3K3JA

P38alpha bound to novel dfg-out compound pf-00416121
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
348
structure length
329
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title The Design, Synthesis and Potential Utility of Fluorescence Probes that Target DFG-out Conformation of p38alpha for High Throughput Screening Binding Assay.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 329
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3k3jA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3k3jA01
2FSOX 3EH9A 3FYJX 4I5HA 4N70A 3F7ZA 3FMHA 2BZJA 3RCDA 3MJ1A 5L6OA 2OJ9A 1XH5A 4FV5A 4NM3A 1YWNA 3FXXA 3UDBA 3P79A 3BE2A 4YUQA 4EI4A 2HENA 5AIRA 1NA7A 5EW9A 3DB6A 4A4XA 3R7GA 5CANA 3WARA 4X2JA 4F9AA 1OKVA 3PVWA 4YZNA 4UWBA 4AN9A 1BYGA 4O27B 2X7OA 2FSLX 3F82A 2WMUA 3OROA 4M67A 5A6OA 4ZSEA 4QP4A 3QUEA 3GU4A 5G6VA 4F0IA 5AA8A 3EIDA 3Q9YA 5E4HA 1XBBA 3F9NA 2ZAZA 3II5A 3ORPA 2JDVA 4PL3A 3V5JA 3ZXTA 1ZYCA 4DT8A 3QGYA 4CT1A 1RQQA 3ZFMA 3V04A 3OEFX 2W1CA 2Y6OA 4Q2AA 4EHEA 1KE9A 3FZSA 4GRBA 5KBQA 3VWAA 5HTBA 4O38A 2X39A 4CMTA 4ZS4A 5HICA 5HLWA 4IAYA 5A4EA 2CGWA 4JAJA 5FDXA 1DAYA 2QNJA 3HDNA 4K0YA 2Q0NA 4X21A 2BDFA 4FSTA 3NCZA 4EK5A 2YCSA 4GK2A 4IWPA 4PPAA 1W83A 2C6IA 3AGLA 4QQ5A 4YLJA 3TL8A 4EC8A 1OL2A 4Z16A 2PU8A 2R2PA 3DOGA 3F3VA 2EXCX 2WD1A 3LFAA 2O2UA 5D12A 5AM7A 3RNIA 2C3IB 5HZNA 2BRNA 2JITA 2QKWB 3KXHA 2IVUA 3KF7A 1UNGA 4ANQA 4BDDA 1R78A 5DH3A 3PRFA 5DEYA 5HLNA 3QQUA 4L44A 3U6JA 3MIAA 5LVMA 1OZ1A 4XJ0A 3FPMA 1Q61A 3E64A 4TWPA 4XV9A 3W32A 3D14A 5DIAA 3HAMA 2WKMA 2RFDA 4BDIA 4PRJA 5A4LA 5IQAA 3TN8A 3UIBA 4RLKA 2HELA 3QC4A 2JGZA 2XIKA 4FT3A 4CMOA 5IMXA 3LMHA 2R3OA 5E90A 2YIXA 1PMVA 4F70A 4L8MA 5BVKA 4TKSA 3SKCA 2F7EE 3C9WA 4XH6A 4A9UA 4BBEA 3TACA 1KV1A 2CDZA 3KXZA 3PPZA 3VUMA 2G2IA 4BKZA 1W0XC 5AWMA 4C2VA 3UIMA 3R8ZA 4RIOA 4DN5A 5HGIA 5HTCA 4E73A 2W4OA 3ORMA 4X2NA 3GOPA 4WNMA 3HMNA 4U44A 2F9GA 3PXYA 2ETMA 5L8KA 4O96A 4FV1A 5CF8A 3ZRMA 2VTAA 2QG5A 1Y8GA 4IM3A 1UWJA 3FSFA 2B9HA 2NP8A 2QC6A 4MEDA 3EQHA 5AP2A 2VTLA 5CEPA 5BMMA 1P2AA 3VBXA 2PMOX 2RFSA 4DFBA 4I6BA 5CAQA 1P4FA 1MQBA 3PXZA 1VYWA 3FAAA 3EMGA 3LOKA 3QCXA 4I5PA 3LKMA 4O21A 4Y95A 4FTUA 3I1AA 4IX6A 3RPOA 5L4QA 3EQRA 4AE6A 4BDAA 2W9FB 3DXQA 3ELJA 3HNGA 4E4LA 4ZS0A 1A06A 4DEAA 4LV8A 4DT9A 2ZVAA 2OJIA 1BLXA 1NXKA 2UZBA 3S4QA 4AFJA 3NDMA 1OIUA 3KB7A 4FVQA 5CU4A 4AX8A 2JBPA 3I0OA 3LFDA 3QTZA 4BBFA 4BCIA 4QT1A 4G9CA 3VS7A 4B9DA 3HA6A 2R7IA 3KEXA 4QTCA 5J1VA 5JZJA 3O0GA 4FF8A 3KRXA 5CEIA 4QTDA 3DLSA 1ZWSA 3OT3A 1E9HA 1VYZA 4IZ7A 1SVHA 4TYIA 3RKBA 5H3QA 5HO6A 1MUOA 2O63A 4FEQA 2YITA 2XKEA 4QYGA 4PDOA 3REPA 3OTUA 4DYMA 4DLJA 3KQ7A 4EBVA 3D2IA 3ZEWA 3F7WA 3ORLA 2WU7A 2CGUA 3M2WA 4IX5A 1Q8YA 2R64A 4QTBA 1Q3WA 2IWIA 4IM2A 3V5LA 1QPJA 3UC4A 4KSQA 2XIRA 3R01A 5D41A 4ACCA 2PPQA 4D0XA 4IAAA 3ZLSA 4D2TA 2DWBA 3MBLA 4M68A 3L8XA 2BRBA 3EYHA 3QXPA 4I93A 3SQQA 4L52A 4MK0A 3PG3A 4RLLA 3T8OA 3VBWA 3I6WA 4BN1A 4XP0A 3TUCA 4XV1A 3TM0A 3TKIA 4WBBB 4XUFA 1OUKA 2XNGA 2HXQA 3MA6A 2GFCA 4YJRA 3EL7A 3GBZA 4QMOA 5FBOA 2NNWB 1SNUA 5AR3A 4USEA 1YDSE 2UVXA 3FKNA 2X2LA 4JG7A 2PVYA 4F0FA 2JAMA 2PUUA 1RDQE 4MF1A 2Y9QA 2UZEA 4ZSJA 4LUDA 3WF7A 4BCOA 5M57A 5IQHA 1YXTA 4YJVA 3W2QA 3AMYA 3E93A 3I0QA 3KXNA 2ITOA 1WMKA 4P5QA 5HTIA 3NUUA 5KMMA 4BR3A 5LVLA 5TO8A 5LVNA 2J5FA 4RVKA 4HGLA 3OHTA 1Q97A 3S2PA 3VQHA 4G3CA 3PSDA 3NVKI 5BVOA 3F3WA 4FYOA 4KD1A 4KA3A 1YW2A 4Y46A 4UALA 3LFCA 3GCQA 4KKEA 3OXIA 4PNKA 4FSZA 1REJA 3MPTA 2WMTA 3QA8A 5C01A 4BWXA 5GJDA 5A54A 5GHVA 5FEQA 2YM7A 4JLCA 5FD2A 4AZFA 4B7TA 4EEVA 5F20A 5E8YA 4ANOA 4BCHA 3A7FA 5F9EA 4JOAA 4CV9A 4E4NA 4LRKA 4TYGA 4EOOA 3EFWA 2OWBA 5EHYA 1FVRA 4L6QA 5CVGA 1WZYA 1YHWA 4AZVA 3E8DA 2ITTA 2UW9A 3C4FA 1KSWA 4FR4A 5AEPA 3DKOA 1TQMA 4KS8A 4DH3A 4IB5A 2H8HA 3V6RA 3O50A 4O7VA 3M42A 4M69B 4NM7A 5DR6A 4R1VA 4Z3VA 5LMKA 3HAVA 1K9AA 4N6ZA 4J98A 3PY3A 4M69A 4A4LA 4L7FA 5HNGA 4KIPA 4E20A 2OJJA 3R73A 5HO7A 3SRVB 3QQFA 4YJPA 3R0TA 2GNIA 5GZAA 4E26A 4EH7A 3CQUA 3SRVA 4ZTLA 2OLCA 3VQUA 2YIYA 3PJCA 3TXOA 3Q9ZA 5E8WA 4C4EA 1EH4A 4X2KA 5AR5A 1NVQA 1L8TA 5ANKA 4E5BA 4IB3A 4R78A 2BMCA 3TDVA 3LFFA 2CGVA 5EH0A 2ITQA 2PVLA 2XNNA 2VTJA 3TZ8A 4N6YA 4CG9A 5I9UA 2B1PA 3CGOA 3EOCA 3SXSA 5JN2A 4HVDA 5KNJA 2WU6A 3A7IA 5EYDA 2OZOA 4ZY5A 2I1MA 5I9ZA 3NVMB 4I23A 3FE3A 3KXGA 3SAYA 3F3TA 3D15A 4RX5A 2GNJA 3FQEA 3R7VA 2C1AA 3E3PA 2YFXA 3R04A 1H1PA 5CEQA 3A7JA 3LM0A 3BEGA 3BWJA 2J0LA 2BHHA 5AP6A 2C6DA 3N4TA 1CSNA 3TTIA 4C33A 1YXXA 4JDJA 1UU3A 2GMXA 1V0PA 2W06A 4FIHA 2JKOA 4A06A 2JC6A 3GEQA 3O7LD 2X81A 3TZ9A 1UVRA 5A4QA 4TRLA 3FKOA 3VBVA 2ITNA 3PDTA 3MB7A 3QQGA 4PL5A 4IAZA 5LMKC 3D7TB 4YR8A 5K5NA 2ACXA 3PJ3A 1M2QA 5M51A 4O0YA 2PUPA 4WG5A 4ASDA 3D7TA 1YDRE 4NTTA 3ZFXA 5CU2A 2VGOA 4ZY4A 2V7AA 3C5UA 3QUDA 4NW6A 2J7TA 1UU8A 1KE8A 2PY3A 3FZOA 3D5VA 4TNBA 1GZKA 5HORA 1J7IA 5IQBA 4S34A 3U55A 3ALNA 3JS2A 3NR9A 2PZIA 3QRTA 1FBNA 1OECA 4FIEA 3HDMA 5ANGA 3ANQA 5GINE 3CIKA 3MTLA 4O84A 4B8MA 4XLIA 5DBXA 4O91A 1KE7A 4EYJA 4DCAA 2R3GA 4O2PA 4FTTA 5EW8A 5FXRA 2BZKB 2GNLA 2OFUA 3P23A 5IKWA 5BYZA 3DQWA 4A9RA 5HU9A 4D4VA 2GDOA 4YZBA 5E8XA 2X9FA 3PP0A 1XR1A 4EORA 4W9WA 4MNEB 4CXAA 4FBXA 3G15A 3WZEA 3FLSA 3GU6A 5FP5A 2XBAA 4FTNA 5EYMA 4MNEA 4DLIA 3QRKA 2F4JA 3LFSA 4JNWA 2YM6A 1H28A 3OCTA 2JKQA 5AA9A 2H6DA 3B2WA 1Q62A 3OWLA 1LP4A 4FV9A 3VS4A 3MA3A 4EK8A 4EYMA 4G5PA 2FH9A 2V22A 3FSKA 4C4IA 3R9OA 4RC2A 5FG8A 3FLQA 5DWRA 1AGWA 5E8UA 4FOBA 4UMQA 1H0WA 3A99A 3POOA 4IXPA 3ZONA 2CKQA 2PMLX 3KN5A 4CD0A 4GK4A 2F7XE 3OCSA 5HBHA 3TNIA 3FYKX 3LCDA 1ZYDA 1JKLA 3E7VA 2IW9A 2FO0A 2RG6A 3EFLA 4I0SA 4CV8A 4I6FA 4DC2A 4APPA 4YGAA 4K18A 2V62A 3I7CA 3G6HA 4U7ZA 4B8LA 3OS3A 2YA9A 4L45A 2B9FA 3ITZA 3VUHA 4JVGA 1FVVA 2B9JA 3HP2A 3K3IA 3Q04A 4GK3A 3EQBA 4OTRA 4UXQA 4EZ5A 2WZJA 5L2WA 2GQSA 4FEUA 5EK7A 3L1SA 2VO3A 2DUVA 2J0JA 4RJ6A 4LYNA 5AUYA 4NWMA 3HMOA 3W8LA 5FEDA 3IW5A 4MD9E 3FLWA 5E8ZA 4OAUC 2C69A 4V0GB 2XP2A 2G01A 1JSUA 1U5RA 2HZ0A 2QLUA 3DQXA 4V0GA 3DTWA 3RPVA 2CKPA 1OL7A 5ANIA 3C4XA 3L9MA 4NH1A 4EHZA 2QODA 4OW8A 4DH7A 1FINA 2PE2A 3GC0A 4I92A 4DFZE 3KFAA 4DEBA 4ZJJA 4O7SA 4E4XA 3D2KA 3NYOA 3D9VA 3MPAA 3P78A 1CKIA 5AAFA 3UMWA 3R2BA 3RK5A 5EDPA 2J50A 3SVVA 4D4RA 5JFXA 2Y4PA 4RT7A 2VUWA 2ZV2A 4RRVA 5L3AA 2C5XA 3CTJA 2BAJA 2Y4IB 4JIKA 4JQ7A 4WRGA 3AQVA 3MPMA 4RJ3A 4WNPA 2X8DA 4ITJA 4S2ZA 4BVUA 5JKGA 2X6EA 2YISA 4QP1A 1KOAA 5KUPA 1YHVA 3GQIA 4IB1A 2QR8A 4BGQA 1SNXA 3WE8A 4QMZA 5AP4A 2XZSA 3QTRA 4ZSAA 1XH6A 3FMLA 4DTKA 4DH1A 3CLYA 2CN8A 2XH5A 1ATPE 4FSRA 4YTFA 3GI3A 4FNXA 4I21A 1LPUA 3RAHA 4C59A 4F7NA 4YZMA 1MRYA 4DGOA 3BGPA 1GZNA 2WXVA 3NPCA 5HVYA 3MH0A 4C2WA 3POZA 2OO8X 4U45A 4A9YA 1ZY4A 3TNHA 3ZM9A 4BCFA 3EQFA 1XH7A 1K2PA 1TQIA 2R3KA 4YP8A 3RHXA 3N4UA 3QAME 2IW8A 5E1EA 4PV0A 3QQHA 3SV0A 4I5MA 2JKKA 4FSMA 3WF5A 4PTCA 4DE4A 3E8EA 3QTSA 4BY9E 5J9LA 3ERKA 4YNOA 2VD5A 2C47A 1Q8TA 5BVNA 4DFUA 3CEKA 1B6CB 4PTEA 1PW2A 3DK6A 1OL6A 4RZVA 5E92A 5AUWA 5T3QA 3R8UA 3G9NA 3QQLA 4H3PA 4PUZA 3QCYA 1CM8A 4EH9A 5L2IA 3UYSA 4GV1A 2KULA 4D9UA 1IRKA 3DGKA 1OPJA 3I4BA 2VAGA 5EOBA 1Q5KA 4YURA 3RPRA 5AAEA 4FKTA 3RPYA 3BELA 3IG7A 4YTCA 3W55A 1J3HA 4EK3A 5A14A 2EB3A 1U59A 4FNWA 2Z8CA 5I9YA 3QZFA 1DS5A 2J0KA 3Q5ZA 4NUSA 4I4EA 1M7NA 1UNHA 3V8TA 4A9SA 5HE1A 4I6QA 3RJCA 5EI6A 4F64A 3QD2B 4WNOA 4IAKA 2QHMA 2ZV8A 2OXYA 5H2UA 1YKRA 2JFLA 3P9JA 1XKKA 3UVQA 2IW6A 4IAIA 3PVUA 3PWYA 2Y4IC 2PVJA 4NIFB 3G5DA 4FKIA 4WBOA 2BCJA 4A07A 2PUIA 3DNEA 2H96A 3E63A 5IQFA 2XUUA 4NIFA 4ALVA 4IH8A 4HVGA 3I5ZA 3UGCA 2RG5A 2QOFA 4CCBA 4IC7A 3PVGA 3BPRA 5E8SA 3PWDA 3WF8A 3NUAA 1JNKA 4DBXA 3NEWA 2Z7LA 4RC3A 4ORKA 3OTVA 3P1AA 1G8AA 4R7IA 3OW3A 4BCJA 2HK5A 1WAKA 4G9RA 2C0OA 4O0XA 4NYEA 4HYHA 3P4KA 4AGUA 3GXLA 4BC6A 4QTEA 3VS0A 3BEAA 4AQCA 2X9EA 4AU8A 2QVSE 4XEYA 4D1ZA 1GAGA 2Y6MA 3HKOA 2ZMDA 4U79A 4M13A 1AD5A 4G3DA 2X4ZA 4DH5A 4AW2A 1ZMUA 4BWPA 4F9WA 1MRVA 3OUNB 5JFSA 4BHNA 3FEGA 2E9OA 3FMDA 4DINA 3LVPA 1ZRZA 3R71A 5BUIA 1URWA 4M14A 4U81A 1H1WA 3GQLA 4RWIA 3LCSA 3ZUTA 3HA8A 3EKNA 2ERZE 4R6VA 5TE0A 2YLEA 3MFRA 4CKRA 2YWVA 2VWBA 3QF9A 5CNNA 2VTQA 4ZY6A 5K4IA 5C9CA 1YWVA 2BRGA 1YQJA 2G2HA 2J90A 2OJFE 3LLTA 3ZRKA 3FLYA 4GU9A 4KIOA 3D5UA 3G51A 2UV2A 4CT2A 3LXNA 3HGKA 4QYHA 3OXZA 3BI6A 5IPJA 4Q5EA 3WILA 3COMA 4JBQA 4QNAA 3JXWA 4WT6A 2XNBA 3BCEA 2WIHA 3AC1A 3Q2MA 3DS6A 4HVIA 2ZDUA 2J0MB 2HXLA 5T6KA 3FMNA 1PXPA 4BICA 4YLKA 3A60A 4N57A 4EH8A 3BBWA 4DGMA 5LVOA 4FZ6A 4L46A 3RTPA 5JEBA 5BVDA 5H8GA 2P3GX 4GL9A 4FTIA 3RK7A 4ZTMA 4O83A 3MFSA 3UO6A 5AP5A 4CSVA 2P2IA 1CTPE 2VX0A 3VS6A 4JQ8A 5DI1A 3NCGA 3BX5A 5FTOA 5HEZA 2CSNA 1IAJA 2YERA 2HZNA 5FP6A 2IVTA 3FV8A 4RWLA 3PLAE 1Y8YA 2W1DA 3VJOA 3FZTA 4KSPA 4NTSA 3KMMA 3NNVA 2E9VA 1L3RE 3M1SA 4MXCA 3SLSA 4FV4A 2O5KA 5CT7A 4F6WA 4G17A 2XS0A 2PE1A 3ENHA 3AMBA 4FTOA 4LUEA 2VTMA 2VWZA 2XRUA 5AUUA 5KMIA 4D5KA 1Q8ZA 5JH6A 4HW7A 2Y8OA 4UZDA 4RFYA 2EVAA 2ZMCA 5AV4A 1M14A 4ITHA 3BHVA 3HUCA 4EWHA 2E2BA 4FKQA 3LMIA 1H1SA 3S95A 3OP5A 1A9UA 3U6HA 1SYKA 3CC6A 1BI7A 2P0CA 2QLQA 4NM5A 4UZHA 3RMFA 3PE1A 4MD7E 3TV4A 1R3CA 5K4JA 4K9YA 3VNTA 1VZOA 2IZSA 4CFMA 2O64A 3FHIA 5ACBC 4EOIA 4FTRA 4FV3A 3HECA 3IDPA 4WUNA 2QQ7A 3OUKA 5DMZA 1JSTA 5EFQA 4CQGA 3R1YA 5C26A 1ZZ2A 2I40A 4G31A 5JK3A 2UUEA 2PWLA 2VTSA 3CP9A 4J8MA 3EFJA 1NVSA 4JG6A 5AIKA 2J51A 3WZKA 3NYXA 4RPVA 5GIOE 5GNKA 4BDKA 3EN7A 3JY9A 3PIZA 4U40A 3BLHA 3G0EA 1JKSA 5GZ9A 2WQMA 4IDVA 4O7YA 2JDSA 3LPBA 2BTRA 3ET7A 2JLDA 5CEMA 5CAVA 4EOJA 5EM6A 3BWFA 4ACDA 3UNZA 4O1PA 1SZMA 3MB6A 3RPSA 2YHVA 3AD6A 4UMTA 4J1RA 1YRPA 2WQOA 2P4IA 5M4FA 2QURA 2UW4A 5EQEA 4B6LA 2X2KA 1CKJA 4AGCA 4IJ9A 4Y5HA 4OLIA 3TEIA 4C57A 2PVFA 3EN4A 3QRIA 3Q9XA 3BYSA 3KCKA 5AP3A 3MI9A 4YTHA 4E1ZA 5BYYA 4RIYB 4TNDA 3QTIA 3MS9A 3DT1A 4RIYA 3W2SA 4M66A 4WKQA 1PHKA 5BVWA 2B4SB 3GNIB 3R9NA 1YI6A 4S33A 4EK6A 3CSVA 5JZNA 4UXLA 5JSMA 1IEPA 1K3AA 2BZHB 1X8BA 3H9RA 4UMPA 4NW5A 5KMNA 4U80A 4IJPA 5AV3A 4NSTA 4C34A 4BI1A 2CCHA 3CQEA 2HZIA 3OXTA 4O1OA 2WELA 5AFVA 4U0IA 2JBOA 2R7BA 4GFMA 1WBWA 4AOIA 5FTQA 5BYLA 3PE2A 3H10A 4FIJA 1JKKA 5AP0A 3Q5IA 1LEZA 1PMUA 2WTJA 4CTCA 3JR1A 4DG3E 3OY3A 2R3IA 4FUXA 2GHGA 2B9IA 3TWJA 1OKYA 4H1MA 3QTQA 2YABA 4XYFA 3IDCA 4KNBA 5FM3A 2LAVA 2OXXA 5IA2A 4BDBA 2IPXA 4BCMA 1XH9A 1Y6AA 5HG7A 3PY1A 2GNHA 4FZ7A 3CTQA 2F49A 4EL9A 4A9TA 2W05A 5JFVA 3R22A 4MHAA 5LCKA 4FGRA 1KE5A 2BVAA 3NW5A 4BZOA 3PVBA 2YJRA 4OTDA 4C4GA 2YM4A 3LXKA 3A4OX 2VWWA 3MJ2A 5DT4A 3UTOA 1OIYA 1BI8A 2H34A 4FL2A 3VRYA 1MRUA 3QTXA 4AZEA 3DK7A 3DA6A 3ZO1A 4CEGA 3WI6A 3E5AA 3DFCB 2WTIA 1J1BA 1JSVA 1R39A 4JX7A 2BRMA 3DAJA 3TKUA 4HPUE 2I0HA 3WBLA 3OMVA 4S31A 3GB2A 5CSHA 4PMMA 5CT0A 4BCPA 2R0UA 5A6NA 2V55A 4EUUA 3MY1A 4MBIA 2XRWA 2G2FA 2GFSA 4YJUA 2OF4A 4HCTA 3UVRA 4RC4A 3GU7A 1OB3A 4X7QA 2DS1A 4YZCA 3CY2A 4TWOA 3VVHA 1HCKA 1Q3DA 2F2CB 3KU2A 5HBJA 2ITYA 4L01A 5DR2A 4BIDA 5BVFA 3COHA 3FZPA 4BZDA 3ID6C 1PMEA 4MXAA 5HI2A 1U5QA 3ZS5A 4FT7A 5EQYA 4GUEA 4GU6A 3BYMA 4FK3A 4KBKA 2PVHA 4FKVA 3AT3A 1M17A 1OI9A 3DTCA 3QKLA 2JKMA 3GOKA 1IAHA 4MQ2A 4YTIA 3IOKA 4F09A 4O0UA 5DE2A 2YZLA 3GCUA 5JMSA 3U51A 5EQPA 2UZWE 3F5GA 2XKFA 3QWJA 4O0VA 4RMZA 4CFWA 3OWPA 2OH0E 2DQ7X 3UYTA 4I41A 1OMWA 2ZM3A 3VUDA 5HVKA 3ACKA 4LV5A 5BVEA 1SM2A 5IEXA 5DFPA 1FMKA 3H0YA 4QMSA 4TZRA 2QOHA 3DJ5A 3QYZA 4E5AX 4J97A 3RGFA 1GIJA 4G2FA 4IC8A 4XG3A 5CX9A 4P2KA 3ZLXA 2GQRA 5CZIA 4XRJA 5GJGA 5L2TA 3ZUVA 2WMSA 3MVJA 4C62A 2ZM1A 3FPQA 1YI4A 5B0XA 2OFVA 3NYNA 4AW5A 5DG5A 2HWOA 2JIUA 2XNEA 1YXVA 4FC0A 1YVJA 4N4SA 4BTFA 4ASXA 3EWHA 5HCXA 4ANLA 4AOTA 4OT6A 4IMYA 2GPHA 1H27A 1UV5A 2G1TA 5ETCA 3TDWA 3HVCA 3NUNA 4XLVA 2QONA 2ZM4A 2UW3A 4FA2A 4IANA 3HMMA 3WZDA 3H4JA 3SGCA 3KF4A 1KOBA 5A4CA 1PXLA 4L00A 2VTHA 3HLLA 1PXOA 2CMWA 3MFUA 4OUCA 3WIGA 3EB0A 4AZWA 3I5NA 4BF2A 5TF9A 4EK4A 4R3PA 4U43A 1PYXA 3EZRA 3KKVA 4TN6A 4F0GA 2XEZA 4P4CA 3DBEA 3UQFA 4KUJA 5KKRC 4Q9SA 3SOAA 4ARKA 4MBJA 3QALE 4GG7A 4QMPA 5E91A 4R7HA 5AR7A 3SOCA 4CLJA 2VTIA 2OW3A 3OEZA 3ZYAA 3QZGA 3ACJA 2VGPA 3BYUA 5I3RA 4LMNA 3QX2A 3LIJA 3PJ1A 3D7ZA 3NAXA 3FXZA 3W2CA 1XJDA 4EHGA 3SA0A 3GENA 3FC2A 1TVOA 4RIXB 1XH4A 2C6KA 2CJMA 3EYGA 5CI6A 4RSSA 3F88A 3KULB 3FXWA 4RIXA 2BFYA 2YEXA 3F2RA 5DA3A 3KULA 2RF9A 5EW3A 3U9CA 5BPYA 3EN9A 3MSSA 4C4FA 3NGAA 4I4FA 2WMRA 2X6DA 4TTHB 4WSYA 3VS2A 2W17A 2UW8A 3FBVA 2PSQA 3MW1A 3DNDA 4LGDA 4MH7A 4YHFA 3AXWA 3EZVA 5AR4A 4DITA 1Y57A 3LCOA 4OT5A 2JIVA 3KCFA 4C8BA 3Q3BA 2HZ4A 1T46A 3JY0A 4GFGA 5CQWA 4JQEA 5EDRA 3VS3A 4E93A 1OGUA 5CAOA 4M15A 2A27A 3DXNA 3Q60A 3MIYA 4RVLA 3TKHA 4JJRA 4GIHA 2YIRA 3NX8A 4YPSA 4FGBA 3A61A 5FRIA 4ANBA 5ICPA 1PKDA 3A8XA 3MGYA 3B8RA 3LLAA 1U46A 4MWHA 2W1GA 3LJ0A 4WUAA 4BTMA 3U4UA 2JFMA 3F3UA 2BALA 4YBJA 4MKCA 5M4IA 3F5XA 3UQGA 4TWNA 2W9ZB 2FA2A 3C50A 3EQIA 5I3OA 3ZBFA 4XG6A 4MF0A 3V5PA 3NUSA 4WNKA 3IW7A 4PWNA 5BMSA 5HD7A 3PA4A 2FVDA 2YM5A 4NJDA 3UPXA 2BAKA 5E8VA 3VUKA 4OTQA 2XK3A 2QO2A 3AOXA 2IVVA 5H8BA 5IG1A 2R3HA 3HYHA 4XS2A 3TUDA 1J1CA 3WOWA 2R4BA 4I20A 3MY0A 4FTAA 4ZK5A 2I0YA 2RFNA 3OD6X 2OG8A 4AWIA 3PP1A 2ZB0A 4IFCA 3RZBA 4CVAA 4ZJVA 3UOKA 5C03A 4AE9A 3AC8A 3NUXA 5KCVA 4GG5A 1QL6A 1UNLA 1ZXEA 2OBJA 3UVPA 4CMUA 2PZPA 4OTWA 3HL7A 1W84A 3MDYA 1XO2B 4XMOA 4FKWA 4C02A 3UNKA 4C58A 3QXOA 3QX4A 5HE0A 1R0EA 4DTAA 5HCZA 3F5PA 4FIGA 4M7IA 4PMTA 4L68A 2J4ZA 3QCSA 5HESA 5HIEA 4FVPA 4QP3A 1ZMVA 2GNFA 4JX3A 4YO4A 1PRYA 3LMGA 4GS6A 2R0IA 3PIYA 4KWPA 4EOLA 4Q9ZA 5JGBA 2EWAA 4QMMA 3LJ2A 4FVRA 3V8WA 3BLQA 3CPCA 3IGOA 4XV2A 2X8EA 3K5VA 4D4SA 5IA0A 4EOKA 2VTTA 4TWCA 4D0WA 3KRWA 3HRBA 4FKSA 4JT3A 4LRMA 3CD3A 3ORIA 2IN6A 1FGKA 3ZDUA 5HX6A 3HRFA 4YJNA 2JDRA 2QU5A 3R9HA 2CNUA 3R1SA 4G3GA 5AX3A 4EOQA 4H05A 3OOGA 2WNTA 3TNQB 4ERKA 4NL0A 4V01A 3ANRA 2UZOA 2W1IA 5KBRA 1DI8A 4YNEA 4WSQA 4Z7GA 3Q6UA 5KE0A 4YMJA 3OF0A 1H24A 3BHYA 2GNGA 3QA0A 4QP9A 2X0GA 3I79A 3UC3A 1OBGA 3H9OA 3NRMA 4RJ4A 3D5WA 3L9PA 4WA9A 3EFKA 4RA4A 3HX4A 3FI8A 3HZTA 4JDIA 2ITXA 3ZLYA 1UWHA 2G9XA 3ZM4A 1FMOE 3ZZWA 5AJQA 1Q8WA 4AF3A 3PRIA 5IEYA 3ZUUA 4AN3A 3O96A 3P7CA 3UPZA 5JQ8A 4U5JA 3NW6A 3G33A 3VN9A 3V01A 4AZSA 4G5JA 5CYIA 4EKLA 5J9YA 5JQ5A 2HOGA 4CRLA 1GZ8A 2DYLA 2CGXA 4AA5A 3K3JA 4LM5A 4ACHA 4EBWA 3UO5A 4LGGA 4PPBA 3TIYA 2C3LA 4FG7A 1XQZA 5TR6A 1JWHA 4O0WA 2VWXA 4XBRA 1QCFA 5E1SA 4C36A 3LQ3A 1YOJA 2P2HA 1U4DA 2GTMA 3UOHA 3DKCA 2C3JA 4H1JA 2GTNA 3W10A 3DBQA 4N0SA 1PXJA 1XBCA 3CJGA 4RVTA 4X6QC 5C27A 3KRJA 3R8MA 4DHFA 1GJOA 2J0IA 3LQ5A 5I9VA 3KXMA 4HNFA 4X3FB 4EZ7A 4F7LA 2XVDA 5K5XA 2CLXA 2UW0A 2VO7A 2VN9A 4X3FA 1FVTA 4QP7A 2QOIA 3CBLA 3FI3A 4XHKB 3UBDA 5EKOA 4FTLA 5J9ZA 3EQPA 4R7BA 1WBTA 1XWSA 2C6MA 4HZSA 2YDIA 4JBOA 3AC5A 1WBVA 3RAKA 2R3NA 3A7HA 3LHJA 1YWRA 2WGJA 3ORZA 1PF8A 1GIIA 3IK3A 2R5TA 4KAOA 4QPAA 3BHHA 4XCUA 1WCCA 3UNJA 4D28A 2XF0A 2OIQA 4M0YA 3I81A 4QMTA 3R9RA 2QO7A 5HE2A 2YN8A 4QQCA 5EHLA 3OWKA 4EH6A 4FSWA 4O7NA 5DT0A 3CQWA 5HO8A 3TNPC 4K1BA 4YZ9A 2O8YA 3QTWA 5CF5A 4BI2A 3I7BA 4FUYA 2C68A 4BIEA 4JDKA 5J7HA 4DFNA 4TYJA 3QRUA 3C51A 5J79A 2E9PA 3KMWA 4D2SA 1ZY5A 4CLIA 4HCVA 5AAGA 4LRJA 4GT3A 2XIXA 5HBEA 5BUJA 4RIWB 4MXOA 4RWJA 3ZMMA 2YZAA 1SVGA 3ZRLA 3ROCA 4AG8A 4LOPA 4KRDA 4C3PA 3QRJA 3K54A 4RIWA 5IH5A 3SDJA 5CU6A 2FYSA 5EDQA 2GCDA 2YWPA 4C3RA 2I6LA 3ZBXA 2PZRA 5H9BA 5C4KA 4YHJA 2QU6A 2WEVA 3ENMA 4BDFA 2B0QA 5IMEA 2XJ0A 3F66A 3TCPA 5KHWA 1Y91A 2YCFA 4LOOA 4BCKA 3MVLA 3GUBA 3Q53A 2UZUE 4OTIA 4X3JA 4NEUA 5IQDA 5EYCA 2NRYA 4FL1A 3RI1A 1M7QA 2R3JA 3UMXA 3QD3A 4DGGA 5BUEA 2QCSA 5AUXA 5IF1A 3E88A 4ASEA 2WAJA 2F2UA 3IGGA 4CZUA 4FYNA 3R9DA 4CZYB 3MYGA 1PYEA 4YJOA 1ZOHA 3ORKA 4F1MA 3BQRA 4MXZA 4KIQA 3AMAA 4X3FC 5ACKA 2YLFA 4J96A 4QP8A 5M44A 3UZRA 5IQCA 4W4VA 2QD9A 4IDTA 1QPDA 3PUPA 3BGZA 3DFAA 1G8SA 5K0KA 4FZAB 2EXMA 4GW8A 4E5WA 3R83A 4E6AA 3R7IA 3Q4TA 5A9UA 3FMJA 2OU7A 2YIWA 3FUPA 5JT2A 4CGAA 2HY0A 3FI2A 5CSVA 1P4OA 2C6TA 4UMRA 3BU3A 4DGNA 4FNZA 4EH4A 3VS1A 1NT2A 3GCVA 3UIXA 5ANOA 1W82A 4XG8A 2VTRA 2VTNA 3LFEA 4AT5A 4EOMA 4HVSA 5I9WA 1W98A 1YOLA 2YCQA 4ZSLA 3VF9A 4E6CA 4JRVA 4H58A 5FEEA 5AV0A 3IW6A 3SX9A 3ORXA 3OBGA 2RKUA 4ENXA 4JBPA 3EQDA 3T3UA 2QOBA 5AP1A 2OGVA 3EN5A 3HMIA 3BU5A 4I0TA 2R3QA 3CPBA 3GFWA 4CNHA 4F4PA 2C4GA 4IEBA 5FBNC 2FUMA 4R1YA 4EQCA 3UZPA 3IQ7A 3MESA 4GT4A 4QPMA 3E92A 3GFEA 3KRLA 1V1KA 5L2SA 5J8IA 2Z02A 4CCUA 4QP2A 3PZEA 1H25A 2QOLA 5J95A 4DGLC 4Y85A 2CKEA 3B2TA 1QPEA 2R3LA 5M09A 2JDOA 1F3MC 3DCVA 4UBAA 2QR7A 4Z7HA 5IH4A 4FT9A 3NNUA 1I44A 4QOXA 2A1AB 3DDQA 4RQVA 5ANJA 5CLPA 3R7UA 4O0SA 4DAWA 5CEKA 5LJJA 4RA5A 3NNXA 3G90X 1JKTA 1YI3A 4O7ZA 2QOKA 5D9HA 3QD4A 4A4OA 3V6SA 3DBDA 4MD8E 4PTGA 4E6QA 4M3QA 5CAUA 5LWMA 3ODYX 2HW6A 3NS9A 2OF2A 1Q99A 2W7XA 3LFQA 4L67A 2Z7QA 2V5QA 2BROA 3FY0A 4Y73A 5HIBA 4E4MA 5IUHA 3VF8A 5IQEA 5FXSA 5F4NA 2QHNA 1MQ4A 4O2ZA 5IDNA 3O23A 3E7OA 5D10A 4DEIA 1OUYA 4XOYA 1PXMA 4UYAA 2PTKA 5L8JA 4GVAA 3QC9A 2XK6A 1W7HA 2XIYA 5LMAA 4AOJA 4EH5A 4GH2A 3PXFA 3D0EA 1NY3A 2PVNA 5LVPA 3DY7A 3QWKA 5K9IA 4BB4A 4NZWB 4YZDA 4BTJA 3KK8A 3D4QA 3ATTA 5HQ0A 3NSZA 1M2RA 4FG8A 4NU1A 4USDA 3MFTA 5CSWA 3W16A 2BUJA 3QL8A 5EG3A 4EH3A 3U4WA 3PSCA 3C4CA 3ZSHA 4QTAA 4AP7A 4AZTA 5KO1A 4J52A 4BCNA 3TUBA 5IDPA 3EL8A 2C30A 3QQJA 4Y83A 4EH2A 4HYSA 4PL4A 5FGKA 3WIKA 2R3MA 4FK6A 5DEWA 3ZOSA 4BKJA 3VAPA 4IW0A 5CXZA 4XOZA 3F2NA 2WPAA 1Q41A 4ZOGA 4RJ5A 3FZ1A 4C61A 5FTGA 3UE4A 4IFGA 5CQUA 4YJQA 4KBAA 2V7OA 2PMNX 3IPHA 2YCRA 5T68A 4FSYA 5HX8A 3TZMA 4S30A 4TYHB 3BHTA 4ACGA 3Q96A 3E87A 2GS7A 4IVBA 5B2MA 4TYHA 5HCYA 3T3VA 4I24A 4LL0A 4DEEA 1PMNA 2XCHA 3PA3A 3W2RA 3GP0A 2XIZA 4ONAA 2XNMA 4TPTA 4D2PA 4FV2A 4IADA 4KABA 4AS0A 2Z7RA 3BBTB 3OFMA 4ASZA 4TXCA 4RBLA 3OG7A 3TV7A 5GZ8A 5CALA 4XX9A 3U87A 4QMNA 3L8SA 4ZP5A 4HYUA 4C0TA 2IVSA 1URCA 5B2KA 3S1HA 3R6XA 4UX9A 1VR2A 1H0VA 3PXKA 1H8FA 3GC7A 3O8UA 3P7BA 2P33A 4W4WA 3Q4ZA 4L43A 5J87A 3MH3A 5ITAA 4RVMA 4Y5QA 2OI4X 5ANEA 4F99A 3OWJA 4YC8A 5FLFA 2XKCA 1YXUA 4FZDB 3FMKA 5CVHA 5EI8A 3V5WA 4L7SA 5FM2A 2OK1A 2XKDA 3P7AA 4O22A 4EOSA 4QMXA 4RGJA 4C4HA 3N4VA 1BL7A 5EM5A 2YAAA 4IVAA 4U3YA 4R3CA 3LFBA 3VO3A 1FGIA 3TJDA 1OIRA 3E62A 2NPQA 4BIBA 3EN6A 4FODA 2RSVA 4EJ7A 3VHEA 5KZIA 1OPKA 1H4LA 3C4EA 3C0IA 4MQ1A 4IWOA 4AAAA 1NW1A 2HIWA 4M12A 2HY81 4NCTA 2ERKA 3DKGA 3Q4CA 3WZJA 3MWUA 3V3VA 3O71A 4MX9A 2OIBA 4EQMA 2PMIA 4QPSA 1H08A 5C1QB 5KX8A 5EKNA 3HEGA 3RBWA 1IR3A 4O7LA 3O51A 4WOVA 4FICA 4DFLA 4DEDA 4F65A 4XG4A 3FMMA 4IZAA 4AGDA 3GGFA 1M52A 3BIZA 5K3YA 3ETAA 3VHKA 5I5ZA 3Q2JA 4IZYA 1PXIA 4XG2A 4ZTNA 3PSBA 3DKFA 4IQ6A 5HD4A 1KWPA 3THBA 1XHAA 2BZIB 2WMWA 2FB8A 3GC9A 4I0RA 4TT7A 3ZTXA 5CF4A 3W18A 3WF9A 2QG7A 4MWIA 2OICA 5IEVA 5CNOA 2R3RA 4JR7A 4O6EA 5B7VA 4HZRA 5DYJA 1ERKA 3BHUA 4USFA 3FZRA 3PY0A 4QMYA 4M97A 1FQ1B 5AR8A 3FLNC 3WF6A 4NM0A 2XK8A 5DN3A 5CI7A 2YJSA 4IACA 2XYUA 3CS9A 4ZSGA 2W4KA 5GIPE 3OVVA 1ND4A 5DRBA 3EKKA 3GVUA 4XNEA 3RAWA 3LJ1A 4C38A 3BV2A 3IOPA 4L3LA 1ZAOA 5AUTA 3SXRA 4CFVA 4HCUA 4ZMFA 4BGHA 2ZB1A 2YDJA 3BKBA 3S00A 3UG2A 3E3BX 3VC4A 2B54A 4DBNA 4EC9A 2BFXA 4YU2A 4TYEA 5F95A 1UU9A 1UKIA 4C37A 2W1FA 4IX4A 3M11A 4XG7A 5HKMA 4TY1A 2W4JA 1TQPA 2WMXA 3V5QA 3BYOA 3DB8A 5K0XA 3AC3A 1QMZA 2W1ZA 2X7GA 4KIKB 4NCTC 3SW4A 4J95A 1T45A 1WBOA 2Y0AA 4KIKA 4APCA 4Y8DA 3JPVA 4AFEA 1OL1A 2WTWA 4CKJA 4FKGA 4OGRA 3C4ZA 3BGQA 3IW8A 3Q6WA 2BAQA 4A7CA 4CFFA 2Q0BA 4HGTA 4NKSA 3F6XA 2GHLA 3KXXA 2C5OA 5IISA 3KREA 2VZ6A 3AT4A 3E8NA 1E1XA 2VWIA 5EHOA 5JGDA 1F0QA 3RWPA 3NNWA 3PIXA 4GJ3A 4E3CA 4UN0C 5EM8A 2QI8A 2UZDA 3P0MA 4M0ZA 4AT4A 4GKIA 3SG8A 4H36A 4X0MA 5IA5A 4I6HA 4XP3A 4B4LA 3G9LX 3O7LB 5A46A 1JAMA 2B7AA 1UKHA 5A3XA 3S0OA 1HCLA 3RVGA 1ZOGA 5HG5A 4B0GA 5E7RA 4GKHA 1YOMA 5M06A 3T9TA 1JPAA 2YM3A 4KINA 4EHVA 1H26A 3VIDA 3R8LA 4QD6A 3MVHA 3ZSIA 2RIOA 3PJ2A 4UV0A 5L2QA 3TV6A 4QMWA 5C8KA 3R21A 4J53A 4O6LA 3VUTA 5IA1A 4J8NA 4GIIA 3HP5A 5BNJA 4U97A 2VNYA 4KS7A 4YBKA 3HUBA 4UYNA 5IA4A 5LCJA 2VX1A 4UWCA 2ITPA 4QO9A 1BKXA 4O7TA 1JQHA 3IECA 4F1OA 2VTPA 4GYGA 5CU3A 4YJTA 4EOPA 4FTCA 4II5A 4FKRA 3A8WA 3FMEA 1BL6A 3K2LA 4FSUA 3KVXA 2CNQA 1HOWA 3FLZA 3QCQA 4PPCA 3BRBA 1H07A 4U42A 5FXQA 3C1XA 4YHTA 4E7WA 3C5IA 4DG2E 2ZV9A 2A4LA 3NUYA 2WFYA 4GJ2A 3UJGA 2SRCA 4LGHA 2CKOA 4BYJA 2XEYA 3NIZA 5CZHA 5TOZA 3GU8A 5CSPA 5EOLA 4EUTA 2WMQA 2OXDA 2QOOA 2VRXA 3HMPA 5CAPA 2WO6A 4RJ8A 1LUFA 1OBDA 4NT4A 3HV5A 4BFMA 3JYAA 4MVFA 4E8AA 4GCJA 4MNFA 4BKYA 4G1WA 3A62A 4BZNA 3BE9A 5BQ0A 4ZTSA 2WTKB 3L8PA 3VUIA 2C6OA 4ITIA 3NAYA 4FEXA 4O81A 5ETAA 1Q4LA 1VEBA 4C35A 3KN6A 3CCNA 1ZYSA 4FV7A 4PP7A 5C8NA 1CMKE 1H00A 3L8VA 3D83A 1CDKA 1UA2A 3OBJA 3W2PA 4WD5A 5DRDA 1BX6A 4I1ZA 4BDEA 1O6YA 2XMYA 4FOCA 4OTHA 4CYIA 3ATSA 5ANDA 3H9FA 4D1SA 1OITA 3OW4A 4JDHA 2PZ5A 3CJFA 4AA4A 5IQGA 2W5AA 3MVMA 3SXFA 5LARA 4FMQA 1ZOEA 5KMKA 3D5XA 4ZZNA 2Z60A 5CENA 4F9CA 5D11A 3PFQA 3OCGA 2HCKA 4FKOA 4DH8A 4G6NA 3KK9A 3QKKA 2A2AA 2UVZA 5CASA 5JRQA 4UB7A 5EM7A 3QLGA 5CSXA 5KKRB 5M55A 4ALWA 4IB0A 4FSNA 3H3CA 4MAOA 1OVEA 4PQNA 5KZ0A 4PDYA 5EI2A 4V05A 5HNBA 4ZMEA 3D94A 5J7BA 1R0PA 5F1ZA 1O6KA 4AT3A 2VX3A 3U8WA 2XA4A 3VJNA 4BCQA 3OT8A 5AX9A 4KRCA 3KY2A 4DG0E 1J7UA 5DOSA 3F3ZA 4IIRA 2VO0A 3MV5A 4YC3A 4KKGA 3TG1A 2Z7SA 2BPMA 4ANNA 4ZZMA 3ZEPA 4K6ZA 5JGAA 2W0JA 4QYFA 1OL5A 2UW6A 4C7TA 5LXMA 2A19B 4GVJA 3PZHA 4B99A 5J5SA 5FWKK 5JFWA 1TKIA 4IX3A 3BZ3A 1O9UA 3LW0A 2ZJWA 2WTKC 3QKMA 3ZO4A 1KUTA 2ZDTA 1VJYA 2RL5A 5DT3A 4FTKA 3OOMA 3BYVA 2HYYA 3QD0A 5ETFA 3VS5A 3PLSA 1XBAA 4R5YA 3UG1A 4K11A 5AMNA 5TKDA 5AADA 4XG9A 4OTGA 5DHJA 1GZOA 3UQCA 2X2MA 1OKZA 2NO3A 3Q52A 4P7EA 4J99A 2OIDA 1GNGA 4D2VA 2J5EA 5KMLA 3FQHA 3DLZA 3LCTA 3NMUF 2FSTX 2PZYA 4JR3A 2BDWA 4ZXTA 1IA8A 2UZLA 4I3ZA 3ZC6A 4QP6A 3QZIA 3C0GA 4H39A 2P55A 3WYXA 3IS5A 4D9TA 3E8CA 4QMLA 4PMPA 1GIHA 3G2FA 2QO9A 2RFEA 4JRNA 4BDJA 4JS8A 4D5HA 4L9IA 3AG9A 4D4YA 4GEOA 5DLSA 3QGWA 2F57A 3JUHA 3FC1X 1ZYLA 4G6LA 3L9LA 3RNYA 3DJ7A 4FKLA 1RW8A 4CTBA 2JD5A 3O8TA 3DU8A 4EWQA 3W1FA 3C13A 2JDTA 1IASA 2WMAA 4K2RA 4PY1A 4XRLA 2O0UA 3ALOA 2H9VA 2OKRA 4QYYA 3ZXZA 2REIA 2R9SA 1YHSA 3VBTA 3F2AA 4P90A 4NFMA 5HVJA 4WO5A 4L3PA 4O86A 3KVWA 3TT0A 5HLPA 3RZFA 1KE6A 3CY3A 3CXWA 2WMVA 4DFYA 5J5TA 4JBVA 3DK3A 2EB2A 3U6IA 3QU0A 2F7ZE 3CTHA 1GY3A 2AC3A 1J91A 2XCKA 3HV7A 1U54B 3Q9WA 3RCJA 3W2OA 2W5HA 4ZAUA 3LE6A 4F6UA 1U54A 3R8PA 4W8EA 3ZHPC 5L8LA 2BDJA 4GSBA 1O6LA 4UWYA 5AV1A 3ZO3A 2I0VA 4RX8A 2KTYA 4H3BA 4W4YA 4KBCA 5IH6A 3R63A 4F7JA 4D2RA 1APME 3IDBA 1JVPP 4ZTQA 4ZLZA 4R77A 5CXHA 4J7BA 5AM6A 5HIDA 2JAVA 2O3PA 4PP9A 1B38A 2IZRA 2X7FA 4G6OA 4MYGA 5AUZA 3R7OA 3SC1A 4TL0A 5IZFA 2J6MA 1JBPE 5FDPA 3RP9A 2FSMX 4X2GA 4YO6A 2BKZA 4BDCA 3HRCA 3PA5A 4D58A 2ZV7A 2UZTA 3QHRA 4W4XA 4PNIA 3QTUA 3UP2A 5CY3A 3ZLWA 2BRHA 5CS6A 4F9YA 2YIQA 3H30A 4XV3A 3RWQA 3TZ7A 2BIKB 2ONLA 3N9XA 5A4TA 2GS6A 4GMYA 4D55A 2FGIA 3RAIA 4IVCA 5LMBA 4O7WA 3EQGA 4BL1A 1DM2A 5FQDC 2C5NA 2BHEA 4PDPA 2UW7A 4Z9LA 1BMKA 4NJ3A 5DR9A 2B53A 3AD4A 3COIA 3NW7A 4WHZA 1DAWA 3PPKA 4BI0A 5HG9A 3ZCLA 2ETKA 5M4CA 3QYWA 3UP7A 4QQJA 4F1TA 5I0BA 3CGFA 4MTAA 2GHMA 2XK7A 2VTOA 3MY5A 4JXFA 2W96B 2PE0A 3QQKA 4FV6A 4MXYA 1P14A 3VBYA 4O0RA 1M2PA 1MP8A 2VO6A 5DNRA 5KMJA 4O82A 3I60A 3TIZA 3R30A 4K8AA 4FSQA 3GCPA 4GFOA 4U41A 4IWDA 1Q8UA 2LGCA 2OSCA 3FJQE 4QYEA 4FKJA 5M56A 4F6SA 3UOLA 5C4LA 3NIEA 4RX7A 1WBPA 4RQKA 2VV9A 4GUBA 4LOQA 4AXAA 4E6DA 5CU0A 2PYWA 1JOWB 4LG4A 3ORTA 3V8SA 3PXRA 1BUHA 1PY5A 3UOJA 4W9XA 4RWKA 2Q83A 2UVYA 4BGGA 4AGWA 2OH4A 3F5UA 2ESMA 2ZYBA 1PXKA 2PHKA 2VU3A 3ORNA 4X6RA 4ZLYA 1S9IA 3VUGA 4XP2A 2HAKA 1QPCA 4LFIA 3F69A 3W8QA 2XBJA 4I94A 3TJCA 2ITWA 2R3PA 1OM1A 1Q24A 5HU3A 3PYYA 4MCVA 5CVFA 3FY2A 2ZOQA 5H8EA 4HNIA 3DPKA 3OC1A 4H3QA 3QLFA 4I5CA 4JAIA 1OPLA 4PF4A 5LQFA 2ONLC 2XJ2A 2XYNA 3C4WA 3DZQA 3FQSA 3QZHA 4FI1A 4FNYA 4CFXA 5LOHA 3FWQA 4PX6A 5HOAA 2W99B 2O65A 1I09A 4ALUA 3IW4A 3ZC5A 2G15A 1CKPA 4OBPA 3RM6A 4YPDA 2WQEA 3MTFA 5L6WL 2XJ1A 2XK4A 1V0OA 3DZOA 4EJNA 4IVDA 1YDTE 3PG1A 4BDHA 4FT5A 3R7YA 2C3KA 3LQ8A 1Z57A 2AC5A 4CFNA 4UY9A 5DVRA 4IAFA 5CWZA 5KMOA 2GU8A 1V0BA 4NFNA 2EXEA 3VRZA 4FKPA 3KMUA 3DAKA 4FT0A 3DDPA 5ETIA 5HE3A 4ANMA 4YSMA 4QMUA 1WVXA 2WEIA 2C6LA 1OKWA 3GU5A 4BHZA 4F63A 3VULA 4FTJA 4BYIA 3EJ1A 4FKUA 4MBLA 2ITVA 4ID7A 2C1BA 1FPUA 3DAEA 4ZJIA 3DV3A 4ACMA 2J9MA 3AT2A 1ZYJA 3COKA 4OBOA 3MH2A 4RX9A 3ZDIA 3HV6A 3I6UA 2C6EA 4OBQA 4WG4A 5EYKA 2C0TA 1AQ1A 3OZ6A 4FEVA 2GS2A 3Q32A 2CPKE 2BIYA 4OTFA 1WBNA 4NK9A 4HPTE 2WOTA 3R28A 2JEDA 2WOUA 5DPVA 1F5QA 3W33A 4ZLOA 4UEUA 4G16A 4YC6A 2BR1A 2B52A 3FDNA 3KGAA 4HOKA 3QHWA 4S32A 1IA9A 2W1HA 5CEOA 1H01A 2PUNA 2PL0A 3BV3A 4FTMA 2ETRA 4LI5A 4EZ3A 5AUVA 4MXXA 5C8MA 4CQEA 2YDKA 2RGPA 4BBMA 1H1QA 5L6PA 4X2FA 4ZZOA 4FIFA 5CF6A 4ZTRA 4RFMA 2IO6A 1SMHA 1Y6BA 4DA5A 5LWNA 3CE3A 4ZEGA 2WHBA 1E1VA 2W1EA 2WB8A 4LL5A 3LFNA 3ODZX 4J71A 3RALA 4YJSA 3FL5A 3V5TA 3TNWA 4I22A 3NZ0A 3HV3A 4L42A 2E9UA 3VW6A 1G5SA 3Q4UA 4BCGA 4D1XA 3RK9A 4IM0A 4F08A 3NYVA 3KL8A 3RHKA 3TI1A 4AN2A 2ITZA 2HWPA 3RM7A 5M4UA 3R2YA 4FZFB 3UO4A 4WG3A 4AW1A 2C5VA 4CYJA 5GJFA 3AC4A 1WFCA 3U9NA 4CKIA 3HV4A 2R3FA 5J1WA 2W5BA 4DF3A 4HGEA 3LAUA 3TTJA 3LXLA 1YXSA 4BTKA 4DEHA 3B8QA 2CLQA 2I0EA 3BQCA 4Z55A 4CG8A 4HJOA 2QKRA 2YM8A 2Z2WA 2BKKA 3GC8A 4LQMA 1H1RA 4L53A 5E9EA 4U8ZA 3QUPA 5E8TA 3N51A 2YAKA 2GSFA 5IA3A 4P5ZA 2V0DA 4G3EA 3ULIA 3AD5A 3AGMA 4FEWA 3PPJA 5HHWA 2IZUA 4Q5HA 4RJ7A 3ZH8A 4WRSA 4YSJA 1PXNA 2Y7JA 2IZTA 1GOLA 4QMVA 3JVRA 4JL9A 3ZFYA 4UMUA 4U9AA 3U54A 3FI4A 4NKAA 4ERWA 1R1WA 3AC2A 3G0FA 2UW5A 4R5SA 3SW7A 3PXQA 3KC3A 1STCE 2UZVA 4KB8A 4FL3A 3VBQA 3EQCA 3LM5A 3R1QA 3T9IA 5BX0A 2CHLA 2PK9A 3BU6A 4TW9A 3ZZEA 3A2CA 4ANSA 3OCBA 5IQIA 1REKA 1A48A 4K33A 4CFUA 5F94A 2X8IA 3EHAA 4FE2A 2OZAB 4G34A 4IE9A 3R1NA 3V51A 3BLRA 3CKWA 4R8QA 2OZAA 3GCSA 4V04A 4QRCA 2QOCA 2VWYA 5I4NA 3FL4A 4YLLA 2XK9A 4AUAA 4OR5A 3PJ8A 4Y72A 3WE4A 4K77A 5IUIA 1J7LA 1Z5MA 3LXPA 1SVEA 5M07A 3MN3A 3P5KA 4C3FA 2XNPA 5TT7A 3H0ZA 2VNWA 4DTBA 5G1XA 1Z9XA 4G3FA 2VWVA 4AW0A 5M53A 2I7QA 3G6GA 4W8DA 4CZTA 3NLBA 2IG7A 2WTCA 3LZBA 2UZNA 4KKHA 3CKXA 3R8VA 4RFZA 2X1NA 4FTQA 4EONA 3KRRA 1RE8A 3QFVA 4XBUA 4FV8A 2XNOA 3JVSA 5M08A 3LCKA 3NWWA 4JG8A 4F7SA 4FV0A 3SD0A 3GT8A 2WQBA 4HYIA 5D1JA 2PVMA 5JRSA 4CRSA 3QBNA 3UIUA 3ROYA 4F9BA 3ZSGA 3O2MA 1S9JA 4BWKA 5IUGA 5DGZA 4JIAA 4ZTHA 2VWUA 4BRXA 4M8TA 4DFXE 5KHXA 4IHPA 1ZARA 5IU2A 2C5YA 3P08A 4GT5A 4FX3A 1LEWA 2B55A 4PMSA 2XB7A 4DEGA 1UU7A 2C0IA 3IKAA 3KA0A 4GYIA 2A0CX 4L3JA 2CCIA 1NVRA 2J2IB 1W8CA 2BILB 3FHRA 4WIHA 1ZZLA 2PVKA 2WQNA 3WYYA 2WMBA 3A4PA 4O7RA 3SG9A 1DI9A 2XM8A 2ITUA 4DCEA 4M84A 5AP7A 3DBFA 3DJ6A 4RZWA 5I9XA 4IWQA 3NUPA 3R02A 3S3IA 1PJKA 2WIPA 4U3ZA 1WVYA 3VW8A 2X4FA 4OAVB 4LMUA 1RJBA 2YACA 3L9NA 1FOTA 4IBMA 3ZU7A 5B2LA 1XH8A 4OTPA 3CR0A 1B39A 3A7GA 4O0TA 3RINA 4ENYA 3R7EA 3MH1A 4BDGA 2QOQA 4D2WA 1OIQA 5D7AA 3IONA 3DXPA 4U6RA 2XM9A 3C0HA 3C7QA 4QNYA 2CNVA 4ZIMA 3DBCA 3PTGA 3O17A 5D7VA 2EU9A 2E9NA 2HW7A 4QQTA 4R3RA 1ZMWA 5HNIX 1KV2A 2OJGA 3ZO2A 3UODA 2BTSA 2AYPA 4JI9A 4EQUA 1G3NA 2WTDA 4C4JA 1ZLTA 4AA0A 1LR4A 4IZ5A 3WZUA 3K5UA 1JLUE 1IG1A 2JIIA 2GQGA 3ULZA 3UZTA 2PULA 3SHEA 1WVWA 4HVHA 4PDSA 1P5EA 5AV2A 3IO7A 4QMQA 4AACA 1WBSA 4FIIA 5CTPA 3CD8A 5AR2A 5FUTA 3O8PA 2EUFB 4HGSA 4RG0A 4FG9A 2CN5A 5HG8A 2WTVA 3FKLA 1PKGA 3F61A 2AUHA 2IJMA 2NRUA 3OY1A 3P86A 4EKKA 3R00A 2PVRA
chains in the Genus database with same CATH superfamily
2FSOX 3EH9A 3FYJX 4I5HA 4N70A 3F7ZA 3FMHA 2BZJA 3RCDA 3MJ1A 5L6OA 2OJ9A 1XH5A 4FV5A 4NM3A 3UDTA 1YWNA 3FXXA 3UDBA 3P79A 3BE2A 4YUQA 1XMMA 4EI4A 2HENA 5AIRA 1NA7A 5EW9A 3DB6A 4A4XA 3R7GA 5CANA 3WARA 4X2JA 4F9AA 1OKVA 3PVWA 4YZNA 2XANA 4UWBA 4AN9A 1BYGA 4O27B 2X7OA 2FSLX 3F82A 2WMUA 3OROA 4M67A 5A6OA 4ZSEA 4QP4A 3QUEA 3GU4A 5G6VA 4F0IA 5AA8A 3EIDA 3Q9YA 5E4HA 1XBBA 3F9NA 2ZAZA 3II5A 3ORPA 2JDVA 4PL3A 3V5JA 3ZXTA 1ZYCA 4DT8A 3QGYA 4CT1A 1RQQA 3ZFMA 3V04A 3OEFX 2W1CA 2Y6OA 4Q2AA 4EHEA 1KE9A 3FZSA 4GRBA 5KBQA 3VWAA 5HTBA 4O38A 2X39A 4CMTA 4ZS4A 5HICA 5HLWA 4IAYA 5A4EA 2CGWA 4JAJA 5FDXA 1DAYA 2QNJA 3HDNA 4K0YA 2Q0NA 4X21A 2BDFA 4FSTA 3NCZA 4EK5A 2YCSA 4GK2A 4IWPA 4PPAA 1W83A 2C6IA 3AGLA 4QQ5A 4YLJA 3TL8A 4EC8A 1OL2A 4Z16A 2PU8A 2R2PA 3DOGA 3F3VA 2EXCX 2WD1A 3LFAA 2O2UA 5D12A 5AM7A 3RNIA 2C3IB 5HZNA 2BRNA 2JITA 2QKWB 3KXHA 2IVUA 3KF7A 1UNGA 4ANQA 4BDDA 1R78A 5DH3A 3PRFA 5DEYA 5HLNA 3QQUA 4L44A 3U6JA 3MIAA 5LVMA 4DHIB 1OZ1A 4XJ0A 3FPMA 1Q61A 3E64A 4TWPA 4XV9A 3W32A 3D14A 5DIAA 3HAMA 2WKMA 2RFDA 4BDIA 4PRJA 5A4LA 5IQAA 3TN8A 3UIBA 4RLKA 2HELA 3QC4A 2JGZA 2XIKA 4FT3A 4CMOA 5IMXA 3LMHA 2R3OA 5E90A 2YIXA 1PMVA 4F70A 4L8MA 5BVKA 4TKSA 3SKCA 2F7EE 3C9WA 4XH6A 4A9UA 4BBEA 3TACA 1KV1A 2CDZA 3KXZA 3PPZA 3VUMA 2G2IA 4BKZA 1W0XC 5AWMA 4C2VA 3UIMA 3R8ZA 4RIOA 4DN5A 5HGIA 5HTCA 4E73A 2W4OA 3ORMA 4X2NA 3GOPA 4WNMA 3HMNA 4U44A 2F9GA 3PXYA 2ETMA 5L8KA 4O96A 4FV1A 5CF8A 3ZRMA 2VTAA 2QG5A 1Y8GA 4IM3A 1UWJA 3FSFA 2B9HA 2NP8A 2QC6A 4MEDA 3EQHA 5AP2A 2VTLA 5CEPA 5BMMA 1P2AA 3VBXA 2PMOX 2RFSA 4DFBA 4I6BA 5CAQA 1P4FA 1MQBA 3PXZA 1VYWA 3FAAA 3EMGA 3LOKA 3QCXA 4I5PA 3LKMA 4O21A 4Y95A 4FTUA 3I1AA 4IX6A 3RPOA 5L4QA 3EQRA 4AE6A 4BDAA 2W9FB 3DXQA 3ELJA 3HNGA 4E4LA 4ZS0A 1A06A 4DEAA 4LV8A 4DT9A 2ZVAA 2OJIA 1BLXA 1NXKA 2UZBA 3S4QA 4AFJA 3NDMA 1OIUA 3KB7A 4FVQA 5CU4A 4AX8A 2JBPA 3I0OA 3LFDA 3QTZA 4BBFA 4BCIA 4QT1A 4G9CA 3VS7A 4B9DA 3HA6A 2R7IA 3KEXA 4QTCA 5J1VA 5JZJA 3O0GA 4FF8A 3KRXA 5CEIA 4QTDA 3DLSA 1ZWSA 3OT3A 1E9HA 1VYZA 4IZ7A 1SVHA 4TYIA 3RKBA 5H3QA 5HO6A 1MUOA 2O63A 4FEQA 2YITA 2XKEA 4QYGA 4PDOA 3REPA 3OTUA 4DYMA 4DLJA 3KQ7A 4EBVA 3D2IA 3ZEWA 3F7WA 3ORLA 2WU7A 2CGUA 3M2WA 4IX5A 1Q8YA 2R64A 4QTBA 1Q3WA 2IWIA 4IM2A 3V5LA 1QPJA 3UC4A 4KSQA 2XIRA 3R01A 5D41A 4ACCA 2PPQA 4D0XA 4IAAA 3ZLSA 4D2TA 2DWBA 3MBLA 4M68A 3L8XA 2BRBA 3EYHA 3QXPA 4I93A 3SQQA 4L52A 4MK0A 3PG3A 4RLLA 3T8OA 3VBWA 3I6WA 4BN1A 4XP0A 3TUCA 4XV1A 3TM0A 3TKIA 4WBBB 4XUFA 1OUKA 2XNGA 2HXQA 3MA6A 2GFCA 4YJRA 3EL7A 3GBZA 4QMOA 5FBOA 2NNWB 1SNUA 5AR3A 4USEA 1YDSE 2UVXA 3FKNA 2X2LA 4JG7A 2PVYA 4F0FA 2JAMA 2PUUA 1RDQE 4MF1A 2Y9QA 2UZEA 4ZSJA 4LUDA 3WF7A 4BCOA 5M57A 5IQHA 1YXTA 4YJVA 3W2QA 3AMYA 3E93A 3I0QA 3KXNA 2ITOA 1WMKA 4P5QA 5HTIA 3NUUA 5KMMA 4BR3A 5LVLA 5TO8A 5LVNA 2J5FA 4RVKA 4HGLA 3OHTA 1Q97A 3S2PA 3VQHA 4G3CA 3PSDA 3NVKI 5BVOA 3F3WA 4FYOA 4KD1A 4KA3A 1YW2A 4Y46A 4UALA 3LFCA 3GCQA 4KKEA 3OXIA 4PNKA 4FSZA 1REJA 3MPTA 2WMTA 3QA8A 5C01A 4BWXA 5GJDA 5A54A 5GHVA 5FEQA 2YM7A 4JLCA 5FD2A 4AZFA 4B7TA 4EEVA 5F20A 5E8YA 4ANOA 4BCHA 3A7FA 5F9EA 4JOAA 4CV9A 4E4NA 4LRKA 4TYGA 4EOOA 3EFWA 2OWBA 5EHYA 1FVRA 4L6QA 1ST0A 5CVGA 1WZYA 1YHWA 4AZVA 3E8DA 2ITTA 2UW9A 3C4FA 1KSWA 4FR4A 5AEPA 3DKOA 1TQMA 4KS8A 4DH3A 4IB5A 2H8HA 3V6RA 3O50A 4O7VA 3M42A 4M69B 4NM7A 5DR6A 4R1VA 4Z3VA 5LMKA 3HAVA 1K9AA 4N6ZA 4J98A 4JMQA 3PY3A 4M69A 4A4LA 4L7FA 5HNGA 4KIPA 4E20A 2AEGA 2OJJA 3R73A 5HO7A 3SRVB 3QQFA 4YJPA 3R0TA 2GNIA 5GZAA 4E26A 4EH7A 3CQUA 3PFYA 3SRVA 4ZTLA 2OLCA 3VQUA 2YIYA 3PJCA 3TXOA 2NYAA 4DHZA 3Q9ZA 5E8WA 4C4EA 1EH4A 4X2KA 5AR5A 1NVQA 1L8TA 5ANKA 4E5BA 4IB3A 4R78A 2BMCA 3TDVA 3LFFA 2CGVA 5EH0A 2ITQA 2PVLA 2XNNA 2VTJA 3TZ8A 4N6YA 4CG9A 5I9UA 2B1PA 3CGOA 1W2CA 3EOCA 3SXSA 5JN2A 4HVDA 5KNJA 2WU6A 3A7IA 5EYDA 2OZOA 4ZY5A 2I1MA 5I9ZA 1XMLA 3NVMB 4I23A 3FE3A 3KXGA 3SAYA 3F3TA 3D15A 4RX5A 2GNJA 3FQEA 3R7VA 2C1AA 3E3PA 2YFXA 3R04A 1H1PA 5CEQA 3A7JA 3LM0A 3BEGA 3BWJA 2J0LA 2BHHA 5AP6A 2C6DA 3N4TA 1CSNA 3TTIA 4C33A 1YXXA 4JDJA 1UU3A 2GMXA 1V0PA 2W06A 4FIHA 2JKOA 4A06A 2JC6A 3GEQA 3O7LD 2X81A 3TZ9A 1UVRA 5A4QA 4TRLA 3FKOA 3VBVA 2ITNA 3PDTA 3MB7A 3QQGA 4PL5A 4LDTA 4IAZA 5LMKC 3D7TB 4YR8A 5K5NA 2ACXA 3PJ3A 1M2QA 5M51A 4O0YA 2PUPA 4WG5A 4ASDA 3D7TA 1YDRE 4NTTA 3ZFXA 5CU2A 2VGOA 4ZY4A 2V7AA 4BJJB 3C5UA 3QUDA 4NW6A 4BJJA 2J7TA 1UU8A 1KE8A 2PY3A 3FZOA 3D5VA 4TNBA 1GZKA 5HORA 1J7IA 5IQBA 4S34A 3U55A 3ALNA 3JS2A 3NR9A 2PZIA 3QRTA 1FBNA 1OECA 4FIEA 3HDMA 5ANGA 3ANQA 5GINE 3CIKA 1TZDA 3MTLA 4O84A 4B8MA 4XLIA 5DBXA 4O91A 1KE7A 4EYJA 4DCAA 2R3GA 4O2PA 4FTTA 5EW8A 5FXRA 2BZKB 2GNLA 2OFUA 3P23A 5IKWA 5BYZA 3DQWA 4A9RA 5HU9A 4D4VA 2GDOA 4YZBA 5E8XA 2X9FA 3PP0A 1XR1A 4EORA 4W9WA 4MNEB 4CXAA 4FBXA 3G15A 3WZEA 3FLSA 3GU6A 5FP5A 2XBAA 4FTNA 5EYMA 4MNEA 4DLIA 3QRKA 2F4JA 3LFSA 4JNWA 2YM6A 1H28A 3OCTA 2JKQA 5AA9A 2H6DA 3P5JC 3B2WA 1Q62A 3OWLA 1LP4A 4FV9A 3VS4A 3MA3A 4EK8A 4EYMA 4G5PA 2FH9A 2V22A 3FSKA 4C4IA 3R9OA 4RC2A 5FG8A 3FLQA 5DWRA 1AGWA 5E8UA 4FOBA 4UMQA 1H0WA 3A99A 3POOA 4IXPA 3ZONA 2CKQA 2PMLX 3KN5A 4CD0A 4GK4A 1W2FA 2F7XE 3OCSA 5HBHA 3TNIA 3FYKX 3LCDA 1ZYDA 1JKLA 3E7VA 2IW9A 2FO0A 2RG6A 3EFLA 4I0SA 4CV8A 4I6FA 4DC2A 4APPA 4YGAA 4K18A 2V62A 3I7CA 3G6HA 4U7ZA 4B8LA 3OS3A 2YA9A 4L45A 2B9FA 3ITZA 3VUHA 4JVGA 1FVVA 2B9JA 3HP2A 3K3IA 3Q04A 4GK3A 3EQBA 4OTRA 4UXQA 4EZ5A 2WZJA 5L2WA 2GQSA 4FEUA 5EK7A 3L1SA 2VO3A 2DUVA 2J0JA 4RJ6A 4LYNA 5AUYA 4NWMA 3HMOA 3W8LA 5FEDA 3IW5A 4MD9E 3FLWA 5E8ZA 4OAUC 2C69A 4V0GB 2XP2A 2G01A 1JSUA 1U5RA 2HZ0A 2QLUA 3DQXA 4V0GA 3DTWA 3RPVA 2CKPA 1OL7A 5ANIA 1OGYA 3C4XA 3L9MA 4NH1A 4EHZA 2QODA 4OW8A 4DH7A 1FINA 2PE2A 3GC0A 4I92A 4DFZE 3KFAA 4DEBA 4ZJJA 4O7SA 4E4XA 3D2KA 3NYOA 3D9VA 3MPAA 3P78A 1CKIA 5AAFA 3UMWA 3R2BA 3RK5A 5EDPA 2J50A 3SVVA 4D4RA 5JFXA 2Y4PA 4RT7A 2VUWA 2ZV2A 4RRVA 5L3AA 2C5XA 3CTJA 2BAJA 2Y4IB 4JIKA 4JQ7A 1G8KA 4WRGA 3AQVA 3MPMA 4RJ3A 4WNPA 2X8DA 4ITJA 4S2ZA 4BVUA 5JKGA 2X6EA 2YISA 4QP1A 1KOAA 5KUPA 1YHVA 3GQIA 4IB1A 2QR8A 4BGQA 1SNXA 3WE8A 4QMZA 5AP4A 4O4CA 2XZSA 3QTRA 4ZSAA 1XH6A 3FMLA 4DTKA 4DH1A 3CLYA 2CN8A 2XH5A 1ATPE 4FSRA 4YTFA 3GI3A 4FNXA 4I21A 1LPUA 3RAHA 4C59A 4F7NA 4YZMA 3W0PA 1MRYA 4DGOA 3BGPA 1GZNA 2WXVA 3NPCA 5HVYA 3MH0A 4C2WA 3POZA 2OO8X 4U45A 4A9YA 1ZY4A 3TNHA 3ZM9A 4BCFA 3EQFA 1XH7A 1K2PA 1TQIA 2R3KA 4YP8A 3RHXA 3N4UA 3QAME 2IW8A 5E1EA 4PV0A 3QQHA 3SV0A 2XALA 4I5MA 2JKKA 4FSMA 3WF5A 4PTCA 4DE4A 3E8EA 3QTSA 4BY9E 5J9LA 3ERKA 4YNOA 2VD5A 2C47A 1Q8TA 5BVNA 4DFUA 3CEKA 1B6CB 4PTEA 1PW2A 3DK6A 1OL6A 4RZVA 5E92A 5AUWA 5T3QA 3R8UA 3G9NA 3QQLA 4H3PA 4PUZA 3QCYA 1CM8A 4EH9A 5L2IA 3UYSA 4GV1A 2KULA 4D9UA 1IRKA 3DGKA 1OPJA 3I4BA 2VAGA 5EOBA 1Q5KA 4YURA 3RPRA 5AAEA 4FKTA 3RPYA 3BELA 3IG7A 4YTCA 3W55A 1J3HA 4EK3A 5A14A 2EB3A 1U59A 4FNWA 2Z8CA 5I9YA 3QZFA 1DS5A 2J0KA 3Q5ZA 4NUSA 4I4EA 1M7NA 1UNHA 3V8TA 4A9SA 5HE1A 4I6QA 3RJCA 5EI6A 4F64A 3QD2B 4WNOA 4IAKA 2QHMA 2ZV8A 2OXYA 5H2UA 1YKRA 2JFLA 3P9JA 1XKKA 3UVQA 2IW6A 4IAIA 3PVUA 3PWYA 2Y4IC 2PVJA 4NIFB 3G5DA 4FKIA 4WBOA 2BCJA 4A07A 2PUIA 3DNEA 2H96A 3E63A 5IQFA 2XUUA 4NIFA 4ALVA 4IH8A 4HVGA 3I5ZA 3UGCA 2RG5A 2QOFA 4CCBA 4IC7A 3PVGA 3BPRA 5E8SA 3PWDA 3WF8A 3NUAA 1JNKA 4DBXA 3NEWA 2Z7LA 4RC3A 4ORKA 3OTVA 3P1AA 1G8AA 4R7IA 3OW3A 4BCJA 2HK5A 1WAKA 4G9RA 2C0OA 4O0XA 3AKKA 4HYHA 3P4KA 4AGUA 3GXLA 4BC6A 4QTEA 3VS0A 3BEAA 4AQCA 2X9EA 4AU8A 2QVSE 4XEYA 4D1ZA 1GAGA 2Y6MA 3HKOA 2ZMDA 4U79A 4M13A 1AD5A 4G3DA 2X4ZA 4DH5A 4AW2A 1ZMUA 4BWPA 4F9WA 1MRVA 3OUNB 5JFSA 4BHNA 3FEGA 2E9OA 3FMDA 4DINA 3LVPA 1ZRZA 3R71A 5BUIA 1URWA 4M14A 4U81A 1H1WA 3GQLA 4RWIA 3LCSA 3ZUTA 3HA8A 3EKNA 2ERZE 4R6VA 5TE0A 2YLEA 3MFRA 4CKRA 2YWVA 2VWBA 3QF9A 5CNNA 2VTQA 4ZY6A 5K4IA 5C9CA 1YWVA 2BRGA 1YQJA 2G2HA 2J90A 2OJFE 3LLTA 3ZRKA 3FLYA 4GU9A 4KIOA 3D5UA 3G51A 2UV2A 4CT2A 3LXNA 3HGKA 4QYHA 3OXZA 3BI6A 5IPJA 4Q5EA 3WILA 3COMA 4JBQA 4QNAA 3VONA 3JXWA 4WT6A 2XNBA 3BCEA 2WIHA 3AC1A 3Q2MA 3DS6A 4HVIA 2ZDUA 2J0MB 2HXLA 5T6KA 3FMNA 1PXPA 4BICA 4YLKA 3A60A 4N57A 4EH8A 3BBWA 4O4BB 4DGMA 5LVOA 4FZ6A 4L46A 3RTPA 5JEBA 5BVDA 5H8GA 2P3GX 4GL9A 4FTIA 3RK7A 4ZTMA 4O83A 3MFSA 3UO6A 5AP5A 4CSVA 2P2IA 1CTPE 2VX0A 3VS6A 4JQ8A 5DI1A 3NCGA 3BX5A 5FTOA 5HEZA 2CSNA 1IAJA 2YERA 2HZNA 5FP6A 2IVTA 3FV8A 4RWLA 3PLAE 1Y8YA 2W1DA 3VJOA 3FZTA 4KSPA 4NTSA 3KMMA 3NNVA 2E9VA 1L3RE 3M1SA 4MXCA 3SLSA 4FV4A 2O5KA 5CT7A 4F6WA 4G17A 2XAOA 2XS0A 2PE1A 3ENHA 3AMBA 4FTOA 4LUEA 2VTMA 2VWZA 2XRUA 5AUUA 5KMIA 4D5KA 1Q8ZA 5JH6A 4HW7A 2Y8OA 4UZDA 4RFYA 2EVAA 2ZMCA 5AV4A 1M14A 4ITHA 3BHVA 3HUCA 4EWHA 2E2BA 4FKQA 3LMIA 1H1SA 3S95A 3OP5A 1A9UA 3U6HA 1SYKA 3CC6A 1BI7A 2P0CA 2QLQA 4NM5A 4UZHA 3RMFA 3PE1A 4MD7E 3TV4A 1R3CA 5K4JA 4K9YA 3VNTA 1VZOA 2IZSA 4CFMA 2O64A 3FHIA 5ACBC 4EOIA 4FTRA 4FV3A 3HECA 3IDPA 4WUNA 2QQ7A 3OUKA 5DMZA 1JSTA 5EFQA 4CQGA 3R1YA 5C26A 1ZZ2A 2I40A 4G31A 5JK3A 2UUEA 2PWLA 2VTSA 3CP9A 4J8MA 3EFJA 1NVSA 4JG6A 5AIKA 2J51A 3WZKA 3NYXA 4RPVA 5GIOE 5GNKA 4BDKA 3EN7A 3JY9A 3PIZA 4U40A 3BLHA 3G0EA 1JKSA 5GZ9A 2WQMA 4IDVA 4O7YA 2JDSA 3LPBA 2BTRA 3ET7A 2JLDA 5CEMA 5CAVA 4EOJA 5EM6A 3BWFA 4ACDA 3UNZA 4O1PA 1SZMA 3MB6A 3RPSA 2YHVA 3AD6A 4UMTA 4J1RA 1YRPA 2WQOA 2P4IA 5M4FA 2QURA 2UW4A 5EQEA 4B6LA 2X2KA 1CKJA 4AGCA 4IJ9A 4Y5HA 4OLIA 3TEIA 4C57A 3TYKA 2PVFA 3EN4A 3QRIA 3Q9XA 3BYSA 3KCKA 5AP3A 3MI9A 4YTHA 4E1ZA 5BYYA 4RIYB 4TNDA 3QTIA 3MS9A 3DT1A 4RIYA 3W2SA 4M66A 4WKQA 1PHKA 5BVWA 2B4SB 3GNIB 3R9NA 1YI6A 4S33A 4EK6A 3CSVA 5JZNA 4UXLA 5JSMA 1IEPA 1K3AA 2BZHB 1X8BA 3H9RA 4UMPA 4NW5A 5KMNA 4U80A 4IJPA 5AV3A 4NSTA 4C34A 4BI1A 2CCHA 3CQEA 2HZIA 3OXTA 4O1OA 2XARA 2WELA 5AFVA 4U0IA 2JBOA 2R7BA 4GFMA 1WBWA 4AOIA 5FTQA 5BYLA 3PE2A 3H10A 4FIJA 1JKKA 5AP0A 3Q5IA 1LEZA 1PMUA 2WTJA 4CTCA 3JR1A 4DG3E 3OY3A 2R3IA 3W0RA 4FUXA 2GHGA 2B9IA 3TWJA 1OKYA 4H1MA 3QTQA 2YABA 4XYFA 3IDCA 4KNBA 5FM3A 2LAVA 2OXXA 5IA2A 4BDBA 2IPXA 4BCMA 1XH9A 1Y6AA 5HG7A 3PY1A 2GNHA 4FZ7A 2F49A 3CTQA 4EL9A 4A9TA 2W05A 5JFVA 3R22A 4MHAA 5LCKA 4FGRA 1KE5A 2BVAA 3NW5A 4BZOA 3PVBA 2YJRA 4OTDA 4C4GA 2YM4A 3LXKA 3A4OX 2VWWA 3MJ2A 5DT4A 3UTOA 1OIYA 1BI8A 2H34A 4FL2A 3VRYA 1MRUA 3QTXA 4AZEA 3DK7A 3DA6A 3ZO1A 4CEGA 3WI6A 3E5AA 3DFCB 2WTIA 1J1BA 1JSVA 1R39A 4JX7A 2BRMA 3DAJA 3TKUA 4HPUE 2I0HA 3WBLA 3OMVA 4S31A 3GB2A 5CSHA 4PMMA 5CT0A 4BCPA 2R0UA 5A6NA 2V55A 4EUUA 3MY1A 4MBIA 2XRWA 2G2FA 2GFSA 4YJUA 2OF4A 4HCTA 3UVRA 4RC4A 3GU7A 1OB3A 4X7QA 2DS1A 4YZCA 3CY2A 4TWOA 3VVHA 1HCKA 1Q3DA 2F2CB 3KU2A 5HBJA 2ITYA 4L01A 5DR2A 4BIDA 5BVFA 3COHA 3FZPA 4BZDA 3ID6C 1PMEA 4MXAA 5HI2A 1U5QA 3ZS5A 4FT7A 5EQYA 4GUEA 4GU6A 3BYMA 4FK3A 4KBKA 2PVHA 4FKVA 3AT3A 1M17A 1OI9A 3DTCA 3QKLA 2JKMA 3GOKA 1IAHA 4MQ2A 4YTIA 3IOKA 4F09A 4O0UA 5DE2A 2YZLA 3GCUA 5JMSA 3U51A 5EQPA 2UZWE 3F5GA 2XKFA 3QWJA 4O0VA 4RMZA 4CFWA 3OWPA 2OH0E 2DQ7X 3UYTA 4I41A 1OMWA 2ZM3A 3VUDA 5HVKA 3ACKA 4LV5A 5BVEA 2ZFYA 1SM2A 5IEXA 5DFPA 3TMOA 1FMKA 3H0YA 4QMSA 4TZRA 2QOHA 3DJ5A 3QYZA 4E5AX 4J97A 3RGFA 1GIJA 4G2FA 4IC8A 4XG3A 5CX9A 4P2KA 3ZLXA 2GQRA 5CZIA 4XRJA 5GJGA 5L2TA 3ZUVA 2WMSA 1VLRA 3MVJA 4C62A 2ZM1A 3FPQA 1YI4A 5B0XA 2OFVA 3NYNA 4AW5A 5DG5A 2HWOA 2JIUA 2XNEA 1YXVA 4FC0A 1YVJA 4N4SA 4BTFA 4ASXA 3EWHA 5HCXA 4ANLA 4AOTA 4OT6A 4IMYA 2GPHA 1H27A 1UV5A 2G1TA 5ETCA 3TDWA 3HVCA 3NUNA 4XLVA 2QONA 2ZM4A 2UW3A 4FA2A 4IANA 3HMMA 3WZDA 3H4JA 3SGCA 3KF4A 1KOBA 5A4CA 1PXLA 4L00A 2VTHA 3HLLA 1PXOA 2CMWA 3MFUA 4OUCA 3WIGA 3EB0A 4AZWA 3I5NA 4BF2A 5TF9A 4EK4A 4R3PA 4U43A 4QEBA 1PYXA 3EZRA 3KKVA 4TN6A 4F0GA 2XEZA 4P4CA 3DBEA 3UQFA 4KUJA 5KKRC 4Q9SA 3SOAA 4ARKA 4MBJA 3QALE 4GG7A 4QMPA 5E91A 4R7HA 5AR7A 3SOCA 4CLJA 2VTIA 2OW3A 3OEZA 3ZYAA 3QZGA 3ACJA 2VGPA 3BYUA 5I3RA 4LMNA 3QX2A 3LIJA 3PJ1A 3D7ZA 3NAXA 4FRFA 3FXZA 1XJDA 3W2CA 4EHGA 3GENA 3FC2A 1TVOA 3SA0A 4RIXB 1XH4A 2C6KA 2CJMA 3EYGA 5CI6A 4RSSA 3F88A 3KULB 3FXWA 4RIXA 2BFYA 2YEXA 3F2RA 5DA3A 3KULA 2RF9A 5EW3A 3U9CA 5BPYA 3EN9A 3MSSA 4C4FA 3NGAA 4I4FA 2WMRA 2X6DA 4TTHB 4WSYA 3VS2A 2W17A 2UW8A 3FBVA 4NYEA 2PSQA 3MW1A 3DNDA 4LGDA 4MH7A 4YHFA 3AXWA 3EZVA 5AR4A 4DITA 1Y57A 3LCOA 4OT5A 2JIVA 3KCFA 4C8BA 3Q3BA 2HZ4A 1T46A 3JY0A 4GFGA 5CQWA 4JQEA 5EDRA 3VS3A 4E93A 1OGUA 5CAOA 4M15A 2A27A 3DXNA 3Q60A 3MIYA 4RVLA 3TKHA 4JJRA 4GIHA 2YIRA 3NX8A 4YPSA 4FGBA 3A61A 5FRIA 4ANBA 5ICPA 1PKDA 3A8XA 3MGYA 3B8RA 3LLAA 1U46A 4MWHA 2W1GA 3LJ0A 4WUAA 4BTMA 3U4UA 2JFMA 3F3UA 2BALA 4YBJA 4MKCA 5M4IA 3F5XA 3UQGA 4TWNA 2W9ZB 2FA2A 3C50A 3EQIA 5I3OA 3ZBFA 4XG6A 4MF0A 3V5PA 3NUSA 4WNKA 3IW7A 4PWNA 5BMSA 5HD7A 3PA4A 2FVDA 2YM5A 4NJDA 3UPXA 2BAKA 5E8VA 3VUKA 4OTQA 2XK3A 2QO2A 3AOXA 2IVVA 5H8BA 5IG1A 2R3HA 3HYHA 4XS2A 3TUDA 1J1CA 3WOWA 2R4BA 4I20A 3MY0A 4FTAA 4ZK5A 2I0YA 2RFNA 3OD6X 2OG8A 4AWIA 3PP1A 2ZB0A 4IFCA 3RZBA 4CVAA 4ZJVA 3UOKA 5C03A 4AE9A 3AC8A 3NUXA 5KCVA 4GG5A 1QL6A 1UNLA 1ZXEA 2OBJA 3UVPA 4CMUA 3BL7A 2PZPA 4OTWA 3HL7A 1W84A 3MDYA 1XO2B 4XMOA 4FKWA 4C02A 3UNKA 4C58A 3QXOA 3QX4A 5HE0A 1R0EA 4DTAA 5HCZA 3F5PA 4FIGA 4M7IA 4PMTA 4L68A 2J4ZA 3QCSA 5HESA 5HIEA 4FVPA 4QP3A 1ZMVA 2GNFA 4JX3A 4YO4A 1PRYA 3LMGA 4GS6A 2R0IA 3PIYA 4KWPA 4EOLA 4Q9ZA 5JGBA 2EWAA 4QMMA 3LJ2A 4FVRA 3V8WA 3BLQA 3CPCA 3IGOA 4XV2A 2X8EA 3K5VA 4D4SA 5IA0A 4EOKA 3W0SA 2VTTA 4TWCA 4D0WA 3KRWA 3HRBA 4FKSA 4JT3A 4LRMA 3CD3A 3ORIA 2IN6A 1FGKA 3ZDUA 5HX6A 3HRFA 2X0QA 2JDRA 2QU5A 4YJNA 3R9HA 2CNUA 3R1SA 4G3GA 5AX3A 4EOQA 4H05A 3OOGA 2WNTA 2X0PA 3TNQB 4ERKA 4NL0A 4V01A 3ANRA 2UZOA 2W1IA 5KBRA 3AKLA 1DI8A 4QDVA 4O4EA 4YNEA 4WSQA 4Z7GA 3Q6UA 5KE0A 4YMJA 3OF0A 1H24A 3BHYA 2GNGA 3QA0A 4QP9A 2X0GA 3I79A 3UC3A 1OBGA 3H9OA 3NRMA 4RJ4A 3D5WA 3L9PA 4WA9A 3EFKA 4RA4A 3HX4A 3FI8A 3HZTA 4JDIA 2ITXA 3ZLYA 1UWHA 2G9XA 3ZM4A 1FMOE 3ZZWA 5AJQA 1Q8WA 4AF3A 3PRIA 5IEYA 3ZUUA 4AN3A 3O96A 3P7CA 3UPZA 5JQ8A 4U5JA 3NW6A 3G33A 3VN9A 3V01A 4AZSA 4G5JA 5CYIA 4EKLA 5J9YA 5JQ5A 2HOGA