8LA 4HGSA 2G1TA 4CMOA 3KXHA 4NYEA 2R64A 5HX6A 3V5WA 4RG0A 2EXCX 4GW8A 4KBAA 4ZLZA 4EOSA 4R7BA 5J5TA 4L42A 3RGFA 4QQTA 4JBPA 4IAFA 3UIMA 4AUAA 5DR2A 4D4RA 3QGYA 4FTIA 2Q83A 3EYHA 3KULB 5JK3A 2JAMA 5M09A 3SG8A 5ETAA 4RPVA 3OWJA 1PXOA 3JY0A 3NUUA 3PSDA 3E8EA 2HAKA 4L8MA 4WNOA 3ITZA 1K3AA 4F0FA 1WAKA 5E8VA 4IVDA 2O65A 1P4FA 4R5YA 4KNBA 5HX8A 3NVMB 4BDDA 5E8XA 5M53A 4Y73A 4FEUA 2ZV9A 2KTYA 4FOBA 4DEDA 1DAYA 2XK8A 3R9NA 3ZO2A 3NUAA 4RJ4A 2WGJA 3FL4A 2HW6A 4L67A 2JDRA 3MJ1A 3R00A 5HO6A 5HBJA 5LVPA 1R0EA 3RNYA 3RAWA 2VNYA 4G3DA 5EDPA 1Y91A 5LCJA 2C47A 4FIJA 1J7LA 1FMKA 4FKRA 2ZV2A 3EQRA 4U43A 4XV1A 3FPMA 3NUXA 4FICA 4FOCA 3ZXZA 2XIKA 1BMKA 4Y85A 2B52A 4AE6A 4BKZA 4YJUA 4EONA 3P23A 1BI7A 3MH3A 2X7GA 2A0CX 3GU5A 3BGPA 5H8EA 3UJGA 4C38A 1J7UA 5EH0A 4IEBA 3TV4A 3CR0A 3FXWA 5ANEA 5E90A 2QOHA 4UALA 5GZ9A 3ZZWA 2CNVA 4G1WA 2C68A 2PTKA 3ATTA 3Q60A 4RWIA 1Q61A 3DQWA 4XJ0A 3FY2A 4TNBA 3R22A 4TYGA 3CY3A 1H25A 3VJOA 2F2CB 4DHFA 3QTWA 3UNKA 2F7ZE 4UY9A 1YKRA 5IH6A 1OB3A 3EN5A 3FMHA 4IM2A 3ZFMA 3P7BA 3QCSA 3REPA 3LVPA 5IUGA 3WZEA 4DC2A 3GCUA 4FV9A 4O0XA 3GFWA 3GC9A 5M08A 1YXUA 4KBKA 4NU1A 4C36A 2Z7RA 2IVUA 2NPQA 3BPRA 3HVCA 3HV3A 3KVWA 4IX6A 4FKJA 1Y6AA 3HYHA 2GQGA 1GIJA 5C4KA 1SVGA 5DIAA 3R01A 4MVFA 4I22A 5HG5A 3ZUTA 5HORA 1VR2A 1ZYDA 1YXXA 4I3ZA 4EL9A 1IAHA 3JYAA 4FYNA 4M84A 5KMLA 1PKGA 4CV8A 1K9AA 1OBDA 3OTVA 1OITA 4P90A 3OFMA 3EL7A 4NM0A 2IZSA 5H9BA 4OAUC 2XCKA 4DFYA 3NS9A 2B1PA 3MTLA 4G9CA 3WF7A 4Z7HA 4FEXA 3V5PA 1URWA 4A9UA 4GJ3A 5A4QA 3UNZA 3PVBA 1NA7A 4JRNA 3V5QA 4BDAA 4BF2A 4BTFA 3SA0A 4XMOA 5IQHA 3AD5A 4N70A 4QMQA 1M17A 3DA6A 2XUUA 4H36A 4YNEA 3FXZA 3WIGA 3BYOA 3DFCB 3R1SA 4KRDA 1V0BA 4AF3A 1OL2A 4TKSA 2Q0BA 2DYLA 5AAGA 5KKRC 3Q2JA 3WILA 2J90A 4DFNA 3FKOA 4DAWA 3G0EA 1H0WA 2ONLC 3G9LX 4JRVA 2VTSA 3UQGA 4G9RA 5CEIA 4ARKA 4F99A 2YACA 1FBNA 2J7TA 2GCDA 3UC3A 3FMDA 2W4JA 2IW8A 4F9CA 4C0TA 5L6PA 5BMMA 2QU5A 4YTIA 5AR8A 3DXPA 5C27A 3MFUA 4GT4A 4JDIA 1ZMVA 3DV3A 3QYWA 1IAJA 3RCJA 3JVSA 4I92A 4HYHA 3OTUA 2BRMA 2I0YA 3C4WA 4G6OA 4OT6A 3HRCA 2QOBA 2QO7A 2HZ4A 4ZJVA 4AN2A 3EQGA 3NVKI 3UTOA 5IQIA 4HVIA 3RHXA 2YM8A 2CCHA 3DBDA 2CGWA 5EI2A 4RX5A 2P4IA 2C30A 4QMMA 3E8NA 4FTKA 2X81A 2Y8OA 2YM4A 3RHKA 2HXQA 3A7JA 3LXPA 4QTDA 3TUBA 4DE4A 1KOAA 2JBPA 2P55A 3BE9A 3AMAA 3FZOA 4OT5A 4PTEA 4XG4A 2GDOA 1NVQA 4X2FA 3UG1A 3QUPA 2W5BA 2REIA 2VTNA 3MA6A 3RPYA 5A4CA 4W4XA 2C6EA 2PWLA 2ERZE 3EFKA 3U54A 5CALA 2J51A 4IX4A 4IZ7A 4V04A 2G2IA 2B9JA 4C4GA 1O9UA 2GS6A 4CZUA 4BICA 4AGDA 2QNJA 3DB6A 4FTJA 4TXCA 4F9AA 3BBTB 3BQRA 1R3CA 4EH2A 4I20A 3HDNA 4L44A 2R4BA 4GU6A 4O7YA 3DDPA 1KE9A 4Y72A 3UE4A 5E8WA 3RM6A 3G90X 4GMYA 4QPMA 3OW3A 3EN9A 4L6QA 1UKHA 3BU6A 2UW4A 3IDCA 4RC4A 5FXQA 1U59A 3UIUA 1XH7A 3LFAA 4FF8A 5HVYA 2XKCA 4QPAA 5AMNA 4EOIA 4HVHA 4CLIA 3RPOA 2VWUA 4NKAA 4YU2A 1H01A 3DPKA 4ZZNA 1PMVA 4FZ6A 3FYJX 2PVYA 3GGFA 3IECA 3O51A 4HW7A 4B9DA 5HI2A 3KF4A 3V04A 5J87A 4MBLA 1XH9A 4RIXB 3R9DA 5HO7A 4MXAA 4IB1A 3KRJA 2W1GA 1FVVA 2PVKA 3EMGA 4J53A 5IMEA 2VTAA 1H0VA 4KKEA 3FL5A 3T8OA 3R2BA 4G34A 3G33A 4C4IA 4UWYA 4H58A 3VQHA 3PJ8A 4D1XA 1WBSA 2X1NA 1PYXA 3D7TB 3EQHA 3F5PA 3KEXA 3WE8A 3LXLA 4ALVA 4BGGA 3UO4A 3H9FA 3K2LA 5E1SA 5CF6A 3I7BA 2W5HA 3ALOA 2F49A 5CYIA 4U40A 3DTWA 4XRLA 1Q4LA 3A7GA 4MWHA 3AC5A 3FLQA 4FKPA 4Y5QA 4ZY4A 3L9PA 3U51A 2WMQA 4X21A 2Z60A 3DNEA 3F82A 5AUZA 3ZZEA 4O0UA 4PP9A 3C50A 1KE8A 5AR5A 4FV2A 5CAVA 3BHVA 2JDVA 5L8KA 4FKQA 5J7HA 4AAAA 2BHHA 4FKVA 3R8LA 1PHKA 4EOPA 3OP5A 3UOHA 5JGBA 4KKHA 3HGKA 5EQEA 5JKGA 4ZK5A 2WMAA 3O0GA 4M15A 4AOTA 3CY2A 5KMKA 2WMRA 3LMHA 2O63A 3QTXA 3UOKA 5BVNA 4FSWA 2W1IA 5L3AA 4FTNA 1JAMA 2BRNA 2GHMA 5I0BA 3QQHA 4GK4A 5CSWA 4AN3A 5CI6A 2V7OA 4TRLA 4FTAA 4YLJA 5I9ZA 2BALA 2PE1A 4RJ5A 1CMKE 5DT0A 4G17A 3D7TA 3HECA 4MXCA 3R9OA 3NEWA 3RINA 4G6LA 4GS6A 2BIYA 1P4OA 2WFYA 3LCTA 4BDBA 4CMTA 4EQMA 4FSYA 4E4XA 3NIEA 1SM2A 2C6MA 4II5A 4HVDA 3R04A 3PG1A 1CKPA 4A4XA 5C1QB 1MQ4A 3DNDA 4C3FA 4O7VA 4U7ZA 5KMIA 1M2RA 3C13A 5AP4A 2XBJA 4FEVA 4R7IA 3SLSA 1PXMA 2BR1A 3QRTA 4FI1A 3ROCA 1OPJA 3RALA 2Z8CA 5KUPA 4BTJA 4GG7A 2FSTX 2W9ZB 3FEGA 2C1AA 5IQAA 1W98A 3D15A 2ZDUA 3V5TA 3TZ7A 4D5KA 5GZAA 3NWWA 2ETMA 5EHYA 1RDQE 3PXRA 4JDHA 5FGKA 4PDSA 4C61A 3W18A 5FEQA 2EWAA 4E5BA 2C3JA 4HYSA 4J1RA 2IVSA 1H26A 4ZY6A 2UZTA 4N57A 3FHRA 4F08A 1ZXEA 2IVTA 4E6AA 5CTPA 1W84A 3H9OA 2OFUA 4WOVA 2R3GA 2WOUA 3I0OA 4KBCA 2ZB1A 4NW6A 3VULA 4F6WA 4BCQA 4QNYA 1A06A 5IUIA 3SD0A 5DRDA 1H28A 5CLPA 4DITA 4PNKA 5I9XA 4QMLA 2JLDA 5I4NA 3TEIA 4OR5A 4KS7A 5EM8A 4XOZA 5FM3A 3CD3A 5CT7A 3PFQA 4J98A 4X2JA 3R7IA 4BIBA 2WMSA 5F20A 3CC6A 3BGZA 2PMLX 3PPJA 3DBQA 1G3NA 2VX1A 2IO6A 2WKMA 4QQCA 4RJ7A 3UZTA 3HEGA 3MTFA 2ZAZA 2J4ZA 1QCFA 4YZDA 4C02A 2YM3A 3L1SA 4MAOA 4EHZA 3TNPC 2PZ5A 3BCEA 1RE8A 4IWPA 4PF4A 3ZDUA 5FBNC 4MNFA 4BL1A 5HTCA 3NYXA 3MESA 3VVHA 2RL5A 3WOWA 3OCGA 4GSBA 3A62A 4GFGA 1ZLTA 1EH4A 1M7NA 1WZYA 2DQ7X 3SX9A 4FZFB 5AUXA 1E9HA 3PUPA 5E9EA 3NYNA 2W99B 3RAIA 5J9LA 1B6CB 5C03A 3DZOA 4CCUA 2AC3A 2EVAA 3OOMA 4IAZA 4ACDA 1IG1A 2GPHA 4FNZA 1IEPA 3VWAA 4DYMA 5IQFA 4WBBB 1W7HA 4AZWA 4IB0A 3H3CA 4ZMFA 1ZOGA 3D83A 4AA0A 2OIDA 3R8UA 2GFCA 4PPCA 3TKHA 3G5DA 2IZUA 3SV0A 2IPXA 5L6OA 4FTMA 1WBOA 4TYEA 3QLFA 5HGIA 4ACMA 3MPMA 4MD7E 4OBQA 4RX7A 3ZRLA 5JT2A 2UZLA 4L7SA 2B4SB 4PPAA 1UVRA 4QYFA 2VNWA 1JSTA 4FBXA 4AZEA 4GK3A 4BFMA 4CZTA 3CPCA 2IWIA 4BWPA 1OECA 2FUMA 3GU8A 4C35A 4XOYA 3FI8A 4DG3E 4O2PA 1TVOA 2PUUA 4EH7A 4WKQA 1IRKA 5AIRA 2ETKA 4FODA 4CVAA 4DEEA 4FZAB 2QOOA 2F2UA 2ITUA 5CEKA 5HVKA 4WUAA 4M69B 4PDOA 4NZWB 5HKMA 5AUVA 4O7NA 4RFMA 5AR3A 4ENYA 3Q32A 1Y8YA 5M55A 4BDIA 4ZJIA 1IA9A 2C6OA 1Q97A 5KBRA 2XRUA 5FP6A 4Z55A 5A6NA 2WO6A 4YHJA 3LFNA 4USEA 2GTMA 1ZZ2A 2BROA 3HMNA 3NNVA 2WZJA 1KOBA 3PY3A 3R71A 4G3GA 5CSXA 3DT1A 3KCFA 1P14A 3A7HA 5CS6A 4AGWA 4E4MA 3QD4A 2X8EA 4LFIA 4C33A 2QURA 4IH8A 4PPBA 5CF8A 4C4JA 3O17A 4U81A 3Q9YA 4AA5A 4IXPA 4NUSA 3U6IA 5F1ZA 2XJ0A 3NW6A 5IZFA 4FG7A 3BHYA 4QP3A 4JNWA 4BI0A 2PY3A 1WBPA 3FQSA 2B55A 4HNIA 5A3XA 4AZVA 4EH4A 3A7IA 4NH1A 4O82A 3MA3A 3NUPA 3MPTA 3E7VA 4EOJA 5AAEA 5KMOA 3HMMA 2NRYA 2QD9A 4EH3A 3RVGA 5HEZA 3FLWA 3E63A 5G1XA 4CGAA 4PRJA 4M69A 3N4TA 2E9NA 4BBFA 2BKZA 2PVHA 4LYNA 4BIEA 4D9UA 3DK3A 4QMTA 3W10A 2Y0AA 3DS6A 3HDMA 3V5LA 4F9WA 3EWHA 2QOQA 2XNGA 4EHVA 2OF4A 1QMZA 4ZTQA 4AW1A 2JDTA 4NT4A 3FYKX 3KXZA 3PZEA 4ZLOA 4YC6A 3QYZA 4EC8A 2HWPA 4EOKA 5K4IA 2J0LA 1OL7A 2VGOA 2OJ9A 2WU7A 5BUJA 1OZ1A 3KRXA 3U8WA 5C01A 4CSVA 4S32A 1DI9A 2YDJA 3KB7A 4V05A 4EOMA 4MNEB 2B0QA 4GYIA 1Q24A 3VRYA 4DEAA 3TZMA 4K2RA 5LVMA 4YTCA 3TTJA 5LQFA 3QX2A 5AA9A 2H8HA 2WU6A 3FZRA 5KNJA 1VYWA 3FUPA 4G3EA 4NM3A 3OBGA 4QMYA 4X6QC 2LAVA 1BKXA 1UNHA 2ITQA 1S9IA 1TQMA 3I0QA 4I24A 3TT0A 3SXRA 1OPKA 3IDBA 4AA4A 4QPSA 3ZUUA 3IPHA 1H1RA 4GU9A 4WNKA 4XLVA 3VO3A 5HU9A 1ZOEA 4LV8A 1YDSE 3R0TA 4K33A 3ZDIA 4O1PA 1YHSA 3KK8A 3E3PA 4TW9A 3VIDA 4FV3A 5HCXA 1B38A 3ZEPA 5A9UA 2IG7A 3UQFA 5D11A 4D0XA 3PVGA 2R0IA 3A60A 4LUEA 5ANIA 4IWOA 4PP7A 3HMIA 4FSRA 3PJ3A 4YC8A 4FKSA 2QHNA 4ZY5A 4GVAA 2VU3A 4MNEA 4MD9E 3E3BX 2B9HA 2C0OA 4Q9SA 5AWMA 3JXWA 4QTBA 5I9VA 3BIZA 5AR4A 1P5EA 2C6IA 3QUDA 5ANJA 1UA2A 4FL2A 4C4FA 1CKJA 4YJSA 1JKSA 4XHKB 3VUDA 3ZH8A 4O22A 4D2PA 5M06A 1X8BA 1CKIA 1JKTA 3HL7A 3MY0A 4WA9A 1R39A 5C26A 4RIWB 1FGKA 4IC8A 3IGGA 3AD6A 5E91A 2HZNA 2WQBA 3I6WA 1URCA 4RFZA 2P2HA 4S31A 2B7AA 3NNWA 5LXMA 1H1QA 4JVGA 3JR1A 4F7NA 5J9YA 3BU5A 3UPXA 4APPA 4O0SA 3VF9A 3ORZA 1JOWB 3LFDA 3OS3A 2OW3A 4FUYA 3VS1A 3ORMA 3K5VA 3UIBA 5KX8A 4NJDA 4EUTA 3CQEA 3L9NA 3IQ7A 3BWJA 3OUNB 5CF5A 3O7LD 3F3WA 4XBUA 3O8TA 2WTCA 3CE3A 1J91A 4RVTA 5ETIA 4A06A 1QPJA 5C9CA 4L43A 4C58A 3BZ3A 4MH7A 2X0GA 3M11A 4FSTA 5D7AA 5IISA 2YWPA 2PVLA 4XG9A 5D7VA 3CXWA 3LLAA 3OZ6A 3QL8A 4ACGA 2CPKE 3VW6A 2FSLX 3E92A 3SRVA 4ANMA 1VEBA 5CU3A 4DEBA 4BI2A 4M14A 4U44A 2VWYA 1H1WA 4EKLA 3UZRA 4RWLA 2B53A 3LKMA 3N4UA 4OLIA 4RZVA 5CT0A 5K5NA 3RWQA 3EL8A 4FL1A 3DXNA 3NAXA 4BDCA 2GTNA 4HVSA 3FSFA 2BRGA 3C0IA 2C3LA 2XH5A 1PMEA 1ZYCA 3F7WA 3MIAA 2YEXA 4M8TA 4QOXA 5EHLA 5EFQA 2PVNA 2OZAA 1H4LA 4FTOA 2A27A 3QXPA 5T3QA 4ACCA 2R3JA 4DCEA 2AYPA 5FQDC 3PE2A 1GY3A 1JQHA 4TZRA 4ZSJA 5CSPA 4GEOA 5DR9A 2XB7A 4O38A 3GQIA 4IC7A 4MEDA 5C8KA 5M4UA 2BCJA 2OJJA 2Q0NA 2XEYA 2XK7A 3DGKA 4JJRA 4JX7A 4GYGA 4OTHA 5AP5A 5E7RA 1WVYA 4CRLA 4DG2E 2VWWA 4IVBA 2RIOA 4GIHA 3V6RA 1HCKA 2P33A 2QG5A 2GNJA 5HNIX 4JIKA 4YSMA 2ITOA 4OAVB 4YMJA 3Q9ZA 3R02A 4MQ1A 5JH6A 5CWZA 4QP1A 5AA8A 1A48A 2HXLA 5IEXA 4AE9A 4CEGA 4TT7A 4D1SA 4U45A 3BKBA 2XA4A 1Y57A 3ZC5A 1TQPA 2YABA 3E7OA 3VC4A 4CFXA 3PIZA 1U4DA 1UKIA 2PE0A 3NYOA 4APCA 2R9SA 2VWIA 3LFSA 2OIQA 1WVXA 3FE3A 4E6CA 3FMJA 3ENHA 3F6XA 3WYYA 5HG9A 1KUTA 4YZBA 3UO5A 4O0TA 3VS0A 3U55A 2YA9A 1YOMA 5LCKA 2Y7JA 4FC0A 1HCLA 4FV6A 2C3KA 2JBOA 2QR7A 3BBWA 2X8IA 4I6BA 3LCOA 4O2ZA 5CEQA 1YXTA 4YGAA 3KRLA 4EK3A 4CKJA 2PUIA 4DTBA 4WRGA 2EXEA 5HIDA 3FZ1A 4YO6A 4H3QA 4WNPA 4CFFA 3LFCA 4WT6A 5IDPA 2HZIA 2CNUA 4IACA 2BIKB 2CHLA 2VO7A 4FTTA 5DN3A 4BBEA 4O84A 3FMEA 4TWNA 4NSTA 5DHJA 5FDPA 5JN2A 3UDBA 1PMNA 4YJVA 4MK0A 4J8MA 5K3YA 4U41A 5EW8A 3AC3A 3R28A 5AV0A 2IZTA 2ITZA 4AP7A 3CSVA 4ID7A 4NWMA 4UB7A 2WELA 2UZVA 5FD2A 4YHTA 4EZ7A 3KCKA 2YDKA 1AQ1A 4Y8DA 3H0YA 4QNAA 1Z57A 4PL4A 5TF9A 5FTQA 1YI4A 3RZBA 4JBOA 4GT3A 3NMUF 1XHAA 1W8CA 3FMNA 5AV3A 4AXAA 1NVSA 4DEHA 4O21A 1ZMUA 3QALE 4DFXE 1PXKA 5EK7A 1XH8A 3QQKA 3HP2A 3K5UA 4M68A 4OTQA 5E1EA 3COKA 4E73A 1CDKA 2YJSA 1KV2A 2CSNA 3QTRA 3E88A 3MVLA 3V51A 3C7QA 4OTGA 4FEQA 2B54A 4JAIA 5J79A 5EKNA 4U3YA 1L3RE 2IN6A 5GNKA 3TM0A 4ZSGA 3O96A 3FKLA 2PZIA 3QTIA 4XV2A 2YZLA 1OKZA 3GVUA 3IONA 4I41A 3FXXA 3ZO1A 4CNHA 3DDQA 3PTGA 2BHEA 2FB8A 3NCGA 4JI9A 2R3HA 2EB3A 3WZUA 5CAUA 3V8WA 4X6RA 4ZTLA 3BYUA 4DH3A 4QQJA 4HPUE 3V8TA 3F2RA 5KKRB 4TL0A 2XP2A 4P4CA 4I0TA 2XNBA 4YPSA 3GCVA 4CT2A 1G5SA 2GNLA 3L8XA 4KABA 4FSZA 4KIKB 4YJQA 5DWRA 3ID6C 4DF3A 4UBAA 4C7TA 4NTSA 1PMUA 3FLYA 5HOAA 3SG9A 1LEWA 4LI5A 1Q8TA 3AG9A 3EOCA 3L9MA 4O91A 4JOAA 3QLGA 1WFCA 2GS7A 2I6LA 4EYJA 4DA5A 3MWUA 3Q6WA 1PXPA 2PVFA 4FA2A 2WMBA 4D4SA 1G8AA 3C4XA 5B0XA 4S30A 2CKOA 2ITXA 4FK3A 4Z9LA 1M14A 4IJ9A 2OH4A 3MW1A 3ZRMA 4D55A 1XH4A 3ELJA 3B8RA 4EOOA 4K0YA 4G5PA 2JGZA 4GG5A 3I81A 3PWYA 4OTPA 5DH3A 5H3QA 4P5ZA 3HA6A 3JVRA 4IB5A 3TG1A 5M44A 3EH9A 3I5NA 4N4SA 3O7LB 4QP4A
chains in the Genus database with same CATH superfamily
2VWVA 3T9TA 3S95A 2X4ZA 3HUCA 3IS5A 4ZTSA 2ONLA 5EDRA 3V6SA 4K6ZA 4KIKA 3BU3A 3ZONA 4ASDA 2WMWA 4QTAA 5IA0A 5IH4A 4ZMEA 2X6DA 3PRIA 1AD5A 3THBA 1SZMA 5DRBA 3RAKA 3KKVA 3W2CA 3ZYAA 1XO2B 3AGLA 3C0GA 3Q4UA 3VS5A 4M66A 4RC3A 4AU8A 4BYJA 3IW4A 3MB7A 3Q4CA 1J7IA 3TWJA 5CF4A 3VN9A 4EOLA 2IZRA 4GIIA 5L2IA 3TIZA 3MDYA 4EZ3A 2XNPA 4PMMA 5CXHA 3E8CA 3LM0A 5CEOA 4S33A 1BI8A 4X2KA 4PNIA 3C4ZA 2Y6OA 5L8JA 3FPQA 5CNNA 4D28A 4HCVA 2VTQA 4MBJA 4PMTA 5ETCA 2OLCA 4BZNA 3DBCA 5IEYA 5JGAA 2OF2A 3TZ8A 4M0YA 4PMPA 5AUTA 4ZLYA 2OBJA 4QMZA 4BWXA 2VX3A 3PP0A 3HUBA 4BGQA 5GZ8A 4IFGA 4DTAA 3F5GA 1UNGA 4AS0A 3DK6A 2WQMA 3KVXA 5TOZA 2O64A 4BYIA 3BI6A 5LVLA 3R7VA 4JR7A 2BUJA 1CSNA 3ET7A 3P4KA 4HZRA 4R6VA 4ZSLA 3IOKA 4J99A 3HMPA 4GCJA 5DVRA 2ZMDA 3W2PA 4J8NA 1OIQA 3CD8A 3W2RA 4X2NA 4DT8A 4FSNA 3E87A 5HG7A 3SW7A 4HGEA 2JIIA 2X39A 2QLQA 2ZV8A 4XH6A 3TNQB 4EK5A 3R8PA 5G6VA 2HCKA 4K8AA 1XKKA 4FNWA 3LIJA 3QF9A 3I60A 4CFMA 5ETFA 2RFNA 3NRMA 3OUKA 2R3QA 4ZAUA 3CCNA 1H00A 4XBRA 3ULZA 5BUEA 2UW7A 3ENMA 3RJCA 2E9OA 3LHJA 1QPCA 4FKOA 3NYVA 4DFBA 4DBNA 4HPTE 3BHTA 1APME 5AP7A 4QMUA 3QQJA 5BVKA 5JMSA 3O71A 1GOLA 2HK5A 4IBMA 4HZSA 1UU8A 2VTJA 4EEVA 3OXTA 4CFWA 2V22A 1YI6A 2WMTA 4UEUA 5CX9A 2W1EA 4EJNA 5IA2A 2CLQA 3EHAA 4QRCA 4FX3A 4QP2A 4X3JA 3L8PA 3OHTA 5HBEA 2VWXA 3F66A 2C6KA 4ZTMA 2F57A 3BYVA 5JZNA 3A8WA 3PY0A 3NIZA 3C1XA 4ZJJA 3RAHA 4DLJA 3SVVA 4ZZOA 3FAAA 2WTDA 2YIQA 1QPDA 3Q52A 4GL9A 3LOKA 3R7UA 1MRYA 4TN6A 3VBXA 2UZOA 3R7GA 1PRYA 3GXLA 3Q96A 5ITAA 5EW3A 5HICA 3AT4A 2QKRA 3TNIA 4R77A 3DKCA 5IKWA 4KSQA 3RKBA 5IQGA 4EK8A 5IH5A 2QLUA 5IQCA 3KC3A 4ANBA 5JGDA 4IZAA 5EOBA 4DN5A 3ORKA 4I93A 3AQVA 2JEDA 2VUWA 2A1AB 3ORXA 2YIRA 4BHZA 3LPBA 1Q8ZA 2DWBA 4E93A 3I5ZA 4B8MA 2ESMA 4MX9A 4IJPA 3EJ1A 3RPRA 5D41A 2NP8A 2ZOQA 2VO6A 3HKOA 3QD0A 4BDHA 4R5SA 5M4FA 2YCSA 5CU2A 2WMXA 1MP8A 4XG7A 5KE0A 1PXLA 4D0WA 4F65A 1UNLA 2F9GA 2XCHA 2XYUA 3BYMA 3FWQA 3R63A 3NFFB 4ITJA 3Q9XA 4NCTC 3BRBA 4UMQA 4FUXA 3BL9A 3HRFA 3DAKA 4FZ7A 4BCOA 3C0HA 3D5VA 4PL5A 3UGCA 3QTZA 1NT2A 2I0EA 3PPKA 3C51A 4FZDB 3ZBXA 4E4NA 2XEZA 3VRZA 5M51A 1VYZA 4OGRA 4ZS0A 4HGLA 2HWOA 3CTQA 4OTRA 2R3OA 4UZHA 3KREA 3JUHA 3OC1A 4IWDA 3HV6A 4MF0A 3TV6A 5GIOE 4ZTNA 4LL0A 1Q8WA 4HYUA 2YN8A 5BVFA 2FVDA 3UZPA 2UZDA 4EWQA 5HESA 4RQVA 5A14A 4MBIA 4EOQA 4AQCA 3O8UA 3FDNA 3E62A 3TKUA 1WCCA 5DGZA 1IA8A 4V0GB 3M1SA 2Z7SA 3OG7A 4KINA 1LR4A 4JBQA 2QO2A 4FG8A 4YC3A 1DM2A 2OFVA 2PK9A 4R8QA 4U42A 4CFNA 4F1OA 3W0MA 3HV4A 4YBKA 2J0JA 2WMVA 4TWOA 3H0ZA 4TTHB 2SRCA 2XK6A 3UQCA 2OXXA 4F6SA 2X2MA 4R7HA 2JKOA 4FTLA 4BCKA 5CI7A 4DDGA 4A7CA 3V01A 1S9JA 2W4KA 3LFQA 4LV7A 3OY3A 3MJ2A 5DFPA 1H08A 3DBEA 2BTRA 3KRWA 2O5KA 4B0GA 4F0GA 1BLXA 2UW5A 2P3GX 2XIRA 2YITA 3QD3A 4L46A 1U54B 3ZMMA 3R1NA 4NFNA 4CLJA 1YXVA 3QQUA 3M2WA 2QODA 5JFWA 5HE1A 3CQWA 3AC8A 3VHEA 4PDPA 4W9XA 3ODZX 3ZTXA 4U0IA 3EQPA 3VUIA 4DTKA 3TNWA 3W55A 3UIXA 1R1WA 4G31A 3KRRA 3DB8A 3PRFA 4FT0A 3VS2A 4CZYB 3C5UA 2PZRA 4TYIA 4FIGA 5L2QA 1OMWA 2UVXA 4CYIA 3G0FA 4IIRA 4V0GA 2WTKC 1PW2A 2R3LA 3BELA 3P7AA 5J95A 1F0QA 3D94A 4GKHA 4TNDA 2OJGA 5JQ5A 2W1ZA 3TJDA 3R73A 4F9YA 2G9XA 4W4WA 1PXIA 3F7ZA 3WYXA 2C5OA 5HLWA 3P0MA 4KAOA 4CG9A 5IEVA 3EFJA 5M4IA 2W7XA 5F94A 5GJDA 1H1SA 4IDVA 3VS7A 3QRKA 4FGBA 3KK9A 1Y8GA 2R3IA 2R2PA 1OGYA 3GC7A 4FT5A 3EN7A 4MD8E 2X9FA 4MXZA 3W0PA 2VTTA 3AOXA 3GU4A 5HHWA 3U9NA 3GCQA 5AV1A 4F09A 3D14A 3OEZA 4FGRA 2UW8A 3F2AA 2W1FA 5EHOA 3UP2A 4ASZA 1H07A 1U54A 2J50A 3OMVA 3BEGA 3EYGA 1Q5KA 4BJJB 3N9XA 4FV1A 3QAME 3ZFYA 4D2SA 3QZGA 2OK1A 3R83A 2CGVA 3W2OA 4IX3A 4NEUA 4RA4A 5C8MA 2QONA 4BDGA 3BL7A 3B2WA 1GZKA 3PWDA 5L2TA 4O7LA 2X2LA 3DJ5A 4ALWA 4D1ZA 3H9RA 4D2TA 2Y6MA 2WHBA 4KKGA 5DLSA 5AP6A 2ITVA 2VO0A 2XNEA 3P79A 4XG3A 4JXFA 3IW8A 5T68A 4PUZA 2ZM4A 4FKLA 3L8SA 4O86A 4IVCA 5ANGA 4I4FA 2WQOA 4U3ZA 3GU6A 5HCYA 5HO8A 4KD1A 5AUWA 5AM6A 4EH5A 3C9WA 5GJFA 2G15A 3W0SA 4D58A 4DDIA 5A4LA 3DK7A 1OVEA 4EBVA 3OROA 3WBLA 4B4LA 5E8YA 4GKIA 4WRSA 4AT3A 3UYTA 2WTWA 4YJNA 3CTHA 2V0DA 4AACA 3MVHA 5L2SA 3WZKA 4IVAA 3CQUA 4FT7A 3R8MA 5CASA 2A2AA 2YAKA 2PZPA 5CSVA 3A4PA 3HNGA 1XR1A 3MY5A 5K0KA 4AFEA 2BDJA 2FA2A 2PMOX 3HV5A 1ATPE 2QOIA 3CPBA 3DJ7A 2EB2A 3KU2A 3Q04A 4N0SA 5FTOA 3UODA 3ZHPC 3FI3A 3QQGA 4GJ2A 1V1KA 4X3FC 3DAJA 3FC1X 4YTFA 1SMHA 2WB8A 3G6HA 3BGQA 2R3NA 3SQQA 5BMSA 4U6RA 3TZ9A 3PZHA 5EYKA 1GZNA 5B7VA 2VTHA 5AJQA 5DG5A 3ZBFA 4BCNA 4EQCA 3NZ0A 5M4CA 4QYHA 5C4LA 2QOKA 2W1HA 4D2WA 4FV4A 4MXYA 5LOHA 3VBTA 2UZEA 2OICA 3MSSA 4DINA 1Q3WA 3D5WA 4XCUA 3ZSGA 5LWMA 2ITTA 1ZOHA 3ATSA 2QC6A 4LRKA 2PYWA 4KIPA 4O0WA 3H10A 3G15A 4QMNA 2BZHB 1WBNA 3JPVA 5I5ZA 5BYZA 5JFSA 3EKNA 3QGWA 4FRFA 1OM1A 2XIXA 3KF7A 4FV0A 4EJ7A 3IW6A 4RVKA 4DHZA 3MYGA 3T3UA 5L8LA 2RSVA 2BDWA 2VGPA 4G3FA 4QP9A 1T46A 3QTQA 4BHNA 3B2TA 3KMMA 4DH5A 4PX6A 2VV9A 2ZB0A 4XG2A 1GZOA 3PFYA 4GV1A 2ITNA 5HE0A 2JDSA 3W0NA 4IM3A 2XKDA 4DGMA 4QMWA 4JDJA 4RIYB 3KA0A 3BV3A 3T3VA 4CCBA 1H8FA 4DEIA 4KA3A 4C4EA 1U5RA 3S2PA 4XP3A 2DS1A 2RFEA 1QL6A 3MPAA 5AIKA 3AD4A 3PPZA 3R30A 3ANQA 3QZIA 3HLLA 5BVDA 2RKUA 4FV8A 3UC4A 4I4EA 3PXQA 3NR9A 4ANQA 4AX8A 5K4JA 2I1MA 3L8VA 5KCVA 1YWNA 4G3CA 4GH2A 4IZ5A 1VLRA 2GHLA 2AEGA 4PQNA 3IO7A 5BPYA 5AP3A 2P0CA 2XNMA 4O4FA 5DPVA 2C3IB 3LW0A 3VBWA 5HG8A 3QRJA 3UDTA 2W06A 5EQYA 4E1ZA 3Q4ZA 2ITWA 4RMZA 4S2ZA 4QP7A 2CDZA 1L8TA 4O1OA 4YJTA 1PXJA 2H34A 1AGWA 3COMA 4UWCA 5EYCA 4RVMA 4C62A 4IHPA 3OWKA 1YHWA 5ACKA 3R7EA 4F9BA 2X0OA 5AX9A 4FVRA 3UVPA 4DGLC 4JX3A 2RGPA 2BVAA 4BCPA 3SOAA 2YM5A 5LMBA 3D5UA 5M57A 4N6ZA 3MGYA 4FIHA 4RIYA 4WUNA 3PVWA 2XJ1A 1F5QA 3OD6X 5FWKK 1XWSA 3UYSA 3OWLA 2W9FB 1R0PA 4Y95A 5ANOA 1YI3A 5E8UA 3VQUA 1ZY5A 3F2NA 4NTTA 4MWIA 1OPLA 2YIYA 3BV2A 4QMPA 4WG3A 5HBHA 5L6WL 5DMZA 3QBNA 3MFTA 3SRVB 3NCZA 3TI1A 4M13A 4WIHA 4JQ8A 2QR8A 4ITHA 3O50A 4MUQA 1UU9A 4XP2A 5T6KA 2HY0A 1XJDA 4O6EA 4O7WA 5HLPA 1YXSA 5AR7A 2X6EA 1YQJA 1W83A 2BILB 2BRHA 3CBLA 3OT3A 3CLYA 3Q5ZA 4UYNA 4YJPA 5I3OA 4RIOA 4W8DA 2OZOA 4FE2A 3DAEA 4O7SA 2F4JA 3ALNA 3G2FA 2VX0A 2OZAB 1SNUA 5GHVA 3ZU7A 3ANRA 4H39A 1WBWA 5J8IA 3ZUVA 4D2VA 4DH8A 3PXFA 3G9NA 5E8TA 5JEBA 4WBOA 3WARA 2ITYA 2C6DA 3M42A 3NW7A 1TFFA 4K77A 2WEIA 5GJGA 3RP9A 2QHMA 3SOCA 5HU3A 5DNRA 3EKKA 3QQFA 1Q62A 3BHHA 4QMOA 5H8GA 4B7TA 4PTCA 4BCHA 1SYKA 3LXKA 4IQ6A 4UMRA 1E1VA 5HE2A 4D9TA 4BKYA 3EFWA 1RJBA 4ZP5A 4FV5A 4W9WA 1Z9XA 2GNHA 2YAAA 3WIKA 5LMKC 4CV9A 3QHRA 4V01A 4QYEA 4O0VA 4CXAA 3QTSA 3R6XA 5B2KA 4FTCA 3F3TA 3QD2B 3R1QA 2XK9A 3KN6A 3GC0A 4I21A 4O6LA 3QKLA 4TY1A 5CQWA 5FM2A 3ZM4A 4KUJA 5DYJA 3FQHA 3DKGA 4RWJA 4ERWA 4GFOA 3TIYA 3EZRA 2RFDA 1GZ8A 5C8NA 3UOJA 3SXFA 2CNQA 5AEPA 3BLHA 1KV1A 1CM8A 1MUOA 1JKKA 4I5CA 5FRIA 1KE5A 4O27B 3ZO4A 2BAJA 2OXDA 4K18A 2JFMA 4M97A 5FEDA 5JFXA 2X7FA 4QO9A 2BZIB 4C57A 2A4LA 2YIWA 3VW8A 4MKCA 4EBWA 3P08A 4IB3A 4EORA 3RK9A 4Y5HA 3KXNA 3LJ0A 5AR2A 4D2RA 1OIYA 3DLZA 4Z16A 3HP5A 4BKJA 1MRUA 4ANOA 5D12A 5KMNA 3PJCA 4OTIA 5LWNA 4PMSA 5FEEA 4XV3A 5FDXA 4B6LA 4FJVA 3DJ6A 2GNFA 4O0RA 4QTCA 1Y6BA 4FK6A 1ZMWA 4IE9A 4FSQA 4E6QA 3EQDA 3PSCA 3PP1A 5F95A 2Y4IC 2R7BA 3QC9A 4O7TA 3PIXA 4CT1A 3S0OA 4S34A 5IA5A 4DFUA 1NY3A 4DCAA 1YHVA 3TUDA 4FVQA 3HV7A 2J0IA 3H30A 2XZSA 2GFSA 3BWFA 2HELA 2CJMA 4L68A 1GIHA 2WTJA 2C5NA 3D7ZA 3OVVA 1JSVA 3BQCA 1ZZLA 3HX4A 4LRJA 2JD5A 3EQBA 3KMWA 2H9VA 3EFLA 2VAGA 4BTMA 4AOIA 5B2MA 4I6FA 2XF0A 2C0IA 3W32A 5AFVA 5EM5A 3II5A 4W4VA 2EXMA 2R7IA 2YZAA 4FTRA 3GP0A 1RQQA 4MCVA 3FJQE 3ZO3A 1LUFA 4DGOA 2Y9QA 4DFLA 3FZPA 4FT3A 4UMUA 2DUVA 2XALA 5AUUA 3OCTA 2QI8A 1DI8A 3UP7A 3TL8A 3NDMA 3W2QA 3QZHA 4GUBA 3JS2A 2UVZA 4KIQA 2E9UA 4JG6A 4RRVA 4UYAA 2RG5A 3QRIA 2PPQA 3ZSIA 3GFEA 1O6YA 3IDPA 1E1XA 4UWBA 3VBQA 3AGMA 2BFYA 4FIEA 3ODYX 5CVGA 4AN9A 4EKKA 3FLSA 3AMYA 3ZRKA 3BEAA 1OUYA 3QFVA 3F61A 3P1AA 4FNYA 3U9CA 2BTSA 3A4OX 3GCSA 2JITA 2X2KA 3B8QA 3F5XA 5I9UA 2W1CA 2NO3A 2KULA 4ZSAA 3R21A 5BYYA 3COIA 3R7YA 3LXNA 4RWKA 3KXGA 3GOPA 3P9JA 3BLQA 2JIUA 1XQZA 4EI4A 1ZYJA 3Q6UA 2C4GA 2R3PA 4FKTA 4ZSEA 2O0UA 4XNEA 1ZY4A 3OW4A 4BDKA 4C8BA 3P5KA 5H8BA 3ZLSA 4C2WA 2QCSA 4YUQA 3PXYA 4M7IA 3WF5A 4OBOA 4F7JA 3AT2A 4ASXA 1GAGA 3GUBA 4FYOA 4QYGA 2I0HA 3LCDA 5IDNA 4BR3A 3LCKA 3FHIA 3EIDA 2GQSA 5CEMA 1W0XC 3QUEA 5LARA 3LE6A 4YBJA 5EM7A 4BB4A 1U5QA 5HCZA 3ORTA 3U4WA 1K2PA 1Q8UA 3DQXA 5CSHA 5CZHA 2CCIA 5IPJA 1TZDA 3AKJA 2LGCA 2O3PA 5KBQA 2QOFA 4M0ZA 1ZAOA 3PIYA 1REJA 3QA8A 3CGFA 3KMUA 4OUCA 3FLNC 3KULA 3FBVA 4NFMA 4ZTRA 5CNOA 5E92A 4K11A 4BWKA 4LOOA 3VNTA 3OCBA 3ZC6A 2WXVA 3SDJA 3C4FA 4QD6A 5EQPA 4USDA 4R3CA 4DFZE 4R1VA 3QCYA 2C0TA 5EM6A 4RA5A 3TV7A 2HW7A 2PSQA 1ZARA 5CVHA 5A4TA 3DU8A 3G51A 3LM5A 2UV2A 1ND4A 5AP2A 1REKA 3C5IA 4G5JA 4K9YA 2I7QA 1IR3A 4RGJA 2XKEA 3O2MA 3IG7A 5HNBA 2CKEA 4BCIA 5KO1A 5KHWA 4FVPA 4M67A 4UXQA 5TE0A 4FV7A 2CN5A 3HMOA 1NXKA 5AUYA 4NK9A 4FR4A 2FO0A 3GEQA 5D9HA 3I7CA 4AFJA 4ITIA 2YLFA 3N51A 1ST4A 3N4VA 4RZWA 2FSOX 3GOKA 3SXSA 5BX0A 4CTCA 2VN9A 1SVEA 4KB8A 3MV5A 2I40A 1LPUA 3FMLA 3LFFA 4LG4A 2YFXA 4LOQA 4GUEA 2OJIA 2OH0E 3NSZA 3UG2A 4E4LA 2HY81 4EH6A 3AT3A 4XP0A 3RK7A 5J7BA 2FYSA 2B9FA 3F69A 1B39A 1GNGA 5TT7A 4DT9A 1O6KA 2VWZA 2ZV7A 3FI2A 3W1FA 3RI1A 4EHGA 2CLXA 2XIZA 4XG8A 5HNGA 4KS8A 2R3RA 3O5AA 4LMUA 5K0XA 1PF8A 4EH9A 3I1AA 3CS9A 4QMVA 3D2IA 4CQEA 1OIUA 3NUYA 4NKSA 3RCDA 3SHEA 1R78A 2UVYA 2R3KA 4B8LA 4A9TA 4I6LA 1YWRA 4U9AA 5TKDA 2PHKA 4GK2A 4USFA 4UX9A 2VTOA 4PWNA 1FQ1B 5BUIA 3ACKA 4OTFA 2XJ2A 5AX3A 4W4YA 3VAPA 1OUKA 3NUSA 3NNUA 4JAJA 4KWPA 5EYDA 3W16A 4ANSA 4CTBA 2R3MA 4K1BA 1ZRZA 3T9IA 5IA3A 4E6DA 4F1TA 4NL0A 3P7CA 1XBAA 2OXYA 3IGOA 3OCSA 4WNMA 2Z7QA 4I6QA 2HENA 3WZDA 4DG0E 2ZFYA 4AAYA 4LV5A 4UMPA 2EUFB 2QOCA 4LQMA 4FMQA 1DAWA 4O4DA 4PL3A 5JSMA 3KL8A 3RM7A 2YJRA 2A98A 4JG7A 4UV0A 5CANA 3KGAA 2NYAA 3LQ3A 3QWJA 2BAQA 5BYLA 3ETAA 5GIPE 2OSCA 1P2AA 3QA0A 1MRVA 3PA4A 4YZMA 4ALUA 2BRBA 2VO3A 4JG8A 2HOGA 3FV8A 3KXXA 2ZMCA 4ZS4A 3D4QA 5IA1A 4D4VA 4ORKA 2NRUA 4JQ7A 3RZFA 4YO4A 1ST0A 2UUEA 2IEWA 2V55A 4R3PA 5ANKA 3ZCLA 1ZWSA 4JT3A 3SAYA 5J1WA 1H1PA 2BAKA 4AW5A 4J52A 3VUTA 2WQEA 4J96A 5CVFA 3LJ2A 4Q9ZA 1M2QA 3P78A 5DBXA 3VHKA 4LL5A 1LP4A 2EU9A 3PLSA 4I5MA 1J1CA 3ORPA 2C5XA 3OWPA 4FSMA 2YWVA 3RWPA 2PVMA 4L7FA 2OI4X 2RFSA 3QKKA 4QQ5A 4YHFA 3MH1A 1FOTA 3KQ7A 4PTGA 5AP0A 2ZVAA 1OL1A 1Q99A 4YR8A 2BDFA 4XX9A 2WTIA 5BQ0A 5CAPA 1JBPE 2VTPA 3RMFA 3UVQA 2ZYBA 3S00A 2XRWA 3F88A 2GMXA 2QVSE 4ZOGA 2WQNA 3LQ8A 3NW5A 2ZJWA 3F3VA 1KWPA 4YJRA 4QP6A 3TNHA 4A07A 5CU0A 2C5YA 2A19B 4FKGA 4J71A 4Q2AA 4FKWA 4YZNA 4H1JA 4I5PA 4F6UA 2J0MB 4BBMA 5AV2A 3KIOC 4U8ZA 4BC6A 3IKAA 3POOA 2O2UA 4JQEA 5ANDA 1YRPA 4NCTA 3GENA 5DEYA 5E4HA 3FC2A 5FXRA 1A9UA 2PE2A 3DZQA 3PG3A 4FKUA 4XLIA 3UMWA 3HA8A 3LAUA 3R9HA 5LVOA 2XS0A 2PL0A 3LFBA 4YJOA 2ETRA 4LGHA 4RJ3A 5HTIA 1BL7A 3G6GA 2GS2A 3KXMA 2GQRA 4I6HA 3GQLA 4MTAA 5EKOA 4EHEA 3DY7A 4PV0A 3QWKA 4L3JA 2VZ6A 2Z02A 4BY9E 3PSBA 5ICPA 3Q2MA 1XBBA 1XH5A 4FIFA 5FLFA 4AZTA 1ERKA 1JNKA 2OKRA 3O23A 2R5TA 2WIHA 4MQ2A 3OOGA 2W0JA 3LMIA 1SNXA 5EW9A 3ZFXA 2ACXA 3MN3A 5A46A 3BE2A 4YLKA 3WF6A 5IF1A 2V5QA 2VRXA 2PVRA 1YVJA 3JY9A 4RBLA 2GNIA 3TXOA 3D5XA 3AKKA 2WTKB 1M52A 1GJOA 4RJ8A 4U79A 5HIEA 4RIXA 3F3ZA 3ORIA 2RF9A 3QKMA 2R3FA 2OO8X 4J95A 3PLAE 1IASA 4R78A 3QTUA 4AT4A 5JRQA 4DHIB 4Q5EA 1I44A 3ZEWA 4BDFA 4LUDA 5FXSA 3MH0A 3MVJA 4TWPA 4CFVA 1BX6A 3Q4TA 4LMNA 4O83A 4BCMA 2ZM3A 3QZFA 2BKKA 1UV5A 3A2CA 3CKWA 2UZNA 3RPVA 4OW8A 2W5AA 4I0RA 5FTGA 4ZXTA 1F3MC 2CGUA 4FL3A 4TYJA 3WF8A 3VS4A 3DTCA 4TPTA 4F7SA 3COHA 3E64A 2VTRA 3DLSA 5DE2A 4A9YA 3IK3A 2G01A 2X7OA 3CTJA 4QYYA 4AW0A 1G8SA 2XK3A 4HYIA 1W2FA 4QMSA 3TN8A 5BV3A 4HOKA 1OI9A 4L01A 3RNIA 4CMUA 3UMXA 1LEZA 5F4NA 4LDTA 2BZJA 3P86A 3E8DA 3R8VA 1J3HA 4F64A 2E2BA 3HRBA 2WOTA 4U5JA 4CYJA 2YM7A 1JSUA 3GB2A 3LFEA 2P2IA 3NAYA 4BCFA 3DCVA 4H05A 1TQIA 2PZYA 4I94A 3TJCA 4LOPA 4OTDA 2GSFA 3MS9A 3QCXA 3DOGA 3F3UA 4YZ9A 1MQBA 5IUHA 4FSUA 2UW3A 5CQUA 3KN5A 3FQEA 3UPZA 4E5AX 3PE1A 4JLCA 4O0YA 5CENA 5TR6A 2XVDA 4ONAA 1OL5A 2W1DA 2WMUA 2YDIA 1OKWA 3GT8A 1STCE 2XMYA 3EZVA 3PJ1A 4IADA 4BN1A 3DKFA 1PJKA 3QRUA 4KIOA 1PYEA 4U80A 2C5VA 4WSQA 3A7FA 4P7EA 4R3RA 3GU7A 2CGXA 5J1VA 4BI1A 4YNOA 3AC2A 1QPEA 2GNGA 1ZYSA 2R0UA 2JKKA 2PUNA 3MI9A 2YCQA 3BHUA 4X3FB 1Q8YA 2G2FA 5JRSA 2ITPA 4MYGA 5D10A 2X8DA 3VUMA 5AV4A 4ZIMA 3QX4A 4FIIA 4RQKA 1XBCA 3FKNA 3E93A 5B2LA 4NW5A 2BFXA 2AC5A 3I6UA 1H27A 3FY0A 3H4JA 3ORLA 4H3BA 4I0SA 3KFAA 5FBOA 1KE7A 3UNJA 2FH9A 2JIVA 4HVGA 5EOLA 1OGUA 4X2GA 2HYYA 2PVJA 5DR6A 3HAMA 4F7LA 4O7ZA 3WE4A 4GVJA 4JR3A 4RJ6A 2OWBA 4JBVA 3VUHA 2J9MA 1OKYA 4Z7GA 4AW2A 4IFCA 5KHXA 4BRXA 2C6TA 1WMKA 2VD5A 4XRJA 5BVOA 2YISA 3WF9A 2YM6A 2H96A 1JWHA 2IJMA 3MVMA 4XG6A 5ACBC 5L2WA 3PXKA 3EN6A 1PKDA 3VONA 3TTIA 2XYNA 3PY1A 1XH6A 3ZLWA 1OIRA 4DHJA 4M12A 1H24A 1BYGA 4H3PA 4OTWA 4E20A 4IAKA 3SW4A 5FUTA 4FT9A 4EZ5A 4X3FA 1UU3A 4IW0A 3EQCA 3HZTA 2C6LA 2PMNX 4HCTA 1KSWA 2IW9A 4HJOA 5FP5A 3PDTA 3VS3A 5J5SA 2YHVA 3FZSA 3SC1A 2AUHA 2V62A 3ERKA 3ZXTA 4EK4A 3DBFA 5CAQA 5HZNA 3FI4A 4I5HA 4NJ3A 5CZIA 4HGTA 4EH8A 4D4YA 5KMJA 2XK4A 4WG4A 4IDTA 2OU7A 3OBJA 4CFUA 3MBLA 2WNTA 4WSYA 4X0MA 4MHAA 4MF1A 2VWBA 4AGCA 2BMCA 4A9RA 3R2YA 4EYMA 5AADA 1UWHA 2WPAA 1V0PA 2YCRA 2YERA 2Z7LA 4HCUA 4I1ZA 2UW0A 3DFAA 4BZDA 1FGIA 3PA3A 4BCGA 2X9EA 1GIIA 2QKWB 5EI6A 2YIXA 4AT5A 3OEFX 4RC2A 4AZSA 3IW5A 3C4EA 4M3QA 1W2CA 3MB6A 2J5EA 4BVUA 4UXLA 3WZJA 5F9EA 5IQDA 1UWJA 3GCPA 2B9IA 4FTUA 2XBAA 3RK5A 3ROYA 2W05A 4CRSA 3VBYA 4DEGA 4I23A 2PU8A 2OG8A 4Z3VA 4GFMA 3U4UA 1OL6A 5I9WA 1YOJA 2JAVA 4AQKA 4AG8A 4ANNA 2AQXA 3EQFA 3LZBA 5HVJA 4FNXA 3QQLA 5E8SA 4Y46A 5M07A 2GU8A 3TDVA 1RW8A 3CJFA 1HOWA 4LM5A 2XANA 5DA3A 2JFLA 3U87A 5JZJA 2WAJA 5A6OA 4UZDA 5M56A 3L9LA 1ZYLA 4QT1A 4BGHA 4OBPA 5AM7A 4AGUA 3U6JA 4A4OA 3TACA 2JDOA 5BVEA 4CQGA 4YLLA 4DH1A 5HIBA 3TDWA 3GBZA 1CTPE 5FG8A 4IANA 4L3LA 4L53A