4D4YA

Focal adhesion kinase catalytic domain
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
272
structure length
255
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
publication title Allosteric Regulation of Focal Adhesion Kinase by Pip2 and ATP.
pubmed doi rcsb
source organism Gallus gallus
total genus 81
structure length 255
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d4yA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d4yA01
5AP6A 4V01A 2C0TA 2UW8A 2B0QA 3R1SA 1P14A 3ENHA 2W05A 4LRKA 3I6UA 1U54B 4ZY4A 1Y8GA 4GUBA 4FA2A 4IWDA 4L3JA 2WOTA 3IDPA 3I4BA 1H1SA 3NNUA 2W4KA 4DTAA 3H4JA 3TNQB 1IEPA 1KOAA 4L67A 3C50A 3TIZA 2PSQA 3HLLA 1X8BA 5ETFA 1F5QA 5CEOA 3BHUA 1IAJA 1QPDA 3UOHA 2VO7A 3CTQA 5ANGA 2RG6A 1BYGA 3F5UA 3R1NA 4RJ3A 5AR7A 1YXXA 4FKWA 4ANNA 4M8TA 3Q9XA 2C6IA 4TYJA 4F9CA 2XRWA 3NMUF 2XKFA 3IOKA 3GGFA 4MTAA 4FG9A 4KINA 3A7IA 4QQ5A 4Y73A 1R0PA 3POOA 3R71A 4XLVA 2QURA 4YNEA 5J8IA 3RPYA 5I5ZA 5CYIA 1Q41A 5JFVA 2X7GA 4FGBA 5AM7A 4MYGA 1REJA 4QMSA 5BUIA 4CLIA 4B0GA 4O6EA 4XP3A 2PMIA 4USDA 1DI9A 3SG9A 4G3GA 2FGIA 2YFXA 3GEQA 4O0UA 4E6AA 4CGAA 1GZNA 3AGLA 3HUBA 4WD5A 4O38A 1Q3DA 2G9XA 5FTGA 5L2IA 4W9XA 4RZVA 5HE1A 3KVWA 4DH5A 4IVBA 4OUCA 4CZTA 5IEXA 4DN5A 4TYGA 2GPHA 4TPTA 2VWWA 4J7BA 5T3QA 4FTTA 3KL8A 4C36A 4F6UA 2J0JA 4L42A 5K0XA 2P4IA 3QRUA 4Y83A 5H8BA 5JQ5A 2R3OA 3FI2A 3VBTA 3DLZA 3VW8A 2PZYA 2J0LA 2IZUA 3LCKA 3LCSA 3ZXZA 4JJRA 4R7BA 1OUYA 2UUEA 5E92A 3NIEA 4EYMA 3HMNA 4TZRA 4HVSA 4DBNA 4F0IA 5EM7A 4TXCA 2R3JA 2Z60A 2C6LA 4YJNA 3SOCA 2HYYA 3OBGA 5KKRC 3SVVA 3FC1X 3GCVA 5ETIA 2R3RA 3QQFA 4ALUA 2BPMA 4MNEB 3CPCA 2ZV2A 4JQ8A 3OROA 4FV6A 4KAOA 4J96A 4FKSA 5CSHA 3RK5A 5EHYA 3IG7A 5DH3A 4B6LA 2W1FA 1FMKA 2F7XE 5DI1A 1OKVA 4DE4A 2YM8A 2QO7A 4JLCA 5CT0A 5ETCA 3Q2MA 1UA2A 3MVLA 3OFMA 4NZWB 3E8DA 4GT5A 1PMEA 4B99A 1ZMWA 2E9NA 2VTPA 3BU6A 3MIAA 5J7BA 2CDZA 2YWVA 2C30A 5E8XA 4FIGA 4WSQA 5TR6A 4DFZE 3LVPA 2R3FA 3P79A 5KCVA 4DFBA 5KX8A 3RHKA 4UWBA 4WG3A 4GFOA 4ANOA 4E1ZA 3ZMMA 3FXXA 3F3ZA 4WA9A 3CSVA 2W4OA 5DYJA 4IXPA 4I5CA 4J95A 4P7EA 2PVJA 3QC4A 4I1ZA 1REKA 3BEAA 3MFRA 4QMOA 1O9UA 4EL9A 1W84A 4FT7A 4I93A 2QO9A 4BY9E 1GNGA 4BIBA 2AC5A 2W1CA 4V05A 5K3YA 4EH8A 2J5FA 5H3QA 4FZ6A 4R7IA 2GNLA 4JG7A 4RFMA 5EI8A 1MUOA 1OIYA 3AD5A 4NM5A 2X2KA 2OW3A 3BHYA 3QTWA 5E7RA 2R3NA 5HBHA 3VRYA 2ITYA 5F4NA 5GIPE 3EYGA 2YCFA 4JG8A 3UG2A 3EHAA 1KV1A 4JVGA 4TY1A 4MCVA 5J95A 2ITXA 5BQ0A 4DEIA 4YZ9A 1PXPA 4BHNA 3AT2A 2HAKA 3LJ0A 3QCSA 1OPLA 2WMRA 4X3FB 2UZLA 5L8JA 2OXYA 3Q9WA 2BROA 2W9ZB 2BMCA 3Q4UA 3R1YA 4ANSA 5EK7A 4BYJA 4DINA 1H07A 5LCKA 3R63A 2WQOA 4WNKA 4JRVA 2GHLA 4FZFB 3FJQE 3NW6A 4IWPA 4P90A 4WSYA 5AR8A 2CCIA 1HOWA 5D7VA 3SQQA 3VS6A 4RC4A 3MYGA 4GVAA 2YHVA 4AW5A 1UNHA 3WI6A 1OL7A 4H3PA 4PP9A 5DGZA 4E6CA 3MY1A 3P08A 3KXMA 4AWIA 4O0WA 4DT8A 3PWYA 3GU5A 2JBPA 4R3RA 3JR1A 3O17A 2JBOA 3EL8A 3R9NA 2CNVA 3LFSA 4P5QA 4C3RA 2YM5A 5AV3A 3EKKA 3IO7A 4JNWA 3ORLA 3H3CA 5AUWA 3TKHA 2ZV8A 3AOXA 4E3CA 4FOCA 4KRCA 3SV0A 3R8LA 1TVOA 3HV7A 3NCGA 4JOAA 5EDPA 4EC9A 4IB3A 5JGDA 5HE3A 2QR7A 3TNPC 3C4FA 4QP4A 4M0ZA 4E20A 4FEWA 1TQIA 3ODZX 2HIWA 3PVGA 5HCZA 3MY5A 3Q6WA 4FVPA 3UZRA 1BUHA 3TEIA 2HY0A 3GQLA 3PG1A 2ZVAA 3OY1A 4M69B 3DAKA 3G51A 4ZJJA 3R21A 4ZZOA 2JIVA 4NKAA 5J9ZA 5A6OA 1KV2A 5B0XA 2YCRA 4FF8A 5A46A 5BMSA 4F7NA 1ZYLA 4NFMA 4UZDA 3I5ZA 3V5PA 5M07A 3DBEA 3ANRA 3HKOA 4FNXA 2BAJA 4IZYA 3LM0A 2J90A 2QCSA 2IWIA 3UNZA 3V5TA 4EKLA 1XR1A 4FT5A 1EH4A 4YZCA 3DTCA 4C02A 4EWHA 5ANEA 2QOBA 5FEEA 3SRVB 3I81A 2W5BA 5HE0A 4CSVA 5LCJA 2F49A 3NNXA 4FV0A 4PNKA 3UO6A 1H0WA 1XHAA 1WBWA 1NXKA 3FKLA 4OR5A 4U8ZA 4RJ7A 4G9RA 4CCBA 5IA1A 4IWQA 2XCHA 4FV9A 5LMKC 4K77A 1I44A 3PE2A 3K5VA 3K3IA 4DFYA 3Q5ZA 4Y8DA 3QGYA 3D4QA 4H05A 4IAFA 1P2AA 3RNIA 2E9VA 4FZ7A 5HU3A 3LFDA 4GUEA 5JZNA 3RPSA 4IB1A 5M4UA 3SG8A 5HX6A 3L8PA 3NW7A 4IAKA 4MBJA 4DG2E 2Y6MA 5DIAA 3BBTB 3ZCLA 1B6CB 5HICA 3NCZA 4X2FA 3BE9A 4GFGA 2PUIA 1G8SA 2X7FA 3AMYA 4C2VA 4IEBA 2VNWA 1Q8TA 3OY3A 4C4JA 5IUGA 3L8XA 4FTKA 4F64A 1WVWA 4P4CA 3ALNA 5CAUA 5AUYA 2XJ1A 4NIFA 4BRXA 4JAJA 5AR4A 3L9LA 1R1WA 4OTRA 3CD8A 1CKPA 1CM8A 3M11A 2GHGA 5FQDC 4BFMA 2RIOA 3RZFA 4UBAA 1M2RA 2QVSE 2QOFA 4RA4A 3UQGA 4WG5A 4EOJA 2F9GA 4FKIA 4ZLYA 3MVJA 4XUFA 2GQRA 2YJSA 1YWVA 5IKWA 4RIXA 3RK7A 2VTAA 3A99A 4IAIA 2C6EA 3E3PA 1CDKA 3MTLA 3VULA 3MFUA 3Q53A 1H25A 4OW8A 4MD7E 4RG0A 4NUSA 3BV3A 1R39A 4IMYA 5BUJA 5HTBA 4PP7A 3R8VA 3PP1A 1PHKA 2C6DA 5JH6A 3BE2A 4FI1A 2PUUA 4FKLA 4GV1A 5BVFA 5CZIA 4BGQA 4I6QA 3ZEPA 3QX4A 1M2PA 2BHHA 4XV1A 4YJTA 3KRXA 3FAAA 1XH5A 3GOPA 3MH3A 3QBNA 4LGGA 4U6RA 3U8WA 4EHEA 3HP2A 3PVUA 3R2YA 4N6YA 4OTPA 3NPCA 3R01A 5CEIA 5J87A 5KZ0A 3RVGA 5K5NA 4HVIA 4FSNA 4QP1A 4QP8A 3SLSA 4BKYA 5B2LA 3KFAA 4KS7A 3GU4A 4BDHA 2YACA 4RX8A 4YSMA 4PMSA 1VYZA 3GC9A 4QTBA 5B2KA 5IA5A 3REPA 4AN3A 4WKQA 3OZ6A 1PXOA 3LW0A 3QQUA 1KE9A 3UIXA 3HRBA 5HVJA 5FBNC 5CU3A 5A6NA 1UU8A 3OXTA 4TW9A 4LRMA 3ZYAA 4G17A 5HI2A 3VVHA 3ORMA 4X2NA 4AP7A 2XJ2A 3IDCA 3R9HA 3D5XA 4BF2A 4XBUA 3IKAA 3VAPA 3CGOA 3K5UA 5FUTA 2B9FA 5JN2A 3D5VA 4S33A 4U3YA 5IF1A 4YJPA 5DT0A 2I0EA 3ZUVA 3N4TA 5IQEA 4BL1A 4F1MA 2WPAA 4DGLC 4USFA 5K4JA 2XK6A 5FWKK 5K0KA 5D10A 3RWPA 1CTPE 4NK9A 4X3FC 2LGCA 1DS5A 3KXNA 3AG9A 4L01A 1F0QA 4YNOA 1IR3A 5GIOE 3CR0A 4R77A 2YWPA 2B9HA 2UVZA 5DEYA 4HVGA 4V0GA 3ZLSA 2A2AA 3OXIA 4HCUA 3LE6A 4HPTE 5I9UA 2BR1A 4ZS0A 5KMNA 3QTSA 2RF9A 4C58A 2DYLA 1W98A 1XO2B 3ENMA 1JBPE 2GNHA 2VU3A 3QAME 3G0FA 5E1EA 4UWCA 3KQ7A 3GB2A 4RMZA 3R7IA 4EK8A 4KIQA 3W2SA 2UZDA 1WBTA 3T9TA 1H08A 3KU2A 4KS8A 5FTOA 4D4YA 4F1TA 5L2WA 4MXAA 2VTOA 3NIZA 4JG6A 2G2HA 5HX8A 2ZMCA 1IA8A 3VQUA 4ZZMA 3GU6A 3EJ1A 3BWFA 2VX3A 5HVYA 3QXOA 3A4PA 2PZIA 4JBQA 3ELJA 3U54A 5J1WA 2CMWA 2IW6A 4U0IA 3RZBA 3JY9A 4FR4A 3VRZA 4AZSA 3OOGA 4OTFA 1RW8A 2OXXA 4OAUC 2JFMA 4WNPA 4BCPA 2BRBA 3MBLA 3NGAA 2XIKA 4JQ7A 4D1SA 3TN8A 1TKIA 3O7LB 3ERKA 4K11A 3TNIA 1MP8A 2VWXA 4AZVA 2J9MA 1GZKA 2J0IA 2R9SA 4ZJIA 3S3IA 5HIEA 2XBAA 4IC7A 3QD3A 2B4SB 3LZBA 3ORZA 3OS3A 3CKXA 1M14A 1IRKA 1PYXA 2R5TA 3MIYA 2R3MA 5L6OA 5HLNA 2XF0A 3SXRA 2XKDA 3TL8A 3F3UA 1BMKA 4AACA 3G0EA 4BCIA 1UWHA 1Q99A 1YXSA 3KN6A 3ZS5A 5J9LA 4U97A 2J0MB 4E93A 1XH4A 5AA8A 4Y85A 4ASXA 3EWHA 5M44A 4QYHA 2VO3A 5AAGA 2V7OA 5E8UA 1OKZA 3U51A 1YKRA 5LMKA 4DFLA 4RZWA 2GNFA 3GVUA 3CQWA 5HD7A 1HCKA 4E26A 2J7TA 5DR9A 3UZPA 5D41A 2GCDA 5EQEA 3BIZA 3FYKX 2CGUA 1H4LA 3BYUA 2ZM1A 4J1RA 2CPKE 3IONA 3BELA 3KCFA 4JIAA 4CKRA 2VWUA 3E3BX 3D2KA 5HESA 3C4EA 5LVMA 3EFLA 2WXVA 2HK5A 4C38A 3C4ZA 3RK9A 3DNDA 4BBEA 4M67A 4O7WA 3V6SA 5GJDA 3PJ8A 1Z5MA 4XHKB 2IZSA 4G31A 3RAIA 2WIHA 2R3PA 4RC2A 5FXSA 3NUNA 5CWZA 3OEFX 4GYGA 3QRIA 2UVYA 3BGPA 5DA3A 1LR4A 2QHNA 3FV8A 3DBQA 3GU7A 2PU8A 4FSWA 1OPKA 1ERKA 4D58A 1ZMVA 5AP3A 3OOMA 2J51A 2W9FB 2JGZA 5FG8A 3UOKA 2BHEA 2EB2A 4FUXA 3RTPA 3FEGA 1YDSE 2B54A 4LV8A 2B9IA 4EI4A 5D1JA 5TE0A 1CKIA 3Q32A 3UIUA 4UXLA 4Y46A 3P4KA 4PV0A 3Q96A 3QZGA 4WNOA 4CRSA 4ITHA 2YDJA 2PVNA 3KK8A 3Q6UA 2XCKA 5I9VA 4GW8A 1ZZLA 2JIUA 4IAZA 5M4FA 5ANDA 2EXEA 3A4OX 3S4QA 3FMEA 1R0EA 2OK1A 2JKOA 3QF9A 4RVLA 4QTCA 5CNNA 3W2RA 5HVKA 4FTRA 2I1MA 5J5SA 1PXLA 3DAEA 4R3PA 2H9VA 2HWOA 3D5UA 5E91A 2NPQA 3OBJA 1ATPE 2R0IA 2XEYA 4XMOA 4O7LA 4H58A 3ORXA 4NJDA 4IHPA 4FIFA 3FKOA 4WRSA 3T3UA 4HZSA 1VJYA 3QUPA 3QKKA 3G9LX 1YW2A 4I5MA 3FI3A 4LGHA 1ZOGA 2C0IA 2YJRA 4CD0A 1QPJA 3PJ1A 3O0GA 4HYIA 5BYLA 3Q52A 3UVRA 1GIIA 4BWXA 2OO8X 3SA0A 4FV8A 1M17A 5I9YA 5E4HA 3EQDA 2XB7A 2OIQA 4EH6A 1QPCA 4CTBA 4DITA 4I3ZA 4ARKA 4C4GA 1JKLA 3F82A 3TUCA 4BICA 1KE6A 1CKJA 3FL5A 4UB7A 4NIFB 4JDHA 3PSDA 3V04A 5A9UA 3VN9A 4IADA 5AP1A 3NUUA 1Z9XA 3L1SA 5IQGA 3D15A 4FIEA 4QP3A 4ZTQA 3W2OA 2QQ7A 4FC0A 5C8KA 4O0XA 4DH1A 4PL3A 4CFXA 5JSMA 2BRGA 3OT3A 2FB8A 2W1DA 4RIXB 3V8TA 3MS9A 5TO8A 4D2SA 5C4KA 4WBOA 4TYHA 3BLRA 4NYEA 1T45A 2PZPA 1JNKA 5CTPA 4BI1A 1SM2A 1R3CA 3FZSA 5EYCA 3KRLA 4Y5HA 5HEZA 5CVFA 3PXQA 4M66A 5D9HA 5IMXA 4I41A 5M57A 2UZWE 4QMVA 2OJFE 3C7QA 4RPVA 3PIZA 3GT8A 3R8UA 3VJNA 4G3DA 2XH5A 3LFBA 3PPZA 1OBDA 4QMPA 2W06A 5HZNA 1OECA 2YERA 2Y4PA 4RFYA 4FIJA 5HHWA 4A9UA 3F69A 3W2CA 4DG0E 4UXQA 3FMNA 3NNVA 2X4ZA 4EOSA 5CSVA 4YTCA 3SC1A 5L4QA 1YOJA 3ZHPC 2X81A 3SW4A 5EYDA 4EOKA 1ZRZA 4EBWA 5KMJA 4LM5A 3OD6X 5IG1A 2QOCA 5M55A 4BDGA 3EYHA 4X6QC 2V22A 4NTSA 4ASEA 1Q97A 2YLEA 4QPSA 4UZHA 3WIGA 1J7IA 4FNWA 4YC8A 3F6XA 5AV4A 1ZZ2A 2I0YA 1M7QA 3EQCA 4YUQA 5KUPA 2PYWA 2WTKB 2OH4A 2JDVA 3DTWA 4UWYA 5CEQA 4MD9E 3VNTA 5KBRA 1UKHA 5M08A 1IG1A 2QLQA 2WEIA 3COMA 1YXUA 4HPUE 4IANA 3UTOA 4C59A 3SGCA 4K9YA 5BVNA 5BVOA 4XLIA 3PLSA 4GVJA 3GXLA 2W4JA 2BFYA 2BCJA 2XVDA 3TNWA 3MPMA 4QO9A 4CT2A 3H30A 4D2WA 4D4RA 2QKWB 4XP0A 1SZMA 3QRJA 2E9OA 3ACJA 3CLYA 4O2ZA 5HCXA 3F7WA 2WO6A 4RIOA 3LFQA 3ZLYA 4AX8A 4RX7A 5GINE 3P5KA 3TM0A 2X8DA 3PA4A 2C5OA 3UMWA 4S32A 4JXFA 3ORPA 4FV3A 4YJSA 3QTIA 2OJJA 3BBWA 3GC7A 3MY0A 5CXHA 1Y6AA 3F9NA 5IPJA 2VTLA 2VTTA 4V0GB 5AV2A 3FZOA 3HV6A 4JL9A 1G5SA 4C7TA 4XG6A 4ZSGA 1FBNA 4NCTC 4M68A 2WOUA 3VS1A 4C4HA 1FOTA 1V0BA 3I1AA 1H24A 2CN5A 5EH0A 4O81A 3DGKA 4LMUA 3VWAA 4L9IA 5HBJA 4ALVA 3PZEA 3W2PA 4DHFA 2I6LA 3ORTA 3B8RA 3ZSGA 4APPA 3V3VA 4EK6A 4F7LA 2W1ZA 2F2CB 2XMYA 4CMUA 5CAPA 2BKZA 4ID7A 3NS9A 5HD4A 2J6MA 4D0WA 5C03A 4AFJA 5KO1A 5AUXA 4X0MA 3C5UA 3IW6A 2H6DA 4DF3A 2BIYA 3EQFA 4H1JA 2JDOA 4YO6A 2KTYA 4BB4A 4O7ZA 4FBXA 1PXJA 2X8IA 5EQPA 5AR3A 5E1SA 5HE2A 3MJ1A 1URCA 3QKMA 3VIDA 2FVDA 4FK6A 4D2RA 4E6DA 1Q5KA 4HNFA 3FLWA 3W8QA 2R2PA 3AC4A 5AX9A 3TUBA 3FHRA 2WD1A 2CSNA 1LEWA 2C5VA 1OL1A 2FSOX 2HZ0A 4I6HA 4ZY6A 5HTCA 4EH7A 5CF6A 3KREA 3FMJA 3GCSA 4TNDA 4EOMA 3LXLA 1ZMUA 4FKTA 4IB0A 1DAWA 4IBMA 2X0GA 4W4YA 2ERKA 4KBCA 4ZOGA 3WZKA 5AEPA 5JGAA 4XCUA 2GMXA 2X39A 4HGSA 4JDJA 3D14A 4WBBB 1GJOA 4PL4A 4CG9A 3D2IA 2C0OA 5AUVA 2XP2A 3P7CA 1BL6A 2UZUE 3K54A 3OW4A 3PXRA 3G2FA 5ANJA 5GZ8A 2V5QA 3D7ZA 5GNKA 3DJ6A 3G90X 4IDTA 4J53A 5KMKA 4GSBA 5DOSA 3OWLA 1OIUA 2YN8A 3P9JA 3POZA 4EJNA 2YIYA 1Q8YA 4KNBA 3QRTA 3P78A 5E8YA 3P86A 2XIYA 4R1YA 3R7VA 3ATSA 3QUEA 5FEQA 2JKQA 3ZC6A 4NW6A 4U7ZA 3D7TA 3PXKA 3V5JA 3VO3A 3H0ZA 3C4WA 3TZ8A 4JQEA 2FSMX 3KF7A 5LVLA 3DPKA 4IB5A 4MWIA 2BTSA 5AP5A 4A9RA 2XK4A 3GBZA 3OC1A 1QPEA 1GY3A 2VGOA 4RQVA 1U59A 4B8MA 3TV6A 1HCLA 3GUBA 5FM2A 5A4TA 4U5JA 5KMMA 3UGCA 2H34A 2C6MA 2YAAA 1UV5A 1ZY4A 5DLSA 5H2UA 2P2IA 3IPHA 3DJ7A 1Q4LA 2HW6A 3IK3A 3CIKA 4FKOA 4G3EA 4ITIA 4BCMA 4GU6A 2OG8A 2XZSA 3FQEA 3LFAA 2CN8A 4RJ4A 3OTUA 4PDPA 5C9CA 3F3TA 3KCKA 5M4CA 3MI9A 2RG5A 4HZRA 3UQCA 2VWVA 5BVWA 1OKYA 2IJMA 2GQGA 2XK3A 4O2PA 4AZEA 4EOIA 3DFCB 4FV2A 4ANLA 4RLKA 2UW9A 5K4IA 1ZWSA 3C1XA 5T6KA 3U6HA 1OUKA 2BDJA 4NT4A 3EQHA 3BV2A 2C3KA 4FUYA 1P5EA 4ACMA 4XYFA 2PVHA 1XBBA 4OTHA 4L52A 4X6RA 3A7JA 4J99A 4XV2A 3MB6A 2GS7A 2HZNA 5JQ8A 4H3QA 4CG8A 3H9OA 4BDIA 2IVUA 2P55A 1ZOHA 1RQQA 3RAKA 3BQCA 5D12A 3BLQA 3FZTA 4JT3A 5HBEA 5JGBA 4A9TA 4ZMFA 4XOZA 5FDXA 4O84A 4EUTA 3COIA 3TUDA 3HA6A 3VBQA 4BIDA 1ND4A 3GC0A 4KBAA 3F5PA 2O65A 3A8XA 1U5RA 3MJ2A 4K8AA 4YC3A 4F9YA 1SMHA 4FYNA 4XV3A 5DBXA 3Q4CA 4PMPA 1QCFA 3LFNA 3E93A 3G6GA 4ENXA 3Q9ZA 4AFEA 2QHMA 2XA4A 4LUDA 3R6XA 4CFMA 1NY3A 4EOLA 4FKGA 3VUMA 5IMEA 4N4SA 1SVGA 1P4FA 1OMWA 5FGKA 3C4XA 2ZMDA 3VJOA 1WBOA 4NM0A 4BTKA 5DMZA 2O3PA 2WTKC 4D2VA 4HYUA 4KKGA 4MEDA 4PRJA 4UYNA 3LCOA 4C3PA 4FK3A 3ZTXA 4JX7A 2IZRA 3GI3A 4AT4A 1Q8ZA 4G16A 4DG3E 5FP6A 5EOBA 1BX6A 3GP0A 4OT6A 2BFXA 4QQCA 3U4UA 4JAIA 1YI3A 2XNBA 4BTMA 4R6VA 3U6IA 4LRJA 2PE2A 4Z16A 4EEVA 3DQWA 3W16A 3DK3A 5BYYA 5AADA 4NKSA 4QMLA 4CVAA 2VX1A 4TYHB 5LWNA 3LJ1A 1E1VA 2VTRA 2Y0AA 5IUIA 4U40A 2JLDA 3I60A 4I21A 4XG3A 5CSXA 4F4PA 4YHTA 4QMQA 3RMFA 2BKKA 2C1BA 2HXLA 4NCTA 4RJ8A 5CASA 5LMBA 4IW0A 1PMUA 2W0JA 2X9FA 3FY0A 5EI2A 5BPYA 2YM6A 4EOPA 1PF8A 3H9RA 2C3IB 2VTNA 4XOYA 3FY2A 4U42A 3QCQA 5CF4A 3ZOSA 2QU6A 3MFSA 5A3XA 3ZC5A 4NL0A 1J1CA 3UVPA 2JAMA 4IFGA 4K33A 3UE4A 5DG5A 1FVVA 5EKOA 2VTSA 2EB3A 4R3CA 3M1SA 2PMNX 5H8GA 4BTFA 3OWJA 5JFSA 1W83A 4E5WA 4TT7A 2GNIA 3NYXA 3IGOA 3QL8A 3HL7A 2BIKB 3N51A 3HP5A 4FTOA 1KUTA 2BRHA 3ITZA 4F09A 3D5WA 2YDKA 5L2SA 4DT9A 2WMXA 4Q5EA 5IQDA 4O22A 5M4IA 4OTIA 3KULB 2Y4IB 4GCJA 4KD1A 3RWQA 3M42A 3TG1A 1XH7A 4H1MA 5LWMA 2BZHB 4BHZA 4W8DA 5TOZA 2R3LA 3T9IA 3OWKA 4PPBA 4D28A 2HY81 3W8LA 5HU9A 2VD5A 1MQBA 4A9YA 4TWOA 4HCTA 5J79A 5E9EA 3VS4A 4B8LA 3E63A 2O2UA 2A0CX 2PVRA 3Q60A 3L9NA 3H0YA 1WBSA 4ZEGA 3DV3A 5A14A 2FH9A 4FSRA 2H96A 4FOBA 4GU9A 1JSVA 1URWA 4TWCA 4CNHA 3NUYA 3FYJX 4O7RA 4QMNA 2WIPA 3SXFA 3ROYA 4B7TA 5LVNA 4BZOA 4MWHA 3VBYA 3F3WA 1ZYJA 1OGUA 3CEKA 2I0VA 3JUHA 1H00A 3ZRKA 4J98A 4YURA 5EHOA 1CMKE 2NRYA 4FMQA 4TYIA 2O5KA 4RVMA 4YJQA 5DEWA 4O27B 5GZ9A 5IA0A 4QRCA 5ITAA 3FLZA 5CVHA 4KKEA 3L9PA 3D83A 5I9WA 4E7WA 4BDBA 5IQAA 1JAMA 2GNJA 3AT3A 4MXOA 5I9ZA 2UZTA 4MBLA 2E2BA 4F0FA 3V5LA 4QNAA 4O0SA 1STCE 3PZHA 2QLUA 2R3IA 1UKIA 4D2TA 3BU5A 2WEVA 2XIZA 2J2IB 2PK9A 3QD4A 3AMAA 4GIHA 3ZBFA 4C2WA 4RC3A 4GG7A 3R7UA 3VC4A 3HRFA 3ZO1A 5CAVA 4MBIA 4HGEA 4ZSLA 1MRYA 4KIKA 3H10A 3M2WA 2Z2WA 3E7VA 4YZBA 5KHXA 5IQCA 3KY2A 5CU4A 3IECA 2JC6A 4KSQA 5HG5A 4AOJA 3AC2A 1UU7A 1OL2A 4TL0A 3C0IA 4M3QA 1FVRA 3PJ3A 3V01A 4ANMA 3ZDUA 2X6DA 2C47A 1FMOE 2HENA 2UW0A 3KB7A 4FTJA 4YC6A 3WF6A 3W10A 2GS6A 3PRIA 4CMOA 2KULA 4QMUA 4ACHA 2IW8A 4RBLA 1M52A 4MXYA 2YA9A 3LQ3A 4RJ5A 4UALA 4DEHA 3CJGA 4BZNA 4YR8A 4UMPA 1E9HA 2F57A 2AUHA 2G01A 3U55A 3CTJA 1AD5A 3HECA 2XBJA 3EFJA 3EQRA 5CQUA 4NFNA 2G2IA 4AOIA 3O71A 2BILB 3SXSA 4DH8A 3F3VA 3V5WA 5AAEA 4EQCA 3GFWA 2CGWA 3FC2A 2UZOA 2ERZE 1A9UA 2XNEA 4ZP5A 3GCPA 4EQMA 2I40A 3QD0A 2I7QA 1BKXA 5FM3A 2C69A 3R00A 3L9MA 4FODA 4U44A 2VO0A 1GOLA 4F70A 2OH0E 4CRLA 3D7TB 1PXKA 2YM4A 2PMOX 4C4IA 3QWJA 4QPAA 4WHZA 5ETAA 4ANQA 4UMUA 3CP9A 2PHKA 3WZJA 4PY1A 4DH7A 4ZLZA 4E6QA 4GKIA 5C1QB 4FT9A 5I4NA 5EOLA 2E9UA 3ZEWA 2G1TA 3DQXA 3BPRA 4CQGA 3UBDA 1SVEA 2ONLA 4LFIA 4BDAA 2XNGA 1JSUA 4MAOA 3UQFA 4YGAA 4U43A 5C27A 3KXHA 3KXZA 2G2FA 1LUFA 3TV4A 1GZ8A 2ITWA 3MA3A 1Q24A 3QRKA 4BTJA 3N4VA 5IUHA 3WE8A 2UZNA 2PZRA 3UYTA 3DS6A 1PXNA 2WQBA 3IW7A 3O8TA 3PY0A 5AV1A 2JKMA 1PKGA 3DBCA 5HO8A 1JLUE 4FKRA 2QOHA 2YIWA 2R7BA 1QMZA 3BQRA 1VR2A 2V62A 3HAMA 1A06A 4G6LA 1LEZA 3UYSA 3DZQA 4FEXA 4GJ3A 4D9UA 1YDTE 4QMWA 5A4LA 4QP2A 4ALWA 3A62A 3IDBA 4TRLA 4YPDA 4BCGA 4E4MA 2FO0A 3V8WA 1WCCA 3V8SA 4XG4A 4O7YA 3OUKA 1T46A 3R8ZA 5G1XA 1QL6A 3PY1A 4NEUA 2JITA 3BCEA 2XJ0A 5FEDA 4JDKA 4LL5A 4DFNA 1O6KA 4AQCA 3E8CA 3UC4A 4WO5A 1YHVA 4FIHA 4FEUA 3A61A 2QKRA 5AUTA 1UVRA 2UW6A 3NR9A 3TDWA 2C3JA 3KN5A 1U46A 5AIRA 1Z57A 3UODA 3VQHA 3VUHA 4BYIA 4QT1A 3VF9A 2XIRA 4Y95A 2JIIA 2Y4IC 3UIMA 4A06A 5CU0A 2PVYA 4GJ2A 3R28A 4HGTA 2ETRA 2B53A 2RFSA 2Z7RA 3AD4A 4PTCA 4F6WA 5CAOA 2UZVA 2ITNA 2C3LA 5CF5A 4C8BA 3OUNB 2A27A 2R3GA 3COKA 3NYOA 4FSMA 2QOQA 3VHEA 1H0VA 3R30A 3EQBA 2ACXA 1KWPA 3O8UA 4LGDA 4QP7A 4BCFA 4O0VA 3S0OA 4O0YA 3CS9A 2JD5A 2QNJA 2VTJA 2CNQA 4QNYA 3UNJA 4XG7A 3JVSA 2ITZA 4G5JA 3QYZA 3CJFA 3HNGA 3HDMA 2Z02A 3C51A 4B9DA 4IX4A 4LL0A 4CKJA 5KBQA 4O86A 3DJ5A 4Q5HA 2IVSA 4L46A 3DFAA 2GTNA 4EH3A 1IASA 3U87A 4R5SA 2ITOA 4DGMA 5AWMA 1NW1A 4NM7A 3MESA 3QQLA 5E8VA 3KVXA 4EONA 5IEYA 5JT2A 2WNTA 3HV5A 3AGMA 1ZARA 2X1NA 4MH7A 3VS7A 3BHHA 4MHAA 3R73A 3E87A 3SX9A 3C5IA 2WU6A 4TNBA 3DAJA 3Q3BA 3QA0A 5M53A 1OI9A 3HYHA 4LYNA 4O6LA 3DB8A 5F94A 1YOMA 4KRDA 4BCJA 5EKNA 3T3VA 4ITJA 1B39A 3HGKA 3CQEA 3ORNA 3TZ9A 1H1RA 2A19B 3NUPA 3NYNA 2RFEA 5AUZA 3O7LD 3B2TA 3GENA 4K1BA 4YZNA 2WQEA 3Q9YA 2BZKB 3DK6A 1L8TA 3EN9A 3ZU7A 5DRBA 4QD6A 2NP8A 4NU1A 2OI4X 2E9PA 3DNEA 3FWQA 3MW1A 4RIWA 1Q61A 3B2WA 1WMKA 2P3GX 4X3JA 3R7EA 2VTQA 3FI4A 2ZV7A 4FSZA 3CBLA 5CEMA 2VWZA 3ZRLA 1XWSA 4IQ6A 5DN3A 5AR5A 3ZUTA 3LLAA 4O96A 2XUUA 3ZUUA 4ACGA 5FTQA 3LXNA 4O0TA 2PUPA 3KF4A 1H1PA 4EH5A 3E92A 1M7NA 4J52A 5LOHA 4IDVA 3OWPA 3PY3A 4QPMA 1YQJA 2V7AA 4I22A 2R3KA 3LFCA 2C4GA 4BN1A 5I0BA 1JKSA 3DDPA 4JBPA 3OG7A 5DVRA 2WB8A 2EUFB 1F3MC 3G5DA 4CTCA 4D5KA 5HO7A 2QOLA 3FLNC 1OM1A 3V51A 3U9CA 1PYEA 3LLTA 3NLBA 4FNYA 4GK4A 4QMXA 4DA5A 3HMPA 4ACCA 4KA3A 3AQVA 4IM3A 4C37A 5IDPA 1OL6A 4RX5A 5IQIA 4BR3A 2XYNA 4Q2AA 3QZIA 4LQMA 2QO2A 3PTGA 4GT4A 4AF3A 2OJ9A 2WGJA 2UZBA 3MB7A 3P23A 4FEVA 4AG8A 2BUJA 4C4EA 3NVMB 5J1VA 4DYMA 2VWBA 1APME 2W1HA 2UW3A 1H27A 4E4NA 3JXWA 2C68A 5IA2A 2O0UA 4R5YA 2HZIA 1PMNA 4EHGA 4MQ1A 3UOLA 4I20A 3BYOA 2R7IA 2IVTA 5EI6A 2CKPA 4DEEA 3LQ5A 4FNZA 3KGAA 2XKEA 1ZAOA 3NAYA 4RSSA 5AP0A 2VO6A 5HOAA 4OT5A 1Y57A 4FL3A 2WQMA 4CFVA 4KIKB 4O21A 3HX4A 3MV5A 4PF4A 2YEXA 4FYOA 5AJQA 2IVVA 4BDDA 4G2FA 4IAYA 5B7VA 2XK8A 2ZOQA 4I4FA 3QTUA 4ZSJA 3I7CA 3LIJA 3O50A 2P0CA 5FP5A 3FBVA 3R7YA 4RT7A 3O51A 3OF0A 4RJ6A 5EW9A 2LAVA 4AE9A 4DFXE 4AN9A 4IX3A 2W96B 4JIKA 5LQFA 2EWAA 4FSQA 2J0KA 4HW7A 2PUNA 1KE8A 4I5HA 3VS0A 3QWKA 4ASDA 3P1AA 4MNFA 4AGDA 1WBNA 4XH6A 4K6ZA 4EHZA 5C26A 3OMVA 2WAJA 5LVOA 4IZAA 4AW1A 1WZYA 4G3FA 3CKWA 3FLSA 4PPAA 3O23A 1YRPA 3SD0A 5IQFA 3A7GA 4FVRA 3UIBA 3I79A 1H28A 3Q5IA 4I94A 5EM6A 5AUUA 4BKJA 3RNYA 3K2LA 4I6BA 3TDVA 3ZFXA 1G8AA 4APCA 3PLAE 1SVHA 4D9TA 1XH8A 4MX9A 4CXAA 3UJGA 3IW4A 3LCTA 3ZLXA 2GQSA 5DHJA 3FMLA 4F63A 3TKIA 2BAKA 3R8MA 3DLSA 3DKCA 4ZK5A 5EFQA 1IA9A 5HTIA 3BZ3A 3E8EA 4C0TA 2G15A 2FA2A 3KRWA 3KXXA 1O6LA 4K2RA 4IE9A 3UNKA 2WELA 4R1VA 3QQKA 1RJBA 3T8OA 2HOGA 4DCEA 1XBCA 1UU3A 4C61A 4CYJA 1NVQA 4IM2A 3W33A 4F7JA 1OIQA 3O8PA 2UVXA 3RGFA 1PXIA 3EMGA 3EN6A 2ITUA 3EQGA 3R22A 5CS6A 4O7SA 4MQ2A 4YLLA 2UV2A 5DRDA 4CCUA 2OFVA 4MXZA 3I5NA 3MH2A 4MXXA 4FKJA 4AT3A 3F88A 4YJVA 4LMNA 4YSJA 3MTFA 5ANKA 3DXNA 3GU8A 4FSYA 4PMTA 3CTHA 4ZIMA 3PFQA 4L7FA 2EXCX 3EZVA 4MXCA 2WMWA 4CFWA 3KKVA 4ZTLA 3RBWA 5KMLA 4XRJA 5A54A 5HCYA 4QTEA 2DS1A 3A7HA 3CY3A 3RI1A 1Y6BA 1YI4A 5TT7A 5JZJA 3EH9A 3TJCA 4EBVA 2H8HA 4KKHA 5EQYA 4N57A 4O83A 1BLXA 3MN3A 4Q9SA 1LP4A 3A8WA 2PZ5A 2V0DA 4YLKA 3R7OA 3IS5A 2YIQA 4FG7A 1JQHA 4EOQA 2OJIA 4A4XA 2OICA 3DU8A 3KK9A 2ITVA 2O63A 3THBA 1NVSA 1KE7A 4H3BA 3RKBA 4IJPA 3II5A 5HNIX 4RWKA 2PVKA 2GFSA 4OBQA 1R78A 5EW3A 3FE3A 4FT0A 3WF8A 3SKCA 5ACBC 5JFXA 3FZPA 3MA6A 4JR3A 3LAUA 2UW7A 2C6OA 5DR6A 1Q62A 4F99A 3V5QA 3PUPA 3MWUA 2WTDA 3EQIA 3GFEA 3FMDA 5L2QA 3WZUA 3LXKA 4C57A 3TWJA 3IGGA 4RFZA 3BEGA 4TN6A 3FKNA 3KA0A 4MKCA 3ZXTA 4ZAUA 3IOPA 4I0TA 3F2NA 3R04A 3UDBA 4LI5A 3FMMA 3LFFA 4FVQA 4JX3A 4M13A 1YWNA 3ZO4A 4BIEA 5CI7A 1J3HA 4ZY5A 4WUAA 2WTCA 3QFVA 1SNUA 5J7HA 3VBVA 1OB3A 2BTRA 4MF1A 3KRJA 4UY9A 5E8TA 1XQZA 4HVDA 2HXQA 1GZOA 4D55A 3QQHA 1XH9A 3DK7A 3QKLA 4IZ7A 4O1PA 4XNEA 4YO4A 3F5XA 5KE0A 3GCUA 5JMSA 4CQEA 2WMAA 3ZM9A 5H9BA 4DTKA 1L3RE 4PDYA 4HOKA 4MK0A 3OXZA 3ORIA 3VS3A 2ZYBA 3AD6A 3TT0A 3OHTA 5FLFA 3QHRA 2B7AA 5HORA 4L53A 4AGWA 3UPXA 3JYAA 2O64A 4U80A 3PG3A 3VUKA 1WBPA 4GEOA 1ZXEA 5EDQA 5KZIA 1DM2A 2YZAA 4I4EA 4FSTA 2BAQA 3QXPA 4BZDA 4BI2A 5A4EA 2YITA 5FXRA 2R4BA 3VF8A 3MVMA 2PY3A 2VN9A 3OEZA 5HG9A 4BCOA 3PVBA 4HYSA 5A4CA 2YLFA 5KHWA 4PDOA 4AU8A 4LV5A 4DAWA 2JEDA 4EZ5A 4LOOA 4BDKA 4O91A 4EZ3A 2W99B 3WF7A 3QA8A 2ZAZA 3RPVA 2VAGA 3QCXA 3RCJA 1OPJA 4EOOA 4RIWB 2QONA 3G9NA 4EH2A 2EXMA 4GS6A 5CENA 3VUDA 1K9AA 3Q2JA 4I24A 1XKKA 3NUSA 4CLJA 4ZMEA 3DBDA 4FZDB 3JVRA 2PPQA 3SHEA 4KUJA 2FYSA 4HVHA 3EZRA 2Z7QA 4ZJVA 2W7XA 3ZO3A 4S31A 4DH3A 3FPQA 4QYFA 1LPUA 4ANBA 3WYXA 3BGQA 5EYMA 2FSLX 2P2HA 3W1FA 4ERKA 5BNJA 2J5EA 3NAXA 4DLIA 2VGPA 3DKFA 4YJOA 4ZTSA 5HIDA 3W55A 2OLCA 4AAAA 2QG7A 4FT3A 2O8YA 1GIJA 1OKWA 3COHA 4IVCA 5DPVA 5GJGA 2JKKA 4E4XA 2X2MA 4PMMA 4S2ZA 1VZOA 4E5AX 3Q4ZA 2RGPA 4BCHA 4IFCA 5IA3A 2REIA 3ZFYA 3FLYA 4OLIA 3ZDIA 3CC6A 4BGGA 2BDFA 4J8NA 2P33A 1UNLA 4PPCA 2BRNA 5FXQA 3PA3A 4FKVA 3DB6A 2WTJA 1WAKA 2WZJA 2XS0A 2F7EE 2ZM3A 3HMIA 5DWRA 5L6PA 2OZOA 2C6KA 4JS8A 1Q8WA 1KSWA 3RP9A 2CGVA 4AW0A 2XNPA 1GIHA 4F08A 2ITTA 4GH2A 3KEXA 2JDSA 4O1OA 4A9SA 5HQ0A 5EW8A 2ONLC 4RWIA 4CFFA 4PWNA 1WVYA 3E5AA 1G3NA 2R64A 2EU9A 3L8SA 3F7ZA 1XH6A 4AXAA 1Q3WA 4I0RA 2OBJA 4M0YA 3MGYA 3D0EA 3RINA 3PVWA 2VTMA 2WFYA 3PJCA 4EK4A 3H9FA 5CLPA 1ZY5A 2VWYA 3TIYA 1U5QA 4BGHA 3C0GA 3PE1A 2BRMA 3FMHA 2OF2A 4M12A 3EL7A 4EYJA 2YZLA 3NDMA 2XIXA 2AC3A 4OAVB 3AC1A 2QODA 3QTQA 4GL9A 5LXMA 4QYGA 1PXMA 4EQUA 3EKNA 1M2QA 3GQIA 1FVTA 5TF9A 4BWPA 5H8EA 2Q83A 2Q0BA 4U9AA 4U45A 3QX2A 2XK9A 1WFCA 4AA5A 4AT5A 4DGOA 3QTXA 2C6TA 3MPTA 2VX0A 4FV4A 3IW8A 3NSZA 4GK2A 4C3FA 2JDRA 4QQTA 2X8EA 2ZV9A 4FTNA 4O7NA 2QOIA 5CY3A 2IPXA 4YTIA 2PTKA 4DEDA 2BALA 4CZYB 3E64A 5F1ZA 1H1QA 2YDIA 3ULZA 4CYIA 4WUNA 4GG5A 5HG7A 3S00A 2F2UA 3TZMA 5AIKA 1CSNA 2CJMA 5HNBA 3ZSIA 4RIYA 3PPKA 3HEGA 3WIKA 1W0XC 5IH6A 4QOXA 4TKSA 3CD3A 2WMSA 3LMGA 1H01A 3LM5A 3LCDA 4IZ5A 4F0GA 4GK3A 3BYMA 1JSTA 3S2PA 3R9OA 3FL4A 5HNGA 3RCDA 3PJ2A 5EYKA 3NRMA 5JRSA 2IZTA 4M14A 4D0XA 2XM9A 3C9WA 5EM8A 4S34A 5FBOA 4YJRA 3ANQA 2VTIA 3QLGA 3OT8A 2IO6A 3EFKA 3QTZA 3LFEA 4M7IA 3UO4A 4Z55A 3UZTA 5CEKA 5AA9A 2OFUA 3PIYA 4IM0A 4MF0A 4HCVA 4EUUA 3ULIA 3BYVA 2ESMA 4ZTNA 1JOWB 4AZTA 5JKGA 4Z9LA 5CEPA 3QD2B 2F7ZE 2NO3A 4JRNA 4J97A 3RHXA 3NUXA 3GCQA 1FQ1B 3ZZWA 5HKMA 2QU5A 5C4LA 4FIIA 4ONAA 3HRCA 3MVHA 4FTIA 2Y7JA 4R7HA 4XG9A 3QYWA 3BYSA 3DDQA 2W1GA 2OJGA 1KOBA 2R3QA 4K0YA 4RGJA 2DQ7X 2UZEA 4BVUA 4LOQA 3PXZA 4KABA 4BI0A 3EFWA 3AXWA 1JKKA 4XEYA 5L8KA 2YCQA 4C62A 4FG8A 4ASZA 1NA7A 5AM6A 4ZTHA 3R9DA 4L43A 2WKMA 2XRUA 3N9XA 2GTMA 2B52A 2VTHA 3PWDA 4DEAA 3D9VA 3PPJA 3BGZA 4AE6A 4YJUA 4XG8A 4WIHA 3ID6C 4DTBA 5GJFA 4GFMA 4LOPA 2OF4A 3ZRMA 3FI8A 4FTLA 5CX9A 3RM6A 3ZZEA 2CHLA 4AGUA 2CKQA 3QLFA 4WT6A 1RE8A 5I3OA 3GC8A 2ITPA 3DKGA 4L00A 4TTHB 5E90A 1AQ1A 3R0TA 3VS2A 3ZONA 4UMRA 1UU9A 4NH1A 3EQPA 3O2MA 4L8MA 4AZFA 2XNNA 4BCKA 4L45A 4DBXA 3MDYA 2F4JA 1K2PA 4RWLA 4BWKA 4K18A 3R83A 4G34A 1P4OA 2FUMA 2OU7A 2JFLA 2CCHA 5E8ZA 2PE1A 5HG8A 5DE2A 4CV9A 2UW4A 2B9JA 3GNIB 4A07A 1PMVA 4WG4A 3PRFA 2QR8A 2GU8A 4CFUA 4FKUA 1J1BA 4OTWA 1PKDA 5L3AA 1YOLA 2XYUA 2ZJWA 3HDNA 4QTAA 2Q0NA 5BVEA 3K3JA 1I09A 3BU3A 4UV0A 5HLWA 4RA5A 4AS0A 3CPBA 4MD8E 4C33A 3AMBA 3I7BA 3I6WA 4PQNA 5E8WA 4Q9ZA 1B38A 4QYYA 4V04A 4ACDA 1SYKA 4O7VA 2YISA 3CY2A 1J91A 2GDOA 4JBVA 3CQUA 2HCKA 2CKEA 4EORA 3OCTA 3U9NA 4IC8A 1H1WA 2OSCA 5T68A 5KMOA 2CGXA 4Y72A 3IW5A 1MRUA 1PRYA 2RL5A 4G6OA 3C13A 2GS2A 3F61A 2W1EA 1JWHA 4FV5A 5G6VA 4F1OA 3EOCA 2Z8CA 4XG2A 4C34A 4UMQA 5FDPA 1V0PA 2QI8A 1TQMA 2X7OA 3HV3A 3ORKA 4BC6A 4RLLA 3O96A 4EZ7A 5FRIA 3R2BA 3R9RA 4M97A 4WRGA 5CALA 4DEBA 3RAHA 4W4WA 4FTCA 3BI6A 2CLXA 1YDRE 1OVEA 4IVDA 3WILA 4JBOA 2FSTX 4IH8A 4YPSA 2YM7A 4ZLOA 4TYEA 3CGFA 3JPVA 2C1AA 2AYPA 1KE5A 5L2TA 5D7AA 4OBOA 3G15A 4D4VA 2BDWA 3F66A 4L44A 5LJJA 2V55A 3EIDA 3OCGA 4N0SA 4ZSEA 3RALA 4PTGA 3VUTA 3VW6A 4AN2A 3R02A 3DCVA 3C4CA 4YU2A 5CNOA 1OBGA 4PNIA 4BCQA 5KNJA 4RVTA 4CEGA 4QP6A 3VUGA 5IH5A 2A4LA 4QMTA 4YHFA 3C0HA 5CVGA 3W18A 4F9BA 2WHBA 2RFNA 2OIBA 4W4VA 5F20A 5ANIA 4FE2A 3DT1A 5M51A 1AGWA 1ZYDA 3E8NA 1JVPP 5IQBA 3DBFA 1YXVA 3QCYA 3TKUA 4FTQA 4O82A 4IIRA 2XNOA 4PTEA 4O7TA 4DCAA 2OZAA 3LOKA 3BKBA 3UVQA 1FPUA 1ZYSA 2IG7A 4MVFA 3DZOA 3HMMA 2I0HA 4UN0C 4H39A 3LPBA 4AUAA 2VNYA 1VYWA 2IW9A 5K5XA 4BDEA 2VRXA 5LARA 2PMLX 4FKPA 5E8SA 5M56A 4CFNA 3PDTA 2RSVA 3EN5A 4W4XA 3V6RA 2EVAA 4KWPA 4NWMA 4M84A 5F95A 2OGVA 4N70A 4RX9A 3P7AA 5F9EA 2CKOA 4I5PA 2HWPA 2B1PA 4EH9A 1NVRA 3MFTA 4U41A 2WMBA 3F2RA 5CANA 1V0OA 2OIDA 5IDNA 2ETKA 3HZTA 3FQHA 4U79A 3NWWA 1OIRA 1MRVA 1W7HA 5IISA 5CI6A 3UP2A 2XNMA 3W32A 2PVLA 4KIOA 3KMWA 2SRCA 3WARA 2JAVA 1V1KA 3DXQA 1GAGA 3BHTA 4NSTA 4XBRA 3B8QA 1DAYA 3VBXA 4F65A 5CSWA 3DOGA 1A48A 3R8PA 5L6WL 3AC5A 4DFUA 3TNHA 5BYZA 3AT4A 4FX3A 3ZH8A 1U4DA 5EM5A 4AZWA 4U81A 3LXPA 1ZOEA 4I92A 3VS5A 4YBKA 3CCNA 4C35A 5DNRA 2YAKA 1U54A 4F7SA 3HA8A 3ZM4A 4EWQA 4KSPA 3EN7A 4S30A 5BMMA 4FTAA 4EC8A 3ROCA 3VBWA 3OCSA 4X2GA 5HGIA 2GHMA 4OTDA 3QUDA 4KIPA 4E8AA 4GT3A 4QMMA 4IX6A 4QQJA 3DY7A 1MQ4A 3D94A 4WNMA 2J4ZA 4GKHA 4G3CA 1WBVA 5EHLA 4FKQA 2WQNA 3OCBA 4P2KA 4QP9A 4I23A 2W17A 4HGLA 4JDIA 4DGGA 3FZRA 4G5PA 4IAAA 3RM7A 4EK3A 3ODYX 4FL2A 3WZEA 2PVFA 3PIXA 2GFCA 2IN6A 4PL5A 4EH4A 2RKUA 2CNUA 4DGNA 3A2CA 5FD2A 4YZMA 4DC2A 2WTVA 4R8QA 3LMHA 4R78A 3MH0A 3TJDA 4ZZNA 3KC3A 1BI8A 4RIYB 4A4OA 3WOWA 5CSPA 2W1IA 5KMIA 2NRUA 3FSKA 4L6QA 3QQGA 2YCSA 3WF9A 2CLQA 4YZDA 3HAVA 4YP8A 3NEWA 3DKOA 1S9IA 1Y8YA 4D1XA 4ZTRA 3WYYA 4H36A 2QG5A 4G1WA 2YABA 4QMZA 4L7SA 3TACA 2X9EA 1W8CA 3P0MA 3P7BA 3QZFA 1H26A 4UMTA 4XRLA 5ACKA 3FMKA 1FGKA 5C01A 4AGCA 5JK3A 4FZAB 3U6JA 1UNGA 4NTTA 4X7QA 3WBLA 3QHWA 2W5AA 5AR2A 3FUPA 2VZ6A 4FV7A 3MSSA 4TWNA 2ZB0A 4L3LA 5IA4A 1YVJA 4CZUA 3ETAA 4AA0A 3FXZA 4ENYA 3KRRA 3BLHA 3TTJA 4W9WA 4FL1A 4XS2A 3ZO2A 5I9XA 2BZJA 3VUIA 4BBFA 1ZYCA 3G33A 3DA6A 4J8MA 3PXFA 2VWIA 3OP5A 3WZDA 4EK5A 4GYIA 3LHJA 3I0OA 3PYYA 4MNEA 3N4UA 4AW2A 1YHSA 2A1AB 4QMYA 1WVXA 3MPAA 1XJDA 4UYAA 5J5TA 2YIXA 3BX5A 4GRBA 4I0SA 3RPOA 4FGRA 4TWPA 3ZSHA 2ITQA 3HV4A 3Q4TA 4RVKA 3HVCA 3KMMA 5AAFA 4XV9A 3QU0A 4B4LA 3NUAA 3NVKI 3PSBA 3R7GA 3KMUA 3PA5A 3A60A 3RPRA 2C5YA 4C4FA 4CT1A 4D1ZA 3TI1A 3TZ7A 3WF5A 4PUZA 4ERWA 5CF8A 5M06A 3GOKA 3PP0A 1E1XA 3FZ1A 3AC8A 4BDJA 5IZFA 5BVKA 2X2LA 4FV1A 4NJ3A 5EG3A 2R3HA 4DLJA 3VHKA 2JDTA 4YTHA 4OGRA 1PJKA 2XKCA 4XX9A 5LVPA 3BWJA 3L8VA 2WTWA 4FICA 4F6SA 3QTRA 4J71A 2DWBA 2XEZA 3UC3A 1VEBA 1PW2A 4D5HA 4O0RA 2PULA 2OXDA 5AV0A 2C5XA 3OTVA 4AA4A 2J50A 3RJCA 4I6FA 4ZXTA 4ZS4A 5CU6A 4M15A 3ZLWA 4GIIA 3F2AA 1TQPA 3OVVA 5L8LA 4Y5QA 1UWJA 2Y9QA 3WE4A 4G6NA 4XP2A 2WMVA 2XK7A 2WMTA 4WOVA 5DT3A 4E5BA 1OL5A 3FHIA 3FQSA 5KKRB 1IAHA 3LJ2A 5BUEA 4X3FA 2WU7A 3E7OA 5JRQA 3QC9A 4YHJA 3E62A 4X21A 4PDSA 4EKKA 3UPZA 3DXPA 1JKTA 4YMJA 5AP2A 3ET7A 2WMUA 2DUVA 3ZBXA 1FINA 4FEQA 2HZ4A 5D11A 5JEBA 1RDQE 4L3PA 1S9JA 2BVAA 3NYVA 5AMNA 2OKRA 4FSUA 3ALOA 4ZTMA 4AOTA 2PVMA 4UX9A 2XM8A 4BKZA 3IQ7A 4II5A 3U4WA 4CKIA 1YI6A 3CE3A 4UEUA 4JI9A 3ATTA 5M09A 4HYHA 4E73A 1JPAA 3NW5A 5DFPA 4Z7GA 3PSCA 3UMXA 4LG4A 2GSFA 3I0QA 4IVAA 5HIBA 5AFVA 4F9AA 3FSFA 4HJOA 2ZDUA 1YWRA 4IX5A 3QALE 3W2QA 2YIRA 5AP4A 1BI7A 2QOKA 4D2PA 3NX8A 1PY5A 2Y6OA 4W8EA 3QZHA 2WMQA 4XJ0A 3SW7A 3HMOA 5J9YA 3LMIA 4HNIA 2PWLA 4NW5A 1DI8A 3S1HA 4A4LA 3EN4A 4ZSAA 3E88A 3Q04A 5A4QA 3UG1A 4JR7A 5HLPA 3CXWA 2HW7A 2OWBA 3EB0A 3KULA 4D4SA 2VUWA 1Y91A 3SDJA 4KB8A 2R0UA 1OZ1A 2W5HA 4U3ZA 2YM3A 4M69A 4GMYA 3MH1A 4QTDA 5DR2A 1K3AA 4FTMA 4Z3VA 4EHVA 2Y8OA 3FPMA 3NZ0A 3HUCA 4RRVA 5C8NA 3A7FA 3UP7A 4IWOA 3OW3A 2QOOA 4DEGA 2X6EA 4YBJA 2C5NA 5HO6A 5ICPA 4RWJA 3TCPA 4BCNA 5CQWA 2HELA 2ZDTA 4BBMA 2OZAB 4LUEA 5BX0A 3ACKA 2X4FA 5B2MA 1SNXA 2ETMA 3G6HA 3SRVA 4X2JA 5CAQA 3QGWA 4FTUA 4L68A 5ANOA 5CXZA 1NT2A 4OTQA 1BL7A 1W82A 2QD9A 4RQKA 2NNWB 4P5ZA 4X2KA 3KXGA 2RFDA 5LMAA 4G9CA 4A7CA 3F5GA 3FLQA 4F9WA 3NNWA 4PX6A 1O6YA 5IH4A 2B55A 2Z7LA 5K9IA 2GNGA 4NM3A 4USEA 1YXTA 4KBKA 1J7UA 5BVDA 1Q8UA 3SAYA 3TXOA 5IU2A 3RAWA 2VV9A 4IJ9A 5CU2A 1YHWA 5DT4A 3QQJA 4OBPA 1FGIA 2PE0A 2UW5A 1J7LA 4BDFA 4YTFA 3TV7A 3AC3A 3JS2A 1ZLTA 3FDNA 3ZFMA 2PL0A 3JY0A 5CZHA 4CMTA 5IQHA 5CT7A 4BDCA 5GHVA 2Z7SA 2WTIA 2ZB1A 4QYEA 4OTGA 3FXWA 4YLJA 5EDRA 5TKDA 4E4LA 3TTIA 4Z7HA 5I3RA 3UOJA 3LKMA 5AX3A 4ORKA 2ZM4A 2QC6A 3S95A 1OITA 3LQ8A 3BHVA 2BZIB 5AP7A 5C8MA 4N6ZA 1H8FA 5JFWA 4CV8A 3PXYA 3R1QA 4IACA 4EJ7A 3BRBA 3UO5A 5IEVA 1XBAA 5GZAA 3SOAA
chains in the Genus database with same CATH superfamily
5AP6A 4V01A 2C0TA 2UW8A 2B0QA 3R1SA 1P14A 3ENHA 2W05A 4LRKA 3I6UA 1U54B 4ZY4A 1Y8GA 4GUBA 4FA2A 4IWDA 4L3JA 2WOTA 3IDPA 3I4BA 1H1SA 3NNUA 2W4KA 4DTAA 3H4JA 3TNQB 1IEPA 1KOAA 4L67A 3C50A 3TIZA 2PSQA 3HLLA 1X8BA 5ETFA 1F5QA 5CEOA 3BHUA 1IAJA 1QPDA 3UOHA 2VO7A 3CTQA 5ANGA 2RG6A 1BYGA 3F5UA 3R1NA 4RJ3A 5AR7A 1YXXA 4FKWA 4ANNA 4M8TA 3Q9XA 2C6IA 4TYJA 4F9CA 2XRWA 3NMUF 2XKFA 3IOKA 3GGFA 4MTAA 4FG9A 4KINA 3A7IA 4QQ5A 4Y73A 1R0PA 3POOA 3R71A 4XLVA 2QURA 4YNEA 5J8IA 3RPYA 5I5ZA 5CYIA 1Q41A 5JFVA 2X7GA 4FGBA 5AM7A 4MYGA 1REJA 4QMSA 5BUIA 2XAOA 4CLIA 4B0GA 4O6EA 4XP3A 2PMIA 4USDA 1DI9A 3SG9A 4G3GA 2FGIA 2YFXA 3GEQA 4O0UA 4E6AA 4CGAA 1GZNA 3AGLA 3HUBA 4WD5A 4O38A 1Q3DA 2G9XA 5FTGA 5L2IA 4W9XA 4RZVA 5HE1A 3KVWA 4DH5A 4IVBA 4OUCA 4CZTA 5IEXA 4DN5A 4TYGA 2GPHA 4TPTA 2VWWA 4J7BA 5T3QA 4FTTA 3KL8A 4C36A 4F6UA 2J0JA 4L42A 5K0XA 2P4IA 3QRUA 4Y83A 5H8BA 5JQ5A 2R3OA 3FI2A 3VBTA 3DLZA 3VW8A 2PZYA 2J0LA 2IZUA 3LCKA 3LCSA 3ZXZA 4JJRA 4R7BA 1OUYA 2UUEA 5E92A 3NIEA 4EYMA 3HMNA 4TZRA 4HVSA 4DBNA 4F0IA 5EM7A 4TXCA 2R3JA 2Z60A 2C6LA 4YJNA 3SOCA 2HYYA 3OBGA 5KKRC 3SVVA 4I6LA 3FC1X 3GCVA 5ETIA 2R3RA 3QQFA 4ALUA 2BPMA 4MNEB 3CPCA 2ZV2A 4JQ8A 3OROA 4FV6A 4KAOA 4J96A 4FKSA 5CSHA 3RK5A 5EHYA 3IG7A 5DH3A 4B6LA 2W1FA 1FMKA 2F7XE 5DI1A 1OKVA 4DE4A 2YM8A 2QO7A 4JLCA 5CT0A 5ETCA 3Q2MA 1UA2A 3MVLA 3OFMA 4NZWB 3E8DA 4GT5A 1PMEA 4B99A 1ZMWA 2E9NA 2VTPA 3BU6A 3MIAA 5J7BA 2CDZA 2YWVA 4FRFA 2C30A 5E8XA 4FIGA 4WSQA 5TR6A 4DFZE 3LVPA 2R3FA 3P79A 5KCVA 4DFBA 5KX8A 3RHKA 4UWBA 4WG3A 4GFOA 4ANOA 4E1ZA 3ZMMA 3FXXA 3F3ZA 4WA9A 3CSVA 2W4OA 5DYJA 4IXPA 4I5CA 4J95A 4P7EA 2PVJA 3QC4A 4I1ZA 1REKA 3BEAA 3MFRA 4QMOA 1O9UA 4EL9A 1W84A 4FT7A 4I93A 2QO9A 4BY9E 1GNGA 4BIBA 2AC5A 2W1CA 4O4EA 4V05A 5K3YA 4EH8A 2J5FA 5H3QA 4FZ6A 4R7IA 2GNLA 4JG7A 4RFMA 5EI8A 1MUOA 1OIYA 3AD5A 4NM5A 2X2KA 2OW3A 3BHYA 3QTWA 5E7RA 2R3NA 5HBHA 3VRYA 2ITYA 5F4NA 5GIPE 3W0MA 3EYGA 2YCFA 4JG8A 3UG2A 3EHAA 1KV1A 4JVGA 4TY1A 4MCVA 5J95A 2ITXA 5BQ0A 4DEIA 4YZ9A 1PXPA 4BHNA 3AT2A 2HAKA 3LJ0A 3QCSA 1OPLA 2WMRA 4X3FB 2UZLA 5L8JA 2OXYA 3Q9WA 2BROA 2W9ZB 2BMCA 3Q4UA 3R1YA 4ANSA 5EK7A 4BYJA 4DINA 1H07A 5LCKA 3R63A 2WQOA 4WNKA 4JRVA 2GHLA 4FZFB 3FJQE 3NW6A 4IWPA 4P90A 4WSYA 5AR8A 2CCIA 1HOWA 5D7VA 3SQQA 3VS6A 4RC4A 3MYGA 4GVAA 2YHVA 4AW5A 1UNHA 3WI6A 1OL7A 4H3PA 4PP9A 5DGZA 4E6CA 3MY1A 3P08A 3KXMA 4AWIA 4O0WA 4DT8A 3PWYA 3GU5A 2JBPA 4R3RA 3JR1A 3O17A 2JBOA 3EL8A 3R9NA 2CNVA 3LFSA 4P5QA 4C3RA 2YM5A 5AV3A 3EKKA 3IO7A 4JNWA 3ORLA 3H3CA 5AUWA 3TKHA 2ZV8A 3AOXA 4E3CA 4FOCA 4KRCA 3SV0A 3R8LA 1TVOA 3HV7A 3NCGA 4JOAA 5EDPA 4EC9A 4IB3A 5JGDA 5HE3A 2QR7A 3TNPC 3C4FA 4QP4A 4M0ZA 4E20A 4FEWA 1TQIA 3ODZX 2HIWA 3PVGA 5HCZA 3MY5A 3Q6WA 4FVPA 3UZRA 1BUHA 3TEIA 2HY0A 3GQLA 3PG1A 2ZVAA 3OY1A 4M69B 3DAKA 3G51A 4ZJJA 3R21A 4ZZOA 2JIVA 4NKAA 5J9ZA 5A6OA 1KV2A 5B0XA 2YCRA 4FF8A 5A46A 5BMSA 4F7NA 1ZYLA 4NFMA 4UZDA 3I5ZA 3V5PA 5M07A 3DBEA 3ANRA 3HKOA 4FNXA 2BAJA 4IZYA 3LM0A 2J90A 2QCSA 2IWIA 3UNZA 3V5TA 4EKLA 1XR1A 4FT5A 1EH4A 4YZCA 3DTCA 4C02A 4EWHA 5ANEA 2QOBA 5FEEA 3SRVB 3I81A 2W5BA 5HE0A 4CSVA 5LCJA 2F49A 3NNXA 4FV0A 4PNKA 3UO6A 1H0WA 1XHAA 1WBWA 1NXKA 3FKLA 4OR5A 4U8ZA 4RJ7A 4G9RA 4CCBA 5IA1A 4IWQA 2XCHA 4FV9A 5LMKC 4K77A 3BL9A 1I44A 3PE2A 3K5VA 3K3IA 4DFYA 3Q5ZA 4Y8DA 3QGYA 3D4QA 4H05A 4IAFA 1P2AA 3RNIA 2E9VA 4FZ7A 5HU3A 3LFDA 4GUEA 5JZNA 3RPSA 4IB1A 5M4UA 3SG8A 5HX6A 3L8PA 3NW7A 4IAKA 4MBJA 4DG2E 2Y6MA 5DIAA 3BBTB 3ZCLA 1B6CB 5HICA 3NCZA 4X2FA 3BE9A 4GFGA 2PUIA 1G8SA 2X7FA 3AMYA 4C2VA 4IEBA 2VNWA 1Q8TA 3OY3A 4C4JA 5IUGA 3L8XA 4FTKA 4F64A 2XALA 1WVWA 4P4CA 3ALNA 5CAUA 5AUYA 2XJ1A 4NIFA 4BRXA 4JAJA 3KIOC 5AR4A 3L9LA 1R1WA 4OTRA 3CD8A 1CKPA 1CM8A 3M11A 2GHGA 5FQDC 4BFMA 2RIOA 3RZFA 4UBAA 1M2RA 2QVSE 2QOFA 4RA4A 3UQGA 4WG5A 4EOJA 2F9GA 4FKIA 4ZLYA 3MVJA 4XUFA 2GQRA 2YJSA 1YWVA 5IKWA 4RIXA 3RK7A 2VTAA 3A99A 4IAIA 2C6EA 3E3PA 3UDSA 1CDKA 3MTLA 3VULA 3MFUA 3Q53A 1H25A 4OW8A 4MD7E 4RG0A 4NUSA 3BV3A 1R39A 4IMYA 5BUJA 5HTBA 4PP7A 3R8VA 3PP1A 1PHKA 2C6DA 5JH6A 3BE2A 4FI1A 2PUUA 4FKLA 4GV1A 5BVFA 5CZIA 4BGQA 4I6QA 3ZEPA 3QX4A 1M2PA 2BHHA 4XV1A 4YJTA 3KRXA 3FAAA 1XH5A 3GOPA 3MH3A 3QBNA 4LGGA 4U6RA 3U8WA 4EHEA 3HP2A 3PVUA 3R2YA 4N6YA 4OTPA 3NPCA 3R01A 5CEIA 5J87A 5KZ0A 3RVGA 5K5NA 4HVIA 4FSNA 4QP1A 4QP8A 3SLSA 4BKYA 5B2LA 3KFAA 4KS7A 3GU4A 4BDHA 2YACA 4RX8A 4YSMA 4PMSA 1VYZA 3GC9A 4QTBA 5B2KA 5IA5A 3REPA 4AN3A 4WKQA 3OZ6A 1PXOA 3LW0A 3QQUA 1KE9A 3UIXA 3HRBA 5HVJA 5FBNC 5CU3A 5A6NA 1UU8A 3OXTA 4TW9A 4LRMA 3ZYAA 4G17A 5HI2A 3VVHA 3ORMA 4X2NA 4AP7A 2XJ2A 3IDCA 3R9HA 3D5XA 4BF2A 4XBUA 3IKAA 3VAPA 3CGOA 3K5UA 5FUTA 2B9FA 5JN2A 3D5VA 4S33A 4U3YA 5IF1A 4YJPA 5DT0A 2I0EA 3ZUVA 3N4TA 5IQEA 4BL1A 4F1MA 2WPAA 4DGLC 4USFA 5K4JA 2XK6A 5FWKK 4LDTA 5K0KA 5D10A 3RWPA 1CTPE 4NK9A 4X3FC 2LGCA 1DS5A 3KXNA 3AG9A 4L01A 1F0QA 4YNOA 1IR3A 5GIOE 3CR0A 4R77A 2YWPA 2B9HA 2UVZA 5DEYA 4HVGA 4V0GA 3ZLSA 2A2AA 3OXIA 4HCUA 3LE6A 4HPTE 5I9UA 2BR1A 4ZS0A 5KMNA 3QTSA 2RF9A 4C58A 2DYLA 1W98A 1XO2B 3ENMA 1JBPE 2GNHA 2VU3A 3QAME 3G0FA 5E1EA 4UWCA 3KQ7A 3GB2A 4RMZA 3R7IA 4EK8A 4KIQA 3W2SA 2UZDA 1WBTA 3T9TA 1H08A 3KU2A 4KS8A 5FTOA 4D4YA 4F1TA 5L2WA 4MXAA 2VTOA 3NIZA 4JG6A 2G2HA 5HX8A 2ZMCA 1IA8A 3VQUA 4ZZMA 3GU6A 3EJ1A 3BWFA 2VX3A 5HVYA 3QXOA 3A4PA 2PZIA 4JBQA 3ELJA 3U54A 5J1WA 2CMWA 2IW6A 4U0IA 3RZBA 3JY9A 4FR4A 3VRZA 4AZSA 3BL7A 3OOGA 4OTFA 1RW8A 2OXXA 4OAUC 2JFMA 4WNPA 4BCPA 2BRBA 3MBLA 3NGAA 2XIKA 4JQ7A 4D1SA 3TN8A 1TKIA 3O7LB 3ERKA 4DDGA 4K11A 3TNIA 1MP8A 2VWXA 4AZVA 2J9MA 1GZKA 2J0IA 2R9SA 4ZJIA 3S3IA 5HIEA 2XBAA 4IC7A 3QD3A 2B4SB 3LZBA 3ORZA 3OS3A 3CKXA 1M14A 1IRKA 1PYXA 2R5TA 3MIYA 2R3MA 5L6OA 5HLNA 2XF0A 3SXRA 2XKDA 3TL8A 3F3UA 1BMKA 1VLRA 4AACA 3G0EA 4BCIA 1UWHA 1Q99A 1YXSA 3KN6A 3ZS5A 5J9LA 4U97A 2J0MB 4E93A 1XH4A 5AA8A 4Y85A 4ASXA 3EWHA 5M44A 4QYHA 2VO3A 5AAGA 2V7OA 5E8UA 1OKZA 3U51A 1YKRA 5LMKA 4DFLA 4RZWA 2GNFA 3GVUA 3CQWA 5HD7A 1HCKA 4E26A 2J7TA 5DR9A 3UZPA 5D41A 2GCDA 5EQEA 3BIZA 3FYKX 2CGUA 1H4LA 3BYUA 2ZM1A 4J1RA 2CPKE 3IONA 3BELA 3KCFA 4JIAA 4CKRA 2VWUA 3E3BX 3D2KA 5HESA 3C4EA 5LVMA 3EFLA 2WXVA 2HK5A 4C38A 3C4ZA 3RK9A 3DNDA 4BBEA 4M67A 4O7WA 3V6SA 5GJDA 3PJ8A 1Z5MA 4XHKB 2IZSA 4G31A 3RAIA 2WIHA 2R3PA 4RC2A 5FXSA 3NUNA 5CWZA 3OEFX 4GYGA 3QRIA 2UVYA 3BGPA 5DA3A 1LR4A 2QHNA 3FV8A 3DBQA 3GU7A 2PU8A 4FSWA 1OPKA 1ERKA 4D58A 1ZMVA 5AP3A 3OOMA 2J51A 2W9FB 2JGZA 5FG8A 3UOKA 2BHEA 2EB2A 4FUXA 3RTPA 3FEGA 1YDSE 2B54A 4LV8A 2B9IA 4EI4A 5D1JA 5TE0A 1CKIA 3Q32A 3UIUA 4UXLA 4Y46A 3P4KA 4PV0A 3Q96A 3QZGA 4WNOA 4CRSA 4ITHA 2YDJA 2PVNA 3KK8A 3Q6UA 2XCKA 5I9VA 4GW8A 1ZZLA 2JIUA 4IAZA 5M4FA 5ANDA 2EXEA 3A4OX 3S4QA 3FMEA 1R0EA 2OK1A 2JKOA 3QF9A 4RVLA 4QTCA 5CNNA 3W2RA 5HVKA 4FTRA 2I1MA 5J5SA 1PXLA 3DAEA 4R3PA 2H9VA 2HWOA 3D5UA 5E91A 2NPQA 3OBJA 1ATPE 2R0IA 2XEYA 4XMOA 4O7LA 4H58A 3ORXA 4NJDA 4IHPA 4FIFA 3FKOA 4WRSA 3T3UA 4HZSA 1VJYA 3QUPA 3QKKA 3G9LX 1YW2A 4I5MA 3FI3A 4LGHA 1ZOGA 2C0IA 2YJRA 4CD0A 1QPJA 3PJ1A 3O0GA 4HYIA 5BYLA 3Q52A 3UVRA 1GIIA 4BWXA 2XAMA 2OO8X 3SA0A 4FV8A 1M17A 5I9YA 5E4HA 3EQDA 2XB7A 2OIQA 4EH6A 1QPCA 4CTBA 4DITA 4I3ZA 4ARKA 4C4GA 1JKLA 3F82A 3TUCA 4BICA 1KE6A 1CKJA 3FL5A 4UB7A 4NIFB 4JDHA 3PSDA 3V04A 5A9UA 3VN9A 4IADA 5AP1A 3NUUA 1Z9XA 3L1SA 5IQGA 3D15A 4FIEA 4QP3A 4ZTQA 3W2OA 2QQ7A 4FC0A 5C8KA 4O0XA 4DH1A 4PL3A 4CFXA 5JSMA 2BRGA 3OT3A 2FB8A 2W1DA 4RIXB 3V8TA 1W2FA 3MS9A 5TO8A 4D2SA 5C4KA 4WBOA 4TYHA 3BLRA 4NYEA 1T45A 2PZPA 1JNKA 3W0NA 5CTPA 4BI1A 1SM2A 1R3CA 3FZSA 5EYCA 3KRLA 4Y5HA 5HEZA 5CVFA 3PXQA 4M66A 5D9HA 5IMXA 4I41A 5M57A 2UZWE 4QMVA 2OJFE 3C7QA 4RPVA 3PIZA 3GT8A 3R8UA 3VJNA 4G3DA 2XH5A 3LFBA 3PPZA 1OBDA 4QMPA 2W06A 5HZNA 1OECA 2YERA 2Y4PA 4RFYA 4FIJA 5HHWA 4A9UA 3F69A 3W2CA 4DG0E 4UXQA 3FMNA 3NNVA 2X4ZA 4EOSA 5CSVA 4YTCA 3SC1A 5L4QA 1YOJA 3ZHPC 2X81A 3SW4A 5EYDA 4EOKA 1ZRZA 4EBWA 5KMJA 4LM5A 3OD6X 5IG1A 2IEWA 2QOCA 5M55A 4BDGA 3EYHA 4X6QC 2V22A 4NTSA 4ASEA 1Q97A 2YLEA 4QPSA 4UZHA 3WIGA 1J7IA 1ST4A 4FNWA 4YC8A 3F6XA 5AV4A 1ZZ2A 2I0YA 1M7QA 3EQCA 4YUQA 5KUPA 2PYWA 2WTKB 2OH4A 2JDVA 3DTWA 4UWYA 5CEQA 4MD9E 3VNTA 5KBRA 1UKHA 5M08A 1IG1A 2QLQA 2WEIA 3COMA 1YXUA 4HPUE 4IANA 3UTOA 4C59A 3SGCA 4K9YA 5BVNA 5BVOA 4XLIA 3PLSA 4GVJA 3GXLA 2W4JA 2BFYA 2BCJA 2XVDA 3TNWA 3MPMA 4QO9A 4CT2A 3H30A 4D2WA 4D4RA 2QKWB 4XP0A 1SZMA 3QRJA 2E9OA 3ACJA 3CLYA 4O2ZA 5HCXA 3F7WA 2WO6A 4RIOA 3LFQA 3ZLYA 4AX8A 4RX7A 5GINE 3P5KA 3TM0A 2X8DA 3PA4A 2C5OA 3UMWA 4S32A 4JXFA 3ORPA 4FV3A 4YJSA 3QTIA 2OJJA 3BBWA 3GC7A 3MY0A 5CXHA 1Y6AA 3F9NA 5IPJA 2VTLA 2VTTA 4V0GB 5AV2A 3FZOA 3HV6A 4JL9A 1G5SA 4C7TA 4XG6A 4ZSGA 1FBNA 4NCTC 4M68A 2WOUA 3VS1A 4C4HA 1FOTA 3AKJA 1V0BA 3I1AA 1H24A 2CN5A 5EH0A 4O81A 3DGKA 4LMUA 3VWAA 4L9IA 5HBJA 4ALVA 3PZEA 3W2PA 4DHFA 1OGYA 2I6LA 3ORTA 3B8RA 3ZSGA 4APPA 3V3VA 4EK6A 4F7LA 2W1ZA 2F2CB 2XMYA 4CMUA 5CAPA 2BKZA 4ID7A 3NS9A 5HD4A 2J6MA 4D0WA 5C03A 4AFJA 5KO1A 5AUXA 4X0MA 3C5UA 3IW6A 2H6DA 4DF3A 2BIYA 3EQFA 4H1JA 2JDOA 4YO6A 2KTYA 4BB4A 4O7ZA 4FBXA 1PXJA 2X8IA 5EQPA 5AR3A 5E1SA 5HE2A 3MJ1A 1URCA 3QKMA 3VIDA 2FVDA 4FK6A 4D2RA 4E6DA 3TMOA 1Q5KA 4HNFA 3FLWA 3W8QA 2R2PA 3AC4A 5AX9A 3TUBA 3FHRA 2WD1A 4QDVA 2CSNA 1LEWA 2C5VA 1OL1A 2FSOX 2HZ0A 4I6HA 4ZY6A 5HTCA 4EH7A 5CF6A 3KREA 3FMJA 3GCSA 4TNDA 4EOMA 3LXLA 1ZMUA 4FKTA 4IB0A 1DAWA 4IBMA 2X0GA 4W4YA 2ERKA 4KBCA 4ZOGA 3WZKA 5AEPA 5JGAA 4XCUA 2GMXA 2X39A 4HGSA 4JDJA 3D14A 4WBBB 1GJOA 4PL4A 4CG9A 3D2IA 2C0OA 5AUVA 2XP2A 3P7CA 1BL6A 2UZUE 3K54A 3OW4A 3PXRA 3G2FA 5ANJA 5GZ8A 2V5QA 3D7ZA 5GNKA 3DJ6A 3G90X 4IDTA 4J53A 4DHJA 5KMKA 4GSBA 5DOSA 3OWLA 1OIUA 2YN8A 3P9JA 3POZA 4EJNA 2YIYA 1Q8YA 4KNBA 3QRTA 3P78A 5E8YA 3P86A 2XIYA 4R1YA 3R7VA 3ATSA 3QUEA 5FEQA 2JKQA 3ZC6A 4NW6A 4U7ZA 3D7TA 3PXKA 3V5JA 3VO3A 3H0ZA 3C4WA 3TZ8A 4JQEA 2FSMX 3KF7A 5LVLA 3DPKA 4IB5A 4MWIA 2BTSA 5AP5A 4A9RA 2XK4A 3GBZA 2A98A 3OC1A 1QPEA 1GY3A 2VGOA 4RQVA 1U59A 4B8MA 3TV6A 1HCLA 3GUBA 5FM2A 5A4TA 4U5JA 5KMMA 3UGCA 2H34A 2C6MA 2YAAA 1UV5A 1ZY4A 5DLSA 5H2UA 2P2IA 3IPHA 3DJ7A 1Q4LA 2HW6A 3IK3A 3CIKA 4FKOA 4G3EA 4ITIA 4O4BB 4BCMA 4GU6A 2OG8A 2XZSA 3FQEA 3LFAA 2CN8A 4RJ4A 1XMLA 3OTUA 4PDPA 5C9CA 3F3TA 3KCKA 5M4CA 3MI9A 2RG5A 4HZRA 3UQCA 2VWVA 5BVWA 1OKYA 2IJMA 2GQGA 2XK3A 4O2PA 4AZEA 4EOIA 3DFCB 4FV2A 4ANLA 4RLKA 2UW9A 5K4IA 1ZWSA 3C1XA 5T6KA 3U6HA 1OUKA 2BDJA 4NT4A 3EQHA 3BV2A 2C3KA 4FUYA 1P5EA 4ACMA 4XYFA 2PVHA 1XBBA 4OTHA 4L52A 4X6RA 3A7JA 4J99A 4XV2A 4FJVA 3MB6A 2GS7A 2HZNA 5JQ8A 4H3QA 4CG8A 3H9OA 4BDIA 2IVUA 2P55A 1ZOHA 1RQQA 3RAKA 3BQCA 5D12A 3BLQA 3FZTA 4JT3A 5HBEA 5JGBA 4A9TA 4ZMFA 4XOZA 5FDXA 4O84A 2XANA 4EUTA 3COIA 3TUDA 3HA6A 3VBQA 4BIDA 1ND4A 3GC0A 4KBAA 3F5PA 2O65A 3A8XA 1U5RA 3MJ2A 4K8AA 4YC3A 4F9YA 1SMHA 4FYNA 4XV3A 5DBXA 4QEBA 3Q4CA 4PMPA 1QCFA 3LFNA 3E93A 3G6GA 4ENXA 3Q9ZA 4AFEA 2QHMA 2XA4A 4LUDA 3R6XA 4CFMA 1NY3A 3UDTA 4EOLA 4FKGA 3VUMA 5IMEA 4N4SA 1SVGA 1P4FA 1OMWA 5FGKA 3C4XA 2ZMDA 3VJOA 1WBOA 4NM0A 4AXEA 4BTKA 5DMZA 2O3PA 2WTKC 4D2VA 4HYUA 4KKGA 4MEDA 4PRJA 4UYNA 3LCOA 4C3PA 4FK3A 3ZTXA 4JX7A 2IZRA 3GI3A 4AT4A 1Q8ZA 4G16A 4DG3E 5FP6A 5EOBA 1BX6A 3GP0A 4OT6A 2BFXA 4QQCA 3U4UA 4JAIA 1YI3A 2XNBA 4BTMA 4R6VA 3U6IA 4LRJA 2PE2A 4Z16A 5BV3A 4EEVA 3DQWA 3W16A 3DK3A 5BYYA 5AADA 4NKSA 4QMLA 4CVAA 2VX1A 4TYHB 2AEGA 5LWNA 3LJ1A 1E1VA 2VTRA 4MUQA 2Y0AA 5IUIA 4U40A 2JLDA 3I60A 4I21A 4XG3A 5CSXA 4F4PA 4YHTA 4QMQA 3RMFA 2BKKA 2C1BA 2HXLA 4NCTA 4RJ8A 5CASA 5LMBA 4IW0A 1PMUA 2W0JA 2X9FA 3FY0A 5EI2A 5BPYA 2YM6A 4EOPA 1PF8A 2X0QA 3H9RA 2C3IB 2VTNA 3PUFC 4XOYA 3FY2A 4U42A 3QCQA 5CF4A 3ZOSA 2QU6A 3MFSA 5A3XA 3ZC5A 4NL0A 1J1CA 3UVPA 2JAMA 4IFGA 4K33A 3UE4A 5DG5A 1FVVA 5EKOA 2VTSA 2EB3A 4R3CA 3M1SA 2PMNX 5H8GA 4BTFA 3OWJA 5JFSA 1W83A 4E5WA 4TT7A 2GNIA 3NYXA 3IGOA 3QL8A 3HL7A 2BIKB 3N51A 3HP5A 4FTOA 1KUTA 2BRHA 3ITZA 4F09A 3D5WA 2YDKA 5L2SA 4DT9A 2WMXA 4Q5EA 5IQDA 4O22A 5M4IA 4OTIA 3KULB 2Y4IB 4GCJA 4KD1A 3RWQA 3M42A 3TG1A 1XH7A 4H1MA 5LWMA 2BZHB 4BHZA 4W8DA 5TOZA 2R3LA 3T9IA 3OWKA 4PPBA 4D28A 2HY81 3W8LA 5HU9A 4DHZA 2VD5A 1MQBA 4A9YA 4TWOA 4HCTA 5J79A 5E9EA 3VS4A 4B8LA 3E63A 2O2UA 2A0CX 2PVRA 3Q60A 3L9NA 3H0YA 1WBSA 4ZEGA 3DV3A 5A14A 2FH9A 4FSRA 2H96A 4FOBA 4GU9A 1JSVA 1URWA 4TWCA 4CNHA 3NUYA 3FYJX 4O7RA 4QMNA 2WIPA 3SXFA 3ROYA 4B7TA 5LVNA 4BZOA 4MWHA 3VBYA 3F3WA 1ZYJA 1OGUA 3CEKA 2I0VA 3JUHA 1H00A 3ZRKA 4J98A 4YURA 5EHOA 1CMKE 2NRYA 4FMQA 4TYIA 2O5KA 4RVMA 4YJQA 5DEWA 4O27B 5GZ9A 5IA0A 4QRCA 5ITAA 3FLZA 5CVHA 4KKEA 3L9PA 3D83A 5I9WA 4QDEA 4AXFA 4E7WA 4BDBA 5IQAA 1JAMA 2GNJA 3AT3A 4MXOA 5I9ZA 2UZTA 4MBLA 2E2BA 4F0FA 3V5LA 4QNAA 4O0SA 1STCE 3PZHA 2QLUA 2R3IA 1UKIA 4D2TA 3BU5A 2WEVA 2XIZA 2J2IB 2PK9A 3QD4A 3AMAA 4GIHA 3ZBFA 4C2WA 4RC3A 4GG7A 3R7UA 3VC4A 3HRFA 3ZO1A 5CAVA 4MBIA 4HGEA 4ZSLA 1MRYA 4KIKA 3H10A 3M2WA 2Z2WA 3E7VA 4YZBA 5KHXA 5IQCA 3KY2A 5CU4A 3IECA 2JC6A 4KSQA 5HG5A 4AOJA 3AC2A 1UU7A 1OL2A 4TL0A 3C0IA 4M3QA 1FVRA 3PJ3A 3V01A 4ANMA 3ZDUA 2X6DA 2C47A 1FMOE 2HENA 2UW0A 3KB7A 4FTJA 4YC6A 4AXDA 3NFGB 3WF6A 3W10A 2GS6A 3PRIA 4CMOA 2KULA 4QMUA 4ACHA 2IW8A 4RBLA 1M52A 4MXYA 2YA9A 3LQ3A 4RJ5A 4UALA 4DEHA 3CJGA 4BZNA 4YR8A 4UMPA 1E9HA 2F57A 2AUHA 2G01A 3U55A 4AQKA 3CTJA 1AD5A 3HECA 2XBJA 3EFJA 3EQRA 5CQUA 4NFNA 2G2IA 4AOIA 3O71A 2BILB 3SXSA 4DH8A 3F3VA 3V5WA 5AAEA 4EQCA 3GFWA 2CGWA 3FC2A 2UZOA 2ERZE 1A9UA 2XNEA 4ZP5A 3GCPA 4EQMA 2I40A 3QD0A 2I7QA 1BKXA 5FM3A 2C69A 3R00A 3L9MA 4FODA 4U44A 2VO0A 1GOLA 4F70A 2OH0E 4CRLA 1ST0A 3D7TB 1PXKA 2YM4A 2PMOX 4C4IA 3QWJA 4QPAA 4WHZA 5ETAA 4ANQA 4UMUA 3CP9A 2PHKA 3WZJA 4PY1A 4DH7A 4ZLZA 4E6QA 4GKIA 5C1QB 4FT9A 5I4NA 5EOLA 2E9UA 3ZEWA 2G1TA 3DQXA 3BPRA 4CQGA 3UBDA 1SVEA 2ONLA 4LFIA 4BDAA 2XNGA 1JSUA 4MAOA 3UQFA 4YGAA 4U43A 5C27A 3KXHA 3KXZA 2G2FA 1LUFA 3TV4A 1GZ8A 2ITWA 3MA3A 1Q24A 3QRKA 4BTJA 3N4VA 5IUHA 3WE8A 2UZNA 2PZRA 3UYTA 3DS6A 1PXNA 2WQBA 3IW7A 3O8TA 3PY0A 5AV1A 2JKMA 1PKGA 3DBCA 5HO8A 1JLUE