5IG1A

Crystal structure of s. rosetta camkii kinase domain
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
300
structure length
300
Chain Sequence
METETSFFDLYDVDLKDKRSVIGKGAFSTVHRCVNKRTGEVCAVKVIALKSLRSSEINKIKREIGICSSLQHEHIVSMRRAFRDESHFYLVFEYVSGGELFDEIVTRKFYNEKDASACMHQILSALQHCHSKNIIHRDLKPENLLLASKDPNAPVKITDFGLAVIMEQGPTYFGFAGTPGYLSPEVIRRVPYDTAVDVWACGVILYILLVGYPPFWEEDHQKLYAQIKNCQYDFPSPEWDSVTTAAKELIKAMLEPNPKRRPTVQELLQHPWIARRDVPGSVHRQATLEELKKFNARRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CAMK/CAMK2 protein kinase
publication title Molecular mechanism of activation-triggered subunit exchange in Ca(2+)/calmodulin-dependent protein kinase II.
pubmed doi rcsb
source organism Salpingoeca rosetta
total genus 91
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ig1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ig1A01
1UV5A 5CS6A 2GS7A 2YIWA 4X3FC 4PTGA 2FO0A 4YR8A 4GW8A 1BL6A 4QQJA 3FJQE 4IMYA 2JBPA 2W1HA 2YCSA 3DBDA 3DS6A 4BGGA 2DQ7X 3GCQA 2NRYA 2VTRA 4H1JA 3FBVA 3TXOA 1YOJA 3FLWA 3LFFA 5B2MA 2IVSA 4C3RA 5J1WA 3BLRA 3E63A 3SXSA 4EK8A 3FQHA 4WD5A 1T45A 4UMPA 2PK9A 3E64A 4O7NA 3LIJA 2WFYA 3BLHA 3FMJA 3MSSA 4FV3A 4IAYA 4IWOA 5TO8A 1L3RE 5BUIA 1H27A 4LL5A 2RG6A 3PXKA 2J5FA 2PZRA 5L2QA 1ZXEA 4ERKA 3COMA 4FG9A 4D2WA 4QP3A 4G3EA 3ORKA 3EJ1A 4QTAA 5JRQA 3ZEPA 2YAKA 4DEEA 3ZO2A 1R39A 3DKOA 5EI8A 3V8WA 4E5WA 1WBVA 2QOKA 4AZFA 4D2RA 3SGCA 2XNGA 4NK9A 4MQ2A 2BRBA 1H07A 2RGPA 3M42A 4D1ZA 3ZO3A 3Q52A 2WQMA 3HL7A 2PE2A 3VS4A 4R7HA 4P5ZA 2WTKC 2O65A 2GCDA 3F6XA 5HD4A 1VZOA 4GK2A 4TWPA 3OXTA 4JIKA 5IH6A 4E6DA 2J7TA 3EN4A 2X6EA 3NNUA 4EOLA 5DT0A 3S2PA 2ZV7A 3OUNB 4EH6A 3EOCA 4QMLA 3JS2A 2C5OA 3CEKA 3HV6A 3R02A 4L3PA 2JKKA 1W83A 3IW8A 4TN6A 3IGGA 4HPUE 2IWIA 5HCYA 4BKZA 4AZTA 2XBAA 4FKSA 2EXCX 3MVJA 3LQ5A 4YC6A 2VTLA 1KE9A 5E92A 2FVDA 4WBOA 1PW2A 4HZSA 3L9PA 4I6BA 4NFNA 4GYIA 4IQ6A 4YHTA 5K4IA 5LWMA 2UVZA 5HNGA 4IEBA 4QP9A 4I5PA 4EH7A 4JG8A 2UZVA 3OZ6A 2QI8A 2W5BA 4UMUA 1WVWA 2R7BA 3EQHA 4TY1A 2ETRA 2WMTA 2BIYA 4I41A 5J87A 3A7GA 4JBQA 5JT2A 4U42A 4FZDB 4R1YA 4YC3A 3VWAA 4FV6A 5HG8A 3GEQA 2R2PA 5GIOE 4DEHA 3LE6A 5BMSA 1T46A 4XMOA 2HW7A 3PFQA 4O83A 4E1ZA 4AX8A 4O0XA 2B9IA 4FC0A 4LFIA 3R7EA 3MH2A 3GFWA 3RINA 3VRYA 3EKKA 3LXNA 5G6VA 3V51A 3VS2A 3HDNA 3D2KA 3A62A 3EYHA 3ODZX 2Z02A 5IA0A 4XLIA 4JI9A 3TUCA 4JR7A 1JLUE 3OROA 2I0YA 2YA9A 3OP5A 2Y9QA 1FGIA 1PYXA 4L00A 4OTHA 1A06A 4IDTA 1K2PA 5K0KA 3HP5A 1R0PA 2UZEA 2WMBA 2BZJA 2JDOA 4XV2A 4BICA 5T68A 1YDTE 2W4OA 2NO3A 3SA0A 4USFA 1YI6A 4F0FA 3I4BA 4AWIA 5IA1A 5DN3A 1BMKA 1HOWA 4J71A 4OTWA 2CCHA 3F9NA 4XYFA 2WMAA 4ZZMA 2PZPA 4G31A 2YCQA 3MV5A 3OD6X 4Q2AA 3BEGA 1H08A 3P08A 3DK7A 4BHNA 1GIHA 5AX9A 2B4SB 1BLXA 1YWRA 2YJRA 2W17A 4GUBA 4YBKA 3DBQA 4EEVA 4GUEA 4P4CA 2OH4A 3F88A 5I3RA 3EL7A 2VD5A 3I6UA 4ZEGA 1F3MC 4QMSA 2UW3A 3AD4A 2QD9A 3BGPA 4IVDA 3HYHA 3I5ZA 4EL9A 4RWLA 4FZ7A 2JDSA 3CD8A 4U45A 4AOIA 1PMEA 3FUPA 4TWNA 4HGSA 1Z5MA 2YM6A 3VS6A 2ESMA 2GTMA 4LV5A 5HVJA 4AZSA 1G8SA 4FKVA 5I3OA 2BHEA 1Q8ZA 3P86A 4A9UA 1GZKA 3NAXA 4Q5HA 4R7BA 1AQ1A 1CMKE 2QNJA 4FVPA 2C6LA 4ZTHA 4G3DA 4IAZA 4F9YA 4Q9ZA 3SC1A 2QHMA 2KTYA 4WNMA 4E93A 4ENYA 4FZAB 3C7QA 4IAAA 2UZWE 3DFAA 5HE0A 2CDZA 2IZTA 4CT1A 1EH4A 4KAOA 4UMRA 3KCKA 5EDQA 4EKLA 3NMUF 3D2IA 3EQGA 4NFMA 5HI2A 3D5XA 2QURA 4FGBA 4TNDA 4I21A 3BHYA 2ZDUA 3BHUA 3KXNA 4BCPA 3HV5A 3UYSA 2PUIA 4I0RA 4NL0A 4DG2E 4FTRA 4U6RA 5DFPA 3UIMA 4YU2A 2FA2A 3KMUA 3V01A 4H39A 3CCNA 3K2LA 3OT3A 4G3CA 4GS6A 4BDBA 2Y0AA 4Z3VA 3Q2JA 2R3JA 3KK9A 1YRPA 3TL8A 2V7AA 1TVOA 4XJ0A 4YTHA 4LM5A 3R1QA 4G16A 4EKKA 5KHWA 4NYEA 3JY9A 2BHHA 4A4OA 3O8TA 4JAIA 4ACMA 4C4FA 1UVRA 2HXLA 4AN3A 2IN6A 3U8WA 4LL0A 4YPDA 1H25A 4MTAA 5AIKA 1YKRA 3G2FA 2PVYA 3FKNA 5EM5A 3PIYA 4NIFA 3OXZA 1OPKA 2IVVA 3QALE 1SYKA 1MRVA 2QOHA 4I6HA 2ETMA 5EI2A 4M14A 1Q41A 2WMQA 4PUZA 3QXOA 5FEEA 3S4QA 4YHJA 2YZLA 2NNWB 4D0XA 1GAGA 4QMWA 3GB2A 1ERKA 4XLVA 3D4QA 3E62A 3BEAA 3NVMB 1YDRE 4IJPA 3O7LD 4U5JA 1GY3A 4L01A 4MCVA 4Z7HA 3RPOA 3R9HA 1STCE 4ZXTA 4UEUA 3LM0A 3UOLA 3VBTA 1M52A 3W2RA 3A7FA 3FY2A 1YDSE 3KVWA 2HOGA 2C1AA 5CXZA 4EK5A 3BIZA 2BKZA 2W1EA 4S32A 5IDPA 5D10A 1ZOEA 4X3FA 2QR8A 3FMMA 1PMUA 4F7JA 3DB8A 5K0XA 3PP0A 3EN6A 5I9WA 2BDJA 3TV6A 3MA3A 4NM7A 4CMUA 1SZMA 4K11A 5GJDA 2VTOA 5IA3A 2CSNA 2V7OA 2RFEA 4KBCA 2HAKA 5F95A 4ZTLA 4TZRA 4EQCA 2QO7A 4UX9A 2W5AA 3FI2A 4W4YA 3VW8A 4W8DA 3G9LX 2WTWA 4BDGA 5AWMA 3SV0A 3ROCA 5FXRA 4FNZA 5HIEA 4BCOA 5EQPA 4D5KA 4KBAA 2Q83A 2WOTA 3PY3A 3ZDUA 4FF8A 4EOKA 5KCVA 4CTBA 3ATSA 4YHFA 4G34A 3C4EA 4G9RA 3MB6A 3PY1A 2BAKA 4X2FA 4EJNA 2YISA 5DIAA 3DTWA 3MVMA 2GMXA 1XBAA 3A7HA 3PVBA 4EOMA 4UXLA 3R7IA 1I09A 1OPJA 4FTUA 2OFUA 4MXOA 5JMSA 3WBLA 5LQFA 3EYGA 3PYYA 4BTKA 3PG3A 5H8BA 5EOBA 3RMFA 4C37A 4TYIA 2PULA 3GXLA 3IW7A 4QP1A 3EIDA 4CV8A 3VF9A 1H1WA 1KOBA 5AP1A 5KNJA 3G33A 4L7SA 5HBHA 2ZM1A 3R8ZA 4L9IA 3RHXA 4EH5A 2XS0A 3IDPA 4IM0A 5EI6A 4WSQA 3ORLA 3FMKA 4J8MA 5IUIA 3RAWA 2UZBA 3ZHPC 4CGAA 2PE1A 3COKA 4C36A 3TI1A 4GVJA 3CSVA 3ZZEA 3V8TA 4FEVA 4F63A 2BILB 5EQEA 4FKRA 1KWPA 3NLBA 2VTHA 3DBEA 3IGOA 5FRIA 1YQJA 2VUWA 3THBA 4IVAA 3RAIA 2EXMA 1LUFA 4RJ5A 4QMPA 4YO6A 3SOCA 5HNBA 3ZC6A 2F4JA 3AQVA 5ETIA 2W9FB 1UU3A 3NS9A 2BTRA 5BVNA 4YLLA 4IE9A 5JFVA 4YLJA 2R4BA 2A0CX 3H3CA 3RALA 2XZSA 2F2UA 3R2BA 2YJSA 4LI5A 4O91A 4QYYA 5E1EA 3HMPA 5E8XA 4F7LA 4R3RA 2EWAA 3COIA 4IB0A 3PPJA 3RVGA 4G6NA 5HG9A 4CXAA 4J7BA 4F1TA 3WF5A 4RJ3A 3HV3A 4D2VA 5HCXA 3UGCA 4C2VA 5KMNA 3QF9A 3NZ0A 4B7TA 4CKJA 1OL1A 3A7JA 2CLQA 3LAUA 2IJMA 4WRGA 3DFCB 2QO2A 3IOKA 4FOCA 5CF4A 3ACKA 2B53A 4NM3A 3VS0A 5M51A 4PQNA 3DJ7A 1H26A 4O1PA 4R78A 3NW5A 4XCUA 1WBNA 1DS5A 4QYHA 2A27A 3JR1A 5IUHA 5I4NA 1OKZA 2HELA 3U9NA 2IO6A 4C8BA 3PE1A 4W4WA 3F3VA 3U51A 4L3JA 5A4EA 3UBDA 4O96A 2BALA 4Y85A 5EM8A 2XIYA 4C3PA 4BKYA 3L9LA 4FKPA 3G6GA 3QD0A 4FYNA 4N70A 2NRUA 4O0UA 4RFZA 5JQ5A 5AUUA 2I0HA 4KD1A 3MFUA 3BBTB 1ZWSA 4E5BA 5LVPA 4FV5A 4BI2A 3Q9YA 4FV4A 5BUEA 4RGJA 1J3HA 2ZDTA 2YIXA 5EYCA 2DS1A 2V22A 4HYUA 4WBBB 3DAJA 5AUTA 1A9UA 3R9RA 4YJVA 3LOKA 4RJ8A 5C4KA 3MVLA 4UWCA 2PVKA 4DFXE 1VYZA 1ZYLA 2R0UA 2ONLC 2RFDA 1XH8A 2VWIA 3W8QA 2E9PA 3S00A 5E8WA 1Q8YA 4EYMA 4L45A 4C35A 3TWJA 3TUBA 3U54A 3OY3A 3PSBA 4TTHB 4UZDA 2QOOA 1IRKA 3ITZA 3KL8A 3OY1A 2R3LA 4ANLA 4DFYA 2BFXA 3HDMA 4IX3A 5KX8A 3ZONA 4O7VA 3Q6UA 3KA0A 2G2IA 4GKIA 4NIFB 5JFXA 3B2WA 3POZA 4IAKA 1XQZA 4GK3A 4A9YA 5GJFA 5HQ0A 5M44A 2XKEA 5H3QA 3ATTA 2PMIA 2VZ6A 2A1AB 4IJ9A 3SKCA 3ZTXA 4DTAA 2Z2WA 5DR9A 5FM2A 5CEMA 4W9WA 3TZ7A 2H8HA 4OTIA 5DNRA 2XRWA 5BVFA 3FYJX 4EOIA 3IW6A 4S34A 4DEAA 5D1JA 5CAOA 4XG6A 5AUWA 2UZDA 3OC1A 5L3AA 4QOXA 4I6FA 5CASA 2OU7A 4LUDA 3F7WA 3QL8A 4NZWB 3UQCA 3C9WA 5FEQA 5A4TA 5I9XA 4PTEA 4CQEA 2C6OA 4F9WA 2I1MA 4Y72A 3EZVA 3QCXA 4V0GA 3IW4A 4IDVA 4K9YA 2P55A 3KXGA 2HXQA 4L52A 5AR8A 4C34A 4BCGA 5EDRA 3CTJA 1WCCA 3D15A 1H1QA 4FTTA 5TOZA 4X3FB 2G2FA 3CD3A 2BAQA 3TACA 2Y6OA 2PUNA 1Y57A 4PP7A 3P5KA 1MRUA 5FTGA 4QP7A 2YDKA 3NUPA 3UYTA 4RJ7A 5J7BA 3GENA 3VS7A 4IADA 2JAVA 3BBWA 4RVTA 2C47A 2XKDA 3PG1A 2WGJA 3UP2A 5A4LA 2XCKA 5J79A 3RZBA 5CVGA 4G1WA 3LJ2A 4BIEA 4EOQA 3A4OX 3QLGA 4MNFA 3BGQA 3EFJA 4FODA 4U79A 1E9HA 5DBXA 5A6OA 4FZ6A 2V5QA 2CPKE 3R83A 3QQHA 4A9RA 4AA5A 1H1RA 1KE6A 5HBEA 4Z7GA 4LMUA 2A2AA 4D4RA 2WIPA 4EK4A 4CZYB 5BQ0A 4ASZA 3PVUA 4EC9A 3BU3A 1W82A 4O7LA 4HCUA 3Q60A 4BIBA 5JQ8A 2BDFA 2LGCA 3O51A 3DOGA 3UDBA 1Q8UA 4QPSA 3OCGA 3VO3A 5J7HA 5JH6A 4ZTNA 4Y73A 3KK8A 3N9XA 4IWPA 3CXWA 1P4OA 2CGVA 2Y4IC 3HP2A 4FT3A 4BDEA 4BRXA 3PXZA 4BZNA 4O86A 2PZ5A 2WPAA 3IOPA 2WTKB 3MH0A 4K0YA 4H05A 2EB3A 4KUJA 4CV9A 4OW8A 3UOHA 3FMDA 3UC4A 3LXPA 2GPHA 3OWPA 2PL0A 3R9DA 1KE8A 4D28A 3ZFYA 2VTPA 2JFMA 4X6QC 4ANSA 3TKHA 1J7LA 1IG1A 3ODYX 5LARA 4BCJA 4EQUA 3II5A 4FR4A 4FSYA 3CGOA 3R6XA 3C0HA 3HEGA 3ZZWA 3VUTA 4OT6A 3MN3A 4R77A 5FDXA 4F08A 2XIZA 5JN2A 4OR5A 4ZY6A 2GSFA 4K2RA 4PNKA 4ZAUA 4CSVA 4O7SA 4YJRA 5HU9A 1XWSA 2GFCA 4PMPA 3WZEA 1NW1A 1SNUA 1Q4LA 3OT8A 3QYWA 5LVNA 4LG4A 2XNMA 4DHFA 3RP9A 3R7GA 3VW6A 3AMAA 4JT3A 4UXQA 1ZYDA 3U4UA 3D5VA 4KIKA 4ZLYA 1JSVA 3BYSA 3E7OA 2XNNA 4KBKA 2OJ9A 3BGZA 4FSQA 1PMNA 4O22A 3PIZA 3DGKA 5ANDA 2UZUE 2WMRA 3HUCA 2E9VA 2XCHA 4HZRA 4RWIA 4JQ7A 4AQCA 4F9CA 2AYPA 4EQMA 4D0WA 4FSRA 3F5XA 4ITJA 3TTJA 3T9IA 4FKUA 4CQGA 4DEIA 3KMMA 3RPVA 5GZAA 1V0BA 5L6WL 2F7ZE 3CP9A 3FZ1A 3UE4A 3ZEWA 4FIHA 3SVVA 5AMNA 2QQ7A 4ZS0A 4RIXA 5CLPA 3NYNA 3PXYA 2BUJA 2YLEA 5ETCA 3ZYAA 4KKHA 4AACA 2B0QA 4DFUA 4KSQA 2HZ0A 4YNOA 4AFJA 5LVLA 3V5WA 2BRGA 4L67A 5FLFA 1DAWA 1Q97A 4HVIA 4RIYA 3VJNA 2X9EA 5CSWA 5ANIA 2R3NA 4MXZA 4MXXA 5DRBA 5F94A 2R3FA 4I5CA 5IA5A 2CMWA 5BVEA 3R9OA 4E4NA 1YWVA 3AGMA 1E1XA 4ZTMA 4GT5A 1MQBA 1PXIA 3JXWA 5HX6A 5FXSA 4JQ8A 4EH4A 2JKMA 3EFWA 3GQLA 2YEXA 3NGAA 4AW1A 4TNBA 4I5MA 3VHKA 3QBNA 5B2LA 2OF2A 2CHLA 4LGGA 4CFFA 4QMNA 3OOGA 3MI9A 1M17A 4KIPA 4EH8A 2OI4X 4NTSA 3EQFA 3UMXA 4JX7A 4MYGA 4BC6A 2PE0A 2UZLA 1O6KA 2E9NA 3QX2A 3NUAA 3OF0A 4ZY4A 1PXLA 3ENMA 4GV1A 2OIQA 4N57A 2CN8A 4MX9A 2IPXA 3WZDA 3F2RA 4BIDA 2XK7A 4M69A 4QYGA 4RIOA 2KULA 4WO5A 5HCZA 3RZFA 4AGDA 3TDVA 2ITVA 3FSKA 4KINA 1PJKA 1ZYJA 4TWOA 2YDJA 4GK4A 2GS6A 4RBLA 4ZJJA 4MHAA 4PX6A 1Q8TA 5DHJA 5CY3A 3VUMA 2WTIA 4BYIA 2ZJWA 3TM0A 3P1AA 4DITA 2HZNA 4DCAA 4AW0A 4IZ7A 5BVDA 1J91A 4QMYA 1JVPP 4V0GB 5C9CA 2O5KA 2ITTA 4U9AA 2WQOA 4YZ9A 3PDTA 3AC4A 1OL6A 3RNYA 3FEGA 3VRZA 4ARKA 4W4XA 3R8VA 2C30A 2Y7JA 2ITNA 3W16A 4D4VA 2OJGA 4LOQA 4TL0A 3CGFA 1I44A 3MPMA 2WMXA 4XG8A 3HV4A 5A4QA 3DAEA 2BZHB 1IA8A 4BZOA 4RLKA 3CJFA 4I93A 4F1MA 2VTSA 1WZYA 4RG0A 2W96B 2PUPA 3R7UA 3MB7A 5AFVA 4EOPA 2ONLA 4BTFA 3GFEA 4Y83A 2PVLA 1MUOA 5CF8A 3BX5A 1RJBA 4LRMA 4Y5QA 4MXCA 1Q8WA 2CKEA 4ACDA 3NX8A 4QO9A 4FA2A 4ITIA 4M3QA 3BLQA 3LFBA 3R63A 4XV1A 4ORKA 3TZ8A 4IZAA 3ORMA 1V1KA 3H0ZA 5IH5A 4BI1A 2ZM4A 3UG2A 2YFXA 3D14A 4BDFA 5EYDA 3WIKA 4RJ6A 3HAMA 3NYVA 4JX3A 3HX4A 3QXPA 5I9VA 4GVAA 2BROA 2I0EA 1OPLA 4HCTA 4K77A 3V6RA 2ZV2A 3PIXA 4C4HA 4ZY5A 3HMOA 4AW2A 4QPAA 5IQIA 3IQ7A 2R3OA 3GUBA 3U87A 4N4SA 2YM8A 3R8LA 1YHVA 3QQLA 4IHPA 5AIRA 2Q0BA 2G15A 3RGFA 4GEOA 2OF4A 4ALVA 2W99B 4BCQA 2XUUA 2IW9A 3R21A 3VUDA 2Z7SA 4ERWA 3NW7A 5BVOA 4USEA 3FZPA 4NJ3A 2V55A 4D5HA 4NUSA 5IEVA 4ZLZA 5HTIA 4YSJA 4BY9E 3QTSA 1XJDA 3ZLYA 4DT8A 2VTIA 4WUAA 2QVSE 1ZY5A 5FG8A 3LXKA 2O2UA 4O0WA 2GNHA 1ZMWA 4H3BA 3O71A 4KABA 3WF8A 4V04A 4JG7A 2R0IA 4AGCA 2F2CB 4YZCA 4F0GA 2GNGA 5TKDA 3MTLA 4TYHA 4X2KA 2GFSA 2R3IA 3AMYA 3FMEA 4KIKB 5EDPA 4F6WA 5HLWA 1PXOA 3F5PA 3QTWA 3F2NA 4FK3A 3FZOA 5ANEA 5K4JA 5AJQA 5BVKA 3QUPA 5EW8A 5AUVA 4ALWA 3QRJA 4EYJA 5IISA 4TRLA 4YJPA 2A4LA 2C6IA 2JLDA 2VTJA 2RL5A 2ERZE 4OUCA 2VWZA 3PJ8A 3TDWA 4O6LA 4YZNA 1NA7A 4XG4A 4BGQA 4IACA 2OBJA 4YTCA 4C4IA 4QP4A 3JUHA 3TJDA 3IK3A 4ACCA 1FPUA 5CU2A 2XK6A 3F3UA 4LV8A 1ZRZA 5GJGA 4RIXB 3EB0A 2V0DA 3FQEA 4PDOA 5L6OA 5EK7A 4FE2A 1CKIA 5HOAA 4WNKA 4C3FA 4QP6A 5EKNA 5CF5A 5CF6A 4H58A 4DINA 4RIYB 4JBOA 1H28A 1FMOE 1GJOA 2V62A 2QONA 4XP3A 3EN9A 4JQEA 4P2KA 4MBLA 2JKQA 3FXXA 4ZSJA 3VN9A 2R5TA 3UZTA 3FZRA 4FKTA 1RDQE 2YM5A 1KE5A 3PZHA 5FTQA 1O6YA 3LM5A 3PXQA 4KKGA 2C5YA 4A9TA 3S1HA 2XK9A 4MVFA 3EL8A 4IC7A 1R1WA 4PMMA 4QMQA 1LR4A 3Q2MA 1ZAOA 2O64A 3QHWA 2XKFA 1WBTA 3FHIA 4MWIA 4U80A 5C8MA 1WBPA 3RKBA 4RX5A 2YIRA 2C5VA 2VV9A 2VO6A 3Q04A 4X2GA 1TQMA 4XBUA 4L42A 3GU8A 3Q4UA 2CGUA 1YVJA 4R5YA 2ITOA 1BI7A 1YI3A 4U40A 5AAFA 4O2PA 4M69B 4FTIA 3MPTA 2X4FA 5JSMA 3H9RA 3BU6A 2R3KA 3NUUA 4XRLA 3QYZA 4NW6A 2QG7A 3D83A 3RWQA 4I20A 1J1CA 4D2TA 2FSLX 4ASXA 4EOJA 2IZUA 3MFSA 4YUQA 3PY0A 5AUZA 1PKGA 2P2IA 3NYOA 4K8AA 4L6QA 3RAKA 3N4TA 3ULZA 4F65A 1H1SA 3ZCLA 3R1YA 4YZMA 2YZAA 2VWYA 2C6KA 3HMIA 4RFMA 2OLCA 1LPUA 2PTKA 2VGPA 2R3MA 4IAIA 4C33A 4G2FA 1LP4A 3C4WA 5AUXA 5GNKA 4CFWA 2QU6A 2XEYA 3IONA 4ANMA 3CIKA 3KXMA 3PRFA 5E90A 4F6UA 3PWYA 5E91A 4BHZA 3QTUA 3G0FA 5AP5A 2VX0A 4AT3A 4C02A 3FI8A 4UV0A 2JEDA 5HORA 4BCNA 4RLLA 5DR6A 2Y6MA 1ATPE 4G3FA 2PMLX 3MFTA 3OTUA 3UQGA 4CFUA 5L2IA 4DTBA 1ZYSA 3W1FA 4MH7A 1XR1A 1ZOGA 2ITUA 1A48A 3IPHA 3QC4A 3VS1A 5C8NA 2C68A 4QD6A 1GZOA 4FKJA 1PY5A 5M09A 2R3RA 2OSCA 4A06A 2XF0A 3R0TA 3UTOA 4YGAA 2ITZA 5A6NA 4XOYA 3F69A 3H0YA 1IA9A 2HZ4A 2W1ZA 3DNEA 4AN9A 3E92A 5DEWA 4D2PA 5M06A 3P79A 2P2HA 3FHRA 3FL5A 4OT5A 4DN5A 4E7WA 3BE9A 3C0IA 3UOJA 2H34A 3O8PA 4FEUA 1B6CB 5FD2A 4CFXA 4DLIA 3IDBA 4QTDA 5CU6A 2HY81 1PYEA 4F6SA 1XHAA 1CSNA 3WI6A 1QPCA 3EN7A 3QUEA 4NM5A 3MTFA 3FXZA 4CYIA 3SD0A 1W98A 5IQDA 1Q3DA 5IMXA 2RKUA 2XK8A 3I60A 5EYKA 3CC6A 2XJ2A 4FV1A 4S33A 5M57A 2IVTA 2Z7RA 2I40A 3DB6A 4CMOA 4DFNA 3RCJA 4QTEA 4GIHA 4WA9A 3HECA 1FINA 3BI6A 4D4SA 2XNBA 3K3JA 3FV8A 1YHWA 4IWDA 4Z55A 2J5EA 1Y6AA 3N4VA 5IUGA 5DMZA 4FKLA 4WHZA 1WVXA 2C0OA 3R00A 4ZOGA 1NT2A 5BYZA 4BTMA 2PZYA 1P5EA 4BDCA 2WQEA 1OITA 3H9OA 2I7QA 4RVLA 3MH3A 5LWNA 4FG8A 2F9GA 4WSYA 5KZ0A 2O8YA 3OWKA 5CWZA 5EM6A 4V01A 3PUPA 2YDIA 2QOIA 4KWPA 4AAAA 1OVEA 2JKOA 4QYFA 4DGOA 3LCOA 4FSWA 2PVRA 2RF9A 3QWJA 5GIPE 3R2YA 4XH6A 1XH9A 4TYHB 4JLCA 4Q5EA 2F49A 2WNTA 3R7VA 2UW6A 4APPA 2GHGA 2X8IA 2RSVA 3QQGA 3BHTA 1FVVA 1XH6A 3W2SA 1CKPA 4XG2A 4PRJA 4O0SA 3N51A 3PSCA 4IVCA 4XS2A 4O7WA 3QUDA 1OBDA 4AFEA 3C1XA 2JIUA 2J50A 2WMWA 4FKGA 5HG7A 3RM6A 3ZBFA 1SVEA 5C26A 3R30A 2VGOA 2PWLA 2H6DA 4FKIA 3C4FA 4EH3A 4QMVA 3TZ9A 3VJOA 4F99A 5BYLA 3GU7A 3MIYA 2W1FA 4FEQA 2BCJA 4FNYA 2Y4IB 3WZUA 3BHHA 2WTJA 3V5QA 3AOXA 3POOA 1UU7A 4L68A 3LLTA 1OIRA 3MGYA 3Q3BA 5FGKA 4IC8A 3QC9A 4YPSA 4BYJA 1YHSA 1ZLTA 2XB7A 4FK6A 4KIOA 3U6HA 3CPBA 2IG7A 4S2ZA 2XBJA 5DI1A 4EONA 4J8NA 5AM7A 4DTKA 2ITYA 4YZBA 3QQJA 4RSSA 1H24A 1UWHA 5CZIA 5DOSA 1M2PA 2ZB1A 3ZSHA 4CVAA 1LEZA 3A2CA 2JGZA 4JDJA 5LCKA 3DTCA 3W32A 3KKVA 3ZXZA 3O2MA 3KULA 4B8LA 5CT7A 3CQEA 3HA8A 4CMTA 5CEOA 1OZ1A 4AA0A 3R22A 3NCZA 3O50A 3A99A 5DG5A 5CAQA 3FWQA 3PJ3A 4WG3A 2W4KA 4FKOA 3SAYA 3LFSA 5IQBA 4ITHA 3FLYA 4WRSA 1WAKA 4KKEA 5FQDC 4LGHA 3GCVA 4FSMA 4J52A 2VX1A 4AG8A 4IAFA 1JSUA 1WBSA 3UNJA 5I9YA 1U59A 3H30A 5C27A 2IVUA 4X21A 3V5JA 2C69A 3ALOA 3SLSA 3HUBA 5GINE 2PSQA 2QLQA 3PLAE 4C2WA 4FBXA 3R7OA 4FT9A 3V04A 3HV7A 2X39A 2NP8A 2P3GX 2W4JA 5IA2A 1OB3A 3MIAA 1UKHA 4BCIA 3CLYA 3AXWA 1BUHA 3SX9A 3VUIA 3ZSIA 3B8RA 4CYJA 5ANGA 4FTNA 5AAGA 3OHTA 4W8EA 1YWNA 5JKGA 2CJMA 2PMOX 4EK3A 3JVRA 4HJOA 3DZQA 4GG7A 1U5QA 5EG3A 5CSXA 4BBMA 4N6ZA 4RX9A 3GC8A 5F4NA 4GMYA 2CNQA 2YM7A 2NPQA 2VU3A 3F3ZA 3FMHA 4TWCA 4PF4A 3W2OA 1FBNA 2QC6A 2FGIA 2WU6A 5BVWA 3RBWA 4A07A 3LW0A 4OTQA 5DE2A 3C51A 2YIYA 1NVSA 2J0LA 3DKGA 3RNIA 5A54A 3QD3A 5CI6A 4Y5HA 3HRBA 1Q61A 3UG1A 4C57A 1YXUA 4KA3A 4OTFA 2VRXA 3CY3A 5ANOA 2HK5A 4UYNA 5L6PA 3DBFA 2BRNA 3AT2A 1KOAA 3EFKA 1APME 4KS7A 2R3HA 5M4IA 2X6DA 2WTVA 2REIA 2GS2A 5M55A 3W8LA 5HU3A 1VJYA 3QTXA 3LHJA 3EQIA 2VO3A 4YBJA 1O9UA 5AP3A 2Z7LA 2R9SA 4KS8A 2JIIA 2J0MB 5L8JA 3VUHA 3CPCA 4MAOA 5ITAA 4A4LA 2WQNA 5EKOA 5KZIA 3UIUA 3VF8A 2WTDA 4BKJA 3QZFA 3VVHA 3ENHA 5FBOA 4GFGA 4PL3A 4L3LA 2PZIA 3RAHA 5L2TA 3ZOSA 4OTGA 2DYLA 3D7TA 3OWLA 5CU4A 1XBBA 5HLPA 4F7NA 5IDNA 3R8UA 4RPVA 2C4GA 3KMWA 3MDYA 2ITQA 3WOWA 3ZRKA 4IX5A 4XV9A 5M4CA 1HCKA 3NIEA 4BFMA 1XO2B 3BKBA 3F2AA 1H1PA 4XG9A 1ZY4A 3RJCA 1IASA 3UPZA 2QOQA 2BVAA 5DRDA 5HE2A 4RX7A 2I6LA 5CENA 4AOJA 4O21A 1Q3WA 4JL9A 3K3IA 1FMKA 4FZFB 5BMMA 3SOAA 4EBWA 3BU5A 4Y46A 4C58A 1W7HA 3GOPA 4FTLA 4ZZNA 1U5RA 2PVMA 2W06A 2X7OA 3KRRA 3E3PA 5HIBA 4EUTA 4EK6A 3A8WA 5AR4A 4UWBA 3PXFA 5L2SA 4DGLC 1E1VA 3ALNA 2G1TA 2OGVA 3KRLA 3M11A 4HGLA 3PSDA 5AV3A 4BDKA 4F09A 1YOLA 2UW7A 4O0TA 3U55A 5B2KA 4ASEA 2IZSA 4EOOA 3RM7A 4GH2A 5FWKK 4ZSEA 1GZNA 2FSOX 5CT0A 3UVRA 2YM3A 2JDRA 4JOAA 3P4KA 1IAJA 3DZOA 5AR7A 3SXRA 5J5SA 3EQCA 3U6IA 2R3QA 1J7IA 3FPQA 4KRCA 3LPBA 4E3CA 1O6LA 5JGAA 2O3PA 2H96A 2W1IA 3OCTA 2WXVA 3F3WA 2J9MA 4UZHA 3CY2A 4IW0A 4ZTSA 4JBPA 1JAMA 4F4PA 4UMQA 3LCSA 3DKCA 2J4ZA 2QR7A 3M2WA 5DLSA 5KUPA 3OBGA 5DEYA 3DK6A 1YI4A 2ETKA 2EVAA 3CR0A 1QPEA 4I22A 3ROYA 3W2CA 2GNJA 4RQVA 3GCPA 4CLJA 3KXZA 4O0VA 2B1PA 4RWJA 2BMCA 3NDMA 3ZO1A 4U44A 4F9BA 3FLQA 3FAAA 4U81A 3PWDA 3MESA 3DCVA 3V5TA 4Y8DA 2FYSA 4YP8A 3BPRA 3EQPA 2HENA 3KULB 4XOZA 5E8YA 3C4ZA 3MW1A 3NNXA 4ZK5A 3TNQB 4B6LA 4RC2A 5J1VA 4D2SA 3W55A 5HVKA 2OO8X 1S9IA 4HYSA 3VBXA 1JQHA 3TNIA 3MJ2A 2WZJA 4ANBA 3Q96A 1REJA 4FV8A 3ZM4A 1J7UA 5A9UA 3L8SA 4UALA 5GZ9A 2PHKA 2Z8CA 4TKSA 4FUYA 4CRLA 1AGWA 3QRKA 2WOUA 2UW4A 2CCIA 3AD6A 3R9NA 5D9HA 3TEIA 4JG6A 5IH4A 4EJ7A 4UMTA 5H9BA 2VO7A 3KFAA 3ORXA 2IZRA 3S3IA 2VWXA 4JXFA 2X8EA 4IB3A 3FY0A 2WELA 4DG3E 3UPXA 3PRIA 3QGYA 2UVXA 3HNGA 3NRMA 4E6CA 5M56A 3KREA 4FEXA 4IZ5A 2ZMCA 3MBLA 3CBLA 1H0WA 3I81A 1PXMA 2C5NA 4GJ3A 3KGAA 4L7FA 2A19B 3WF9A 2X1NA 4YC8A 2C6DA 3CQWA 1W84A 3EH9A 4DGGA 5GHVA 4HVSA 3QLFA 3V5LA 4L8MA 2YIQA 4PP9A 2ERKA 3OFMA 5K5XA 2BRHA 5F1ZA 3NCGA 5J9LA 3DPKA 5HVYA 4M68A 3ETAA 5LXMA 5HHWA 5AV1A 2OK1A 4K6ZA 5JZNA 2GHMA 3VQUA 2GQRA 2EUFB 3LLAA 2VTQA 3TJCA 3NNWA 5CAPA 3RPRA 3QZIA 5CNNA 3Q9XA 4HVDA 3C5UA 2B7AA 5HICA 2WU7A 3ANQA 4B99A 3E87A 2VN9A 2PPQA 1JKLA 3QQFA 3TTIA 3R73A 3DT1A 4O1OA 1KV2A 2WMSA 4IIRA 4IZYA 5G1XA 3NR9A 5H2UA 3B8QA 4JJRA 3FDNA 1CDKA 3OCBA 3PJCA 3UO6A 4EC8A 3QFVA 4X3JA 3BELA 4NH1A 1Y91A 4BCMA 4MF0A 4GT4A 1OBGA 4FOBA 1HCLA 4EZ3A 1H00A 3MA6A 5CYIA 5J5TA 3QTZA 3ZLSA 4YLKA 3R1SA 4PNIA 5DT3A 4YMJA 3VBQA 5AAEA 1SNXA 1H8FA 2GTNA 4O0YA 3D7TB 4IWQA 4F70A 4DA5A 5DA3A 3K5VA 3OUKA 3KXHA 4QMMA 4C0TA 2XEZA 3P23A 3R01A 3LFAA 4O6EA 4DCEA 4FT5A 3ULIA 4F64A 3UQFA 4R1VA 2OFVA 4U41A 2QODA 5AM6A 5E4HA 5EHLA 1Y6BA 1XBCA 2J6MA 4IFCA 3ANRA 3DA6A 5F20A 5HTCA 4CTCA 2R7IA 3PA4A 4R3CA 3L1SA 4PPBA 3AC8A 4I1ZA 3IECA 1YOMA 3QRIA 4JNWA 3F3TA 3C4XA 4FUXA 4RIWA 4O38A 2OW3A 4L43A 2OJFE 4YNEA 5CSHA 3P7CA 5ETFA 4B8MA 2E9OA 3QHRA 1M2QA 4HGTA 5T3QA 1MQ4A 3RWPA 2OZAA 1B38A 3OG7A 4OTPA 2C3LA 1OUYA 4IM2A 4QMZA 2UW8A 3ZDIA 3FE3A 4Q9SA 3AC2A 3UO4A 5CEPA 4EZ7A 2WEVA 4P7EA 4D55A 4M66A 5H8GA 5J9ZA 4X7QA 4DLJA 2G2HA 3QTIA 4PDPA 4FIIA 3LQ8A 3EZRA 4J99A 3LJ1A 4NTTA 2B9HA 3PVWA 3WZJA 3MS9A 1KUTA 2QG5A 3DJ6A 1SVHA 4QMTA 3CKWA 1NVRA 4DG0E 1VR2A 4CEGA 3H10A 4YSMA 4M12A 1M14A 1Z9XA 3PZEA 5AADA 4FL1A 4PV0A 3HAVA 2OICA 3AC3A 5AP2A 3FKLA 3L8XA 4M84A 4CFVA 4NU1A 3RHKA 4ASDA 3QKLA 1PXPA 4XEYA 2B9JA 5AP0A 4II5A 2OZOA 4M0YA 4FICA 5I9UA 5C01A 3W2QA 3C5IA 5I9ZA 1UWJA 2F7EE 4C61A 4A9SA 4M67A 2ZM3A 5BX0A 2EXEA 3RCDA 3DQXA 4MEDA 3GT8A 4I3ZA 4DFLA 5E8VA 1Q99A 2YACA 2XIXA 4TYGA 5ACBC 3W33A 4GIIA 3GC9A 3MY0A 3PXRA 4YJOA 4YJUA 5DR2A 3BWJA 4M7IA 5IQEA 1R3CA 1R0EA 2YWVA 3ZRLA 2RG5A 2XJ0A 4GJ2A 4XG3A 3TNPC 3ZBXA 2XMYA 3CTHA 5C4LA 5KHXA 3QZGA 3NAYA 5EHOA 2YERA 3DAKA 1OKYA 1RE8A 4XP2A 4ZSLA 4BWPA 5BUJA 3LFCA 4U3YA 4DYMA 2SRCA 4BB4A 2H9VA 2HCKA 4PWNA 2BDWA 3FYKX 4UWYA 2XRUA 1GIIA 2X9FA 1URWA 2HYYA 4FL3A 5TF9A 3SDJA 3Q53A 3ORZA 2VO0A 4NKSA 1DAYA 3A8XA 4TYEA 4YJNA 4AXAA 1S9JA 4I24A 4QT1A 1OM1A 4R5SA 5LJJA 2ZOQA 2PVFA 3NNVA 4OBPA 1XKKA 3B2TA 4CRSA 4EWHA 5HZNA 1IR3A 1JSTA 5J8IA 3AD5A 3R04A 5M4FA 2BPMA 4WT6A 5HO6A 4AT4A 3ZO4A 4IVBA 3WYXA 5HESA 1B39A 3E88A 3MY5A 4XUFA 4XHKB 4AOTA 2AUHA 4X0MA 4BDDA 4G6OA 2ZMDA 4GG5A 3VBWA 2GDOA 4FVQA 3TCPA 4P90A 3UC3A 4O0RA 4OAUC 5L2WA 3OVVA 5A4CA 2X7FA 3COHA 2PUUA 3LVPA 3G0EA 4R3PA 3FLZA 4AGWA 4S31A 4ZMEA 2R3GA 3AMBA 4C38A 4QTCA 5FP6A 5IQGA 3FXWA 3HMNA 4KSPA 5KMMA 2OH0E 3DBCA 3QD2B 4JIAA 3F7ZA 4GRBA 4BBFA 4DFBA 4TT7A 4ZS4A 2J0KA 3E93A 4GU9A 1RQQA 4MK0A 4FTMA 5H8EA 3SW7A 3KC3A 4M13A 4PL4A 4RVMA 4UN0C 2CKPA 2XJ1A 1UA2A 4MKCA 5E8UA 3DLZA 4MNEA 5KKRC 1PHKA 3D5UA 3TN8A 3KVXA 2UZOA 4AE6A 3OTVA 1W0XC 2YN8A 1OI9A 3BRBA 3I6WA 4QP8A 4QP2A 3AG9A 3ZC5A 5JFWA 2J90A 4YURA 2GU8A 2BR1A 5FEDA 4BWKA 5CEKA 2P4IA 2YLFA 4J97A 2OJJA 2EB2A 1BX6A 3WYYA 5C03A 2QKWB 4CKRA 4AE9A 2YHVA 3QA0A 1QL6A 3Q9WA 4LRJA 4YJTA 4RZWA 3I1AA 3CQUA 2X81A 3KXXA 2HWPA 4IB5A 3VC4A 4A7CA 1MP8A 4FTJA 3E3BX 1JBPE 1K9AA 2WQBA 3HZTA 2HW6A 2ZAZA 4E73A 2OXXA 3DY7A 3NUSA 5HLNA 1REKA 4HYIA 3ORTA 4FI1A 2XM8A 2C6TA 2OG8A 4WG5A 5LMAA 2QLUA 5HX8A 2R3PA 5EM7A 4AP7A 4EORA 1P4FA 2W1CA 4FEWA 3VULA 3GOKA 4FIEA 4MD9E 4MWHA 3ZH8A 4FL2A 5JZJA 4YO4A 3DJ5A 2DUVA 4NM0A 4ZP5A 5HBJA 1BI8A 1OGUA 3UZRA 3OOMA 3WILA 4FSZA 5ICPA 5LVMA 2FB8A 2P0CA 3RK5A 3WE4A 3QA8A 4XV3A 5EFQA 1UU8A 4IANA 4XG7A 3NIZA 3U4WA 4A4XA 1FQ1B 2X8DA 2ACXA 4LOOA 2AC5A 3D9VA 2XNPA 5LMBA 2JDTA 4RIWB 4FTCA 1TKIA 1YXTA 4E4XA 3TV4A 3LCKA 5AP4A 3DXQA 3AC1A 3G9NA 3LCTA 3W18A 2X0GA 3BHVA 3GVUA 4V05A 4FMQA 4D1SA 3RTPA 1X8BA 5E8ZA 2OZAB 5JRSA 2UVYA 2B54A 1JKTA 4CG9A 3S0OA 2HY0A 3ZS5A 2J0JA 4FKWA 3I7CA 4H3PA 4X2NA 3E8DA 4CD0A 3DXPA 4BN1A 4L46A 3O96A 3V8SA 5DWRA 3NPCA 5HD7A 3K54A 4HOKA 2XKCA 2ZB0A 4KRDA 4O27B 1ZOHA 2X2KA 4AZWA 4CNHA 4EH2A 4C4EA 3GP0A 5B7VA 3GU5A 3MFRA 4AW5A 4S30A 4HVGA 1JKSA 3PJ2A 4CG8A 3WARA 4USDA 2CGWA 2C6MA 1WBOA 3TG1A 1PXKA 3SG9A 1OECA 4I6QA 4LMNA 1TQPA 4BR3A 3WF6A 1G5SA 2VTAA 3OW4A 3LMHA 3OCSA 3G15A 4HGEA 4FT7A 4QPMA 2QOFA 2VNYA 3VS3A 4XNEA 4RMZA 2UZTA 2Y8OA 5CU3A 2WEIA 3QAME 3D5WA 3LFQA 4GCJA 1KE7A 3EKNA 4DEBA 3P7AA 2YITA 4M97A 4F1OA 3ERKA 4E20A 3Q4CA 4NWMA 2VTNA 5CNOA 4ONAA 3A61A 5J9YA 1BKXA 3DV3A 1QCFA 4RJ4A 3T8OA 4O82A 2OKRA 3GU6A 3MWUA 4RQKA 5CXHA 4BBEA 3IG7A 4JBVA 3H9FA 3OS3A 4LOPA 4ANNA 1VEBA 2AC3A 2OWBA 2ZV9A 1M7QA 3G5DA 5FTOA 1ZARA 2ITXA 5C8KA 5LCJA 3G90X 2PMNX 1SM2A 3UNZA 4ZJVA 4O7ZA 1G3NA 1SVGA 4DEGA 3CS9A 3HMMA 1UU9A 1MRYA 3A4PA 4G9CA 1H0VA 4M0ZA 2E9UA 2XVDA 2CNVA 4O7YA 4KNBA 4G3GA 1L8TA 2JBOA 1GNGA 3ZUTA 4TPTA 4QMOA 4QQCA 5AUYA 4FG7A 2B55A 2YAAA 3FZTA 2P33A 2YWPA 4G5PA 1J1BA 2GHLA 3BQRA 4J98A 4M15A 2C3JA 2CLXA 3E8NA 4L53A 4U97A 4XBRA 3QU0A 2YM4A 3HKOA 4WIHA 5JEBA 3LCDA 2PVJA 3SRVA 4I4FA 5AX3A 3V5PA 3JPVA 5EHYA 5IG1A 4BI0A 4D4YA 5KBQA 4MBIA 5A3XA 3F5UA 5GZ8A 3PTGA 4FV2A 3DKFA 4G17A 4JDIA 4PMTA 4U3ZA 3BZ3A 5ETAA 5JGBA 2QCSA 5BNJA 2YCRA 3Q6WA 4QQ5A 3ZUUA 4MXAA 3ZRMA 3BE2A 2FSMX 3QKMA 4BGHA 4QNAA 3UMWA 3QQUA 4BCKA 4C62A 3O8UA 2O63A 4ENXA 5IEXA 3VIDA 4EH9A 1OL7A 4MD8E 2CGXA 5DH3A 3SHEA 4CZTA 4MF1A 3KF4A 1DI9A 4RA4A 1PXNA 3FLSA 4MNEB 3QX4A 3DQWA 2JAMA 4O2ZA 4QRCA 1JOWB 1K3AA 5E8SA 4C59A 4EUUA 3UIXA 5IQHA 4ALUA 5HO7A 5AV4A 3QZHA 5M07A 1Z57A 4CCBA 2XIKA 3UO5A 5M53A 5CEIA 3AGLA 2VX3A 3QQKA 2W5HA 4ACHA 4RC4A 3NEWA 1WVYA 3OWJA 3LZBA 4DC2A 5IQAA 2HIWA 4GFMA 3WF7A 4WNOA 4UBAA 1ND4A 4N0SA 3JY0A 4R6VA 3ZMMA 2OIDA 1BL7A 3HRCA 2XNOA 5BYYA 3FLNC 4J1RA 3LMIA 4E26A 5AR2A 3TV7A 5HKMA 1F5QA 4FTKA 4JRNA 3N4UA 1PRYA 4DH3A 3UZPA 4EHEA 3R28A 2BTSA 4NCTC 3KN6A 5FBNC 4TYJA 4KIQA 4AZEA 2GQSA 4MXYA 4HYHA 5L8LA 4WOVA 4PDYA 5IQCA 5CQWA 4TW9A 5AA8A 5AA9A 3ID6C 3C0GA 4ZTQA 2PYWA 1PXJA 3KF7A 3KU2A 4U8ZA 2JDVA 3RK7A 4RFYA 1M7NA 2C5XA 2UUEA 5KO1A 4GFOA 3LFEA 3Q4ZA 4GKHA 3FL4A 3NSZA 2UW0A 3FC1X 3HGKA 4JS8A 3FPMA 4BCHA 3GGFA 3V3VA 4WKQA 5ACKA 2C0IA 3GBZA 5EOLA 3VUKA 4AF3A 4PL5A 2ZV8A 4OBOA 3HA6A 1ZMVA 5E1SA 2C1BA 2QOBA 4QMUA 1XH4A 4ZTRA 2CNUA 3ZLXA 3JVSA 2RFNA 3TKIA 5IMEA 2RFSA 3Q5IA 1CTPE 5IKWA 2QO9A 5DYJA 4EHVA 3P7BA 3KEXA 2Z7QA 1UNHA 5KMIA 3PP1A 3PVGA 4FIGA 3I7BA 4U0IA 3U6JA 3EQRA 2C0TA 2G9XA 3NW6A 1TQIA 2G01A 2BZKB 2WIHA 3IKAA 1OL5A 2BFYA 3QTRA 4I23A 2PU8A 3REPA 4LYNA 2UV2A 1RW8A 4D9UA 4LQMA 4ZSAA 4NT4A 5HEZA 4D9TA 1U4DA 1OUKA 4O84A 1Q24A 4IX4A 4RZVA 5IZFA 2VNWA 2Y4PA 3HVCA 3P78A 3WZKA 2JITA 2GNLA 2W0JA 5HO8A 2F7XE 3QD4A 2X7GA 4AN2A 4EHZA 3L9NA 4IXPA 1URCA 3IS5A 2QKRA 5HIDA 4FV9A 4R8QA 4HVHA 3PA3A 4PPAA 4OTDA 4AS0A 3F5GA 1VYWA 2WKMA 5CQUA 2LAVA 1NY3A 1CM8A 4BDJA 5JFSA 3ZSGA 5E8TA 3BYVA 2O0UA 4UB7A 2W1DA 1UKIA 3F82A 1Y8YA 1YXVA 1OIYA 2J51A 3UJGA 3R8PA 3K5UA 2VWUA 2UW9A 3W2PA 4YJSA 1H01A 3O0GA 3Q5ZA 3ZLWA 4XRJA 5TR6A 4JR3A 4F7SA 3UVQA 3UP7A 3HLLA 1GIJA 4ZJIA 3JYAA 4HCVA 4BZDA 1U46A 4PPCA 5K3YA 5HE3A 3W10A 3F66A 1IAHA 4E6QA 1YW2A 4K1BA 1GOLA 2FUMA 5HG5A 1ZZLA 4NW5A 4IBMA 5DVRA 4I4EA 3VBYA 3O23A 3R71A 2I0VA 1Q62A 3QKKA 4PMSA 3SW4A 3L9MA 3VAPA 2C3IB 4QTBA 5DT4A 1WBWA 3BV3A 2WMUA 5IF1A 3ORPA 2ZVAA 4CFNA 2PY3A 4G6LA 3NUYA 5CI7A 5CEQA 3T3UA 3FZSA 3CKXA 5IPJA 2DWBA 2B9FA 4HNFA 2VTMA 3RPYA 1V0OA 3LFNA 3Q32A 2R64A 3T9TA 4DH1A 3VUGA 1OL2A 1PF8A 4DGNA 1YXXA 4BVUA 3SRVB 3IO7A 3E8CA 1DM2A 4EHGA 1Q5KA 1U54A 5CSVA 4Z9LA 5KE0A 3BWFA 4E6AA 5LMKC 1YXSA 2OXYA 3DDQA 5D12A 4WUNA 5CSPA 3FI3A 4FT0A 3AC5A 5EW3A 4E4MA 5LOHA 2F57A 3L8VA 3DU8A 3IDCA 2X2MA 5A14A 4I0TA 4OAVB 4LGDA 3D0EA 5AV0A 5E9EA 3NVKI 1P14A 2WO6A 4U43A 4DGMA 4ZZOA 2QOCA 3S95A 1F0QA 2Z60A 4L44A 4XP0A 3ORIA 1IEPA 2XNEA 3GCSA 2E2BA 4J53A 4JRVA 3VBVA 3ZXTA 4APCA 4B4LA 5I0BA 3IW5A 1H4LA 4B0GA 3VNTA 5L4QA 3VQHA 3RI1A 4RX8A 3U9CA 3R7YA 4FKQA 5CU0A 2WMVA 3ACJA 3PE2A 5DGZA 5DPVA 4CKIA 3OMVA 4F0IA 3L8PA 1JWHA 2WAJA 4EI4A 4JVGA 3FSFA 2Q0NA 4RC3A 3LKMA 3KRJA 4FV7A 4DEDA 3Q9ZA 2VWBA 3R8MA 5HGIA 4JAJA 4U7ZA 5IA4A 4GYGA 5KBRA 3EN5A 2XM9A 5EYMA 5B0XA 4BWXA 2RIOA 4QMXA 3TT0A 1JKKA 3LJ0A 4WNPA 1W8CA 2EU9A 3HRFA 3GI3A 5D11A 5D7AA 3Q4TA 4Z16A 4C4GA 3WIGA 1GZ8A 2JC6A 4IX6A 4WG4A 3SXFA 4Y95A 2VAGA 3BCEA 5M08A 4EZ5A 4W9XA 3LMGA 3KRXA 3MY1A 5FM3A 5L8KA 3GCUA 5AP7A 5JK3A 3MYGA 5JGDA 4X2JA 5TE0A 4GL9A 3GU4A 2QU5A 3FQSA 2XP2A 5EH0A 3DNDA 5IU2A 3RK9A 2GNFA 2BRMA 3PJ1A 4IFGA 3EMGA 5IEYA 5K9IA 3MJ1A 3E7VA 3WE8A 1PKDA 3G6HA 3C50A 4FIJA 4RA5A 3TUDA 3VHEA 3QRTA 3SQQA 4IB1A 4O81A 2XK3A 3UVPA 2WHBA 4N6YA 3GNIB 3ORNA 2HZIA 3EHAA 3UIBA 5CANA 1XH7A 4O7RA 5K5NA 4RVKA 5E7RA 4P5QA 4BF2A 4I94A 3E5AA 4F9AA 4GU6A 5KKRB 3DDPA 4EWQA 5CAVA 2FSTX 1OKWA 2WD1A 4G5JA 5LVOA 1QPDA 5FXQA 2IW8A 3NWWA 3A60A 4EBVA 3M1SA 3RPSA 5CTPA 2C3KA 3TNWA 5FP5A 2B52A 3BYUA 3KN5A 3KY2A 4K18A 4GT3A 4BDAA 4AU8A 2BKKA 2VWVA 2XYNA 1ZZ2A 4H36A 3TZMA 3ZFMA 3MPAA 3QRUA 4J96A 4OGRA 4TXCA 4UY9A 4AGUA 4NJDA 1QMZA 3MVHA 3V6SA 4D1XA 1XH5A 4DBNA 4C4JA 2VTTA 3NUXA 4AZVA 1NXKA 2XK4A 4FV0A 3D7ZA 3ZUVA 3GC7A 2QOLA 3FC2A 1JPAA 4AA4A 4MD7E 3OW3A 4FGRA 4DE4A 2W1GA 3KB7A 4OTRA 4CT2A 4ZMFA 3EQDA 4NCTA 2CN5A 2JFLA 4RRVA 3UNKA 3LQ3A 1R78A 2W05A 3O7LB 4I5HA 3OEFX 3I0QA 4I92A 1FGKA 4DT9A 4FNXA 4PTCA 1PMVA 3OXIA 4ID7A 4MQ1A 3PPZA 4BDHA 3BYMA 4HW7A 3I0OA 3ZFXA 2JD5A 5C1QB 1KSWA 5T6KA 4EOSA 4HNIA 4E8AA 4NSTA 4FTOA 1BYGA 3R1NA 1LEWA 4LRKA 4PY1A 4K33A 4FTAA 5D41A 4HPTE 3GC0A 2UZNA 4FSUA 4NEUA 4AT5A 5KMKA 2WTCA 3C4CA 5AEPA 5M4UA 3DXNA 3T3VA 2OIBA 4ANOA 3G51A 4XX9A 4X6RA 1FVRA 4FSNA 1UNGA 2CKQA 5TT7A 3TKUA 3PA5A 3MH1A 4DFZE 5KMLA 4BL1A 2JIVA 2WB8A 3GQIA 1CKJA 4IM3A 2PVNA 5EW9A 1OIQA 2ITPA 1WFCA 3O17A 3TNHA 3FMLA 5AV2A 4ZIMA 3FMNA 5F9EA 4YTFA 4ZLOA 4JDKA 2ITWA 1WMKA 4OLIA 4M8TA 5HTBA 5CZHA 2HWOA 1G8AA 4H3QA 4R7IA 4ACGA 3P9JA 3E8EA 4NKAA 2J2IB 5CALA 4ANQA 3QCSA 4W4VA 3D94A 1ZMUA 3CTQA 3C13A 1U54B 4DH8A 3CE3A 3CJGA 3KRWA 3ZU7A 5J95A 2VWWA 4LUEA 4CCUA 1OKVA 2OXDA 4B9DA 4FIFA 3PLSA 4YZDA 3A7IA 2XIRA 5FUTA 1M2RA 2X2LA 4DH5A 4I0SA 5D7VA 3FI4A 2X4ZA 3FKOA 4J95A 5CVFA 3QCQA 4QYEA 5CAUA 3NUNA 4MBJA 3KQ7A 2YABA 4YJQA 5BPYA 4C7TA 2FH9A 5HNIX 5EQYA 5AR3A 4FVRA 4GSBA 4FTQA 5ANJA 3F61A 3KCFA 4YTIA 4CFMA 5A46A 4QQTA 4OBQA 4KB8A 5CVHA 2CKOA 2W7XA 1NVQA 2BIKB 3ELJA 3QGWA 3OBJA 5KMJA 1JNKA 1UNLA 4AUAA 5IQFA 2GQGA 4H1MA 1ZYCA 4IH8A 3VS5A 2ZYBA 2GNIA 5I5ZA 2UW5A 4BDIA 1AD5A 3NYXA 5AP6A 1P2AA 3EWHA 4BTJA 4RT7A 3BV2A 5HE1A 2BZIB 2QHNA 3ZM9A 3DLSA 4DBXA 1FOTA 5ANKA 3I79A 1OIUA 4E5AX 2BAJA 4D58A 4ZSGA 3EFLA 5AR5A 4DF3A 5FDPA 3SG8A 3QWKA 1DI8A 4CZUA 1FVTA 1OMWA 3OEZA 3QCYA 2XYUA 3LXLA 1Y8GA 2IW6A 1KV1A 3AT4A 1SMHA 3DK3A 2W9ZB 3ET7A 2C6EA 3I5NA 3P0MA 2YCFA 3TIZA 1QPJA 4DH7A 3BYOA 3QTQA 1V0PA 2PVHA 4PDSA 4QNYA 3LFDA 3TIYA 3AT3A 4FNWA 3H4JA 3BQCA 2OJIA 4RWKA 4DAWA 4FX3A 2XH5A 3EQBA 5LMKA 4CLIA 3PPKA 4UYAA 4BCFA 5KMOA 4O7TA 2XA4A 4FSTA 4JDHA 4FYOA 3UODA 3UOKA 4E4LA 2J0IA 5CX9A
chains in the Genus database with same CATH superfamily
1UV5A 5CS6A 2GS7A 2YIWA 4X3FC 4PTGA 2FO0A 4YR8A 4GW8A 1BL6A 4QQJA 3FJQE 4IMYA 2JBPA 2W1HA 2YCSA 3DBDA 3DS6A 4BGGA 2DQ7X 3GCQA 2NRYA 2VTRA 4H1JA 3FBVA 3TXOA 1YOJA 3FLWA 3LFFA 5B2MA 2IVSA 4C3RA 5J1WA 3BLRA 3E63A 3SXSA 4EK8A 3FQHA 4WD5A 1T45A 4UMPA 2PK9A 3E64A 4O7NA 3LIJA 2WFYA 3BLHA 3FMJA 3MSSA 4FV3A 4IAYA 4IWOA 5TO8A 1L3RE 5BUIA 1H27A 4LL5A 2RG6A 3PXKA 2J5FA 2PZRA 5L2QA 1ZXEA 4ERKA 3COMA 4FG9A 4D2WA 4QP3A 4G3EA 3ORKA 3EJ1A 4QTAA 5JRQA 3ZEPA 2YAKA 4DDGA 4DEEA 3ZO2A 1R39A 3DKOA 5EI8A 3V8WA 4E5WA 1WBVA 2QOKA 4AZFA 4D2RA 3SGCA 2XNGA 4NK9A 4MQ2A 2BRBA 1H07A 2RGPA 3M42A 4D1ZA 3ZO3A 3Q52A 2WQMA 3HL7A 2PE2A 3VS4A 4R7HA 4P5ZA 2WTKC 2O65A 2GCDA 3F6XA 5HD4A 1VZOA 4GK2A 4TWPA 3OXTA 4JIKA 5IH6A 4E6DA 2J7TA 3EN4A 2X6EA 3NNUA 4EOLA 5DT0A 3S2PA 2ZV7A 3OUNB 4EH6A 3EOCA 4QMLA 3JS2A 2C5OA 3CEKA 3HV6A 3R02A 4L3PA 4QEBA 2JKKA 1W83A 3IW8A 4TN6A 3IGGA 4HPUE 2IWIA 5HCYA 4BKZA 4AZTA 2XBAA 4FKSA 2EXCX 3MVJA 3LQ5A 4YC6A 2VTLA 1KE9A 5E92A 2FVDA 4WBOA 1PW2A 4HZSA 3L9PA 4I6BA 4NFNA 4GYIA 4IQ6A 4YHTA 5K4IA 5LWMA 2UVZA 5HNGA 4IEBA 4QP9A 4I5PA 4EH7A 4JG8A 2UZVA 3OZ6A 2QI8A 2W5BA 4UMUA 1WVWA 2R7BA 3EQHA 4TY1A 2ETRA 2WMTA 2BIYA 4I41A 5J87A 3A7GA 4JBQA 5JT2A 4U42A 4FZDB 4R1YA 4YC3A 3VWAA 4FV6A 5HG8A 3GEQA 2R2PA 5GIOE 4DEHA 3LE6A 5BMSA 1T46A 4XMOA 2HW7A 3PFQA 4O83A 4E1ZA 4AX8A 4O0XA 2B9IA 4FC0A 4LFIA 3R7EA 3MH2A 3GFWA 3RINA 3VRYA 3EKKA 3LXNA 5G6VA 3V51A 3VS2A 3HDNA 3D2KA 3NFGB 3A62A 3EYHA 3ODZX 2Z02A 5IA0A 4XLIA 4JI9A 3TUCA 4JR7A 1JLUE 3OROA 2I0YA 2YA9A 3OP5A 2Y9QA 1FGIA 1PYXA 4L00A 4OTHA 1A06A 4IDTA 1K2PA 5K0KA 3HP5A 1R0PA 2UZEA 2WMBA 2BZJA 2JDOA 4XV2A 4BICA 5T68A 1YDTE 2W4OA 2NO3A 3SA0A 4USFA 1YI6A 4F0FA 3I4BA 4AWIA 5IA1A 5DN3A 1BMKA 1HOWA 4J71A 4OTWA 2CCHA 3F9NA 4XYFA 2WMAA 4ZZMA 2PZPA 4G31A 2YCQA 3MV5A 3OD6X 4Q2AA 3BEGA 1H08A 3P08A 3DK7A 4BHNA 1GIHA 5AX9A 2B4SB 1BLXA 1YWRA 2YJRA 2W17A 4GUBA 4YBKA 3DBQA 4EEVA 4GUEA 4F78A 4P4CA 2OH4A 3F88A 5I3RA 3EL7A 2VD5A 3I6UA 4ZEGA 1F3MC 4QMSA 2UW3A 3AD4A 2QD9A 3BGPA 4IVDA 3HYHA 3I5ZA 4EL9A 4RWLA 4FZ7A 2JDSA 3CD8A 4U45A 4AOIA 1PMEA 3FUPA 4TWNA 4HGSA 1Z5MA 2YM6A 3VS6A 2ESMA 2GTMA 4LV5A 5HVJA 4AZSA 1G8SA 4FKVA 5I3OA 2BHEA 1Q8ZA 3P86A 4A9UA 1GZKA 3NAXA 4Q5HA 4R7BA 1AQ1A 1CMKE 2QNJA 4FVPA 2C6LA 4ZTHA 4G3DA 4IAZA 4F9YA 4Q9ZA 3SC1A 2QHMA 2KTYA 4WNMA 4E93A 4ENYA 4FZAB 3W0PA 3C7QA 4IAAA 2UZWE 3DFAA 5HE0A 2CDZA 2IZTA 4CT1A 1EH4A 4KAOA 4UMRA 3KCKA 5EDQA 4EKLA 3NMUF 3D2IA 3EQGA 4BJJA 4NFMA 5HI2A 3D5XA 2QURA 4FGBA 4TNDA 4I21A 3BHYA 2ZDUA 3BHUA 3KXNA 4BCPA 3HV5A 3UYSA 2PUIA 4I0RA 4NL0A 4DG2E 4FTRA 4U6RA 5DFPA 3UIMA 4YU2A 2FA2A 3KMUA 3V01A 4H39A 3CCNA 3K2LA 3OT3A 4G3CA 4GS6A 4BDBA 2Y0AA 4Z3VA 3Q2JA 2R3JA 3KK9A 1YRPA 3TL8A 2V7AA 1TVOA 4XJ0A 4YTHA 4LM5A 3R1QA 4G16A 4EKKA 5KHWA 4NYEA 4JMQA 3JY9A 2BHHA 4A4OA 3O8TA 4JAIA 4ACMA 4C4FA 1UVRA 2HXLA 4AN3A 2IN6A 3U8WA 4LL0A 4YPDA 1H25A 4MTAA 5AIKA 1YKRA 3G2FA 2PVYA 3FKNA 5EM5A 3PIYA 4NIFA 3OXZA 1OPKA 2IVVA 3QALE 1SYKA 1MRVA 2QOHA 4I6HA 2ETMA 5EI2A 4M14A 1Q41A 2WMQA 4PUZA 3QXOA 5FEEA 3S4QA 4YHJA 2YZLA 2NNWB 4D0XA 1GAGA 4QMWA 3GB2A 1ERKA 4XLVA 3D4QA 3E62A 3BEAA 3NVMB 1YDRE 4IJPA 3O7LD 4U5JA 1GY3A 4L01A 4MCVA 4Z7HA 3RPOA 3R9HA 1STCE 4QDEA 4ZXTA 3BL9A 4UEUA 3LM0A 3UOLA 3W0QA 3VBTA 1M52A 3W2RA 3A7FA 3FY2A 1YDSE 3KVWA 2HOGA 2C1AA 5CXZA 4EK5A 3BIZA 2BKZA 2W1EA 4S32A 5IDPA 5D10A 1ZOEA 4X3FA 2QR8A 3FMMA 1PMUA 4F7JA 3DB8A 5K0XA 3PP0A 3EN6A 5I9WA 2BDJA 3TV6A 3MA3A 4NM7A 4CMUA 1SZMA 4K11A 5GJDA 2VTOA 5IA3A 2CSNA 2V7OA 2RFEA 4KBCA 2HAKA 5F95A 4ZTLA 4TZRA 4EQCA 2QO7A 4UX9A 2W5AA 3FI2A 4W4YA 3VW8A 4W8DA 3G9LX 2WTWA 4BDGA 5AWMA 3SV0A 3ROCA 5FXRA 4FNZA 5HIEA 4BCOA 5EQPA 4D5KA 4KBAA 2Q83A 2WOTA 3PY3A 3ZDUA 4FF8A 4EOKA 5KCVA 4CTBA 3ATSA 4YHFA 4G34A 2A98A 3C4EA 4G9RA 3MB6A 3PY1A 2BAKA 4X2FA 4EJNA 2YISA 5DIAA 3DTWA 3MVMA 2GMXA 1XBAA 3A7HA 3PVBA 4EOMA 4UXLA 3R7IA 1I09A 1OPJA 4FTUA 2OFUA 4MXOA 5JMSA 2XAOA 3WBLA 5LQFA 3EYGA 3PYYA 4BTKA 3PG3A 5H8BA 5EOBA 3RMFA 4C37A 4TYIA 2PULA 3GXLA 3IW7A 4QP1A 3EIDA 4CV8A 3VF9A 1H1WA 1KOBA 5AP1A 5KNJA 3G33A 4L7SA 5HBHA 2ZM1A 3R8ZA 4L9IA 3RHXA 4EH5A 2XS0A 3IDPA 4IM0A 5EI6A 4WSQA 3ORLA 3FMKA 4J8MA 5IUIA 3RAWA 2UZBA 3ZHPC 4CGAA 2PE1A 3COKA 4C36A 3TI1A 4GVJA 3CSVA 3ZZEA 3V8TA 4FEVA 4F63A 2BILB 5EQEA 4FKRA 1KWPA 3NLBA 2VTHA 3DBEA 3IGOA 5FRIA 1YQJA 2VUWA 3THBA 4IVAA 3RAIA 2EXMA 1LUFA 4RJ5A 4QMPA 4YO6A 3SOCA 5HNBA 3ZC6A 2F4JA 3AQVA 5ETIA 1TZDA 2W9FB 1UU3A 3NS9A 2BTRA 5BVNA 4YLLA 4IE9A 5JFVA 4YLJA 2R4BA 2A0CX 3H3CA 3RALA 2XZSA 2F2UA 3R2BA 2YJSA 4LI5A 4O91A 4QYYA 5E1EA 3HMPA 5E8XA 4F7LA 4R3RA 2EWAA 3COIA 4IB0A 3PPJA 3RVGA 4G6NA 5HG9A 4CXAA 4J7BA 4O4DA 4F1TA 3WF5A 4RJ3A 3HV3A 4D2VA 5HCXA 3UGCA 4C2VA 5KMNA 3QF9A 3NZ0A 4B7TA 4CKJA 1OL1A 3A7JA 2CLQA 3LAUA 2IJMA 4WRGA 3DFCB 2QO2A 3IOKA 4FOCA 5CF4A 3ACKA 2B53A 4NM3A 3VS0A 5M51A 4PQNA 3DJ7A 1H26A 4O1PA 4R78A 3NW5A 4XCUA 1WBNA 1DS5A 4QYHA 2A27A 3JR1A 5IUHA 5I4NA 1OKZA 2HELA 3U9NA 2IO6A 4C8BA 3PE1A 4W4WA 3F3VA 3U51A 4L3JA 5A4EA 3UBDA 4O96A 2BALA 4Y85A 5EM8A 2XIYA 4C3PA 4BKYA 4AXEA 3BL7A 3L9LA 4FKPA 3G6GA 3QD0A 4FYNA 4I6LA 4N70A 2NRUA 4O0UA 4RFZA 4BJJB 5JQ5A 5AUUA 2I0HA 4KD1A 3MFUA 3WF9A 3BBTB 1ZWSA 4E5BA 5LVPA 4FV5A 4BI2A 3Q9YA 4FV4A 5BUEA 4RGJA 1J3HA 2ZDTA 2YIXA 5EYCA 2DS1A 2V22A 4HYUA 4WBBB 3DAJA 5AUTA 1A9UA 3R9RA 4YJVA 3LOKA 4RJ8A 5C4KA 3MVLA 4UWCA 2PVKA 4DFXE 1VYZA 1ZYLA 2R0UA 2ONLC 2RFDA 1XH8A 2VWIA 3W8QA 2E9PA 3S00A 5E8WA 1Q8YA 4EYMA 4L45A 4C35A 3TWJA 3TUBA 3U54A 3OY3A 3PSBA 4TTHB 4UZDA 2QOOA 1IRKA 3ITZA 3KL8A 3OY1A 2R3LA 4ANLA 4DFYA 2BFXA 3HDMA 4IX3A 5KX8A 3ZONA 4O7VA 3Q6UA 3KA0A 2G2IA 4GKIA 4NIFB 5JFXA 3B2WA 3POZA 4IAKA 1XQZA 4GK3A 4A9YA 5GJFA 5HQ0A 5M44A 2XKEA 5H3QA 3ATTA 2PMIA 2VZ6A 2A1AB 4IJ9A 3SKCA 3ZTXA 4DTAA 2Z2WA 5DR9A 5FM2A 5CEMA 4W9WA 3TZ7A 2H8HA 4OTIA 5DNRA 2XRWA 5BVFA 3FYJX 4EOIA 3IW6A 4S34A 4DEAA 5D1JA 5CAOA 4XG6A 5AUWA 2UZDA 3OC1A 5L3AA 4QOXA 4I6FA 5CASA 2OU7A 4LUDA 3F7WA 3QL8A 4NZWB 3UQCA 3C9WA 5FEQA 5A4TA 5I9XA 4PTEA 4CQEA 2C6OA 4F9WA 2I1MA 4Y72A 3EZVA 3QCXA 4V0GA 3IW4A 4IDVA 4K9YA 2P55A 3KXGA 2HXQA 4L52A 5AR8A 4C34A 4BCGA 5EDRA 3CTJA 1WCCA 3D15A 1H1QA 4FTTA 5TOZA 4X3FB 2G2FA 3CD3A 2BAQA 3TACA 2Y6OA 2PUNA 1Y57A 4PP7A 3P5KA 1MRUA 5FTGA 4QP7A 2YDKA 3NUPA 3UYTA 4RJ7A 5J7BA 3GENA 3VS7A 4IADA 2JAVA 3BBWA 4RVTA 2C47A 2XKDA 3PG1A 2WGJA 3UP2A 5A4LA 2XCKA 5J79A 3RZBA 5CVGA 4G1WA 3LJ2A 4BIEA 4EOQA 3A4OX 3QLGA 4MNFA 3BGQA 3EFJA 4FODA 4U79A 1E9HA 5DBXA 5A6OA 4FZ6A 2V5QA 2CPKE 3R83A 3QQHA 4A9RA 4AA5A 1H1RA 1KE6A 5HBEA 4Z7GA 4LMUA 2A2AA 4D4RA 2WIPA 4EK4A 4CZYB 5BQ0A 4ASZA 3PVUA 4EC9A 3BU3A 1W82A 4O4FA 4O7LA 4HCUA 3Q60A 4BIBA 5JQ8A 2BDFA 2LGCA 3O51A 3DOGA 3UDBA 1Q8UA 4QPSA 3OCGA 3VO3A 5J7HA 5JH6A 4ZTNA 4Y73A 3KK8A 3N9XA 4IWPA 1P4OA 2CGVA 2Y4IC 3CXWA 3HP2A 4FT3A 4BDEA 4BRXA 3PXZA 4BZNA 4O86A 2PZ5A 2WPAA 3IOPA 2WTKB 3MH0A 4K0YA 4H05A 2EB3A 4KUJA 4CV9A 4OW8A 3UOHA 3FMDA 3UC4A 3LXPA 2GPHA 3OWPA 2PL0A 3R9DA 1KE8A 4D28A 3ZFYA 2VTPA 2JFMA 4X6QC 4ANSA 3TKHA 1J7LA 1IG1A 3ODYX 5LARA 4BCJA 4EQUA 3II5A 4FR4A 4FSYA 3CGOA 3R6XA 3C0HA 3HEGA 3ZZWA 3VUTA 4OT6A 4AXDA 3MN3A 4R77A 5FDXA 4F08A 2XIZA 5JN2A 4OR5A 4ZY6A 2GSFA 4K2RA 4PNKA 4ZAUA 4CSVA 4O7SA 4YJRA 5HU9A 1XWSA 2GFCA 4PMPA 3WZEA 1NW1A 1SNUA 1Q4LA 3OT8A 3QYWA 5LVNA 4LG4A 2XNMA 4DHFA 3RP9A 3R7GA 3VW6A 3AMAA 4JT3A 4UXQA 1ZYDA 3U4UA 3D5VA 3TYKA 4KIKA 4ZLYA 1JSVA 3BYSA 3E7OA 2XNNA 4KBKA 2OJ9A 3BGZA 4FSQA 1G8KA 1PMNA 4O22A 3PIZA 3DGKA 5ANDA 2UZUE 2WMRA 3HUCA 2E9VA 2XCHA 4HZRA 4RWIA 4JQ7A 4AQCA 4F9CA 2AYPA 4EQMA 4D0WA 4FSRA 3F5XA 4ITJA 3TTJA 3T9IA 4FKUA 4CQGA 4DEIA 3KMMA 3RPVA 5GZAA 1V0BA 5L6WL 2F7ZE 3CP9A 3FZ1A 3UE4A 3ZEWA 4FIHA 3SVVA 5AMNA 2QQ7A 4ZS0A 4RIXA 5CLPA 3NYNA 3PXYA 2BUJA 2YLEA 5ETCA 3ZYAA 4KKHA 4AACA 2B0QA 4DFUA 4KSQA 2HZ0A 4YNOA 4AFJA 5LVLA 3V5WA 2BRGA 4L67A 5FLFA 1DAWA 1Q97A 4HVIA 4RIYA 3VJNA 2X9EA 5CSWA 5ANIA 2R3NA 4MXZA 4MXXA 5DRBA 5F94A 2R3FA 4I5CA 5IA5A 2CMWA 5BVEA 3R9OA 4E4NA 1YWVA 3AGMA 1E1XA 4ZTMA 4GT5A 1MQBA 1PXIA 3JXWA 5HX6A 5FXSA 4JQ8A 4EH4A 2JKMA 3EFWA 3GQLA 2YEXA 3NGAA 4AW1A 4TNBA 4I5MA 3VHKA 3QBNA 5B2LA 2OF2A 2CHLA 4LGGA 4CFFA 4QMNA 3OOGA 3MI9A 1M17A 4KIPA 4EH8A 2OI4X 4NTSA 3EQFA 3UMXA 4JX7A 4MYGA 4BC6A 2PE0A 2UZLA 1O6KA 2E9NA 3QX2A 3NUAA 3OF0A 4ZY4A 1PXLA 3ENMA 4GV1A 2OIQA 1W2FA 4N57A 2CN8A 4MX9A 2IPXA 3WZDA 3F2RA 4BIDA 2XK7A 4M69A 4QYGA 4RIOA 2KULA 4WO5A 5HCZA 3RZFA 4AGDA 3TDVA 2ITVA 3FSKA 4KINA 1PJKA 1ZYJA 4TWOA 2YDJA 4GK4A 2GS6A 4RBLA 4ZJJA 4MHAA 4PX6A 1Q8TA 5DHJA 5CY3A 3VUMA 2WTIA 4BYIA 2ZJWA 3TM0A 3P5JC 3P1AA 4DITA 2HZNA 4DCAA 4AW0A 4IZ7A 5BVDA 1J91A 4QMYA 1JVPP 4V0GB 5C9CA 2O5KA 3UDZA 2ITTA 4U9AA 2WQOA 4YZ9A 3PDTA 3AC4A 1OL6A 3RNYA 1ST0A 3FEGA 3VRZA 4ARKA 4W4XA 3R8VA 2C30A 2Y7JA 2ITNA 3W16A 4D4VA 2OJGA 4LOQA 4TL0A 3CGFA 1I44A 3MPMA 2WMXA 4XG8A 3HV4A 5A4QA 3DAEA 2BZHB 1IA8A 4BZOA 4RLKA 3CJFA 4I93A 4F1MA 2VTSA 2IF8A 1WZYA 4RG0A 2W96B 2PUPA 3R7UA 3MB7A 5AFVA 4EOPA 2ONLA 4BTFA 3GFEA 4Y83A 2PVLA 1MUOA 5CF8A 3BX5A 1RJBA 4LRMA 4Y5QA 4MXCA 1Q8WA 2CKEA 4ACDA 3NX8A 4QO9A 4FA2A 4ITIA 4M3QA 3BLQA 3LFBA 3R63A 4XV1A 4ORKA 3TZ8A 4FJVA 4IZAA 3ORMA 2XANA 1V1KA 3H0ZA 5IH5A 4BI1A 2ZM4A 3UG2A 2YFXA 3D14A 4BDFA 5EYDA 3WIKA 4RJ6A 3HAMA 3NYVA 4JX3A 3HX4A 3QXPA 5I9VA 4GVAA 2BROA 2I0EA 1OPLA 4HCTA 4K77A 3V6RA 2ZV2A 3PIXA 4C4HA 4ZY5A 3HMOA 4AW2A 4QPAA 5IQIA 3IQ7A 2R3OA 3GUBA 3U87A 4N4SA 2YM8A 3R8LA 1YHVA 3QQLA 4IHPA 5AIRA 2Q0BA 2G15A 3RGFA 4GEOA 2OF4A 4ALVA 2W99B 4BCQA 2XUUA 2IW9A 3R21A 3VUDA 2Z7SA 4ERWA 3NW7A 5BVOA 4USEA 3FZPA 4NJ3A 2V55A 4D5HA 4NUSA 5IEVA 4ZLZA 5HTIA 4YSJA 4BY9E 3QTSA 1XJDA 3ZLYA 4DT8A 2VTIA 4WUAA 2QVSE 1ZY5A 5FG8A 3LXKA 2O2UA 4O0WA 2GNHA 1ZMWA 4H3BA 3O71A 4KABA 3WF8A 4V04A 4JG7A 2R0IA 4AGCA 2F2CB 4YZCA 4F0GA 2GNGA 5TKDA 3MTLA 4TYHA 4X2KA 2GFSA 2R3IA 3AMYA 3FMEA 4KIKB 5EDPA 4F6WA 5HLWA 1PXOA 3F5PA 3QTWA 3F2NA 4FK3A 3FZOA 5ANEA 5K4JA 5AJQA 5BVKA 3QUPA 5EW8A 5AUVA 4ALWA 3QRJA 4EYJA 5IISA 4TRLA 4YJPA 2A4LA 2C6IA 2JLDA 2VTJA 2RL5A 2ERZE 4OUCA 2VWZA 3PJ8A 3TDWA 4O6LA 4YZNA 1NA7A 4XG4A 4BGQA 4IACA 2OBJA 4YTCA 4C4IA 4QP4A 3JUHA 3TJDA 3IK3A 4ACCA 1FPUA 5CU2A 2XK6A 3F3UA 4LV8A 1ZRZA 5GJGA 4RIXB 3EB0A 2V0DA 3FQEA 4PDOA 5L6OA 5EK7A 4FE2A 1CKIA 5HOAA 4WNKA 4C3FA 4QP6A 5EKNA 5CF5A 5CF6A 4H58A 2AQXA 4DINA 4RIYB 4JBOA 1H28A 1FMOE 1GJOA 2V62A 2QONA 4XP3A 3EN9A 4JQEA 4P2KA 4MBLA 2JKQA 3FXXA 4ZSJA 3VN9A 2R5TA 3UZTA 3FZRA 4FKTA 1RDQE 2YM5A 1KE5A 3PZHA 5FTQA 1O6YA 3LM5A 3PXQA 2NYAA 4KKGA 2C5YA 4A9TA 3S1HA 2XK9A 4MVFA 3EL8A 4IC7A 1R1WA 4PMMA 4QMQA 1LR4A 3Q2MA 1ZAOA 2O64A 3QHWA 2XKFA 1WBTA 3FHIA 4MWIA 4U80A 5C8MA 1WBPA 3RKBA 4RX5A 2YIRA 2C5VA 2VV9A 2VO6A 3Q04A 4X2GA 1TQMA 4XBUA 4L42A 3GU8A 3Q4UA 2CGUA 1YVJA 4R5YA 2ITOA 1BI7A 1YI3A 4U40A 5AAFA 4O2PA 4M69B 4FTIA 3MPTA 2X4FA 5JSMA 3H9RA 3BU6A 2R3KA 3NUUA 4XRLA 3QYZA 4NW6A 2QG7A 3D83A 3RWQA 4I20A 1J1CA 4D2TA 2FSLX 4ASXA 4EOJA 2IZUA 3MFSA 4YUQA 3PY0A 5AUZA 1PKGA 2P2IA 3NYOA 4K8AA 4L6QA 3RAKA 3N4TA 4AQKA 3ULZA 4F65A 1H1SA 3ZCLA 3R1YA 4YZMA 2YZAA 2VWYA 2C6KA 3HMIA 4RFMA 2OLCA 1LPUA 2PTKA 2VGPA 2R3MA 4IAIA 4C33A 4G2FA 1LP4A 3C4WA 5AUXA 5GNKA 4CFWA 2QU6A 2XEYA 3IONA 4ANMA 3CIKA 3KXMA 3PRFA 5E90A 4F6UA 3PWYA 5E91A 1VLRA 4BHZA 3QTUA 3G0FA 5AP5A 2VX0A 4AT3A 4C02A 3FI8A 4UV0A 2JEDA 5HORA 4BCNA 3PUFC 4RLLA 5DR6A 2Y6MA 1ATPE 4G3FA 2PMLX 3MFTA 3OTUA 3UQGA 4CFUA 5L2IA 4DTBA 1ZYSA 3W1FA 4MH7A 1XR1A 1ZOGA 2ITUA 1A48A 3IPHA 5BV3A 3QC4A 3VS1A 5C8NA 2C68A 4QD6A 1GZOA 4FKJA 1PY5A 5M09A 2R3RA 2OSCA 4A06A 2XF0A 3R0TA 3UTOA 4YGAA 4AXFA 2ITZA 5A6NA 4XOYA 3F69A 3H0YA 1IA9A 2HZ4A 2W1ZA 3DNEA 4AN9A 3E92A 5DEWA 4D2PA 5M06A 3P79A 2P2HA 3FHRA 3FL5A 4OT5A 4DN5A 4E7WA 3BE9A 3C0IA 3UOJA 2H34A 3O8PA 4FEUA 1B6CB 5FD2A 4CFXA 4DLIA 3IDBA 4QTDA 3AKKA 5CU6A 2HY81 1PYEA 4F6SA 1XHAA 1CSNA 3WI6A 1QPCA 3EN7A 3QUEA 4NM5A 3MTFA 3FXZA 4CYIA 3SD0A 1W98A 5IQDA 1Q3DA 5IMXA 2RKUA 2XK8A 3I60A 5EYKA 3CC6A 2XJ2A 4FV1A 4S33A 5M57A 2IVTA 2Z7RA 2I40A 3DB6A 4CMOA 4DFNA 3RCJA 4QTEA 4GIHA 4WA9A 3HECA 1FINA 3BI6A 4D4SA 2XNBA 3K3JA 3W0OA 3FV8A 1YHWA 4IWDA 4Z55A 2J5EA 4O4EA 1Y6AA 3N4VA 5IUGA 5DMZA 4FKLA 4WHZA 1WVXA 2C0OA 3R00A 4ZOGA 1NT2A 5BYZA 4BTMA 2PZYA 1P5EA 4BDCA 2WQEA 1OITA 3H9OA 2I7QA 4RVLA 3MH3A 5LWNA 4FG8A 2F9GA 4WSYA 5KZ0A 2O8YA 3OWKA 5CWZA 5EM6A 4V01A 3PUPA 2YDIA 2QOIA 4KWPA 4AAAA 1OVEA 2JKOA 4QYFA 4DGOA 3LCOA 4FSWA 2PVRA 2RF9A 3QWJA 5GIPE 3R2YA 4XH6A 1XH9A 4TYHB 4JLCA 4Q5EA 2F49A 2WNTA 3R7VA 2UW6A 4APPA 2GHGA 2X8IA 2RSVA 3QQGA 3BHTA 1FVVA 1XH6A 3W2SA 1CKPA 4XG2A 4PRJA 4O0SA 3N51A 3PSCA 4IVCA 4XS2A 4O7WA 3QUDA 1OBDA 4AFEA 3C1XA 2JIUA 2J50A 2WMWA 2X0OA 4FKGA 5HG7A 3RM6A 3ZBFA 1SVEA 5C26A 3R30A 2VGOA 2PWLA 2H6DA 4FKIA 3C4FA 4EH3A 4QMVA 3TZ9A 3VJOA 4F99A 5BYLA 3GU7A 3MIYA 2W1FA 4FEQA 2BCJA 4FNYA 2Y4IB 3WZUA 3BHHA 2WTJA 3V5QA 3AOXA 3POOA 1UU7A 2ZFYA 4L68A 3LLTA 1OIRA 3MGYA 3Q3BA 5FGKA 4IC8A 3QC9A 4YPSA 4BYJA 1YHSA 1ZLTA 2XB7A 4FK6A 4KIOA 3U6HA 3CPBA 2IG7A 4S2ZA 2XBJA 5DI1A 4EONA 4J8NA 5AM7A 4DTKA 2ITYA 4YZBA 4LDTA 3QQJA 4RSSA 1H24A 1UWHA 5CZIA 5DOSA 1M2PA 2ZB1A 3ZSHA 4CVAA 1LEZA 3A2CA 2JGZA 4JDJA 5LCKA 3DTCA 3W32A 3KKVA 3ZXZA 3O2MA 3KULA 4B8LA 5CT7A 3CQEA 3HA8A 4CMTA 5CEOA 1OZ1A 4AA0A 3R22A 3NCZA 3O50A 3A99A 5DG5A 5CAQA 3FWQA 3PJ3A 4WG3A 2W4KA 4FKOA 3SAYA 3LFSA 5IQBA 4ITHA 3FLYA 4WRSA 1WAKA 4KKEA 5FQDC 4LGHA 3GCVA 4FSMA 4J52A 2VX1A 4AG8A 4IAFA 1JSUA 1WBSA 3UNJA 5I9YA 1U59A 3H30A 5C27A 2IVUA 4X21A 3V5JA 2C69A 3ALOA 3SLSA 3HUBA 5GINE 2PSQA 2QLQA 3PLAE 4C2WA 4FBXA 3R7OA 4FT9A 3V04A 3HV7A 2X39A 2NP8A 2P3GX 2W4JA 5IA2A 1OB3A 3MIAA 1UKHA 4BCIA 3CLYA 3AXWA 1BUHA 3SX9A 3VUIA 3ZSIA 3B8RA 4CYJA 5ANGA 4FTNA 5AAGA 3OHTA 4W8EA 1YWNA 5JKGA 2CJMA 2PMOX 4EK3A 3JVRA 4HJOA 3DZQA 4GG7A 1U5QA 5EG3A 5CSXA 4BBMA 4N6ZA 4RX9A 3GC8A 5F4NA 4GMYA 2CNQA 2YM7A 2NPQA 2VU3A 3F3ZA 3FMHA 4TWCA 4PF4A 3W2OA 1FBNA 3BLAA 2QC6A 2FGIA