3W55A

The structure of erk2 in complex with fr148083
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
347
structure length
335
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of a cysteine residue in the active site of ERK and the MAPKK family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
total genus 86
structure length 335
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3w55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w55A01
4PL3A 3RAIA 1UU7A 5HIEA 5L3AA 4E4MA 3C9WA 2ITUA 4HGSA 4V01A 4WOVA 3T3VA 4LG4A 2UW5A 3KRLA 4FNWA 4IX3A 4IANA 4PTGA 3SW7A 1IA9A 4NL0A 5CANA 2QOKA 2R3GA 3H10A 3ZCLA 2DQ7X 3E3PA 2F57A 3P1AA 3D4QA 4FIHA 3IGGA 4CRSA 4XV3A 5JT2A 4F6UA 4W8DA 3R8ZA 3G9NA 3PXYA 4FGBA 1CM8A 4HCUA 3MIYA 4ZY6A 3QD2B 3VS1A 3IG7A 3RK7A 4D9TA 2YDIA 5JEBA 5HEZA 3QGYA 1JSVA 3PG3A 3OEZA 2YDKA 3RM6A 3UVPA 4AA4A 3F7WA 4KKHA 3QQUA 2WIHA 4ZZOA 4BCOA 4G3DA 2WMQA 4KBAA 5AV3A 3FZTA 3R1NA 2BZKB 5CTPA 3O0GA 3UYSA 3VW8A 4S2ZA 4EQUA 1HCLA 2ZV2A 3BBTB 5JQ8A 2GS6A 3TV7A 4JR7A 5CY3A 3FZPA 2C4GA 4QRCA 4B8MA 1OBDA 5FG8A 3A7HA 5BQ0A 1Q8UA 3D5UA 1HCKA 5LWMA 3IK3A 3MDYA 3BRBA 4NKSA 3SA0A 5CI7A 4KABA 3VW6A 3FMNA 4IB0A 2VO7A 3OXTA 1LR4A 2EB2A 2QURA 3ACKA 3E5AA 3R1QA 4ENYA 2VO6A 5BNJA 3TKUA 3D7ZA 4UXQA 3EQRA 4C57A 1GNGA 4TT7A 4NKAA 2P4IA 4E7WA 4JDKA 5LARA 3Q9YA 1YXXA 2F7EE 3NNWA 4QP9A 4AF3A 3KXMA 5L2SA 4GVJA 3V6RA 3JY9A 3Q04A 4HVSA 4X6QC 3PPKA 3FQHA 4MX9A 4PX6A 2OXXA 4G9CA 5FEEA 4BF2A 4CQEA 3QD0A 3DT1A 3R9DA 4R1VA 2XIRA 3QLFA 4HVDA 3QTUA 1FQ1B 4WNKA 4R78A 5C01A 3L9PA 4X0MA 4F9BA 3G6HA 4O7TA 2UZEA 4ANNA 4NIFB 1V0OA 1CKIA 1OL1A 4MWIA 4C35A 1F0QA 4ACGA 4JX3A 5B7VA 1QPDA 3FLQA 3NYXA 5J1WA 2NRUA 3FUPA 2PSQA 1RQQA 5DLSA 4FSWA 5J1VA 3T8OA 2Q83A 3DBCA 2H96A 2HYYA 4CVAA 4JJRA 2PUNA 2C6OA 3CSVA 1R39A 3PZEA 3UOLA 2RKUA 4LGHA 4K11A 4J99A 1FGKA 3IS5A 3E8NA 3ORIA 3PSBA 4UMTA 5AV2A 2VWWA 3FI4A 3MPAA 3ATSA 4IM0A 4KIPA 4Z3VA 1YDRE 1H28A 4HZSA 2VTPA 2HELA 3BI6A 3PWYA 3ZSHA 2XIZA 3SDJA 4OTFA 2F49A 3GQLA 1WVWA 2WMVA 4CFWA 1MQBA 3OG7A 4FBXA 4KIOA 4HPTE 3OUNB 3I6UA 2ZM3A 4RJ3A 2XNEA 4DH7A 3SG8A 3ENMA 4FKJA 4GT4A 4JI9A 3GU8A 4L46A 4EWQA 3FC2A 3Q5ZA 1J7IA 2ETMA 4FV9A 3TKHA 2OJFE 2B9IA 2I0EA 4BDKA 1YOLA 2VWVA 3P23A 3AMBA 4UV0A 4D4YA 3Q3BA 4FKIA 4XH6A 4ZAUA 1FBNA 3FMHA 2GFCA 1UU3A 5DVRA 2AUHA 5AP0A 4D2VA 3ZXZA 4MTAA 4QMVA 3CQWA 4FL1A 4IB1A 4JT3A 3IW5A 5FDXA 3QKLA 4AOIA 3MTFA 4X3FA 3KGAA 5A14A 4AW0A 3Q4ZA 5CZIA 2FUMA 3P7CA 4O82A 4O7LA 2YM4A 4TWNA 3TV6A 4F7JA 4R7HA 1Q8WA 4AZEA 2R3JA 4AS0A 3W1FA 5C8MA 4R5SA 4RJ7A 1YOMA 4JBPA 3TM0A 4M15A 4DFLA 2C6TA 1QMZA 3F2AA 4O27B 4F65A 2YCRA 2FGIA 2YIQA 5HBJA 2R3PA 3B2TA 1G5SA 1YDSE 2FA2A 3TKIA 4ARKA 4YO4A 3E88A 4IDTA 3F5PA 4GSBA 2I1MA 4EUTA 4PDYA 4DH1A 4F1OA 2Y8OA 1SZMA 2ZYBA 4FNZA 5FEQA 3DB8A 2W1IA 5M4UA 4FEXA 4ERWA 1MQ4A 4PMMA 2YIXA 3RGFA 4D4VA 4BCIA 4J8NA 4PNIA 3R8VA 1Q5KA 2VGOA 1RE8A 3U51A 3EFKA 1M2RA 4IX5A 4FKVA 4FEWA 4JG7A 4BWKA 5FXRA 3B2WA 4QMPA 5DGZA 2C5XA 4USDA 3UMWA 4EK4A 4D2TA 3R83A 4CG9A 5L6OA 5KMOA 3FJQE 2XEZA 5HLNA 4FZFB 3VAPA 3VUGA 5AAFA 2XIXA 3D83A 2XK7A 4BCQA 5BX0A 5CEQA 2PVMA 2X7GA 2ZV8A 3N9XA 4YGAA 4YSMA 4QTCA 5HO7A 2QLQA 4X3FC 1GZOA 1JKSA 3G90X 4HGEA 5EDRA 3A61A 4CZTA 2JDOA 1V0PA 3W33A 4FVQA 2JD5A 3II5A 3OW4A 4P4CA 5B2MA 2Y0AA 3G0FA 3QD3A 3U4WA 3CGFA 1ZXEA 4RRVA 3ET7A 5HD4A 5EYKA 4FKTA 3C13A 3R1YA 5ICPA 3MPMA 3MVJA 4ZTNA 4BDJA 4U97A 5CI6A 5E8WA 3VS5A 4YO6A 5DFPA 4C59A 2BR1A 3QTQA 1XBAA 4K0YA 2OJJA 5HO8A 4G9RA 5A6OA 2GMXA 4H05A 3HRCA 4F0GA 2JIIA 4CV8A 4AGCA 3Q6UA 4BGGA 3S1HA 3R7EA 4HYIA 1ZOGA 3H30A 3JUHA 4C36A 4GYIA 3HEGA 3QA8A 3ZBXA 5HE0A 4D4RA 3KMUA 2XEYA 3BHUA 4NM7A 1ZARA 1FVRA 2G2FA 3EN9A 3SVVA 2IZRA 3NW5A 3PG1A 4FF8A 1OIYA 2QHMA 4FKOA 2OI4X 5CF8A 3VULA 1OL6A 2BKKA 4QPAA 4BHZA 3FE3A 3V8TA 3U55A 4IAYA 4GCJA 5TOZA 2XNNA 2BILB 2W0JA 5EM7A 5AV1A 3R7OA 3W16A 3DFCB 3EFLA 3Q9ZA 3PJ8A 4YHJA 1FMKA 4RIXA 3P4KA 3ZO1A 5KUPA 3HDNA 3EQCA 3L9MA 3UO6A 5AUUA 3EWHA 4QP3A 5B0XA 5BMMA 3A7FA 1XQZA 4L7SA 4E26A 4ACHA 3KVWA 3QYWA 4CKIA 4IX6A 4B99A 2NNWB 4Y95A 3VO3A 2OH4A 3GI3A 4RIWA 4LGGA 3V01A 4FIIA 5J7HA 4J52A 3VWAA 3FL5A 3GBZA 2E9PA 1XH4A 4FG7A 4PMTA 4YZBA 3DB6A 2O3PA 3FZRA 3LFSA 4GYGA 3P79A 3E62A 4IAIA 5D10A 3I81A 3OXIA 5DHJA 3R30A 3FI2A 3DBDA 3UO4A 3ORLA 5CSVA 1Z5MA 3C4CA 4E3CA 3NS9A 5CU3A 5CAOA 3CP9A 1NVQA 4F09A 3EQDA 5JN2A 5J8IA 1BUHA 3NUPA 3HRBA 2BROA 5BMSA 2RL5A 3JXWA 3GENA 3QCQA 1OGUA 2Z2WA 3D5XA 4P5QA 1ZYDA 4R3PA 2YIWA 3NUUA 4GG5A 4H3QA 5HE2A 4AA0A 3E87A 4FSTA 2FB8A 3T9IA 5FTOA 4EC8A 4EQCA 4NH1A 1JSTA 2PMLX 4E5BA 3PA4A 3OOMA 2P33A 4FV0A 4IVBA 5I3OA 3PJ1A 2WTWA 3UZTA 1T45A 5E4HA 1CDKA 3ORPA 3QRIA 4DGNA 1KE7A 3PPJA 5E8XA 5IA5A 4MAOA 3S00A 2OZAB 3QTZA 3F3VA 2HZ4A 1XR1A 4O81A 4EOPA 4O0SA 1XH7A 4C3RA 4EUUA 3RPRA 2VAGA 2GTNA 2CNQA 2GNJA 3ZLYA 3ELJA 5EYMA 2C1BA 2OW3A 4D1ZA 5M55A 2OICA 1ZWSA 2I6LA 4DF3A 3U87A 4B6LA 4QTBA 1BX6A 2YHVA 1MRVA 2WU6A 3QLGA 4ZS4A 2CKOA 4D5HA 2BHEA 3EQHA 1P4FA 2X8EA 2C0TA 3E7VA 4FTCA 4IXPA 4ASXA 1U4DA 3DTWA 4BVUA 1F5QA 3U54A 3QHRA 4OBQA 4YJVA 4Q5EA 5C9CA 2XK3A 5AUXA 3V3VA 4DBNA 5A4CA 4J7BA 4O2PA 4RFZA 3R2YA 4UBAA 2VD5A 4FKLA 2VO3A 4YLKA 1KUTA 2A27A 4ZSJA 2IVTA 4IIRA 4MVFA 3TN8A 5L8KA 2HZNA 3Q4CA 2P2IA 4RQKA 4C4FA 1ZRZA 4W4VA 4XBUA 2WTKB 3LFQA 1V0BA 2JKKA 4UWCA 4FSRA 5AADA 4I20A 4I4EA 3I5ZA 4FIEA 5DNRA 4ZXTA 1BI7A 1PKDA 2IJMA 4BI0A 4XJ0A 4RC4A 1PXNA 2FSOX 2X9EA 3AMYA 4JX7A 2YCFA 3TUCA 1B39A 3D7TA 3FDNA 5AM7A 5C4LA 2Z8CA 3ZFXA 3R7GA 2Z7SA 5EW9A 3EQPA 3ORTA 4EORA 2C69A 3POOA 3GU6A 4HZRA 3EL8A 4KNBA 3ZMMA 2HAKA 4BWXA 5JFWA 5TE0A 2VNWA 4NU1A 4XG6A 4FZAB 2JKQA 3VBVA 3BV2A 3NGAA 4L42A 4RJ6A 1FVVA 4IVDA 4FKRA 4DFZE 4AN2A 3FQEA 4U41A 4U79A 3M2WA 1Y57A 4NEUA 1CMKE 5LVLA 2QOFA 2C3IB 3SG9A 3A7GA 3PTGA 2XCKA 4I5MA 4NFMA 5B2LA 5E8SA 3IGOA 5AUVA 4H3PA 5M56A 4IVAA 4CT2A 2QCSA 5KBRA 3KY2A 4IDVA 3S0OA 3PXRA 4PPCA 1S9IA 1VYZA 3NAXA 4AZWA 1OI9A 3C4EA 5LMBA 2A0CX 3MY5A 4FT7A 3SW4A 4AZFA 4DEEA 2V7AA 3KREA 3QZIA 1JBPE 3S3IA 2W5AA 4BDCA 2Y4IB 4QP8A 1NXKA 4JOAA 3WYXA 4WBOA 4LOPA 2GTMA 3UIUA 4U81A 1QPEA 1FPUA 3KRWA 3ZM4A 2Z02A 5D9HA 1NA7A 5DYJA 2WMSA 3ORKA 2EWAA 3FSKA 2X7FA 3MGYA 3NUSA 4PDPA 4M12A 2CCHA 2QG7A 5LVMA 3JPVA 5KX8A 3VS3A 2WTJA 2X2MA 4E4XA 3CLYA 4AZVA 4E6QA 4FTKA 1PXPA 2PY3A 4FKQA 3W2PA 2CKEA 2XB7A 2IZUA 4HNIA 3A60A 4JXFA 2KTYA 2XNOA 4XBRA 3BV3A 3OXZA 3TJCA 1OL5A 1RJBA 3H9OA 4X2FA 3VC4A 2G01A 2NP8A 2YLFA 2ZDUA 4A9SA 4FE2A 4EBWA 3LFAA 1WBOA 5ANEA 4BDIA 5IISA 4IZ5A 4FX3A 5H8EA 4O21A 4YTCA 4ZTMA 1BI8A 1L3RE 2B9HA 3GC7A 4IBMA 4CZYB 1R0EA 2BZIB 1UU8A 4YC6A 5AMNA 5DMZA 1QCFA 3R22A 4RGJA 4UY9A 3W10A 2B7AA 4KS8A 3TIYA 3ZRMA 2VWXA 3W2QA 5EQPA 4I6FA 4L01A 5EQEA 4C2WA 4YURA 2QQ7A 3I0OA 3IW4A 4NW6A 4IFCA 3V5JA 4M14A 1U5QA 3DLZA 5M53A 2W17A 5CU6A 4QP6A 3VS0A 3RWPA 3ULIA 3QX2A 3PE1A 4AXAA 1PMEA 2X0GA 3NUYA 3UPXA 2JC6A 4F64A 3TZMA 4H39A 3WZEA 5FGKA 3D14A 1WZYA 5HNBA 5AR3A 4IW0A 5BVWA 3W8QA 2XMYA 1UU9A 3H9FA 4FL2A 3DXPA 3OT8A 4DGGA 3PVUA 1WBTA 2VTIA 2WO6A 5A46A 4BKJA 4CFVA 1H24A 5IEXA 5CT0A 2OIBA 4I41A 2XCHA 2X8IA 3C4ZA 4JRNA 3WBLA 5KHXA 4KS7A 4GJ2A 2NO3A 3DAKA 5EOBA 1P5EA 2VTNA 1QL6A 3NZ0A 1ZYSA 3BQRA 5FP6A 4RX5A 1PW2A 3DJ6A 2RF9A 3HKOA 1NVRA 2BRBA 2GNIA 3H0ZA 3TACA 3LPBA 2HK5A 5A4LA 4V05A 3LQ5A 5A54A 5AR5A 3IOPA 4GK2A 4EBVA 4D55A 4RVLA 2LGCA 1JOWB 4BDBA 3RALA 4D2PA 4LMUA 4M69B 1G8AA 4MYGA 4ANMA 1GZNA 3F69A 2IW8A 5IA1A 5DT0A 3LXNA 5L6WL 3OT3A 1KE6A 2W1HA 3R02A 3LXLA 5A4QA 5C03A 1GIHA 4NJ3A 4EYMA 4OTWA 1OIUA 4NIFA 3NW6A 5GJGA 3K5VA 3OEFX 5FEDA 3DKCA 1GIIA 1M2PA 3QXPA 4LRKA 4AW1A 1Q3WA 3RNIA 2WAJA 2OXDA 4IJ9A 2VTJA 2I40A 3UQFA 3LHJA 4XYFA 3UBDA 4J97A 3OS3A 4BCHA 5FTQA 2I0HA 4YJSA 3O96A 4C33A 4F9YA 3AMAA 3JYAA 4R8QA 4YLLA 1K3AA 3PLSA 5GZ9A 4ZJIA 4XEYA 3R9OA 3QZFA 2I0VA 3BX5A 4QMWA 4QMLA 1JPAA 4R3CA 4V04A 3PXZA 1OKYA 4TNBA 3V5WA 4BDGA 4GUBA 2J9MA 2R3IA 5FXQA 1EH4A 1YWRA 1W84A 3UOHA 4AP7A 4CEGA 3EB0A 3UNJA 4AOTA 2EB3A 3GFWA 4L44A 3FWQA 5HQ0A 5JFVA 3DBEA 5L2IA 4DT9A 3W2OA 5I9WA 3MFSA 3CEKA 5DBXA 1E1VA 1E9HA 2ZOQA 4RZVA 1QPJA 4H1MA 2R3KA 4IH8A 1L8TA 4OTRA 4FKPA 3VBYA 1YWVA 2W1DA 1YI6A 5GHVA 3MW1A 3NPCA 5I5ZA 2J51A 4P90A 5IZFA 2ZMCA 4DFYA 3UIXA 3CJGA 4MH7A 3EZVA 5C1QB 1J1BA 4H36A 2QD9A 4FMQA 5CALA 5J5TA 3QRKA 4MBLA 3CKXA 1OZ1A 5LOHA 4M7IA 1ATPE 5T3QA 2BAJA 4BZNA 3TUDA 3I5NA 3AD6A 2YM7A 2HXLA 3C4XA 5G1XA 3AD4A 2LAVA 3V8SA 1XH6A 4YU2A 3UP7A 3R8LA 4ASDA 4QP7A 3VNTA 3HRFA 3MH2A 4JBQA 1GY3A 1REKA 4CYIA 1ZAOA 1PXLA 4Y85A 4FTOA 3C0IA 4EH6A 3KRXA 4XNEA 1YRPA 4I5CA 4BCJA 3Q60A 3MH0A 5M4IA 3GVUA 1A06A 3SHEA 4EHZA 1CKJA 3ZO2A 3QUPA 5I0BA 2YN8A 3R2BA 3JVRA 4Z16A 1RW8A 3FPQA 1Y6BA 2WEIA 4KWPA 3E8EA 3MY0A 4O0TA 5A4TA 3O7LB 3ODZX 2QHNA 4KIKB 4RZWA 5DRDA 4QP1A 3UQGA 3DS6A 5CXZA 2BZJA 4CKRA 5IH4A 5KZIA 2ITZA 2XVDA 5CAVA 5J9YA 4WG5A 2C5NA 4FKWA 4QNAA 5J79A 4RVMA 3UZPA 4CYJA 2X7OA 4Y73A 2DWBA 5EM8A 5AR7A 4ITJA 3FKLA 3UG2A 4BDAA 4WHZA 4AZSA 4EH2A 3ORZA 3V8WA 3CR0A 4R7IA 2BIKB 4TYIA 1H8FA 3R9HA 3MFTA 5ANDA 3FLZA 5FD2A 1G8SA 2R3OA 3D2IA 3CC6A 2GQRA 1R78A 2ETKA 1LEWA 3RHKA 4LUEA 3ZLSA 3OBGA 3DU8A 1WFCA 2XS0A 2JDRA 3H9RA 3MIAA 5GJFA 3BHHA 2PL0A 2OXYA 3ZRKA 2Z7RA 2YM6A 3MVHA 5AX3A 4F6WA 3AXWA 1WBVA 3QRUA 3BEGA 3GCPA 2YCQA 3W32A 4DTKA 5ETIA 3CD8A 2QNJA 3LJ1A 2YLEA 2VN9A 4KD1A 2R3HA 4PTEA 5E8YA 5EG3A 3F5UA 3Q52A 3QKKA 4D2SA 4G3EA 5DWRA 5EYCA 2RIOA 2BIYA 3ZDIA 1PF8A 2IN6A 2IZSA 5CSPA 1NVSA 5C26A 1PY5A 4IMYA 3KU2A 2QOOA 3IW8A 4WNOA 4CFMA 3UC3A 4FC0A 4MD9E 1ZOHA 5AV0A 2UW7A 5ANGA 4DCEA 5BVOA 4D28A 5HX8A 5HOAA 2P2HA 4MNEB 1KV1A 4RLLA 4ZSAA 3W55A 2R5TA 1O6LA 3EHAA 2PVNA 2Y4PA 4E5AX 5AA8A 3BQCA 3VBQA 4MNFA 3QUEA 3DAEA 3GC8A 3AC8A 3F5GA 3KMMA 4XV2A 5EM5A 4LI5A 3R7VA 4EOKA 2O2UA 5M08A 5FBNC 3GU7A 4AG8A 3FBVA 3NDMA 4D9UA 4QQ5A 5AP6A 4QTEA 1J1CA 3KXHA 4YJTA 4YP8A 3WZJA 2PVHA 4WRGA 3UE4A 4D1XA 2QKWB 5DT3A 5AP2A 5FTGA 5DI1A 2X8DA 3RJCA 4DG0E 4RQVA 2WMBA 3V6SA 5CEIA 3KCKA 4KUJA 2WIPA 3UTOA 4BDDA 5C8NA 4UMPA 1ERKA 5HTIA 3HX4A 4ZSGA 5FXSA 1O9UA 5J5SA 3ID6C 2BRMA 3OVVA 3LFNA 3FLNC 4K9YA 4L8MA 4XG9A 2BDJA 2ZV7A 3KFAA 4FTQA 4BCFA 5CEPA 3RK9A 2O65A 4FV5A 5HCYA 1JNKA 5D41A 3S2PA 4D58A 1P14A 1NW1A 3ROCA 3L1SA 1XH8A 3F61A 4ALUA 2BDFA 4UZHA 3CY3A 4L7FA 1GZKA 4TN6A 2GFSA 3DV3A 5KZ0A 3MJ2A 1YWNA 3AC4A 5AUWA 3DLSA 4P2KA 2UZNA 5EOLA 5AP3A 2REIA 4QYFA 3QZHA 3OWPA 5E1EA 5K4JA 1PMNA 3WILA 1Y8GA 3QXOA 3R7IA 2J0LA 4TKSA 3QCYA 4NCTC 4OTHA 3HGKA 4X7QA 5M06A 5FM3A 4ORKA 4PDOA 2Q0NA 2J0KA 3S95A 3BKBA 4O22A 3R7YA 4FK3A 5HIDA 4GKIA 2ZJWA 5AAGA 3FC1X 3SGCA 3DNEA 4YZDA 3VUMA 4C37A 4AT3A 3A8XA 4YHFA 4F9WA 5HD7A 5L4QA 3OP5A 2R3NA 2VX3A 2PE2A 3QCSA 5BVDA 3UQCA 4FA2A 1J91A 3HMIA 4GRBA 4QQTA 3LVPA 1OPLA 1U54B 1YHWA 3Q96A 4JNWA 4MHAA 3QFVA 3PIXA 3HV3A 2FSLX 3DK3A 3NR9A 2OO8X 2WEVA 4U8ZA 2OZOA 4C34A 4C61A 4RX7A 1UKHA 1VJYA 2UZUE 3A8WA 1JKKA 3WI6A 1ZLTA 3AC1A 4CZUA 4IM2A 4CFFA 3R01A 4IACA 4X3JA 5EI6A 4X6RA 3E93A 3RCJA 3ZFMA 4CTCA 3EQBA 3O71A 4NJDA 3TNQB 3R9NA 2ZAZA 4KRCA 4JAJA 2QOIA 4Q5HA 3SXSA 4FT3A 4L43A 4TTHB 2J5FA 2WTVA 3WF5A 4ZLOA 4O0YA 4ERKA 4ZTLA 3K54A 4XHKB 4TY1A 4FOCA 4XS2A 3LCOA 3LCSA 4GT3A 4UEUA 2CPKE 3GCQA 2B54A 3FZ1A 2J0MB 3ORXA 1ZYLA 1X8BA 3VBWA 4BHNA 2CNVA 3FKNA 5HTBA 4RWIA 3QGWA 3VVHA 2C3LA 1TVOA 2ZMDA 5AWMA 1KE9A 2R2PA 4PP7A 4XG8A 3KXZA 2UW0A 3D7TB 4QT1A 1YHVA 4ANLA 5K3YA 3AT2A 3RINA 2QR8A 5FP5A 3R71A 3SRVB 3G9LX 3TZ7A 2FVDA 5ACKA 3HV6A 4BFMA 4J95A 5M44A 4AGDA 3BELA 3LJ0A 4LM5A 2E9VA 4HJOA 5AIKA 3VJOA 3BU5A 4RIXB 3KVXA 4EZ3A 3BE9A 2Q0BA 1YW2A 4O91A 3F3TA 2VUWA 3G15A 1H1QA 3DJ5A 4XG7A 5BVNA 2GHMA 3LM5A 5KKRC 4EJ7A 3ZO3A 3HA6A 1YOJA 1MRUA 3DKFA 3QALE 4FT5A 1CKPA 3WOWA 4C7TA 3ZSIA 1PMUA 2VGPA 3TNWA 3P78A 4PL5A 4U42A 4QPMA 5I9XA 4O38A 3DJ7A 2UV2A 3MH1A 4E4LA 4GU9A 4F7LA 2Z7LA 3AQVA 3G6GA 3JS2A 3OY3A 4Q9ZA 4TYHA 5BYLA 1CTPE 1STCE 5IUGA 4WSYA 2UW6A 2R0UA 3BYSA 4W4WA 5DOSA 3V5LA 3EQFA 5EHLA 4FG9A 4IM3A 3UIBA 2WZJA 1PKGA 5HORA 5K0XA 4OR5A 2J7TA 3G5DA 1Y91A 4A07A 5CASA 3UVQA 5M4CA 4XRLA 2HENA 4EHVA 4CV9A 4KSPA 3UOJA 2QO7A 5HHWA 2PK9A 3BGPA 1H0VA 3PIZA 3FAAA 4NW5A 4QMMA 1W7HA 3A7JA 5J9ZA 1DM2A 1WAKA 3WE8A 3ZH8A 5F94A 4AT4A 1OB3A 4RWLA 4U80A 2OFVA 4EKLA 4F63A 4WG4A 2WTKC 3LMHA 5IQHA 4O1PA 4AX8A 4K1BA 3GP0A 4FICA 5CEKA 4C2VA 5A6NA 4BTFA 2OZAA 1JVPP 2RGPA 2C5VA 3CXWA 4PDSA 3OC1A 4RT7A 2H8HA 5EYDA 4O0RA 4FIGA 2XNBA 3P9JA 1LEZA 3R8UA 3IQ7A 2VTQA 2GCDA 4BCMA 2EUFB 2WQMA 3RVGA 4G5JA 1XO2B 2YCSA 5IQFA 4B8LA 4ALWA 1YKRA 3VHEA 3FMMA 2W4OA 3QCXA 3EN6A 3L9LA 3NVKI 4AT5A 3ITZA 2BUJA 3TV4A 5F95A 4BI2A 1IAJA 4HCVA 3UVRA 1JWHA 4E93A 4IFGA 4PP9A 3VUTA 2R3MA 3RM7A 1PMVA 3BIZA 4K2RA 3RAWA 4DH3A 1SYKA 2F4JA 2VX0A 5TR6A 5GZAA 3RPYA 3SX9A 2F2UA 5DA3A 5HG5A 4LL0A 2ITWA 2JEDA 4DEHA 1GIJA 3NYVA 1VR2A 4XCUA 3FL4A 3UMXA 5KHWA 4AUAA 4NUSA 1ZZLA 3EFWA 2FYSA 3KK9A 5E91A 5CZHA 3P7AA 4E20A 4GL9A 2JGZA 3EYGA 3VUDA 4PWNA 3LMGA 4XP2A 3PY3A 3TTIA 4PMPA 4YPSA 1I44A 4QMSA 4FV4A 2F9GA 4L9IA 5KCVA 4CTBA 3FYJX 4QMXA 3QTXA 5BPYA 5HVJA 5HKMA 3ETAA 2QKRA 5DN3A 5DRBA 2R0IA 2PMNX 2VV9A 4JVGA 4DFXE 1MRYA 2WOUA 5CVFA 4EH5A 5D7AA 4QOXA 2CGUA 4EI4A 3LFBA 3KXXA 3HV4A 4UYNA 4R77A 3VF8A 3DQXA 3CBLA 2B9JA 2A1AB 5TF9A 3D9VA 4EOJA 2G2HA 3PP1A 3VUHA 3TNHA 5GIOE 1XBCA 3RI1A 4GV1A 4NM0A 2P55A 3HP5A 5JGAA 3ZSGA 3COMA 3KN6A 2BRHA 4E6DA 4O0UA 1XWSA 4G6OA 4X3FB 3CQUA 4BY9E 5CAQA 2FSTX 4DEAA 1XHAA 2ZVAA 3FXWA 4TL0A 4ITIA 2WD1A 3GCSA 4O1OA 4QMNA 2QOCA 3ANQA 3QAME 4H1JA 4NZWB 3LZBA 4JDJA 4QTAA 1FINA 1PJKA 5HESA 3HA8A 3NYOA 5C8KA 3ZM9A 4JDIA 1H26A 3C5IA 4PUZA 3KXGA 4RFYA 5KMIA 5LMKC 2RFEA 2BKZA 4FYNA 4RVTA 3AOXA 3GC0A 2O0UA 2JITA 4XP0A 5AV4A 2WXVA 4UN0C 5AEPA 4YBKA 4BYIA 1KOAA 3O17A 4NK9A 3R8MA 4DEBA 1W98A 5HLPA 2ITXA 3ZONA 2BVAA 3BLQA 3IOKA 5DR9A 1LUFA 4PPBA 4C4IA 3UPZA 3MH3A 3AGLA 3CCNA 5M4FA 4GT5A 3PSCA 3CPBA 3V5QA 1M14A 2XKFA 5FLFA 3GUBA 4BCNA 5CF4A 2UVYA 4U43A 1K2PA 4FUYA 4IADA 4RJ4A 2WOTA 2Y4IC 5HBHA 3NLBA 4RC2A 5ACBC 3Q4UA 3AC3A 2XM9A 3JY0A 3Q9WA 1YXTA 4UB7A 1OIQA 3NWWA 3O8UA 3MVLA 2WQBA 4RIYB 4O0WA 4A06A 2B9FA 4Y46A 3EQIA 2VWYA 3OCTA 3LIJA 1Q8ZA 1O6KA 2B1PA 4I0RA 4ONAA 1U5RA 2OIDA 3BBWA 4E73A 3KRRA 4XLIA 4E4NA 2JBOA 1ZY5A 4O6LA 2VTHA 4RWKA 4XG3A 2PVYA 4Z7GA 2WMWA 3KCFA 3F82A 3PA3A 3E8CA 4I24A 4K8AA 4WUNA 5EM6A 4U6RA 4Y5QA 2CLQA 4EZ7A 5HU3A 3ATTA 3PJ2A 2WTIA 2XK9A 5D12A 3GT8A 4JDHA 3DBFA 1M7QA 2PZ5A 4FL3A 5CQWA 4QP4A 1TQIA 2WQEA 2VTAA 4QNYA 2QO2A 3QKMA 3RWQA 2ZV9A 4YZCA 3CGOA 2RFDA 3BLRA 4M97A 2VWUA 4KBKA 4ZP5A 1Q61A 4M66A 1ZY4A 5AP7A 4CCBA 4AE9A 4OUCA 4IAAA 4ANSA 4EOIA 4MQ2A 4S32A 3WE4A 3QQGA 4I6HA 4TYEA 4E8AA 4RFMA 3L8PA 3PFQA 4DCAA 3A4OX 2QVSE 5L2QA 2G15A 3G51A 5EKNA 3ANRA 3E8DA 3RPSA 3ZYAA 4DG2E 5E9EA 5LCJA 3TCPA 4AN3A 3O50A 3Q2JA 3WZUA 5E8VA 4ASZA 4EOQA 4IZAA 4M68A 4OLIA 3ZU7A 2X39A 4UMRA 2W9FB 3H4JA 1PXKA 3QQHA 4UZDA 4XV9A 4JRVA 3A2CA 2WNTA 4EK3A 3QUDA 3DZQA 2YM5A 5LQFA 4DHFA 5H3QA 3I60A 3OW3A 5LJJA 2CHLA 2HOGA 4ANQA 3RMFA 3AT3A 3I0QA 2P3GX 3FPMA 4I6BA 3DA6A 4HW7A 1KE8A 3VS7A 3MESA 5JRQA 5H8GA 4G31A 2XNPA 2A4LA 3U8WA 4KSQA 4ZS0A 2YISA 2HZ0A 1T46A 5IMXA 2VTOA 2ERKA 3C4FA 4RJ8A 3FZOA 3FY0A 2CKQA 4CD0A 3Q2MA 5AIRA 1IR3A 2OIQA 3B8RA 3OROA 5LVOA 3SKCA 4JQEA 2F7ZE 4LL5A 5D1JA 3R1SA 5BYZA 3RKBA 5IDNA 4NYEA 5JGBA 3PYYA 4E5WA 3UIMA 1BL7A 3FV8A 2BCJA 3T9TA 4PTCA 5DPVA 4M3QA 4WG3A 3VS2A 5ETCA 4ZIMA 4EK8A 1MP8A 4EOMA 2PVJA 4BIDA 3EFJA 3D5VA 3NX8A 4YC8A 2J2IB 4YLJA 3AG9A 2R3LA 2BFYA 3TT0A 2Z60A 2ZM1A 1DAWA 4BCKA 5C4KA 3VQHA 1W82A 1NT2A 4DT8A 3WF6A 4A9TA 4H58A 1VZOA 2X81A 3PXQA 2WGJA 3KRJA 4IB3A 4UMQA 5C27A 4FT0A 3VF9A 4F08A 3BGZA 2R9SA 3C0HA 4RMZA 3P08A 4V0GA 2YEXA 4BZDA 3OCGA 5HVKA 1Y8YA 3MJ1A 5IEVA 2CKPA 5M09A 2JBPA 5CEMA 4DLJA 3D0EA 5GINE 3MPTA 4BL1A 4F9CA 1H1WA 4KKGA 3ZC6A 3PVWA 4U3ZA 4ZSLA 4DLIA 4JQ7A 4CCUA 1WVYA 3KQ7A 3QQJA 2XA4A 5K9IA 4FK6A 3QRTA 4IE9A 4X2KA 1H0WA 5HLWA 1KWPA 3DKGA 4I22A 5DE2A 2ZM4A 4JG6A 2CN8A 4Y8DA 4GMYA 4YJOA 4AWIA 5LVNA 2C0IA 3MB7A 3ORMA 3ALOA 2XM8A 5HICA 5IEYA 2JKOA 4X2JA 4D5KA 3VRYA 4EHEA 4Z7HA 3EKKA 5IQAA 4EH9A 2J5EA 3OOGA 4EOSA 1CSNA 3LFFA 4I23A 4RSSA 4UWYA 4O7NA 1OPKA 1PXIA 3OZ6A 3RAKA 3TDWA 3UZRA 1XH5A 1UA2A 4QMYA 5HG7A 5DEWA 5AFVA 5HBEA 3M11A 4DINA 4J8MA 1U54A 5CXHA 2VTSA 4JL9A 3ROYA 4EL9A 3MY1A 3F9NA 4GKHA 3QTSA 1GZ8A 1UWHA 2W4JA 4AU8A 4CRLA 4AN9A 4JBOA 1DI9A 4BRXA 4BZOA 5IMEA 1FVTA 4GFOA 4XOYA 4JS8A 3PWDA 4K18A 2BAKA 5HO6A 4EC9A 4CKJA 4J53A 4BBFA 3NMUF 5LMAA 5FWKK 4MD8E 3R9RA 4I5PA 3S4QA 4EHGA 2VZ6A 4I0TA 3R7UA 5HTCA 2OJIA 4TWCA 4FG8A 2PMIA 4KBCA 3MB6A 1BYGA 1OVEA 3CTQA 3PUPA 5EK7A 3C50A 4KKEA 5M51A 4YJNA 1WCCA 2DS1A 1SM2A 5AUYA 1XJDA 2W05A 4GEOA 3KB7A 4FYOA 3EN4A 4X21A 3I7BA 1ZZ2A 2XKEA 5BUEA 3C0GA 4OBPA 3GGFA 3LFDA 4Y72A 3E92A 4ZOGA 4C3FA 3MA3A 4M13A 4BB4A 4F1TA 3NCGA 3EN5A 2JKMA 3OWJA 5T6KA 3BHVA 3P5KA 4MD7E 5AJQA 3RHXA 3BEAA 3I79A 4FV8A 3W2CA 3U6HA 2QOHA 2WMUA 5IA4A 3NAYA 1OL7A 4S33A 3LQ8A 3R28A 3Q5IA 3FY2A 2PUIA 5HNIX 2VWBA 2PU8A 1A9UA 2WFYA 4M67A 4N57A 5L6PA 2QOBA 1J7LA 4IQ6A 2R64A 3MFUA 4LYNA 1UNLA 4X2NA 2OBJA 1URWA 2YACA 3ZOSA 2H34A 4G16A 3TZ8A 4ZLZA 1H1SA 2OK1A 3K5UA 3ZDUA 1OUYA 4QO9A 2OH0E 3FXZA 2GNHA 4IZYA 4GIHA 5D11A 5F20A 1H25A 1TQMA 3VS4A 3IW6A 3DK7A 4XRJA 3EZRA 3KKVA 5KMMA 4R6VA 2CCIA 1BLXA 3O7LD 3NVMB 2JAMA 3G2FA 4DE4A 2R4BA 2XKCA 3D15A 4TYHB 5CSXA 3WARA 2XK6A 2G1TA 2W9ZB 4Q9SA 2UW8A 5E90A 4MBIA 4AW5A 1A48A 2OG8A 2Y6MA 4LUDA 3F3UA 3CD3A 3LFEA 3Q6WA 4BDFA 2CGVA 4YNEA 4CNHA 3CKWA 4EH8A 3CQEA 2ONLA 4F6SA 4OBOA 4FSQA 3GCVA 5IQEA 2JAVA 1JKTA 2OWBA 2X4ZA 4U7ZA 5GJDA 3WF8A 3CTHA 4WO5A 4NTTA 4FZ7A 2V22A 5AR8A 5HU9A 2Y6OA 4D0XA 2GSFA 3DAJA 4O2ZA 3FI3A 5JSMA 3LKMA 5CWZA 2PZIA 4FV2A 3HECA 2QOLA 5BYYA 1JQHA 2OJ9A 3IDPA 3R0TA 2EXEA 2NPQA 4I4FA 4YPDA 3OY1A 2VTTA 4FZDB 2E9UA 3ZHPC 2PVKA 3R63A 3RAHA 4F0IA 3GQIA 2B55A 3I4BA 4N6YA 3UP2A 5DR6A 4FGRA 4JLCA 2UZLA 3FLWA 4JAIA 5K5NA 3G0EA 3PPZA 4L6QA 1UNGA 3R8PA 1IRKA 1BKXA 5JK3A 1M7NA 1WBSA 4IJPA 3R73A 5A3XA 5I9UA 3OTUA 2OLCA 2Y9QA 3HYHA 3FMLA 1F3MC 2IZTA 2GNLA 3MN3A 2JFLA 3ORNA 3P7BA 3VIDA 3UJGA 2VO0A 3ZLWA 4ZY4A 3HAVA 5CU2A 2BHHA 3C7QA 1YVJA 3AGMA 5F9EA 2J0IA 5T68A 4K77A 3WF9A 3ZRLA 3IPHA 3UG1A 4CG8A 2W06A 3F5XA 4WBBB 1G3NA 5CU4A 4YTIA 4E6CA 4UMUA 5IG1A 3PLAE 3WF7A 1ZMVA 2YZAA 3D94A 4WNMA 5GNKA 1ZMUA 4TYGA 3F2RA 3OFMA 2JDTA 4LV8A 3MBLA 5DT4A 3VHKA 3L8XA 3ALNA 4CFXA 5HGIA 3IDCA 4CLJA 3V5PA 3ZC5A 4QMTA 4TRLA 4C58A 4AZTA 5JFSA 2V62A 4L67A 3DQWA 4QMUA 4XP3A 3AC5A 1SNXA 4USEA 3COIA 5EI2A 1OMWA 3SAYA 4LV5A 5JZJA 2QONA 4YSJA 5IDPA 4WA9A 4RLKA 1JKLA 5JQ5A 4DA5A 3CPCA 2X6EA 4K6ZA 3A4PA 4JIAA 1KOBA 4IX4A 4ACDA 4EK5A 3PDTA 3NIEA 4EKKA 2W1ZA 5EFQA 2JLDA 3KULB 2OKRA 1Q3DA 2ITPA 4ZJJA 2GHLA 4FTLA 4TWPA 2YM3A 5IUHA 3TNIA 1W83A 2CGWA 3NRMA 5EW3A 4MKCA 3Q53A 3NIZA 1PXOA 5CS6A 4I3ZA 2WU7A 1IAHA 3ENHA 4I1ZA 4IVCA 2IW9A 3U6IA 4O7WA 5FUTA 4FIFA 3KC3A 2W96B 2EXMA 4J96A 4U3YA 1TKIA 5JMSA 4APPA 5KBQA 3LAUA 4E1ZA 2XIKA 4L3LA 2C3KA 3COHA 4GFGA 3OTVA 4RA4A 4MXZA 4ZTHA 2WQOA 2UZTA 4FTRA 1LP4A 3LJ2A 4PRJA 5BVFA 2QG5A 2G2IA 4RX9A 2Y7JA 1AD5A 3LM0A 3MI9A 4X2GA 1SVGA 4I21A 2J0JA 5EW8A 4NSTA 2OF4A 2ZDTA 2H9VA 1Q41A 4YJRA 4BBEA 3HZTA 2YJSA 3LOKA 1M52A 2YAKA 4FI1A 5AR2A 3ZS5A 2AC3A 4OAVB 4KIKA 2IVUA 1OITA 3PZHA 2F2CB 3QQLA 4D2WA 4RIOA 2EXCX 4YJQA 4B7TA 5AR4A 5LMKA 3U6JA 3NNXA 3LLAA 2CLXA 2R7BA 2XBJA 3R6XA 5CAPA 4FZ6A 1JLUE 4O6EA 4F7SA 2PE1A 4I5HA 3SOAA 3FLYA 4YUQA 4RIWB 5L2WA 4DG3E 4AA5A 4C02A 3CE3A 2RFNA 3HMOA 3LXKA 4FTJA 4RIYA 3BWFA 4BCPA 5AP5A 1FGIA 4J1RA 5CNOA 4W9WA 4Q2AA 4UYAA 3OMVA 3QWKA 3TZ9A 5HIBA 1SMHA 3ZUTA 2NRYA 1U46A 4A4LA 4CMTA 1M2QA 2IO6A 3F2NA 4OW8A 5KNJA 2C6DA 1Q8YA 2QO9A 4IEBA 4G1WA 4EWHA 3BYVA 4I93A 4FKUA 4LFIA 4FOBA 2C6EA 4YZ9A 5I9YA 2UUEA 4CFNA 2O5KA 4KINA 4EOOA 3PP0A 4J98A 3HVCA 5CF5A 4WIHA 4F1MA 2R3QA 3PY1A 1IEPA 4BIBA 2KULA 4F0FA 5HZNA 2R7IA 3HMMA 3MWUA 3TI1A 2EU9A 4G5PA 2YERA 3OD6X 2WTDA 1YI4A 3T3UA 3KEXA 3PXKA 2C5OA 4LRJA 4ZTQA 3K2LA 2ZB0A 4KRDA 4L53A 4ACMA 4QPSA 2I7QA 2C1AA 4AW2A 3ODYX 2C68A 1H1RA 5L2TA 5ANIA 3QTRA 4ID7A 2XBAA 3FHRA 3GC9A 3O23A 4QD6A 3BE2A 4FTTA 3BU6A 4W4YA 4OTQA 1ZYJA 2XIYA 2RFSA 5H2UA 3HV7A 4WSQA 5ITAA 3FSFA 1M17A 4TXCA 2QU6A 3Q9XA 3O8PA 5J87A 1AGWA 5LCKA 3H0YA 4YHTA 4G6NA 4B0GA 4EONA 3P0MA 4HCTA 3DY7A 5F1ZA 2CGXA 5CENA 4FTMA 3UODA 4F99A 5M07A 4NM5A 4GIIA 2BAQA 4G2FA 3ZEPA 4KB8A 4O7ZA 4ALVA 4S30A 1W8CA 4FUXA 4DEDA 1YHSA 3EN7A 1E1XA 4ZSEA 2HY0A 2VU3A 5LXMA 3NW7A 3OCSA 1SVEA 3DDQA 1KV2A 2WMAA 3NUXA 3TJDA 1SVHA 5FQDC 4FIJA 3OWKA 4L3JA 5E8TA 4HYHA 4BC6A 4DH5A 3E3BX 4FSZA 3FLSA 2OU7A 5JFXA 4WKQA 3NSZA 4XX9A 4BDHA 4TW9A 5ANKA 5HG9A 4F4PA 1P2AA 4D4SA 4D0WA 1Q24A 4PL4A 4ASEA 4KAOA 4MXYA 3QQKA 2AC5A 3RNYA 4YMJA 5ANJA 4AFEA 3GU4A 4TYJA 3U9NA 3UDBA 4A4XA 4AAAA 5AUTA 2B0QA 1R3CA 2BFXA 3COKA 4NWMA 1H1PA 1QPCA 4ZTRA 4PNKA 4N4SA 5IQDA 1IASA 3A62A 3GCUA 2BMCA 4NFNA 4C62A 2WMTA 3KMWA 1ND4A 4TZRA 2PUUA 3TEIA 4DFNA 4L52A 4MF0A 4O7VA 3EKNA 3O51A 5HI2A 4M0ZA 4QYYA 3V04A 1K9AA 2PVRA 4J71A 3L8SA 2W7XA 3POZA 4E6AA 5KMLA 3FI8A 3I1AA 2GNFA 3AC2A 3BHYA 3CTJA 3AD5A 1OL2A 4HOKA 4N70A 5H9BA 3QYZA 1NY3A 2GNGA 2YIRA 5K4IA 3PA5A 4FTIA 5HE3A 4CT1A 1JSUA 1YXUA 5CNNA 4R5YA 3C51A 4LRMA 4TWOA 4RA5A 4AE6A 2CDZA 4WRSA 4FV6A 3NUNA 4U0IA 2C6KA 4HGLA 4GFMA 4L45A 1UWJA 1OKZA 4FSYA 5EKOA 3W18A 2PMOX 3EJ1A 4TPTA 3DGKA 3ZZEA 5I9VA 4G6LA 3WZKA 3THBA 3UNZA 5AA9A 1OKWA 4BGHA 5I9ZA 4MQ1A 4RBLA 3F7ZA 3BYOA 4C3PA 2PWLA 4GK3A 4O96A 1RDQE 4BICA 2ACXA 2C3JA 4QQJA 3ZEWA 4YR8A 2GS2A 5A4EA 3RBWA 1IA8A 1VYWA 3RZBA 4QMQA 5GZ8A 5JH6A 4AOJA 4O0XA 3MVMA 2BRGA 2ERZE 2V5QA 2QODA 2YM8A 3E64A 1OKVA 1H07A 2PZYA 2WPAA 3BCEA 3IKAA 5E8ZA 2QOQA 3FXXA 4XV1A 4ZY5A 1R1WA 4FSUA 2ESMA 2ETRA 5IPJA 5EDQA 4BTKA 5AM6A 5EQYA 4GVAA 3HL7A 5J9LA 5CQUA 5HE1A 1UVRA 4BR3A 4RG0A 5EDPA 4BBMA 5J7BA 2EVAA 2O63A 4HVGA 5M57A 3ERKA 3KXNA 3HMNA 5EI8A 3ACJA 5CAUA 1J3HA 5KO1A 3W2SA 4ZEGA 2J6MA 1OIRA 2W1CA 3CY2A 4QYHA 1GAGA 3JVSA 1ZMWA 2XRUA 2OF2A 3QBNA 3Q4TA 4MF1A 4XUFA 3UGCA 2UZWE 3SLSA 3G33A 2XK4A 3WIKA 3FEGA 4P5ZA 5IF1A 3R04A 4JBVA 4RWJA 2VTLA 5LWNA 4DTBA 3I6WA 4DFUA 3AT4A 4DTAA 4U40A 3OF0A 1S9JA 2PZRA 4QYEA 4D2RA 4FV3A 4WD5A 3DK6A 2JFMA 5AUZA 4I94A 4ZZMA 2WQNA 4DC2A 2DYLA 3QD4A 4XLVA 2C6LA 4GW8A 2HIWA 3KN5A 4BYJA 1GJOA 2YDJA 4M84A 5CX9A 2ITNA 2YWVA 2QR7A 3HAMA 2WMXA 3PRFA 3HUBA 1KE5A 4BI1A 2PE0A 5EHYA 3ZTXA 2JIUA 4K33A 2HZIA 3LMIA 4EK6A 5FM2A 4AGUA 4F9AA 4W9XA 1R0PA 3LFCA 1AQ1A 4MCVA 3SQQA 3HDMA 1HOWA 4RJ5A 3FMDA 5CLPA 5FBOA 3EMGA 4IC8A 4JR3A 4DAWA 3LQ3A 5HCZA 3OUKA 2XYNA 2BZHB 2I0YA 2W1GA 3K3IA 3N51A 2ITVA 4LOOA 2XYUA 3RPVA 5E92A 3TTJA 4BTJA 2HWPA 4A4OA 4FKSA 4PV0A 4OTIA 5CSWA 5AP4A 3E63A 2JIVA 3QTIA 4CSVA 1UNHA 2IG7A 3FHIA 2V55A 4QYGA 1BL6A 4YJPA 4HGTA 3B8QA 4NT4A 2VWZA 5BVEA 1Q8TA 2UZVA 1GOLA 2IWIA 1VEBA 2A19B 2YFXA 3IONA 2XNGA 4DGOA 1XBBA 3NYNA 2OSCA 5KMJA 1DS5A 4OT5A 2R3FA 3BHTA 2XRWA 4R7BA 1H27A 3DDPA 4IZ7A 3QWJA 1DI8A 2PVLA 4GJ3A 3N4UA 3HP2A 4FKGA 3UYTA 4YJUA 1DAYA 1B38A 4JQ8A 4LOQA 2R3RA 3NNUA 5IUIA 5I4NA 5KMKA 3GEQA 3PVGA 4MBJA 2XJ1A 4DGLC 3N4VA 3W2RA 1Q62A 2PHKA 3TDVA 4HYSA 2IW6A 3TUBA 5BUIA 5D7VA 5JZNA 1BMKA 4OTGA 2GHGA 3GOKA 3KL8A 4RPVA 3VUIA 5GIPE 3U9CA 3MFRA 5DG5A 2XNMA 2FO0A 3EQGA 4AACA 3UC4A 3NNVA 3VUKA 3L9NA 5E1SA 1U59A 2X4FA 3QRJA 1YI3A 3BPRA 3A7IA 2IVVA 4W4XA 1XH9A 5IKWA 4V0GB 4MEDA 3EIDA 5CF6A 1APME 5ETAA 4LQMA 3GXLA 4A7CA 2OGVA 3DNDA 4I0SA 1TQPA 2QC6A 3QF9A 3PRIA 4EJNA 4FV7A 1UKIA 3QU0A 2BRNA 3FYKX 3ZO4A 4DN5A 4EYJA 5IU2A 3SOCA 4G3FA 2WHBA 2WMRA 1OPJA 3KF4A 3WZDA 4YBJA 3DZOA 5ANOA 4UX9A 4GH2A 3H3CA 1WBNA 1WBPA 3K3JA 4B4LA 3E7OA 2XJ2A 4Y5HA 2F7XE 3DTCA 4MWHA 5CVGA 1Q4LA 2ITYA 2Z7QA 4UXLA 5CYIA 3PE2A 4FSMA 3FZSA 4PF4A 1YDTE 1YQJA 3QZGA 2ITQA 4YTHA 2FH9A 2GPHA 2X1NA 3M1SA 3EOCA 3C5UA 4L3PA 4DGMA 4O83A 4FVRA 1Q97A 3UOKA 1LPUA 3D2KA 1WVXA 5HNGA 1KSWA 3ULZA 2X2KA 4FV1A 5HCXA 4O84A 4MXXA 4OTDA 3RCDA 5FDPA 3IO7A 4F7NA 5KKRB 5AX9A 3QL8A 4Y83A 3TNPC 3P86A 4CLIA 5CVHA 2E2BA 3LW0A 4BCGA 2A2AA 3EL7A 3MA6A 1PXMA 2W5HA 5BVKA 5IA0A 3FMKA 5IQIA 2V7OA 2O8YA 4QQCA 4YZNA 3O8TA 2QLUA 5E8UA 2FSMX 3DFAA 3F66A 4R3RA 4A9UA 2VWIA 4BGQA 2UZDA 4EEVA 3IW7A 3SC1A 4IAFA 3BLHA 4CGAA 3OCBA 1I09A 3BWJA 3ZXTA 4QP2A 1YXVA 2XZSA 1Q99A 2C47A 5KE0A 1W0XC 4M0YA 3V51A 3F3WA 4I92A 4MXAA 3MSSA 4EOLA 4FEQA 4DEIA 2AYPA 2JDSA 4FNXA 3F6XA 2PULA 3HNGA 4RC3A 2ITTA 3RP9A 3PSDA 3VS6A 3ZUUA 4BWPA 3TXOA 4EQMA 2X9FA 3MV5A 2HW6A 4NTSA 3IECA 2VTMA 2UZOA 4B9DA 4Z55A 4USFA 4XG2A 3PIYA 4I6QA 3NUAA 4KIQA 2O64A 4O0VA 3VBXA 4F70A 2E9OA 4L00A 1H01A 2YABA 2XUUA 3GFEA 5IA2A 2HW7A 4HNFA 4P7EA 4PQNA 3QHWA 4FEUA 2CSNA 3HV5A 3A99A 4HVIA 2XK8A 2XF0A 3ZLXA 1URCA 2GS7A 4L68A 3DKOA 4IC7A 5K0KA 1H4LA 4ZK5A 3UO5A 2HXQA 3DXQA 4HPUE 3LXPA 3RTPA 4O86A 5H8BA 4DFBA 2XH5A 2W4KA 1Z9XA 4MK0A 3TG1A 4YNOA 2VX1A 2YIYA 4IAZA 2OFUA 5F4NA 5G6VA 2CMWA 3N4TA 3SD0A 3WYYA 4EH4A 5JGDA 2XJ0A 3D5WA 3QA0A 4UWBA 3DOGA 3KA0A 2YAAA 4A9YA 1WBWA 4A9RA 4TNDA 4ZZNA 2C0OA 2C6MA 3GB2A 4CXAA 1YXSA 2QI8A 4APCA 4ZMFA 3KK8A 4S34A 4Z9LA 3U4UA 3PJCA 5EHOA 3OBJA 3REPA 3R00A 4G17A 5DH3A 4C38A 1J7UA 1OBGA 4ZMEA 3SXFA 1WMKA 5ETFA 4QTDA 2P0CA 4ACCA 5I3RA 4U5JA 3WIGA 5CSHA 2BTSA 2YZLA 2PZPA 1O6YA 2V0DA 3QC9A 5FRIA 3L8VA 1OM1A 1H08A 5E7RA 3ZFYA 4MXCA 3VQUA 2VRXA 4HVHA 4AQCA 5L8LA 4DITA 3SV0A 4NM3A 4FTAA 4HYUA 4MNEA 2C30A 4KA3A 1FMOE 1FOTA 4FTNA 4IAKA 4PY1A 4ENXA 4NCTA 1XKKA 5A9UA 4OAUC 3HMPA 4LMNA 5IQGA 2UZBA 1REJA 5TO8A 2BALA 4EZ5A 2B52A 4M8TA 2PVFA 5CU0A 3FKOA 4FT9A 1B6CB 4ZLYA 5IH5A 4XG4A 2PYWA 2W1EA 5TT7A 2J4ZA 3MYGA 5DR2A 3PJ3A 2PTKA 3EH9A 3BYMA 3HUCA 5DEYA 4OGRA 4AFJA 5CT7A 2XKDA 5HG8A 1ZYCA 4YC3A 2YJRA 4C8BA 2B4SB 4BKZA 4FNYA 2W5BA 3QX4A 3VBTA 3GU5A 2GU8A 1OECA 4PPAA 3UNKA 1PYXA 5KMNA 4BIEA 4ZTSA 1PHKA 3OHTA 3DXNA 2G9XA 4ZJVA 2J50A 5B2KA 3MS9A 4DH8A 1JAMA 5IQBA 2IVSA 2UW9A 4O7SA 3DCVA 3V5TA 4QMOA 3CJFA 3Q32A 4FR4A 2UW3A 3C1XA 3BYUA 3HLLA 4MXOA 3ZUVA 4IHPA 3RZFA 4OT6A 5HX6A 1PRYA 4RVKA 1V1KA 3FMEA 4CMOA 4O7RA 4GK4A 5TKDA 3F3ZA 4OTPA 4C4JA 2YWPA 4IWDA 3TIZA 2YA9A 4CMUA 3TL8A 4ANBA 3KF7A 2E9NA 2UW4A 1IG1A 2B53A 4BDEA 3F88A 3QTWA 4FEVA 4UALA 4BN1A 3W8LA 2BTRA 2BPMA 2H6DA 2W99B 4IWPA 2ONLC 4EH3A 3VN9A 3LCDA 2CNUA 3NEWA 4ITHA 4JG8A 2HWOA 3BU3A 4WNPA 4XOZA 2RG6A 3GOPA 4LGDA 4CFUA 2RG5A 4FODA 4S31A 2ITOA 4D1SA 4N6ZA 2RSVA 3PXFA 2C5YA 2VTRA 3OWLA 4M69A 3PVBA 4YTFA 2VNYA 4IWQA 2X6DA 3NCZA 2C6IA 2X2LA 3CIKA 4II5A 1OUKA 1Z57A 3IDBA 3MTLA 3EYHA 2WKMA 4WT6A 3KULA 4G3CA 1H00A 3ZBFA 3RK5A 5HVYA 4GU6A 3QC4A 4DEGA 4EH7A 4R1YA 3TWJA 4FVPA 2QU5A 3LCTA 4WUAA 2W1FA 2IPXA 4GG7A 3I7CA 4FTUA 4H3BA 5J95A 5DIAA 3JR1A 2OJGA 5JKGA 3DPKA 2JDVA 5AAEA 5LVPA 4U9AA 5CEOA 4G34A 3BZ3A 4W8EA 3C4WA 3CS9A 3FMJA 3O2MA 3LCKA 3LLTA 4IB5A 4QMZA 1PXJA 4AGWA 2XP2A 4C0TA 4O7YA 3FQSA 3BGQA 2WELA 3VJNA 3QQFA 2CJMA 4GS6A 4XMOA 1SNUA 4C4HA 5AP1A 2DUVA 3RPOA 2WB8A 3LE6A 3R21A 4BTMA 2BDWA 4BKYA 4C4GA 4U45A 3DBQA 5IQCA 1PYEA 3VRZA 1Y6AA 3M42A 1MUOA 2HCKA 4C4EA 5BUJA 5IA3A 2J90A 4IWOA 2PPQA 1P4OA 2GQGA 5IH6A 4PMSA 2HY81 2SRCA 5L8JA 3SRVA 2PUPA 4FSNA 2WTCA 3GNIB 1UV5A 2GDOA 4G3GA 5EH0A 2YITA 3ZZWA 5K5XA 2UVXA 5JRSA 1ZOEA 4DYMA 2UVZA 2ZB1A 2GQSA 4JIKA 4DBXA 3PY0A 4GUEA 4YZMA 3SXRA 4CQGA 2CN5A 4ANOA 4U44A 4N0SA 4RX8A
chains in the Genus database with same CATH superfamily
4PL3A 3RAIA 1UU7A 5HIEA 5L3AA 4E4MA 3C9WA 2ITUA 4HGSA 4V01A 4WOVA 3T3VA 4LG4A 2UW5A 3KRLA 4FNWA 4IX3A 4IANA 4PTGA 3SW7A 1IA9A 4NL0A 5CANA 2QOKA 2R3GA 3H10A 3ZCLA 2DQ7X 3E3PA 2F57A 3P1AA 3D4QA 4FIHA 3IGGA 4CRSA 4XV3A 5JT2A 4F6UA 4W8DA 3R8ZA 3G9NA 3PXYA 4FGBA 1CM8A 4HCUA 3MIYA 4ZY6A 3QD2B 3VS1A 3IG7A 3RK7A 4D9TA 2YDIA 5JEBA 2IF8A 4AQKA 5HEZA 3QGYA 1JSVA 3PG3A 3OEZA 2YDKA 3RM6A 3UVPA 4AA4A 3F7WA 4KKHA 3QQUA 2WIHA 4ZZOA 4BCOA 4G3DA 2WMQA 4KBAA 5AV3A 3FZTA 3R1NA 2BZKB 3TMOA 5CTPA 3O0GA 3UYSA 3VW8A 4S2ZA 4EQUA 1HCLA 2ZV2A 3BBTB 5JQ8A 2GS6A 3TV7A 4JR7A 5CY3A 3FZPA 2C4GA 4QRCA 4B8MA 1OBDA 5FG8A 3A7HA 5BQ0A 1Q8UA 3D5UA 1HCKA 5LWMA 3IK3A 3MDYA 3BRBA 4NKSA 3SA0A 5CI7A 4KABA 3VW6A 3FMNA 4IB0A 2VO7A 3OXTA 1LR4A 2EB2A 2QURA 3ACKA 3E5AA 3R1QA 4ENYA 2VO6A 5BNJA 3TKUA 3D7ZA 4UXQA 3EQRA 4C57A 1GNGA 4TT7A 4NKAA 2P4IA 4E7WA 4JDKA 5LARA 3Q9YA 1YXXA 2F7EE 3NNWA 4QP9A 4AF3A 3KXMA 5L2SA 1XMLA 4GVJA 3V6RA 3JY9A 3Q04A 4HVSA 4X6QC 3PPKA 3FQHA 4MX9A 4PX6A 2OXXA 4G9CA 5FEEA 4BF2A 4CQEA 3QD0A 3DT1A 3R9DA 4R1VA 2XIRA 3QLFA 4HVDA 3QTUA 1FQ1B 4WNKA 4R78A 5C01A 3L9PA 4X0MA 4F9BA 3G6HA 4O7TA 2UZEA 4ANNA 4NIFB 1V0OA 1CKIA 1OL1A 4MWIA 4C35A 1F0QA 4ACGA 4JX3A 5B7VA 1QPDA 3FLQA 3NYXA 5J1WA 2NRUA 3FUPA 2PSQA 1RQQA 5DLSA 4FSWA 5J1VA 3T8OA 2Q83A 3DBCA 2H96A 2HYYA 4CVAA 4JJRA 2PUNA 2C6OA 3CSVA 1R39A 3PZEA 3UOLA 2RKUA 4LGHA 4K11A 4J99A 1FGKA 3IS5A 3E8NA 3ORIA 3PSBA 4UMTA 5AV2A 2VWWA 3FI4A 3MPAA 3ATSA 4IM0A 4KIPA 4Z3VA 1YDRE 1H28A 4HZSA 1ST0A 2VTPA 2HELA 3BI6A 3PWYA 3ZSHA 2XIZA 3SDJA 4OTFA 2F49A 3GQLA 1WVWA 2WMVA 4CFWA 1MQBA 3OG7A 4FBXA 4KIOA 4HPTE 3OUNB 3I6UA 2ZM3A 4RJ3A 2XNEA 4DH7A 3SG8A 3ENMA 4FKJA 4GT4A 4JI9A 3GU8A 4L46A 4EWQA 3FC2A 3Q5ZA 1J7IA 2ETMA 4FV9A 3TKHA 2OJFE 3AKJA 2B9IA 2I0EA 4BDKA 1YOLA 2VWVA 3P23A 3AMBA 4UV0A 4D4YA 3Q3BA 4FKIA 4XH6A 4ZAUA 1FBNA 3FMHA 2GFCA 1UU3A 5DVRA 2AUHA 5AP0A 4D2VA 3ZXZA 4MTAA 4QMVA 3CQWA 4FL1A 4IB1A 4JT3A 3IW5A 5FDXA 3QKLA 4AOIA 3MTFA 4X3FA 3KGAA 5A14A 4AW0A 3Q4ZA 5CZIA 2FUMA 3P7CA 3ML1A 4O82A 4O7LA 2YM4A 4TWNA 3TV6A 4F7JA 4R7HA 1Q8WA 4AZEA 2R3JA 4AS0A 3W1FA 5C8MA 4R5SA 4RJ7A 1YOMA 4JBPA 3TM0A 4M15A 4DFLA 2C6TA 1QMZA 3F2AA 4O27B 4F65A 2YCRA 2FGIA 2YIQA 5HBJA 2R3PA 3B2TA 1G5SA 1YDSE 2FA2A 3TKIA 4ARKA 4YO4A 3E88A 3W0NA 4IDTA 4AXDA 3F5PA 4GSBA 2I1MA 4EUTA 4PDYA 4DH1A 4F1OA 2Y8OA 1SZMA 2ZYBA 4FNZA 5FEQA 3DB8A 2W1IA 5M4UA 4FEXA 4ERWA 1MQ4A 4PMMA 2YIXA 3RGFA 4D4VA 3AKKA 4BCIA 4J8NA 4PNIA 3R8VA 3VONA 1Q5KA 2VGOA 1RE8A 3U51A 3EFKA 1M2RA 4IX5A 4FKVA 4FEWA 4JG7A 4BWKA 5FXRA 3B2WA 4QMPA 5DGZA 2C5XA 4USDA 3UMWA 4EK4A 4D2TA 3R83A 4CG9A 5L6OA 5KMOA 3FJQE 2XEZA 5HLNA 4FZFB 3VAPA 3VUGA 5AAFA 2XIXA 1XMMA 3D83A 2XK7A 4BCQA 5BX0A 5CEQA 2PVMA 2X7GA 2ZV8A 3N9XA 4YGAA 4YSMA 4QTCA 5HO7A 2QLQA 4X3FC 1GZOA 1JKSA 3G90X 4HGEA 5EDRA 3A61A 4CZTA 2JDOA 1V0PA 3W33A 4FVQA 2JD5A 3II5A 3OW4A 4P4CA 5B2MA 2Y0AA 3G0FA 3QD3A 3U4WA 3CGFA 1ZXEA 4RRVA 3ET7A 5HD4A 5EYKA 4FKTA 3C13A 3R1YA 5ICPA 3MPMA 3MVJA 4ZTNA 4BDJA 4U97A 5CI6A 5E8WA 3VS5A 4YO6A 5DFPA 4C59A 2BR1A 3QTQA 1XBAA 4K0YA 2OJJA 5HO8A 4G9RA 5A6OA 2GMXA 4H05A 3HRCA 4F0GA 2JIIA 4CV8A 4AGCA 3Q6UA 4BGGA 3S1HA 3R7EA 4HYIA 1ZOGA 3H30A 3JUHA 4C36A 2XANA 4GYIA 3HEGA 3QA8A 3ZBXA 5HE0A 4D4RA 3KMUA 2XEYA 3BHUA 4NM7A 1ZARA 1FVRA 2G2FA 3EN9A 3SVVA 2IZRA 3NW5A 3PG1A 4FF8A 1OIYA 2QHMA 4FKOA 2OI4X 5CF8A 3VULA 1OL6A 4LV7A 2BKKA 4QPAA 4BHZA 3FE3A 3V8TA 3U55A 4IAYA 4GCJA 5TOZA 2XNNA 2BILB 2W0JA 5EM7A 5AV1A 3R7OA 3W16A 3DFCB 3EFLA 3Q9ZA 3PJ8A 4YHJA 1FMKA 4RIXA 3P4KA 3ZO1A 5KUPA 3HDNA 3EQCA 4O4CA 3L9MA 3UO6A 5AUUA 3EWHA 4QP3A 5B0XA 5BMMA 3A7FA 1XQZA 4L7SA 4E26A 4ACHA 3KVWA 3QYWA 4CKIA 4IX6A 4B99A 2NNWB 4Y95A 3VO3A 2OH4A 3GI3A 4RIWA 4LGGA 3V01A 4FIIA 5J7HA 4J52A 3VWAA 3FL5A 3GBZA 2E9PA 1XH4A 4FG7A 4PMTA 4YZBA 3DB6A 2O3PA 3FZRA 3LFSA 4GYGA 3P79A 3E62A 4IAIA 5D10A 3I81A 3OXIA 5DHJA 3R30A 3FI2A 3DBDA 3UO4A 3ORLA 5CSVA 1Z5MA 3C4CA 4E3CA 3NS9A 3BL9A 5CU3A 5CAOA 3CP9A 1NVQA 4F09A 3EQDA 5JN2A 5J8IA 1BUHA 3NUPA 3HRBA 2BROA 5BMSA 2RL5A 3JXWA 3GENA 3QCQA 1OGUA 2Z2WA 3D5XA 4P5QA 1ZYDA 4R3PA 2YIWA 3NUUA 4GG5A 4H3QA 5HE2A 4AA0A 3E87A 4FSTA 2FB8A 3T9IA 5FTOA 4EC8A 4EQCA 4NH1A 1JSTA 2PMLX 4E5BA 3W0OA 3PA4A 3OOMA 2P33A 4FV0A 4IVBA 5I3OA 3PJ1A 2WTWA 3UZTA 1T45A 1W2CA 1CDKA 3ORPA 3QRIA 5E4HA 4DGNA 1KE7A 3PPJA 5E8XA 5IA5A 4MAOA 3S00A 2OZAB 3QTZA 3F3VA 2HZ4A 1XR1A 4O81A 4EOPA 4O0SA 1XH7A 4C3RA 4EUUA 3RPRA 2VAGA 2GTNA 2CNQA 2GNJA 3ZLYA 3ELJA 5EYMA 2C1BA 2OW3A 4D1ZA 2ZFYA 5M55A 2OICA 1ZWSA 2I6LA 4DF3A 3U87A 4B6LA 4QTBA 1BX6A 2YHVA 1MRVA 2WU6A 3QLGA 4ZS4A 2CKOA 4D5HA 2BHEA 3EQHA 1P4FA 2X8EA 2C0TA 3E7VA 4FTCA 4IXPA 4ASXA 1U4DA 3DTWA 4BVUA 1F5QA 3U54A 3QHRA 4OBQA 4YJVA 4DHIB 4Q5EA 5C9CA 2XK3A 5AUXA 3V3VA 4DBNA 5A4CA 4J7BA 4O2PA 4RFZA 3UDSA 3R2YA 4UBAA 2VD5A 4FKLA 2VO3A 4YLKA 1KUTA 2A27A 4ZSJA 2IVTA 4IIRA 4MVFA 3TN8A 5L8KA 2HZNA 3Q4CA 2P2IA 4RQKA 4C4FA 1ZRZA 4W4VA 4XBUA 2WTKB 3LFQA 1V0BA 2JKKA 4UWCA 4FSRA 5AADA 4I20A 4I4EA 3I5ZA 4FIEA 5DNRA 4ZXTA 1BI7A 1PKDA 2IJMA 4BI0A 4XJ0A 4RC4A 1PXNA 2FSOX 2X9EA 3AMYA 4JX7A 2YCFA 3TUCA 1B39A 3D7TA 3FDNA 5AM7A 5C4LA 2Z8CA 3ZFXA 3R7GA 2Z7SA 5EW9A 3EQPA 3ORTA 4EORA 2C69A 3POOA 3GU6A 4HZRA 3EL8A 2AEGA 4KNBA 3ZMMA 2HAKA 4BWXA 5JFWA 5TE0A 2VNWA 4NU1A 4XG6A 4FZAB 2JKQA 3VBVA 3BV2A 3NGAA 4L42A 4RJ6A 1FVVA 4IVDA 4FKRA 4DFZE 4AN2A 3FQEA 4U41A 4U79A 1OGYA 3M2WA 1Y57A 4NEUA 1CMKE 5LVLA 2QOFA 2C3IB 3SG9A 3A7GA 3PTGA 2XCKA 4I5MA 4NFMA 5B2LA 5E8SA 3IGOA 5AUVA 4H3PA 5M56A 4IVAA 4CT2A 2QCSA 5KBRA 3KY2A 4IDVA 3S0OA 3PXRA 4PPCA 4QEBA 1S9IA 1VYZA 3NAXA 4AZWA 1OI9A 3C4EA 5LMBA 2A0CX 3MY5A 4FT7A 3SW4A 4AZFA 4DEEA 2V7AA 3KREA 3QZIA 1JBPE 3S3IA 2W5AA 4BDCA 2Y4IB 4QP8A 1NXKA 4JOAA 3WYXA 4WBOA 4LOPA 4DDGA 2GTMA 3UIUA 4U81A 1QPEA 1FPUA 3KRWA 3ZM4A 2Z02A 5D9HA 1NA7A 5DYJA 2WMSA 3ORKA 2EWAA 3FSKA 2X7FA 3MGYA 3NUSA 4PDPA 4M12A 2CCHA 2QG7A 5LVMA 3JPVA 5KX8A 3VS3A 2WTJA 2X2MA 4E4XA 3CLYA 4AZVA 4E6QA 4FTKA 1PXPA 2PY3A 4FKQA 3W2PA 2CKEA 2XB7A 2IZUA 4HNIA 3A60A 4JXFA 2KTYA 2XNOA 4XBRA 3BV3A 3OXZA 3TJCA 1OL5A 1RJBA 3H9OA 4X2FA 3VC4A 2G01A 2NP8A 2YLFA 2ZDUA 4A9SA 4FE2A 4EBWA 3LFAA 1WBOA 5ANEA 4BDIA 5IISA 4IZ5A 4FX3A 5H8EA 4O21A 4YTCA 4ZTMA 1BI8A 1L3RE 2B9HA 3GC7A 4IBMA 4CZYB 1R0EA 2BZIB 1UU8A 4YC6A 5AMNA 5DMZA 1QCFA 3R22A 4RGJA 4UY9A 3W10A 2B7AA 4KS8A 4O4BB 3TIYA 3ZRMA 2VWXA 3W2QA 5EQPA 4I6FA 4L01A 5EQEA 4C2WA 2IEWA 4YURA 2QQ7A 3I0OA 3IW4A 4NW6A 4IFCA 3V5JA 4M14A 1U5QA 3DLZA 5M53A 2W17A 5CU6A 4QP6A 3VS0A 3RWPA 3ULIA 3QX2A 3PE1A 4AXAA 1PMEA 2X0GA 3NUYA 3UPXA 2JC6A 4F64A 3TZMA 4H39A 3WZEA 5FGKA 3D14A 1WZYA 5HNBA 5AR3A 4IW0A 5BVWA 3W8QA 2XMYA 1UU9A 3H9FA 4FL2A 3DXPA 3OT8A 4DGGA 3PVUA 1WBTA 2VTIA 2WO6A 5A46A 4BKJA 4CFVA 1H24A 5IEXA 5CT0A 2OIBA 4I41A 2XCHA 2X8IA 3C4ZA 4JRNA 3WBLA 5KHXA 4KS7A 4GJ2A 2NO3A 3DAKA 5EOBA 1P5EA 2VTNA 1QL6A 3NZ0A 1ZYSA 3BQRA 5FP6A 4RX5A 1PW2A 3DJ6A 2RF9A 3HKOA 1NVRA 2BRBA 2GNIA 3H0ZA 3TACA 3LPBA 2HK5A 5A4LA 4V05A 3LQ5A 5A54A 5AR5A 3IOPA 4GK2A 4EBVA 4D55A 4RVLA 2LGCA 1JOWB 4BDBA 3RALA 4D2PA 4LMUA 4M69B 1G8AA 4MYGA 4ANMA 1GZNA 3F69A 2IW8A 5IA1A 5DT0A 3LXNA 5L6WL 1G8KA 3OT3A 1KE6A 2W1HA 3R02A 3LXLA 5A4QA 5C03A 1GIHA 4NJ3A 4EYMA 3P5JC 4OTWA 1OIUA 4NIFA 3NW6A 5GJGA 3K5VA 3OEFX 5FEDA 3DKCA 1GIIA 1M2PA 3QXPA 4LRKA 4AW1A 1Q3WA 3RNIA 2WAJA 2OXDA 4IJ9A 2VTJA 2I40A 3UQFA 3LHJA 4XYFA 3UBDA 4J97A 3OS3A 4BCHA 5FTQA 2I0HA 4YJSA 3O96A 4C33A 4F9YA 3AMAA 3JYAA 4R8QA 4YLLA 1K3AA 3PLSA 5GZ9A 4ZJIA 4XEYA 3R9OA 3QZFA 2I0VA 3BX5A 4QMWA 4QMLA 1JPAA 4R3CA 4V04A 3PXZA 1OKYA 4TNBA 3V5WA 4BDGA 4GUBA 2J9MA 2R3IA 5FXQA 1EH4A 1YWRA 1W84A 3UOHA 4AP7A 4CEGA 3EB0A 3UNJA 4AOTA 4O4FA 2EB3A 3GFWA 4L44A 3FWQA 5HQ0A 5JFVA 3DBEA 5L2IA 4DT9A 4AXEA 3W2OA 5I9WA 3MFSA 3CEKA 5DBXA 1E1VA 1E9HA 2ZOQA 4RZVA 1QPJA 4H1MA 2R3KA 4IH8A 1L8TA 4OTRA 4FKPA 3VBYA 1YWVA 2W1DA 1YI6A 5GHVA 3MW1A 3NPCA 5I5ZA 2J51A 4P90A 5IZFA 2ZMCA 4DFYA 3UIXA 3CJGA 4MH7A 3EZVA 5C1QB 1J1BA 4H36A 2QD9A 4FMQA 5CALA 5J5TA 3QRKA 4MBLA 3CKXA 1OZ1A 5LOHA 4M7IA 1ATPE 5T3QA 2BAJA 4BZNA 3TUDA 3I5NA 3AD6A 2YM7A 2HXLA 3C4XA 5G1XA 3AD4A 2LAVA 3V8SA 1XH6A 4YU2A 3UP7A 3R8LA 4ASDA 4QP7A 3VNTA 3UDZA 3HRFA 3MH2A 4JBQA 1GY3A 1REKA 4CYIA 1ZAOA 1PXLA 4Y85A 4FTOA 3C0IA 4EH6A 3KRXA 4XNEA 1YRPA 4I5CA 4BCJA 3Q60A 3MH0A 5M4IA 3GVUA 1A06A 3SHEA 4EHZA 1CKJA 3ZO2A 3QUPA 5I0BA 2YN8A 3R2BA 3JVRA 4Z16A 1RW8A 3FPQA 1Y6BA 2WEIA 4KWPA 3E8EA 3MY0A 4O0TA 5A4TA 3O7LB 3ODZX 2QHNA 4KIKB 4RZWA 5DRDA 4QP1A 3UQGA 3DS6A 5CXZA 2BZJA 4CKRA 1TZDA 5IH4A 5KZIA 2ITZA 2XVDA 5CAVA 5J9YA 4WG5A 2C5NA 4FKWA 4QNAA 5J79A 4RVMA 3UZPA 4CYJA 2X7OA 4Y73A 2DWBA 5EM8A 5AR7A 4ITJA 3FKLA 3UG2A 4BDAA 4WHZA 4AZSA 4EH2A 3ORZA 2XALA 3V8WA 3CR0A 4R7IA 2BIKB 4TYIA 1H8FA 3R9HA 3MFTA 5ANDA 3FLZA 5FD2A 1G8SA 2R3OA 3D2IA 3CC6A 2GQRA 1R78A 2ETKA 1LEWA 3RHKA 4LUEA 3ZLSA 3OBGA 3DU8A 1WFCA 2XS0A 2JDRA 3H9RA 3MIAA 5GJFA 3BHHA 2PL0A 2OXYA 3ZRKA 2Z7RA 2YM6A 3MVHA 5AX3A 4F6WA 3AXWA 1WBVA 3QRUA 3BEGA 3GCPA 2YCQA 3W32A 4DTKA 5ETIA 3CD8A 2QNJA 3LJ1A 2YLEA 2VN9A 4KD1A 2R3HA 4PTEA 5E8YA 5EG3A 3F5UA 3Q52A 3QKKA 4JMQA 4QDEA 4D2SA 4G3EA 5DWRA 4O4EA 2RIOA 5EYCA 2BIYA 3ZDIA 1PF8A 2IN6A 2IZSA 5CSPA 1NVSA 5C26A 1PY5A 4IMYA 3KU2A 2QOOA 3IW8A 4WNOA 4CFMA 3UC3A 4FC0A 4MD9E 1ZOHA 5AV0A 2UW7A 5ANGA 4DCEA 5BVOA 4D28A 5HX8A 5HOAA 2P2HA 4MNEB 1KV1A 4RLLA 4ZSAA 3W55A 2R5TA 1O6LA 3EHAA 2PVNA 2Y4PA 4E5AX 5AA8A 3BQCA 3VBQA 4MNFA 3QUEA 3DAEA 3GC8A 3AC8A 3F5GA 3KMMA 4XV2A 5EM5A 4LI5A 3R7VA 4EOKA 2O2UA 2XAMA 5M08A 5FBNC 3GU7A 4AG8A 3FBVA 3NDMA 4D9UA 4QQ5A 5AP6A 4QTEA 1J1CA 3KXHA 4YJTA 4YP8A 3WZJA 2PVHA 4WRGA 3UE4A 4D1XA 2QKWB 5DT3A 5AP2A 5FTGA 5DI1A 2X8DA 3RJCA 4DG0E 4RQVA 2WMBA 3V6SA 5CEIA 3KCKA 4KUJA 2WIPA 3UTOA 4BDDA 5C8NA 4UMPA 1ERKA 5HTIA 3HX4A 4ZSGA 5FXSA 1O9UA 5J5SA 3ID6C 2BRMA 3OVVA 3LFNA 3FLNC 4K9YA 4L8MA 4XG9A 2BDJA 2ZV7A 3KFAA 4FTQA 4BCFA 5CEPA 3RK9A 2O65A 4FV5A 5HCYA 1JNKA 5D41A 3S2PA 4D58A 4F78A 1P14A 1NW1A 3ROCA 3L1SA 1XH8A 3F61A 4ALUA 2BDFA 4UZHA 3CY3A 4L7FA 1GZKA 4TN6A 2GFSA 3DV3A 5KZ0A 3MJ2A 1YWNA 3AC4A 5AUWA 3DLSA 4P2KA 2UZNA 5EOLA 5AP3A 2REIA 4QYFA 3QZHA 3OWPA 5E1EA 5K4JA 1PMNA 3WILA 1Y8GA 3QXOA 3R7IA 2J0LA 4TKSA 3QCYA 4NCTC 4OTHA 3HGKA 4X7QA 5M06A 5FM3A 4ORKA 4PDOA 2XAOA 2Q0NA 2J0KA 3S95A 3BKBA 4O22A 3R7YA 4FK3A 5HIDA 4GKIA 2ZJWA 5AAGA 3FC1X 3SGCA 3DNEA 4YZDA 3VUMA 4C37A 4AT3A 3A8XA 4YHFA 4F9WA 5HD7A 5L4QA 3OP5A 2R3NA 2VX3A 2PE2A 3QCSA 5BVDA 3UQCA 4FA2A 1J91A 3HMIA 4GRBA 4QQTA 3LVPA 1OPLA 1U54B 1YHWA 3Q96A 4JNWA 4MHAA 3QFVA 3PIXA 3HV3A 2FSLX 3DK3A 3NR9A 2OO8X 2WEVA 4U8ZA 5BV3A 2OZOA 4C34A 4C61A 4RX7A 1UKHA 1VJYA 2UZUE 3A8WA 1JKKA 3WI6A 1ZLTA 3AC1A 4CZUA 4IM2A 4CFFA 3R01A 4IACA 4X3JA 5EI6A 4X6RA 3E93A 3RCJA 3ZFMA 4CTCA 3EQBA 3O71A 4NJDA 3TNQB 3R9NA 2ZAZA 4KRCA 4JAJA 2QOIA 4Q5HA 3SXSA 4FT3A 4L43A 4TTHB 2J5FA 2WTVA 3WF5A 1W2DA 4ZLOA 4O0YA 4ERKA 4ZTLA 3K54A 4XHKB 4TY1A 4FOCA 4XS2A 3LCOA 3LCSA 4GT3A 4UEUA 2CPKE 3GCQA 2B54A 3FZ1A 2J0MB 3ORXA 1ZYLA 1X8BA 3VBWA 4BHNA 2CNVA 3FKNA 5HTBA 4RWIA 3QGWA 3VVHA 2C3LA 1TVOA 2ZMDA 5AWMA 1KE9A 2R2PA 4PP7A 4XG8A 3KXZA 2UW0A 3D7TB 4QT1A 1YHVA 4ANLA 5K3YA 3AT2A 3RINA 2QR8A 5FP5A 3R71A 3SRVB 3G9LX 3TZ7A 2FVDA 5ACKA 3HV6A 4BFMA 4J95A 5M44A 4AGDA 3BELA 3LJ0A 4LM5A 2E9VA 4HJOA 5AIKA 3VJOA 3BU5A 4RIXB 3KVXA 4EZ3A 1VLRA 3BE9A 3NFFB 2Q0BA 1YW2A 4O91A 3UDTA 3F3TA 2VUWA 3G15A 1H1QA 3DJ5A 4XG7A 5BVNA 2GHMA 3LM5A 5KKRC 4EJ7A 3ZO3A 3HA6A 1YOJA 1MRUA 3DKFA 3QALE 4FT5A 1CKPA 3WOWA 4C7TA 3ZSIA 1PMUA 2VGPA 3TNWA 3P78A 4PL5A 4U42A 4QPMA 5I9XA 4O38A 3DJ7A 2UV2A 3MH1A 4E4LA 4GU9A 4F7LA 2Z7LA 3AQVA 3G6GA 3JS2A 3OY3A 4Q9ZA 4TYHA 5BYLA 1CTPE 1STCE 5IUGA 4WSYA 2UW6A 2R0UA 3BYSA 4W4WA 5DOSA 3V5LA 3EQFA 5EHLA 4FG9A 4IM3A 3UIBA 2WZJA 1PKGA 5HORA 5K0XA 4OR5A 2J7TA 3G5DA 1Y91A 4A07A 5CASA 3UVQA 5M4CA 4XRLA 2HENA 4EHVA 4QDVA 4CV9A 4KSPA 3UOJA 2QO7A 5HHWA 2PK9A 3BGPA 1H0VA 3BLAA 3PIZA 3FAAA 4NW5A 4QMMA 1W7HA 3A7JA 5J9ZA 1DM2A 1WAKA 3WE8A 3ZH8A 5F94A 4AT4A 1OB3A 4RWLA 4U80A 2OFVA 4EKLA 4F63A 4WG4A 2WTKC 3LMHA 5IQHA 4O1PA 4AX8A 4K1BA 3GP0A 4FICA 5CEKA 4C2VA 5A6NA 4BTFA 2OZAA 1JVPP 2RGPA 2C5VA 3CXWA 4PDSA 3OC1A 4RT7A 2H8HA 5EYDA 4O0RA 4FIGA 2XNBA 3P9JA 1LEZA 3R8UA 3IQ7A 2VTQA 2GCDA 4BCMA 2EUFB 2WQMA 3RVGA 4G5JA 1XO2B 2YCSA 5IQFA 4B8LA 4ALWA 1YKRA 3VHEA 3FMMA 2W4OA 3QCXA 3EN6A 3L9LA 3NVKI 4AT5A 3ITZA 2BUJA 3TV4A 5F95A 4BI2A 1IAJA 4HCVA 3UVRA 1JWHA 4E93A 4IFGA 4PP9A 3VUTA 2R3MA 3RM7A 1PMVA 3BIZA 4K2RA 3RAWA 4DH3A 1SYKA 2F4JA 2VX0A 5TR6A 5GZAA 3RPYA 3SX9A 2F2UA 5DA3A 5HG5A 4LL0A 2ITWA 2JEDA 4DEHA 1GIJA 3NYVA 1VR2A 4XCUA 3FL4A 3UMXA 5KHWA 4AUAA 4BJJA 4NUSA 1ZZLA 3EFWA 2FYSA 3KK9A 5E91A 5CZHA 3P7AA 4E20A 4GL9A 2JGZA 3EYGA 3VUDA 4PWNA 3LMGA 4XP2A 3PY3A 3TTIA 4PMPA 4YPSA 1I44A 4QMSA 4FV4A 2F9GA 4L9IA 5KCVA 4CTBA 3FYJX 4QMXA 4MUQA 3QTXA 5BPYA 5HVJA 5HKMA 3ETAA 2QKRA 5DN3A 5DRBA 2R0IA 2PMNX 2VV9A 4JVGA 4DFXE 1MRYA 2WOUA 5CVFA 4EH5A 5D7AA 4QOXA 2CGUA 4EI4A 3LFBA 3KXXA 3HV4A 4UYNA 4R77A 3VF8A 3DQXA 3CBLA 2B9JA 2A1AB 5TF9A 3D9VA 4EOJA 2G2HA 3PP1A 3VUHA 3TNHA 5GIOE 1XBCA 3RI1A 4GV1A 4NM0A 2P55A 3HP5A 5JGAA 3ZSGA 3COMA 3KN6A 2BRHA 4E6DA 4O0UA 1XWSA 4G6OA 4X3FB 3CQUA 4BY9E 5CAQA 2FSTX 4DEAA 1XHAA 2ZVAA 3FXWA 4TL0A 4ITIA 2WD1A 3GCSA 4O1OA 4QMNA 2QOCA 3ANQA 3QAME 4H1JA 4NZWB 3LZBA 4JDJA 4QTAA 1FINA 1PJKA 5HESA 3HA8A 3NYOA 5C8KA 3ZM9A 4JDIA 1H26A 3C5IA 4PUZA 3KXGA 4RFYA 5KMIA 5LMKC 2RFEA 2BKZA 4FYNA 4RVTA 3AOXA 3GC0A 2O0UA 2JITA 4XP0A 5AV4A 2WXVA 4UN0C 5AEPA 4YBKA 4BYIA 1KOAA 3O17A 4NK9A 3R8MA 4DEBA 1W98A 5HLPA 2ITXA 3ZONA 2BVAA 3BLQA 3IOKA 5DR9A 1LUFA 4PPBA 4C4IA 3UPZA 3MH3A 3AGLA 3CCNA 3BL7A 5M4FA 4GT5A 3PSCA 3CPBA 3V5QA 1M14A 2XKFA 5FLFA 3GUBA 4BCNA 5CF4A 2UVYA 4U43A 1K2PA 4FUYA 4IADA 4RJ4A 2WOTA 2Y4IC 5HBHA 3NLBA 4RC2A 5ACBC 3O5AA 3Q4UA 3AC3A 2XM9A 3JY0A 3Q9WA 1YXTA 4UB7A 1OIQA 3NWWA 3O8UA 3MVLA 2WQBA 4RIYB </