3K3JA

P38alpha bound to novel dfg-out compound pf-00416121
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
348
structure length
329
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title The Design, Synthesis and Potential Utility of Fluorescence Probes that Target DFG-out Conformation of p38alpha for High Throughput Screening Binding Assay.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 329
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3k3jA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3k3jA01
4DH3A 1RE8A 1PXOA 4GG7A 1MQBA 3TZ8A 4BZNA 3BQCA 4C36A 4AX8A 4OTQA 3BE9A 2GQRA 2ZMCA 3VHKA 3D4QA 4DH1A 4DG3E 2WMVA 4G17A 1FINA 4MD9E 3F66A 3SXFA 3RM6A 4QQ5A 3JYAA 4MD8E 5L2SA 4FL2A 4C4GA 3KMWA 3D5WA 4O0WA 5HU9A 4JR3A 5AM6A 1UNGA 4DTBA 3HP5A 4BCIA 4EWQA 1OIUA 3BIZA 4FF8A 5AUZA 1U4DA 5JH6A 3DPKA 4FIGA 2PVMA 4AACA 4AZSA 2WEVA 3SQQA 4BL1A 4M3QA 5K0XA 3H0YA 3Q2JA 4IJPA 1B38A 4DN5A 2QKRA 4IB0A 3ZONA 2OLCA 2C6MA 1BI7A 2ZB1A 3EIDA 4O84A 4FKGA 3DBEA 1LEZA 3VRZA 3Q9YA 4CV8A 2EWAA 4ZLYA 4ACGA 5FDXA 2B1PA 4O22A 4X7QA 5DMZA 4I3ZA 4O21A 2UZOA 3W55A 3DAEA 1DAYA 1Q61A 3O17A 4XOZA 2OFUA 1ZZ2A 3N4TA 2W1EA 3HLLA 2ZYBA 5HE0A 3I5ZA 5L2TA 4CQEA 3IW6A 4J95A 4PRJA 3UODA 4LI5A 4BDEA 1JSUA 3UG1A 2ITXA 5JRSA 4ANOA 3GU8A 5K5XA 3R9HA 3IW5A 3NYNA 4RJ7A 4QMQA 4FVPA 4IFGA 5LARA 4F7SA 4O6LA 4BWXA 4DITA 3V8WA 4RFZA 3UDBA 5I9ZA 3U6IA 1F5QA 4F9AA 4J7BA 3C4ZA 2PUIA 4DEBA 4Q9ZA 3IQ7A 2FH9A 4EZ3A 3BHHA 4JBOA 5FXSA 4XHKB 4AP7A 3CY3A 1UWHA 4MCVA 3A8WA 3E3BX 1YHWA 3FMKA 3Q96A 4RFMA 2A4LA 3SAYA 1UA2A 3BX5A 2JKKA 3O2MA 5AR2A 3VBXA 3PA5A 2CKPA 4L53A 2VNYA 2WGJA 3MH2A 3D5VA 3KL8A 4DFLA 5IISA 2VWYA 3KULB 4F0GA 1H1WA 4EOLA 3KA0A 2C5VA 3DAKA 4XG7A 3PLSA 4G31A 3Q60A 3UP2A 3ZXZA 4F70A 2XH5A 4YBKA 5HCXA 3FDNA 4BDBA 4B6LA 4MXAA 4HVIA 2IWIA 3LFBA 1PJKA 4NW6A 1YOJA 4FTIA 2PVJA 3AOXA 3LHJA 4W8EA 1ZYDA 4EOQA 3VS4A 3EB0A 3OC1A 2E9OA 2HWPA 4BCNA 4FV7A 2JDVA 4AOTA 4GT5A 4USDA 3SC1A 2OKRA 2J0KA 3TT0A 3SW4A 2C47A 4KBCA 2OJJA 3UQCA 3VNTA 2J0MB 4ZSLA 4JQ8A 2IW8A 1XH5A 2R3KA 3S0OA 4XLIA 4AA5A 3ET7A 2VWWA 2OF4A 4CLIA 4AZWA 3RINA 3KF4A 1OL7A 5GJDA 4E4NA 2C0IA 1WMKA 2BR1A 1OIQA 2OJFE 3C0HA 1Q62A 2P2HA 2BRHA 3R1NA 4FKIA 1H1PA 4FV9A 4NYEA 5F20A 1SVGA 2RGPA 3CTQA 3NW5A 2W9ZB 2WO6A 3C51A 4IAFA 4FTOA 3TTJA 3UIUA 2QURA 2PVHA 3PG1A 1QPDA 3A7HA 3RZFA 4M0YA 3EOCA 4OBPA 3UZPA 3R71A 2PSQA 5FXQA 4TNBA 4JAIA 2PZ5A 2BHEA 3JPVA 4CZTA 2XNGA 1XBAA 3F9NA 5FBNC 3VUGA 4KRCA 3SXSA 2RFNA 3F3VA 4NFNA 1KE7A 4RFYA 3CXWA 5TOZA 3VQUA 3TG1A 1UU9A 3BBWA 3QQLA 4FKVA 4RRVA 5EDQA 2Y4IC 3VULA 4FV4A 4KABA 5AAGA 3BLRA 5C9CA 4FODA 1XWSA 5CEIA 1GZOA 5EHYA 3LKMA 3ZHPC 1YQJA 3KRWA 2WTCA 3S95A 4YZ9A 4V0GB 3O8PA 4JJRA 5DWRA 4BBEA 5CALA 4YGAA 4WRSA 4KA3A 4QP2A 5M09A 4O0SA 4QTEA 3P7AA 3E88A 3C9WA 3HL7A 4NIFB 3OXZA 4DC2A 2GNFA 2OO8X 2W1DA 3OCBA 3O8UA 3BHTA 1Y6AA 3L8VA 3U51A 4BCGA 2QU6A 4FG7A 4FVRA 3ZFMA 3ZO3A 4JBQA 2G2IA 2J0IA 4NL0A 3A2CA 4R5SA 3NAXA 4X3FB 4F1TA 4HCVA 3LFSA 3PXFA 5DRDA 3ORZA 1VZOA 4AN9A 3FHRA 5D12A 3EQDA 4BICA 4J96A 3TZMA 4FK3A 1P14A 2RL5A 4YSMA 3GEQA 1AQ1A 1XJDA 4A07A 2IPXA 4EH3A 4BCJA 2XP2A 3QQKA 4BYIA 4ERWA 4FZ7A 4O0TA 3LMGA 5DPVA 4ZY6A 5M07A 2X0GA 3FPMA 4RQKA 5FQDC 3C4CA 5ANIA 3NUAA 3BLHA 4PQNA 3SKCA 4BHNA 4EUTA 1SVEA 2J51A 2XNBA 4OTIA 3EKNA 3UMWA 5HIBA 3BYOA 4ZMFA 3E62A 2QO2A 4XG9A 4BB4A 4CRLA 3H9RA 4LGDA 4R1VA 3R7EA 1KE6A 4GS6A 5E8XA 4R78A 4E26A 5CI6A 3VF8A 2VV9A 3W8LA 5A9UA 4NCTC 5AIKA 4FKWA 3L9MA 3GT8A 3IECA 2ONLA 2WMUA 4C4JA 3I7CA 5CSPA 3OWKA 3O51A 1ERKA 4NWMA 1GIJA 4CEGA 3AD6A 4I0RA 2IVUA 2BHHA 3GNIB 3R7YA 4BBMA 1CTPE 4RX7A 4QMYA 2XIRA 2UW5A 4KIPA 1VJYA 5IEYA 2HZ4A 3EQFA 4I21A 4R7BA 4KUJA 4EK4A 1YI4A 2EVAA 3R9OA 3DNEA 3QGYA 5HLNA 3F7ZA 3FQSA 3QRKA 4FBXA 4DEHA 5CEMA 4USEA 4FTAA 4APPA 3UOKA 5ANJA 3DAJA 5JFWA 1PMUA 4IM0A 5CXHA 4M68A 3R01A 5CANA 4GVAA 1WBWA 1Q8ZA 1SNUA 3GCPA 3LFFA 4I20A 4IH8A 5HG5A 3T9TA 2VTIA 2UZVA 3FL4A 2ZOQA 2X9FA 3QALE 5DG5A 4AN3A 4II5A 4FTLA 3W2RA 4AGCA 4Z55A 3HAMA 1GJOA 2HW6A 2WB8A 3LM0A 4JRNA 4ZSEA 3UBDA 4RZVA 4ANBA 4D4SA 4BDFA 5BVEA 4IM2A 1H25A 4GKIA 2WQMA 4PPCA 4CG9A 5CS6A 1MUOA 1I44A 3QQJA 2V55A 4RG0A 3O8TA 4E5AX 4TY1A 2AUHA 4BCKA 3QA8A 2ZVAA 4HVDA 3BKBA 4IDVA 1ZRZA 4MF0A 1QPJA 4QRCA 4RJ3A 4U9AA 5M4CA 4MXYA 3R7VA 3OT8A 3TN8A 4UEUA 2PMNX 3FMEA 3VAPA 4EKKA 3UOJA 2ITZA 1UU3A 2IZRA 2RKUA 4DBXA 5HBHA 3BI6A 4O0RA 4TYJA 5AP7A 4P4CA 4RQVA 4FG8A 5CXZA 3MVMA 3OTVA 4W4YA 4BCMA 5M4FA 4BCHA 3UO5A 2VTPA 2QQ7A 4M13A 3E8CA 3D7TA 3PZHA 1UNHA 5TE0A 1OL6A 4KIKB 2XIYA 4XV1A 4YTFA 3UVPA 4C35A 1OECA 1LR4A 2FO0A 3FC1X 3H3CA 5EQYA 3U54A 4O38A 4DEGA 3EL8A 3NS9A 3PP0A 4BIBA 4DFUA 4U97A 2W4OA 5AA8A 4U6RA 4CV9A 4PTCA 4ANMA 3DQWA 4YTCA 3W2PA 1PXNA 2J5EA 3GC7A 3LOKA 3DNDA 2HZNA 3CTHA 2GSFA 3WF5A 4ZZNA 2E9UA 2PMIA 5CSXA 2FGIA 4TXCA 1SYKA 3ELJA 4JLCA 3VWAA 5C1QB 3QQGA 2GHMA 2VN9A 3UTOA 4PMSA 3TIYA 3QZFA 4IM3A 5KMOA 1YI3A 1FGIA 3GP0A 3PWDA 3GXLA 5IDPA 3F5GA 3OBGA 4JIKA 2VNWA 5LMBA 3AGMA 4Q5HA 2VTMA 2XM9A 4QMMA 3OXIA 3QKLA 1ZYSA 2PHKA 5CI7A 4ACCA 2FYSA 2XCHA 4E6CA 5CWZA 4QT1A 1H8FA 4O7TA 1FOTA 1REJA 4D2TA 5HX8A 1YXTA 2XBJA 3V5LA 3QCQA 5L2IA 2RFDA 4OTHA 2VTSA 3CS9A 5E8ZA 3LLAA 3VS3A 3I6UA 5GZ9A 4EONA 5IZFA 2W4KA 3RPOA 3H30A 4NM5A 3MIAA 5IA4A 4D1ZA 4BZDA 2WQOA 5IUGA 2RG5A 2UZEA 3OZ6A 4Z16A 3ZBFA 4D5KA 3SX9A 3KQ7A 4N57A 3KC3A 4C2WA 4RIYA 2OIBA 4MXCA 1OL2A 4DH5A 3EFLA 3DK6A 4FKSA 2DUVA 4OLIA 3MPAA 4C4FA 2OICA 5AP0A 5CSWA 1L3RE 1Q41A 4YJUA 2GHGA 5HVKA 3NMUF 3FXXA 5IF1A 5DR2A 1NY3A 5FRIA 3ZEPA 3TKIA 5IDNA 2X7FA 1CKPA 4QD6A 4F64A 3RHXA 3PP1A 1FQ1B 2JBOA 2JC6A 4C02A 1MP8A 5JQ8A 1ZY4A 2XJ2A 3OTUA 4FMQA 5HIDA 5LMAA 1MRYA 3RAIA 3G15A 2BZHB 2QLUA 2FA2A 3SA0A 3KKVA 3R8MA 2YM6A 4IVDA 1I09A 3LIJA 4QP9A 5E8SA 4C59A 3S4QA 4EL9A 4Y8DA 3QCXA 4MNEB 3NUPA 2ZDTA 4X2GA 3PE2A 3QYZA 4NM7A 1Y57A 3DBCA 3E8EA 1W7HA 3NCZA 4GIHA 4Y5QA 2CGVA 5CT0A 4IX4A 4ZSJA 4ZTQA 3R83A 4C2VA 5I5ZA 2CN8A 4DT8A 5LVNA 4RVMA 5JQ5A 1GIIA 3AMYA 2FSLX 4FC0A 5AX3A 4MXXA 3VBWA 3WF8A 5KKRC 5M57A 1YXUA 3BGZA 4E8AA 5A46A 1M7NA 2J2IB 4HVHA 1YRPA 1JSTA 5GNKA 1QPEA 4WT6A 4ZY4A 1ZYJA 5ANDA 4XRJA 4HYHA 2BKKA 3QRUA 3BU3A 5JSMA 4ZAUA 4F4PA 4RWIA 4L68A 2Q0NA 3EZVA 4FSNA 5I9UA 3UIBA 4A9SA 4AT5A 3H9FA 3UVRA 3W2SA 2VWUA 3NNVA 4FT3A 3U6HA 1E1VA 4QTBA 4FKUA 3I81A 3CKXA 5CVGA 4L3PA 1CM8A 4HGTA 2VAGA 4I4FA 4Q5EA 1XBCA 2OZAB 4YHFA 1K3AA 3LXPA 4IWQA 1U5RA 1TKIA 2PZYA 3GGFA 4ZJJA 4K9YA 4TWCA 4P5QA 4D4YA 2Z7RA 1SVHA 2ITYA 5M4IA 4IXPA 2X2KA 4RX9A 4DBNA 3COMA 3Q4UA 2W1FA 2WU7A 2YA9A 4QYYA 3DKFA 5A14A 2XEYA 4IADA 4Q9SA 4TRLA 4U3ZA 4L6QA 3QTSA 4RIWB 3G9LX 3PJ8A 4BIDA 2V22A 5T3QA 4G16A 4P5ZA 3C5IA 3V5PA 1ZYLA 2C0OA 3NR9A 3VW8A 3RCJA 4E73A 5EDRA 4BDDA 3TUBA 5E91A 3WI6A 4HGEA 4JG6A 5ACKA 2YIYA 2WEIA 3VUIA 2KTYA 2O63A 3KXHA 3QHRA 2Y6MA 2EU9A 3KFAA 4KAOA 2OI4X 4UMQA 4IB3A 5HBJA 2JFMA 4JIAA 4A06A 4ZZMA 5A4LA 4QPMA 5DNRA 3GC9A 4J98A 4K1BA 1IRKA 2WQEA 3DS6A 3E3PA 5HG9A 4BY9E 4D2WA 2BZKB 3CQEA 3L8XA 4PNIA 2C3IB 4F9YA 2PE1A 2XRWA 4V04A 3VVHA 3AQVA 4XCUA 4I23A 2CHLA 1OBGA 4JDJA 4F7NA 3VRYA 3LQ3A 4JXFA 1M52A 3R63A 4F1MA 3PY1A 5AIRA 4P2KA 3W32A 2O3PA 5EKOA 4NFMA 5AR3A 4M66A 4D1XA 2J90A 2ZV8A 4L3LA 3VS2A 3A7IA 3VJOA 4GYGA 5IUIA 3AT3A 3QTRA 4O91A 5IU2A 3OWPA 4FUYA 4PP7A 4O7ZA 5I9VA 3GCVA 2VTRA 3NNUA 2JKMA 3WZKA 2XIKA 3LCKA 1UKHA 3WBLA 4ZMEA 5HNBA 5CEOA 5KMKA 2WOUA 3SLSA 3HEGA 1IASA 4I1ZA 3TDWA 2GFSA 3MH3A 3R1SA 4NTTA 5AAFA 1BLXA 3NSZA 4FIJA 2WMBA 4DCEA 3QX4A 1OITA 2PU8A 3DZOA 2VWVA 5JEBA 3GFWA 4QTAA 5F94A 4BVUA 5TF9A 4E7WA 4ZTNA 1OIYA 4DEIA 4FT5A 4BGHA 4YP8A 2UZBA 1SNXA 4GFMA 3RWQA 3ALNA 3HX4A 5D1JA 4AU8A 3DJ7A 3EKKA 3Q2MA 4KKHA 4RLLA 3HV3A 4UXLA 4ZP5A 5F4NA 5FTQA 4LOPA 4E20A 3ATSA 2PVYA 4L44A 3BHVA 3DT1A 1P4FA 2GTMA 2J7TA 2VWIA 5L6PA 5HE2A 2O64A 4APCA 5CT7A 2IVSA 2VUWA 4K33A 4JI9A 1Q8UA 1ZOEA 4D2PA 5IEXA 1O9UA 5AP5A 4WNOA 3R8ZA 4GKHA 2PUPA 2H34A 3QC4A 4U8ZA 3EYHA 5HE1A 4D0XA 2WTKC 2ACXA 2ZV9A 3W2CA 4C57A 1LUFA 1Q3WA 4RC2A 4FKLA 4QMZA 5HD7A 2VTAA 3KREA 5ITAA 2H96A 2W1HA 2X81A 3O7LD 3S00A 2NRYA 4C0TA 3IOKA 3W33A 1YKRA 5H3QA 3DU8A 4HNIA 4PMTA 5M56A 5M08A 3Q32A 2PVRA 3PSBA 3BQRA 3FMJA 5KMJA 4LQMA 4CSVA 4XV2A 3DCVA 3BU6A 3KULA 2E9PA 3KVWA 4BI1A 2YIRA 3OG7A 2RFSA 4XX9A 2NRUA 4ASZA 1U54B 3CR0A 2FSOX 4EOKA 5TO8A 5KBQA 1TQPA 2QR8A 4QPSA 4D0WA 3V01A 5DRBA 3N9XA 4MBLA 2VTJA 3ZLWA 5IH4A 2UVYA 3IDBA 2WTVA 3F61A 3HP2A 4CYIA 3NIEA 1A06A 3NLBA 2PTKA 4AFJA 5E92A 3V51A 2VX3A 5HEZA 3TACA 4E6DA 4HJOA 3SD0A 2VX0A 5AADA 4OBOA 2PK9A 4GT4A 5AP1A 4G3GA 2IZTA 4HCTA 5BVWA 3PXKA 1H08A 5FLFA 3TIZA 5M51A 4FKTA 1WBPA 2A0CX 4AA4A 3QCSA 5CF5A 2QOOA 4XH6A 4FI1A 4RX8A 4DGNA 4ZTMA 5E4HA 3FZPA 3A8XA 4EQUA 3AC3A 4EOMA 4A9RA 2QCSA 5BVNA 3MI9A 3HVCA 3Q6WA 3QRIA 5EFQA 3F3UA 3ZC5A 4CMUA 4FVQA 5J87A 4ENYA 3N4VA 5GINE 4AZTA 4DT9A 4O7WA 3QA0A 1LP4A 4L7SA 2UZWE 4IZ5A 4L01A 3F3WA 4J1RA 5CZHA 2PMLX 2YIQA 5EW8A 5FEQA 2J9MA 1CSNA 4O82A 2ONLC 4G34A 1BX6A 4MEDA 5DH3A 4WRGA 1W84A 2QODA 2QOLA 4KIOA 3ZDIA 3FI2A 3UYTA 1W98A 2VO7A 4J97A 2R2PA 4NJDA 5AWMA 5C4KA 3PVGA 4OT6A 4HCUA 4R3PA 3QTIA 1V0BA 4HYIA 4IJ9A 5EOLA 4DGLC 3LMIA 2BAKA 3D5XA 4AW1A 4F7LA 5IQAA 2QOHA 3AC1A 3D14A 3VS1A 4IAKA 4KNBA 3AD4A 5EHLA 4KWPA 4YTIA 4C4HA 4DG0E 4EHZA 3E7VA 4CFUA 3LCDA 2XYNA 1TQMA 3ANQA 3EQBA 4HZSA 5FWKK 5J95A 2VTOA 3PJ2A 5FGKA 4ALUA 4JL9A 3C0GA 1YI6A 4CFXA 4ENXA 4YSJA 4DE4A 2WTWA 1PXJA 4GYIA 2AYPA 3DBFA 3LQ5A 3QWJA 4RIXB 4RIOA 4V0GA 5FM2A 3RALA 5HTBA 3DKOA 2QG5A 3ODZX 4EOIA 3ATTA 4NIFA 4E6QA 4UYNA 5HBEA 4G1WA 3PE1A 4O0XA 4PDSA 4YJQA 5DT4A 4FTMA 1OMWA 3OBJA 2ITQA 2CN5A 2XK9A 3HV7A 3MPMA 3OEFX 4RMZA 5HCYA 4TTHB 5HQ0A 3CEKA 4FZDB 1HCKA 3QXOA 2OF2A 3RI1A 3R7GA 4ARKA 3NWWA 2YJSA 5EYCA 3ZZEA 4X3FA 4IE9A 2VWBA 1XKKA 2ZB0A 4FNYA 3PPZA 4GFOA 4IVBA 4Y95A 3F6XA 3G6HA 2A27A 3FJQE 3IPHA 4HOKA 4I0TA 4HW7A 3EQPA 4JDIA 2XUUA 4OTPA 4U5JA 5IUHA 4TWPA 3SOCA 2H9VA 1S9JA 2GQSA 3LE6A 3FYKX 4S2ZA 2OIQA 3Q3BA 4XRLA 1PXLA 2W06A 3ORXA 3MFSA 4YHJA 5G1XA 5C8NA 2XJ1A 3SHEA 3NAYA 1UV5A 4IX6A 4FA2A 2WPAA 3UOLA 3H9OA 3BWJA 1H1RA 4WA9A 5KBRA 1PRYA 1E9HA 2B55A 3BYVA 3FLZA 1F3MC 2YAAA 4HPTE 4ZY5A 4NZWB 3KXMA 3LFAA 5CLPA 1J7UA 1ZY5A 1NT2A 3KXGA 4OUCA 1L8TA 4Z9LA 4G6OA 4RVTA 3QTQA 4FT9A 3TZ9A 3WIGA 2YEXA 1Y8YA 2B4SB 2YHVA 4TPTA 3F5UA 1JKSA 4GK2A 4O2PA 2QOFA 2ITOA 2XYUA 2WKMA 5E8WA 4ORKA 2GNHA 4IX3A 4X2KA 4ZTLA 4GUBA 3QUEA 3FL5A 2IVTA 3ZH8A 4K8AA 1FMOE 2WD1A 2KULA 3CD3A 2I40A 2R4BA 3EZRA 5CAUA 5AX9A 5E8UA 3VS7A 3UQFA 4UWYA 1M2QA 2LAVA 5JT2A 2PVNA 3AGLA 4HZRA 4NSTA 1YVJA 5KX8A 2GS6A 3BLQA 5AV2A 1Q8YA 3NRMA 3EN9A 3BELA 2WU6A 3DJ6A 5CU0A 3SVVA 1UWJA 3SV0A 4GUEA 1A48A 4M7IA 5F95A 5E8TA 1ZMUA 2X4FA 4XG2A 4XP3A 4BDKA 3OT3A 2W1IA 5L8JA 3LVPA 5GZAA 2BROA 3C4XA 2XK8A 4XG3A 3FE3A 5HORA 1W0XC 3ZM9A 4B0GA 3CC6A 4YPSA 3V04A 4PDYA 2V62A 3O50A 5AV3A 3G51A 5FTGA 3P0MA 4S30A 4YZDA 2VD5A 2F57A 4IDTA 5AR5A 2W5BA 5DVRA 3EFJA 2XM8A 4RZWA 4G6NA 2OBJA 2YCSA 3ORMA 4I94A 2ERZE 3MFRA 1WBSA 2HK5A 3PRFA 2X6EA 4JBVA 3EQGA 2C5XA 2HAKA 4YJTA 5JKGA 2OH0E 1M7QA 2G2FA 2W99B 3DXNA 4WNMA 2JKOA 3LXNA 2QG7A 3RPYA 1NW1A 3UPZA 4YJVA 2E9VA 4QMTA 4AQCA 4IC8A 3BYMA 3PSDA 4AE9A 2UUEA 2CKQA 3PXZA 3CLYA 4O6EA 3DJ5A 1OPJA 4GJ3A 3WYXA 3MY0A 4WUNA 5CF6A 4M69B 2R7BA 2XNOA 3LZBA 3QFVA 4I6FA 4W4XA 4GV1A 3R73A 3DZQA 3MWUA 5DGZA 5EKNA 5HO8A 1NA7A 4O86A 5D11A 1HOWA 4CD0A 5AR4A 2XKFA 2WMRA 4EWHA 3EMGA 2QOIA 4XG4A 4EEVA 4O1PA 3A4PA 2Y6OA 3QTUA 4HYUA 2PYWA 4KIKA 1WVWA 4FGBA 1RQQA 5B2MA 2HWOA 1PXIA 4QP4A 3R28A 2AC5A 3OVVA 2BVAA 4UYAA 4X2FA 4YZBA 2F7EE 4J53A 4FNWA 3OCGA 2F2UA 4WKQA 2P2IA 2W1ZA 3CD8A 4BR3A 4IAAA 1XBBA 3FLQA 4TYHB 3VC4A 1Q97A 1F0QA 3AT4A 3MYGA 1X8BA 3G5DA 4PNKA 5BX0A 1IAJA 2RIOA 1QL6A 2YM4A 2Z60A 2BRGA 5H8BA 4CCBA 1Q24A 1FPUA 2CKEA 4O0VA 5CAPA 2YDKA 4RGJA 3JR1A 1JKKA 2C68A 5E7RA 3V6SA 3P08A 3A7FA 1YWRA 3A7JA 3FMNA 4EHGA 4FICA 4FL3A 4UZHA 3DXQA 5EYKA 4IAIA 5B2KA 4LUDA 3TKUA 2O65A 4L52A 3HZTA 2R3OA 3QWKA 4LM5A 4WSQA 4EUUA 4P90A 4X6RA 4F6UA 3IGGA 4CZUA 5A4QA 3IG7A 3F82A 1O6YA 3HUBA 4CKJA 3JY0A 3HKOA 2OXDA 3CE3A 2QO9A 4YZNA 1BL6A 3KU2A 4ITIA 5AV0A 2QOQA 4AT3A 3GOKA 4MTAA 3FPQA 2XMYA 3OS3A 5E1SA 3ZFYA 4YJPA 5D41A 3JY9A 3DBQA 3ULZA 3QHWA 3TV7A 2Z2WA 4FIHA 3FC2A 4F0FA 4MBJA 2BIKB 3FKNA 5D7AA 3E8DA 1KOBA 3ZLXA 4ID7A 3SDJA 3OUKA 4XBUA 4D58A 3C5UA 5GJGA 4AGWA 4FZ6A 1XH6A 5HU3A 3OXTA 4ANSA 3ZMMA 3KRLA 2XJ0A 3PSCA 2B9FA 3PWYA 3P7BA 3ANRA 4D9UA 3Q9XA 2YM8A 3VIDA 1PF8A 4F6WA 2YJRA 2ZV7A 3EHAA 4WD5A 4BGQA 4N6YA 3CKWA 1DM2A 4IAYA 3GVUA 3HV4A 2UZNA 4TNDA 5AV1A 3TNIA 3TI1A 4EC8A 5EI8A 3LCSA 4IVCA 4I92A 2JLDA 4TT7A 1PYEA 3UO4A 5JFVA 1EH4A 3Q6UA 1JSVA 4MNEA 3OY3A 3PRIA 2YM3A 4G3CA 3ZCLA 1Q5KA 4WO5A 5FM3A 2PY3A 3RBWA 2X8DA 2W5AA 2OG8A 4RT7A 5FP6A 1OM1A 4BDAA 5AUUA 5J5SA 3UIXA 4TL0A 4XV3A 1YXSA 4H36A 4WG4A 2YLFA 3EWHA 5K4JA 4DYMA 3I5NA 4PF4A 4IW0A 4O0UA 1ZMWA 3ODYX 5DA3A 5ANGA 4I6QA 2CSNA 2VWXA 2YCQA 3R9NA 1IG1A 3DK7A 4HPUE 1CKIA 3SG9A 3EH9A 3FLWA 3POOA 4YBJA 1DS5A 2R3GA 5D9HA 1T46A 3CJGA 3RK5A 4NTSA 4BDHA 4EQMA 3FV8A 4J8NA 4GCJA 4DLJA 4IFCA 5B0XA 1XQZA 3QXPA 2BZIB 4YR8A 4DLIA 2C6LA 4HYSA 3VUMA 4U3YA 3WE4A 4B8MA 3A62A 4M15A 4DTAA 2OZAA 4QYHA 5CENA 3E7OA 3DBDA 3IK3A 4QTCA 4F09A 5CASA 2B9IA 2UW9A 4FKPA 3HMOA 3CSVA 5JFXA 4O7LA 4XNEA 3FSFA 3I6WA 2P33A 4ZLZA 3RTPA 5HTIA 3TXOA 5FD2A 3E8NA 4BCFA 3ALOA 5LXMA 3PYYA 2BTRA 4RIWA 5ANEA 3Q5IA 3ROCA 4CFVA 4V01A 4X2NA 4ASXA 3TZ7A 4Y73A 2O2UA 3DB8A 1YOLA 2UVXA 3DFAA 4XV9A 5BVFA 3SGCA 4NKAA 4YPDA 2P55A 2W4JA 4YURA 3UZRA 1H4LA 3G0EA 5CF4A 1GZNA 3VQHA 1KSWA 3B2WA 2JD5A 5LWMA 3PXYA 3MB6A 4FR4A 3OW3A 3U9NA 4E1ZA 4GU6A 2DWBA 2PVLA 2WTDA 1ZXEA 2EB2A 3QTWA 4LYNA 5J5TA 4D4RA 1H0WA 1ZARA 3F7WA 4JS8A 3A61A 3MGYA 4QP3A 4BI0A 5BUJA 1AGWA 3I7BA 2H8HA 4DH7A 2HOGA 2HCKA 2VTQA 3FQEA 4DEEA 2VTLA 5I0BA 4IANA 5KCVA 2C5YA 2X4ZA 1JAMA 2HELA 3HNGA 4XP2A 3THBA 4BTFA 5LVPA 4JX7A 5JZJA 4MF1A 4CFMA 1JKLA 3K5UA 4O2ZA 5K4IA 4FSUA 2C6OA 5FXRA 4OAVB 5BQ0A 5EK7A 5CEPA 4IWOA 3PDTA 1PY5A 4C58A 4AW5A 1VR2A 4R7HA 3DLZA 3MV5A 4GMYA 2REIA 2NPQA 2OJ9A 3V6RA 1PHKA 4UN0C 3K3JA 4JDKA 4ZTRA 5ETIA 3PIZA 3RPVA 4QP7A 3LCTA 3MA6A 5HKMA 2YERA 4LL0A 5KO1A 3EQRA 4H39A 3OY1A 4MK0A 1PW2A 4FKQA 4O1OA 2YAKA 2J4ZA 2J50A 3VW6A 4F0IA 2X1NA 4LUEA 3KN6A 4WSYA 5K3YA 3SXRA 4EKLA 1Y91A 4L43A 4R1YA 5CY3A 4C4EA 3ZC6A 2C6EA 4W4WA 3COHA 3HAVA 3ZM4A 1WVYA 3HA8A 2ZAZA 2CCIA 5D10A 4B9DA 3KRXA 1FMKA 4FV1A 5A3XA 1YDTE 3OCTA 2UZDA 2UW4A 2OJIA 3B8QA 3GUBA 3QLFA 1XH9A 3OMVA 2BDWA 3ZBXA 2PVKA 3QD2B 4TN6A 1J3HA 2W5HA 2LGCA 4QO9A 3QTXA 3WARA 3ERKA 3DTWA 2G15A 4RX5A 1Q8TA 3GENA 3EFWA 4JR7A 4Q2AA 4FEVA 2QONA 2Z7QA 2W96B 5KHWA 4FEWA 4IZYA 2R3LA 4PDOA 1MRUA 3R7UA 1PKDA 3QZHA 3NNWA 5DI1A 3JVSA 3G6GA 1YWVA 2PZPA 3R2BA 4TW9A 5A54A 4JT3A 3VUDA 4AWIA 5KHXA 1GAGA 4L42A 3E64A 5EM5A 3D94A 4EJNA 1H07A 1V0OA 5H8GA 5K0KA 5HO7A 2G01A 5JGAA 3LAUA 4DA5A 4FK6A 3UC3A 4X0MA 4X3FC 1PXMA 1DAWA 1U54A 4KBAA 4EH9A 5A6OA 4C3PA 3DDPA 4R3CA 2R3RA 1H27A 3OEZA 4DH8A 4OTGA 4MNFA 4YJSA 1Q4LA 5CQWA 5CU2A 4BDCA 3H4JA 3UG2A 4RA5A 2I0VA 2JBPA 3R0TA 4LG4A 3MTLA 3UPXA 1ZZLA 3W10A 3PIYA 4LRKA 3FKOA 1IEPA 2ERKA 4JRVA 3DA6A 4KKEA 3QKMA 2OH4A 3MVJA 4JQ7A 3V5QA 5A6NA 1H1SA 3ID6C 3PXQA 5CAOA 4PL5A 2VO6A 4QMVA 4PMPA 1Z57A 3UNKA 3PVUA 1G8AA 5HVYA 4FOCA 3DXPA 3BZ3A 4ZLOA 4RJ4A 1XR1A 2PUUA 4GK4A 2G1TA 5AP3A 4ZK5A 2WMXA 5FEEA 2OZOA 4BRXA 4AZVA 1OKWA 5AJQA 2OFVA 5FEDA 4NT4A 2C6KA 2HW7A 3ORPA 2BMCA 3HRCA 4YC8A 3VN9A 1KE9A 4QPAA 3ZLYA 1G8SA 5I9WA 3LFNA 3BV3A 4AFEA 4E93A 2V5QA 3AXWA 5K5NA 3NUUA 4U80A 3ORIA 4YLLA 2XVDA 3NW7A 3OF0A 4XOYA 2XBAA 4FNZA 5BYZA 5AFVA 2GMXA 4PL3A 4PPBA 3E63A 1XO2B 3C4FA 4U7ZA 4NH1A 4UB7A 5KNJA 1R1WA 4IX5A 3DLSA 2JGZA 2Y9QA 2ZM4A 5IKWA 3CTJA 5HCZA 3FXWA 4ACMA 4O7RA 4FKJA 4FUXA 5BMMA 4PP9A 4Z7GA 2B0QA 3NZ0A 4ZS4A 1WBTA 4MWHA 1Y6BA 4RBLA 3QQFA 1OI9A 2YACA 1H28A 4JVGA 3FLSA 3BEGA 5DT3A 1OKVA 5C8MA 3CPBA 5KZIA 4CQGA 4IB5A 3O23A 4F63A 2JIUA 4FKOA 4G5JA 3EFKA 4UMTA 5HG8A 2YFXA 5IQEA 3U9CA 4B99A 2PE0A 4DFZE 4EORA 4BTJA 1M17A 2EXEA 2BCJA 2XIZA 3POZA 4MYGA 2BILB 5EHOA 3WZDA 4RIXA 1KWPA 2JAMA 3N51A 1ZYCA 4PL4A 2I6LA 4C34A 4MD7E 3LFEA 5J7HA 3OHTA 2BKZA 1KV1A 4NEUA 4U0IA 2Z02A 4FSRA 3IGOA 3UMXA 3NW6A 5L2WA 3CQUA 4QP6A 4D2VA 2JDRA 5F9EA 4FV5A 4I5CA 3U4UA 2WMAA 4FE2A 2ZM1A 4ZZOA 1WBOA 4D28A 4GRBA 2O5KA 5EW3A 4H3BA 3CCNA 1WAKA 2V0DA 4RJ6A 3Q53A 3ZFXA 1URWA 1H1QA 5JMSA 4YJRA 3HYHA 1OPKA 1O6LA 3L9LA 3CPCA 3QD3A 4QYFA 2WXVA 5IQIA 2ITPA 4BDGA 1CKJA 2I0HA 4X6QC 5DFPA 4CRSA 4GK3A 5KUPA 5ETCA 4M12A 4NK9A 5BYYA 2C30A 2WIPA 3KVXA 4LL5A 4Z3VA 5K9IA 2C69A 3SRVB 2JIVA 4QTDA 5JN2A 2WMWA 3TNHA 1OPLA 5BUIA 1KOAA 3L9PA 3UGCA 3ETAA 3FI8A 4WG3A 1ATPE 1DI8A 5JZNA 5BMSA 2UZLA 3FSKA 3U4WA 5GIPE 3NUSA 3TKHA 2CJMA 4AOIA 1QCFA 3NYOA 5DT0A 3KGAA 3FLNC 4CGAA 5AUTA 2ITUA 3Q9WA 1G3NA 3BV2A 2Y4PA 3Q04A 1JKTA 2BPMA 2YZLA 4FTKA 5H2UA 3O96A 3NCGA 4WNKA 3UQGA 4CG8A 4F08A 1JNKA 3FLYA 4I41A 3A4OX 5EYMA 3FZSA 2BALA 3FUPA 5ETAA 2O0UA 3V8SA 3KK8A 2QLQA 2QOCA 1UU8A 1T45A 1PMVA 1ND4A 4NJ3A 4I4EA 3UNZA 3C7QA 3R8UA 3KMMA 1BKXA 2RF9A 5IQGA 5CU3A 3QD4A 5HICA 1WBNA 2YWVA 1OGUA 3GFEA 3RAWA 1YHVA 1GZ8A 5HNGA 2Y0AA 3LXKA 2XK7A 1PXPA 3MIYA 4O7YA 2GNGA 1XH8A 2IG7A 2YN8A 4GL9A 4U81A 4UMUA 2CKOA 4RC4A 5M44A 4AT4A 4YC6A 1OIRA 4HNFA 4MHAA 1GIHA 3V8TA 4ZEGA 1BMKA 4JNWA 3FBVA 4FV8A 1OVEA 4EJ7A 3W1FA 1JBPE 4M97A 4CTBA 4XG8A 2GNLA 3L1SA 2CLQA 2CMWA 2XK3A 2X2LA 4KS8A 4UX9A 4IWPA 3ZO2A 4YJOA 3ENMA 1U46A 1H26A 3L8SA 1YWNA 4IVAA 2XNEA 2JDTA 4MKCA 5HZNA 5AUYA 2XA4A 3BYSA 3VS6A 4C3FA 3O0GA 4A4XA 4E3CA 5A4EA 3FEGA 4M69A 1J1BA 3PVBA 3VHEA 1B39A 4DEDA 4JOAA 5IQBA 4WIHA 4EQCA 3HMPA 4W9WA 3R04A 3HUCA 4QMOA 3PG3A 3UO6A 3W2QA 2WMSA 4LMUA 4AS0A 2XRUA 4C4IA 3LPBA 4XUFA 1UNLA 2W17A 5LCJA 4XBRA 4O7SA 2XF0A 2R5TA 3QLGA 4TYIA 2W1CA 4I22A 4I93A 4ZTSA 1JPAA 5EM7A 4OAUC 1KUTA 1ZOGA 2QOKA 3QBNA 4Y85A 3NVKI 3R8VA 2R9SA 3R9DA 1U59A 2J0JA 2HY81 2YITA 3UE4A 1K2PA 3EQIA 5LVLA 2QC6A 2RFEA 4XS2A 1FVTA 4OTFA 4G3DA 3NX8A 4FX3A 4TYHA 4LOQA 3G2FA 4CZYB 2NNWB 4O7VA 3NGAA 3G9NA 4WHZA 4NKSA 2X2MA 5E8VA 4KINA 3N4UA 4AZFA 3BGQA 3WE8A 1UVRA 4FNXA 4YLKA 2G9XA 4OTWA 5IQFA 2B7AA 2Y4IB 3FYJX 4J99A 5AR8A 3QZGA 4YU2A 5HI2A 3A60A 3EQCA 5FUTA 1A9UA 4UY9A 4JDHA 4CVAA 3FMMA 1Q3DA 4G5PA 4R7IA 4PV0A 3DFCB 5AMNA 2R3JA 4NW5A 3MVHA 1P4OA 5HVJA 4F6SA 5DEYA 3TL8A 4ZS0A 4UWCA 5C8KA 5LVMA 1BL7A 1LPUA 3I0QA 1KE8A 5EH0A 5ACBC 2WQNA 5BUEA 5DR6A 5DHJA 4BWPA 4DEAA 2UZUE 4PY1A 4CKRA 2X8IA 2IJMA 4ANNA 2EB3A 4TWOA 3ITZA 4WBBB 3GOPA 4Z7HA 3RM7A 4RA4A 3KK9A 2PL0A 2A19B 5EYDA 4XLVA 4U40A 4FV2A 2HXQA 2PVFA 4QMUA 1VEBA 4UV0A 3VO3A 3HECA 5GZ8A 3P4KA 3IKAA 3JS2A 5EG3A 4DFYA 5AP6A 3P5KA 3R30A 5IMEA 4QP1A 4IAZA 1YDSE 2X7GA 5EOBA 5IA5A 3KCFA 3WZEA 1NVSA 1H24A 4QMXA 4FZFB 4CCUA 4IZAA 3ZSIA 4CXAA 5I4NA 3MA3A 3F3ZA 3LLTA 2YIXA 2CGXA 3LCOA 1BI8A 4ZXTA 4D5HA 4NM3A 4M0ZA 5HESA 2XS0A 3FKLA 4F1OA 4YO4A 2VTNA 2X39A 1OL5A 2W1GA 3FZTA 2OIDA 1JVPP 4YNEA 4E6AA 4QMNA 4YZMA 5J79A 4TWNA 5T6KA 4FTNA 1KV2A 4D2RA 3RMFA 2IN6A 1OKYA 3TNPC 1HCLA 2DYLA 3FHIA 1KE5A 4UWBA 4I6BA 3RPSA 2CNUA 4AOJA 4L46A 3I0OA 1NVQA 3C4EA 4OTRA 4XEYA 3ZZWA 2UW8A 4FG9A 4QYGA 1RW8A 4FV0A 4RWLA 4BCQA 3R02A 4K2RA 2OK1A 2PULA 4YC3A 4E4MA 5CNNA 3WF9A 1REKA 3BE2A 4AF3A 3B8RA 2CPKE 5JRQA 4L8MA 5AUVA 4EH5A 3BEAA 4UMRA 3LFCA 4X2JA 4IWDA 2PUNA 5FDPA 3NUXA 5DLSA 3P7CA 3M11A 5GJFA 4L45A 5KMNA 1FBNA 3AD5A 5J9YA 3FMLA 2B52A 3ZSHA 3ACJA 3NUYA 4N70A 2OWBA 3R00A 4U41A 1VYZA 5KMIA 3LMHA 2PZIA 4YJNA 4D2SA 1H0VA 3PPKA 3QUDA 5C03A 4N4SA 3QQHA 3UJGA 2W7XA 5LMKA 4S34A 3BBTB 3C4WA 3D15A 4ANLA 3OP5A 3UIMA 2JFLA 2OJGA 2PWLA 4LOOA 3TJDA 3R1QA 5DE2A 2GTNA 5IQDA 1RJBA 3RCDA 4QMSA 3O71A 2J6MA 4JG8A 4O27B 5AAEA 1WZYA 4FIIA 4ASEA 2VO0A 5ANKA 1WBVA 5AEPA 3W16A 2R3QA 4UXQA 5CU4A 4EC9A 4A7CA 5J8IA 3BWFA 4IIRA 3MS9A 5IA3A 2V7OA 1FGKA 3MSSA 4RWJA 2C3JA 4DFXE 4FSWA 3RKBA 4A9YA 2R3NA 2XZSA 3II5A 4GVJA 2E9NA 3O7LB 4D55A 4EOJA 2JDOA 4ZIMA 2CGWA 4LFIA 2F7XE 3RGFA 4BKYA 4CFFA 2EXCX 3C13A 4OGRA 3OOMA 3IOPA 3QGWA 3CIKA 3NNXA 4F9BA 1J91A 3TWJA 5J1VA 3ACKA 3KRRA 2W05A 4ASDA 1CDKA 2OGVA 3K54A 5L4QA 3MH0A 4MAOA 4ERKA 4FL1A 1UU7A 3KCKA 5KZ0A 2B54A 3K3IA 3SOAA 1JOWB 2YM5A 3REPA 4S33A 2DQ7X 5AA9A 3NUNA 5IG1A 1E1XA 3B2TA 1APME 5F1ZA 5CEKA 3FMDA 4FT0A 3PTGA 3PLAE 4FKRA 4XJ0A 2BUJA 2Z7LA 2R64A 4QQCA 3JXWA 4AUAA 4ANQA 4OTDA 2I0EA 2O8YA 3AC5A 2HXLA 2R3MA 1S9IA 4FOBA 3MTFA 3Q52A 2ESMA 4K77A 3ORNA 1U5QA 3E92A 3MY1A 4UZDA 4A4OA 4EZ7A 2R0UA 5C27A 3JUHA 4GFGA 4MBIA 3ZRKA 3P86A 2J5FA 4KKGA 4W9XA 4DFBA 4ZJIA 3PIXA 5IH6A 5CYIA 4N0SA 2B9JA 4ZOGA 3W18A 1V0PA 4IC7A 3RK7A 5A4CA 2QD9A 5M53A 4EK8A 4M8TA 3ZUVA 2R3PA 4PPAA 5LWNA 3QKKA 3KY2A 3RAKA 2QR7A 3GI3A 3GQIA 4H1JA 5I3RA 5KE0A 5CEQA 5IA0A 5FTOA 2YM7A 4IQ6A 4JQEA 4PTEA 4CLJA 1XH7A 2YLEA 5M06A 5CAQA 4BCOA 3M1SA 2R3FA 5CQUA 4BN1A 2UW6A 3F2RA 3FQHA 4IBMA 2RG6A 3F88A 2OSCA 1UKIA 5ETFA 4FTCA 2JITA 3E87A 3ZOSA 4BI2A 2HENA 2VO3A 1SZMA 4Y46A 5CNOA 4BZOA 4C8BA 2GNIA 4BTKA 2GHLA 1R0EA 3S1HA 5E90A 5C01A 3K2LA 1M2PA 1PKGA 1G5SA 1GOLA 2V7AA 3ORTA 5HD4A 4C62A 3ZXTA 1OZ1A 2UV2A 2ETRA 4XP0A 4DTKA 4BFMA 4FTTA 3OWJA 3A99A 4X3JA 2WAJA 3QRJA 3R9RA 4HVGA 3LXLA 2CNQA 2IO6A 4L9IA 4U45A 3AMAA 4RVLA 1SMHA 4QNYA 4QQJA 1SM2A 2XIXA 3F2AA 2UW3A 2HY0A 3M2WA 1OB3A 1DI9A 5IQCA 4FV6A 2OU7A 4ZTHA 4GJ2A 2FVDA 3LFDA 5ANOA 3F2NA 5I3OA 3R7OA 4BDIA 5DYJA 3FY2A 5I9XA 2BIYA 4CKIA 2HZ0A 4PDPA 5IPJA 3DB6A 4EYMA 1BYGA 5KKRB 3PY3A 2C3KA 4WOVA 3RJCA 3VBQA 2P4IA 4G3EA 5KMLA 2GDOA 3UYSA 3KF7A 4G9CA 4F65A 3R8PA 1ZMVA 4BC6A 4HGSA 1TQIA 4PMMA 2IZUA 4XG6A 2XKEA 3FZOA 3QL8A 2J0LA 2VTTA 3PJ1A 4E4LA 5T68A 1JQHA 3HGKA 5HTCA 4TYGA 3RPRA 3TNWA 1MQ4A 4FYNA 2BDFA 3QQUA 3TEIA 1BUHA 3COKA 3CGFA 3PA3A 5LVOA 3COIA 2WNTA 3IONA 4EK3A 3VJNA 2QU5A 2UVZA 3HDMA 4S32A 5AP4A 1J7LA 2PMOX 3P23A 4I6HA 2YCRA 4MXOA 4KBKA 2PZRA 4KIQA 4U43A 5HNIX 3I60A 3QD0A 2BRNA 3ROYA 3H10A 4DGMA 2WMQA 2C1AA 2R3IA 3QF9A 4QMLA 3S3IA 3W8QA 4FEUA 1NXKA 2Z8CA 2BZJA 3EN6A 2SRCA 3AC4A 2YDJA 4RVKA 1FVVA 3Q5ZA 3RVGA 3AG9A 4FSYA 2F49A 1R3CA 3Q9ZA 4A9UA 3OROA 4OT5A 3RAHA 3VBYA 4FYOA 3DKGA 2X9EA 4GH2A 3PXRA 4QYEA 2XKCA 2YIWA 2QNJA 2JIIA 3FZRA 3UOHA 1URCA 3IW7A 2YABA 3BCEA 2ITWA 4IZ7A 3V5TA 3GU5A 3WOWA 3R22A 1VYWA 4BCPA 4F7JA 1V1KA 3PJCA 3ZO1A 4YZCA 2UZTA 3KXNA 4EH7A 1QPCA 4S31A 4EHEA 4P7EA 4NM0A 3BPRA 4L67A 5DR9A 3T9IA 5JK3A 1O6KA 3RK9A 2BDJA 3DKCA 3TUCA 3GU6A 2XNMA 1QMZA 2OXYA 1YHSA 3ZTXA 4BTMA 3MPTA 3FMHA 3QX2A 2FSTX 4ZSAA 3G0FA 1OL1A 3IW4A 3L9NA 3ZYAA 3U55A 2BTSA 4HVSA 3D5UA 2CGUA 2VRXA 5LJJA 4IB1A 2NO3A 4UALA 5H9BA 2RSVA 3SRVA 4AE6A 3G33A 3R2YA 4FSZA 2QHMA 2GFCA 1M14A 4MX9A 4B4LA 5DEWA 5IMXA 1PYXA 4JX3A 1PXKA 3UNJA 2CLXA 3VUHA 3GU4A 3PA4A 4U42A 2P0CA 2C1BA 3F5PA 3DOGA 2XB7A 2ETKA 3Q4CA 3U6JA 4KSQA 3GCQA 3T3UA 4FZAB 4O96A 5E1EA 3F69A 4CYJA 1WFCA 2B9HA 5DBXA 4PUZA 2WTIA 3U87A 4USFA 3NDMA 4F9CA 3BHYA 4GW8A 3TJCA 4ITJA 4U44A 2ZDUA 5H8EA 4C61A 2Q83A 4ZJVA 4M67A 2DS1A 4AW2A 3L8PA 4FIEA 4I5PA 5JGBA 2WHBA 3OOGA 5L3AA 3MBLA 4KS7A 2GPHA 2ETMA 5CTPA 1YXXA 4AAAA 2XK6A 2WTKB 4EH8A 4R3RA 2H6DA 4YLJA 5AM7A 3NYVA 3QCYA 4PWNA 2C3LA 3DQXA 4A4LA 1NVRA 1XHAA 2YZAA 4L3JA 3ZUTA 2WELA 4D1SA 4ITHA 3PFQA 4BYJA 2XEZA 2X8EA 4J8MA 2JAVA 4I5HA 2E2BA 5L6WL 3WIKA 4J52A 5CZIA 5L8KA 4FGRA 3RNIA 4O7NA 3TNQB 3FZ1A 1ZLTA 5C26A 3DY7A 3PUPA 3IO7A 4E5WA 4MQ1A 5CX9A 3F5XA 2BRMA 2X7OA 3G90X 3GQLA 2GS2A 2QOBA 4OBQA 4CMTA 3LJ2A 3SW7A 3TV6A 4NU1A 4LGHA 1FVRA 3ZRLA 1AD5A 1YW2A 4UBAA 4CMOA 4O83A 5C4LA 3HA6A 1M2RA 2F4JA 5D7VA 4GIIA 1IA8A 2A1AB 3BHUA 3V5JA 4BWKA 5AUWA 3D9VA 5IEVA 4OW8A 4W8DA 3EN5A 4E4XA 4LRJA 2C5NA 5EDPA 2WOTA 5HG7A 4PTGA 4Y5HA 4EH6A 2R3HA 2NP8A 2IW9A 4RJ5A 2WTJA 2C5OA 4H58A 3EN4A 5BPYA 2XK4A 4R5YA 3AT2A 3GCSA 2CNVA 5TT7A 2P3GX 3PJ3A 4EK6A 2IVVA 3DGKA 5IA2A 4DF3A 3LQ8A 5EQPA 1OKZA 2OW3A 3MW1A 4FSTA 3UVQA 4GSBA 4WG5A 4QNAA 3ZRMA 3D7ZA 3BGPA 5EI6A 5HLWA 4JAJA 4C33A 4Y83A 2WQBA 3IW8A 4FV3A 4YMJA 4FTQA 2C4GA 1ZAOA 2JDSA 4FTJA 3JVRA 4NUSA 4RPVA 3MESA 1TVOA 4EBVA 4DINA 5BVKA 3RHKA 3BYUA 2JEDA 3ENHA 3PZEA 3CJFA 5J9LA 1GNGA 2YCFA 2PE2A 4C37A 3HRBA 4RJ8A 5E9EA 2ITVA 4AA0A 5BYLA 3MFTA 2G2HA 3QAME 4O81A 4N6ZA 2VX1A 5BNJA 3R21A 4AXAA 5BVOA 1CMKE 2YISA 3ZLSA 3QU0A 2Q0BA 2WZJA 4K6ZA 5LMKC 3WZJA 2PPQA 3ZS5A 4BIEA 3P79A 2XNPA 4C7TA 2BAQA 5EI2A 4JBPA 4EOPA 4FEXA 3CQWA 2QKWB 3KXXA 3ZEWA 5EM6A 2WIHA 3GB2A 4D4VA 4ONAA 3VBVA 3A7GA 3WZUA 4EZ5A 2VZ6A 2VGOA 5J9ZA 4BDJA 5LCKA 5DOSA 4JG7A 3DDQA 3EJ1A 3I1AA 3D2IA 4EH4A 4G9RA 4WUAA 2XCKA 4KB8A 4K18A 4TZRA 3WILA 3OFMA 3V3VA 1JLUE 2OXXA 3NPCA 4H3QA 5B7VA 3IDCA 1YDRE 1K9AA 4G2FA 1Z9XA 2I7QA 1RDQE 1WVXA 4IEBA 4MVFA 2X6DA 3MJ2A 5GHVA 3VS0A 4EYJA 3D83A 3CY2A 3R7IA 3IDPA 3GC8A 5AV4A 3AC2A 3T8OA 5M55A 5JFSA 5KMMA 1STCE 3QRTA 4YHTA 1P5EA 4I5MA 3NEWA 3PPJA 4AZEA 1OUYA 4MH7A 5HHWA 5L8LA 3C0IA 2BFYA 3QZIA 5M4UA 3FI4A 2FSMX 3FWQA 3MFUA 3R1YA 4EK5A 4QOXA 2B53A 3D7TB 3NYXA 4KD1A 5FBOA 3U8WA 3VF9A 4AG8A 4YO6A 1LEWA 2XKDA 3LJ1A 4DHFA 3ORKA 3HV6A 4B7TA 4MWIA 4ACDA 3FAAA 2Y7JA 4I0SA 2FUMA 3OUNB 2GQGA 4W4VA 2GCDA 1XH4A 3MB7A 4NCTA 5E8YA 3WYYA 4BHZA 3KB7A 5CU6A 3TM0A 3AMBA 4K11A 4FIFA 1WCCA 4H3PA 4QMPA 3TV4A 3V5WA 5IA1A 2UW7A 4TYEA 4IHPA 5TKDA 4YNOA 2EUFB 2YWPA 5IQHA 3LM5A 2HZIA 3MH1A 4CNHA 3HMIA 3HMMA 5CVHA 3KN5A 5CVFA 4EOSA 4I24A 2QO7A 3HMNA 3P78A 4LV5A 3I79A 4AW0A 4FTUA 5HE3A 4F99A 3TUDA 3ZU7A 1P2AA 1H01A 1OUKA 3H0ZA 3RZBA 2ZV2A 3ZSGA 3C50A 2ZMDA 4FEQA 4EH2A 3HDNA 4O0YA 4LMNA 2HYYA 3MN3A 4AN2A 3OD6X 4EBWA 4YTHA 4MXZA 3BRBA 5HX6A 2QVSE 2QHNA 3EQHA 1Q99A 5EM8A 5AR7A 3EL7A 4FSMA 1H00A 3VBTA 4LRMA 4B8LA 1JWHA 2C6IA 4KSPA 5CAVA 4GU9A 1YXVA 4RIYB 3SG8A 3AC8A 3NIZA 1J1CA 4X21A 3TCPA 4HGLA 3E93A 4R6VA 2C0TA 4WNPA 1R39A 2F7ZE 4FSQA 4LGGA 1MRVA 3FI3A 3MJ1A 3HV5A 4DGGA 1B6CB 4L7FA 5IH5A 4MQ2A 2IW6A 3KRJA 5DIAA 4D9TA 2HIWA 3QTZA 3KXZA 1R0PA 4QMWA 3UZTA 5G6VA 4BKZA 3CBLA 4TKSA 2R7IA 4ZSGA 3QYWA 4EI4A 2Y8OA 2I1MA 2VU3A 4F9WA 5I9YA 5EQEA 3UP7A 5HO6A 3ULIA 5J7BA 4RWKA 4U79A 3F3TA 3VUKA 4DG2E 3KEXA 4L00A 5CSHA 1IR3A 4EHVA 3P1AA 3MDYA 5B2LA 1Q8WA 4Y72A 5LQFA 4J71A 5BVDA 2QI8A 2CCHA 3EN7A 2AC3A 2XNNA 4R77A 3Q4ZA 5CF8A 3D0EA 4XMOA 5AP2A 2ZJWA 5L2QA 4CFNA 3QUPA 4DFNA 5L6OA 3NVMB 2BFXA 1R78A 2BRBA 2R0IA 4ACHA 3LW0A 2ZM3A 5FG8A 3M42A 2W9FB 3HRFA 3RWPA 4CT1A 5GIOE 5HLPA 1GY3A 4C38A 2BAJA 2GS7A 2GU8A 5A4TA 4BBFA 2CDZA 2EXMA 2VGPA 4R8QA 4AGDA 4A9TA 4UMPA 4IACA 2GNJA 1ZOHA 3CGOA 2VWZA 3KMUA 4QP8A 4C3RA 5ICPA 2ITTA 2F9GA 3EYGA 3I4BA 3OWLA 3WF6A 3LFQA 2W0JA 4DAWA 4M84A 3FY0A 4ALWA 1PMNA 4QQTA 3E5AA 3GU7A 1GZKA 3K5VA 4IMYA 4PX6A 4H05A 3DV3A 3GBZA 4G3FA 3LJ0A 5CSVA 1PMEA 4RLKA 4YUQA 3TTIA 5JGDA 5HGIA 4GG5A 3R6XA 4GEOA 2Z7SA 3PVWA 4M14A 5DN3A 4CTCA 4EOOA 3DK3A 4V05A 4ALVA 3WF7A 1W82A 5HIEA 2WMTA 4E5BA 2C6TA 5J1WA 2C6DA 3DTCA 5EW9A 4K0YA 5TR6A 4CFWA 4RC3A 3ORLA 2F2CB 4GT3A 3CP9A 1YOMA 3C1XA 3GCUA 3IS5A 4FTRA 4KRDA 3PY0A 4BGGA 4FT7A 1ZWSA 4RSSA 3R8LA 3UC4A 3VUTA 4CT2A 2JKQA 3MY5A 4DGOA 1W8CA 3P9JA 4OR5A 2YDIA 5FP5A 3TDVA 3OW4A 4BF2A 3ZDUA 2A2AA 3T3VA 2I0YA 3W2OA 2UW0A 3D2KA 1Z5MA 4AGUA 2FB8A 3RP9A 3QC9A 3ZO4A 4LV8A 3Q4TA 3MVLA 5HOAA 3BU5A 5AUXA 1IA9A 3VS5A 3OCSA 4H1MA 5LOHA 1Y8GA 3S2PA 4BKJA 2VTHA 4WBOA 4DCAA 4G6LA 3RNYA 1J7IA 3ZUUA 1W83A 3GC0A 4XYFA 2ITNA 1OBDA 2IZSA 1IAHA 3FXZA 2WFYA
chains in the Genus database with same CATH superfamily
4DH3A 1RE8A 1PXOA 4GG7A 1MQBA 3TZ8A 4BZNA 3BQCA 4C36A 4AX8A 4OTQA 3BE9A 2GQRA 2ZMCA 3VHKA 3D4QA 4DH1A 4DG3E 2WMVA 4G17A 1FINA 4MD9E 3F66A 3SXFA 3RM6A 4QQ5A 3JYAA 4MD8E 5L2SA 4FL2A 4C4GA 3KMWA 3D5WA 4AAYA 4O0WA 5HU9A 4JR3A 5AM6A 1UNGA 4DTBA 3HP5A 2IEWA 4BCIA 4EWQA 1OIUA 3BIZA 4FF8A 5AUZA 1U4DA 5JH6A 3DPKA 4FIGA 2PVMA 4AACA 4AZSA 2WEVA 3SQQA 4BL1A 4M3QA 5K0XA 3H0YA 3Q2JA 4IJPA 1B38A 4DN5A 2QKRA 4IB0A 3ZONA 2OLCA 2C6MA 1BI7A 2ZB1A 3EIDA 4O84A 4FKGA 3DBEA 1LEZA 3VRZA 3Q9YA 4CV8A 2EWAA 4ZLYA 4ACGA 5FDXA 2B1PA 4O22A 4X7QA 5DMZA 4I3ZA 4O21A 2UZOA 1TZDA 3DAEA 1DAYA 1Q61A 3O17A 4XOZA 2OFUA 1ZZ2A 3N4TA 2W1EA 3HLLA 2ZYBA 5HE0A 3I5ZA 5L2TA 4CQEA 3IW6A 4J95A 4PRJA 3UODA 4LI5A 4BDEA 1JSUA 3UG1A 2ITXA 5JRSA 4ANOA 3GU8A 5K5XA 3R9HA 3IW5A 3NYNA 4RJ7A 4QMQA 4FVPA 4IFGA 5LARA 4F7SA 4O6LA 4BWXA 1XMMA 4DITA 3V8WA 4RFZA 3UDBA 5I9ZA 3U6IA 1F5QA 4F9AA 4J7BA 3C4ZA 2PUIA 4DEBA 4Q9ZA 3IQ7A 2FH9A 4EZ3A 3BHHA 4JBOA 5FXSA 4XHKB 4AP7A 3CY3A 1UWHA 4MCVA 3A8WA 3E3BX 1YHWA 3FMKA 3Q96A 4RFMA 2A4LA 3SAYA 1UA2A 3BX5A 2JKKA 3O2MA 5AR2A 3VBXA 3PA5A 2CKPA 4L53A 2VNYA 2WGJA 3MH2A 3D5VA 3KL8A 4DFLA 3PUFC 5IISA 2VWYA 3KULB 4F0GA 1H1WA 4EOLA 3KA0A 2C5VA 3DAKA 4XG7A 3PLSA 4G31A 3Q60A 3UP2A 3ZXZA 4F70A 2XH5A 4YBKA 5HCXA 3FDNA 4BDBA 4B6LA 4MXAA 4HVIA 2IWIA 3LFBA 1PJKA 4NW6A 1YOJA 4FTIA 2PVJA 3AOXA 3LHJA 4W8EA 1ZYDA 4EOQA 3VS4A 3EB0A 3OC1A 2E9OA 2HWPA 4BCNA 4FV7A 2JDVA 4AOTA 4GT5A 4USDA 3SC1A 2OKRA 2J0KA 3TT0A 3SW4A 2C47A 4KBCA 2OJJA 3UQCA 3VNTA 2J0MB 4ZSLA 3UDTA 4JQ8A 2IW8A 1XH5A 2R3KA 3S0OA 4FRFA 4XLIA 4AA5A 3ET7A 2VWWA 2OF4A 4CLIA 4AZWA 3RINA 3KF4A 1OL7A 3W0RA 5GJDA 4E4NA 2C0IA 1WMKA 2BR1A 1OIQA 2OJFE 3C0HA 1Q62A 2P2HA 2BRHA 3R1NA 4FKIA 1H1PA 4FV9A 4NYEA 5F20A 1SVGA 2RGPA 3CTQA 3NW5A 2W9ZB 2WO6A 3C51A 4IAFA 4FTOA 3TTJA 3UIUA 2QURA 2PVHA 3PG1A 1QPDA 3A7HA 3RZFA 4M0YA 3EOCA 4OBPA 3UZPA 3R71A 2PSQA 5FXQA 4TNBA 4JAIA 2PZ5A 2BHEA 3JPVA 4CZTA 2XNGA 1XBAA 3F9NA 5FBNC 3VUGA 4KRCA 3SXSA 2RFNA 3F3VA 4NFNA 1KE7A 4RFYA 3CXWA 5TOZA 3VQUA 3TG1A 1UU9A 3BBWA 3QQLA 4FKVA 4RRVA 5EDQA 3NFGB 2Y4IC 3VULA 4FV4A 4KABA 5AAGA 3BLRA 5C9CA 4FODA 1XWSA 5CEIA 1GZOA 5EHYA 3LKMA 3ZHPC 1YQJA 3KRWA 2WTCA 3S95A 4YZ9A 4V0GB 3O8PA 4JJRA 5DWRA 4BBEA 5CALA 4YGAA 4WRSA 4KA3A 4QP2A 5M09A 4O0SA 4QTEA 3P7AA 3E88A 3C9WA 3HL7A 4NIFB 3OXZA 4DC2A 2GNFA 2OO8X 2W1DA 3OCBA 3O8UA 3BHTA 1Y6AA 3L8VA 3U51A 4BCGA 2QU6A 4FG7A 4FVRA 3ZFMA 3ZO3A 4JBQA 2G2IA 2J0IA 4NL0A 3A2CA 4R5SA 3NAXA 4X3FB 4F1TA 4HCVA 3LFSA 3PXFA 5DRDA 3ORZA 1VZOA 4AN9A 3FHRA 5D12A 3EQDA 4BICA 4J96A 3TZMA 4FK3A 1P14A 2RL5A 4YSMA 3GEQA 1AQ1A 1XJDA 4A07A 2IPXA 4EH3A 4BCJA 4AQKA 2XP2A 3QQKA 4BYIA 4ERWA 4FZ7A 4O0TA 3LMGA 5DPVA 4ZY6A 5M07A 2X0GA 3FPMA 4RQKA 5FQDC 3C4CA 5ANIA 3NUAA 3BLHA 4PQNA 3SKCA 4BHNA 4EUTA 1SVEA 2J51A 2XNBA 4OTIA 3EKNA 3UMWA 5HIBA 3BYOA 3VONA 4ZMFA 3E62A 2QO2A 4XG9A 4BB4A 4CRLA 3H9RA 4LGDA 4R1VA 3R7EA 1KE6A 4GS6A 5E8XA 4R78A 4E26A 5CI6A 3VF8A 2VV9A 3W8LA 5A9UA 4NCTC 5AIKA 4FKWA 3L9MA 3GT8A 3IECA 2ONLA 2WMUA 4C4JA 3I7CA 5CSPA 3OWKA 3O51A 1ERKA 4NWMA 1GIJA 4CEGA 3AD6A 4I0RA 2IVUA 2BHHA 3GNIB 3R7YA 4BBMA 1CTPE 4RX7A 4QMYA 2XIRA 2UW5A 4KIPA 1VJYA 5IEYA 2HZ4A 3EQFA 4I21A 4R7BA 4KUJA 4EK4A 1YI4A 2EVAA 3R9OA 3DNEA 3QGYA 5HLNA 3F7ZA 3FQSA 3QRKA 4FBXA 4DEHA 5CEMA 4USEA 4FTAA 4APPA 3UOKA 5ANJA 3DAJA 5JFWA 1PMUA 4IM0A 5CXHA 4M68A 3R01A 5CANA 4GVAA 1WBWA 1Q8ZA 1SNUA 3GCPA 3LFFA 4I20A 1G8JA 4IH8A 5HG5A 3T9TA 2VTIA 2UZVA 3FL4A 3W0MA 2ZOQA 2X9FA 3QALE 5DG5A 4AN3A 4II5A 4FTLA 3W2RA 4AGCA 4Z55A 3HAMA 1GJOA 2HW6A 2WB8A 3LM0A 4JRNA 4ZSEA 3UBDA 4RZVA 4ANBA 4D4SA 4BDFA 5BVEA 4IM2A 1H25A 2XAMA 2WQMA 4PPCA 4GKIA 5CS6A 4CG9A 1MUOA 1I44A 3QQJA 2V55A 4RG0A 3O8TA 4E5AX 4TY1A 2AUHA 4BCKA 3QA8A 2ZVAA 4HVDA 3BKBA 4IDVA 1ZRZA 4MF0A 1QPJA 4QRCA 4RJ3A 4U9AA 5M4CA 4MXYA 3R7VA 3OT8A 3TN8A 4UEUA 2PMNX 3FMEA 3VAPA 4EKKA 3UOJA 2ITZA 1UU3A 2IZRA 2RKUA 4DBXA 5HBHA 3BI6A 4O0RA 4TYJA 5AP7A 4P4CA 4RQVA 4FG8A 5CXZA 3MVMA 3OTVA 4O4DA 4W4YA 4BCMA 5M4FA 4BCHA 3UO5A 2VTPA 2QQ7A 4M13A 3E8CA 3D7TA 3PZHA 1UNHA 5TE0A 1OL6A 4KIKB 2XIYA 4XV1A 4YTFA 3UVPA 4C35A 1OECA 1LR4A 2FO0A 3FC1X 3H3CA 5EQYA 3U54A 4O38A 4DEGA 3EL8A 3NS9A 3PP0A 4BIBA 4DFUA 4U97A 2W4OA 5AA8A 4U6RA 4CV9A 4QEBA 4PTCA 4ANMA 3DQWA 4YTCA 3W2PA 1PXNA 1ST4A 2J5EA 3GC7A 3LOKA 3DNDA 2HZNA 3CTHA 2GSFA 3WF5A 4ZZNA 2E9UA 2PMIA 5CSXA 2FGIA 4TXCA 1SYKA 3ELJA 4JLCA 3VWAA 5C1QB 3QQGA 2GHMA 2VN9A 3UTOA 4PMSA 3TIYA 3QZFA 4IM3A 5KMOA 1YI3A 1FGIA 3GP0A 3PWDA 3GXLA 5IDPA 3F5GA 3OBGA 4JIKA 2VNWA 5LMBA 3AGMA 4Q5HA 2VTMA 2XM9A 4QMMA 3OXIA 3QKLA 1ZYSA 2PHKA 5CI7A 4ACCA 2FYSA 2XCHA 4E6CA 5CWZA 4QT1A 1H8FA 4O7TA 1FOTA 1REJA 4D2TA 5HX8A 1YXTA 2XBJA 3V5LA 3QCQA 5L2IA 2RFDA 4OTHA 2VTSA 3CS9A 5E8ZA 3LLAA 3VS3A 3I6UA 5GZ9A 4EONA 5IZFA 2W4KA 3RPOA 3H30A 4NM5A 3MIAA 5IA4A 4D1ZA 4BZDA 2WQOA 5IUGA 2RG5A 2UZEA 3OZ6A 4Z16A 3ZBFA 4D5KA 3SX9A 3KQ7A 2AEGA 4N57A 3KC3A 4C2WA 4RIYA 2OIBA 4MXCA 1OL2A 4DH5A 3EFLA 3DK6A 4FKSA 2DUVA 4OLIA 3MPAA 4C4FA 2OICA 5AP0A 5CSWA 1L3RE 1Q41A 4YJUA 2GHGA 5HVKA 3NMUF 3FXXA 5IF1A 5DR2A 1NY3A 5FRIA 3ZEPA 3TKIA 5IDNA 2X7FA 1CKPA 4QD6A 4F64A 3RHXA 3PP1A 1FQ1B 2JBOA 2JC6A 4C02A 1MP8A 5JQ8A 1ZY4A 2XJ2A 3OTUA 4FMQA 5HIDA 5LMAA 1MRYA 3RAIA 3G15A 2BZHB 2QLUA 2FA2A 3SA0A 3KKVA 3R8MA 2YM6A 4IVDA 1I09A 3LIJA 4QP9A 5E8SA 4C59A 3S4QA 4EL9A 4Y8DA 2IF8A 3QCXA 4MNEB 3NUPA 2ZDTA 4X2GA 3PE2A 3QYZA 4NM7A 1Y57A 3DBCA 3E8EA 1W7HA 3NCZA 4GIHA 4Y5QA 2CGVA 5CT0A 4IX4A 4ZSJA 4ZTQA 3R83A 4C2VA 5I5ZA 2CN8A 4DT8A 5LVNA 4RVMA 5JQ5A 1GIIA 3AMYA 2FSLX 4FC0A 5AX3A 4MXXA 3VBWA 3WF8A 5KKRC 5M57A 1YXUA 3BGZA 2AQXA 4E8AA 5A46A 1M7NA 2J2IB 4HVHA 1YRPA 1JSTA 5GNKA 1QPEA 4WT6A 4ZY4A 1ZYJA 5ANDA 4XRJA 4HYHA 2BKKA 3QRUA 3BU3A 5JSMA 4ZAUA 4F4PA 4RWIA 4L68A 2Q0NA 3EZVA 4FSNA 5I9UA 3UIBA 4A9SA 4AT5A 3H9FA 3UVRA 3W2SA 2VWUA 3NNVA 4FT3A 3U6HA 1E1VA 4QTBA 4FKUA 3I81A 3CKXA 5CVGA 4L3PA 1CM8A 4HGTA 2VAGA 4I4FA 4Q5EA 1XBCA 2OZAB 4YHFA 1K3AA 3LXPA 4IWQA 1U5RA 1TKIA 2PZYA 3GGFA 4ZJJA 4K9YA 4TWCA 4P5QA 4D4YA 2Z7RA 1SVHA 2ITYA 5M4IA 4IXPA 2X2KA 4RX9A 4DBNA 3COMA 3Q4UA 2W1FA 2WU7A 2YA9A 4QYYA 3DKFA 5A14A 2XEYA 4IADA 4Q9SA 4TRLA 4U3ZA 4L6QA 3QTSA 4RIWB 3G9LX 4AXDA 3PJ8A 4BIDA 2V22A 5T3QA 4G16A 4P5ZA 3C5IA 3V5PA 1ZYLA 2C0OA 3NR9A 3VW8A 3RCJA 4E73A 5EDRA 4BDDA 3TUBA 5E91A 3WI6A 4HGEA 4JG6A 5ACKA 2YIYA 2WEIA 3VUIA 2KTYA 2O63A 3KXHA 3QHRA 2Y6MA 2EU9A 3KFAA 4KAOA 2OI4X 4UMQA 4IB3A 5HBJA 2JFMA 4JIAA 4A06A 4ZZMA 5A4LA 4QPMA 5DNRA 3GC9A 4J98A 4K1BA 1IRKA 2WQEA 3DS6A 3E3PA 5HG9A 4BY9E 4D2WA 2BZKB 3CQEA 3L8XA 4PNIA 2C3IB 4F9YA 2PE1A 2XRWA 4V04A 3VVHA 3AQVA 4XCUA 4I23A 2CHLA 1OBGA 4JDJA 4F7NA 3VRYA 3LQ3A 4JXFA 1M52A 3R63A 4F1MA 3PY1A 5AIRA 4P2KA 3W32A 2O3PA 5EKOA 4NFMA 5AR3A 4M66A 4D1XA 2J90A 2ZV8A 4L3LA 3VS2A 3A7IA 3VJOA 4GYGA 5IUIA 3AT3A 3QTRA 4O91A 5IU2A 3OWPA 4FUYA 4PP7A 4O7ZA 5I9VA 3GCVA 2VTRA 3NNUA 2JKMA 3WZKA 2XIKA 3LCKA 1UKHA 3WBLA 4ZMEA 5HNBA 5CEOA 5KMKA 2WOUA 3SLSA 3HEGA 1IASA 4I1ZA 3TDWA 2GFSA 3MH3A 3R1SA 4NTTA 5AAFA 1BLXA 3NSZA 4FIJA 2WMBA 4DCEA 3QX4A 1OITA 2PU8A 3DZOA 2VWVA 5JEBA 3GFWA 4QTAA 5F94A 4BVUA 5TF9A 4E7WA 4ZTNA 1OIYA 4DEIA 4FT5A 4BGHA 4YP8A 4AXEA 2UZBA 1SNXA 4GFMA 3RWQA 3ALNA 3HX4A 5D1JA 4AU8A 3DJ7A 3EKKA 3Q2MA 4KKHA 4RLLA 3HV3A 4UXLA 4ZP5A 5F4NA 5FTQA 4LOPA 4E20A 3ATSA 2PVYA 4L44A 3BHVA 3DT1A 1P4FA 2GTMA 2J7TA 2VWIA 5L6PA 5HE2A 2O64A 4APCA 5CT7A 2IVSA 2VUWA 4K33A 4JI9A 1Q8UA 1ZOEA 4D2PA 5IEXA 1O9UA 5AP5A 4WNOA 3R8ZA 4GKHA 2PUPA 2H34A 3QC4A 4U8ZA 3EYHA 5HE1A 4D0XA 2WTKC 2ACXA 2ZV9A 3W2CA 4C57A 1LUFA 1Q3WA 4RC2A 4FKLA 4QMZA 5HD7A 2VTAA 3KREA 5ITAA 2H96A 2W1HA 2X81A 3O7LD 3S00A 2NRYA 4C0TA 3IOKA 3W33A 1YKRA 5H3QA 3DU8A 4HNIA 4PMTA 5M56A 5M08A 3Q32A 2PVRA 3PSBA 3BQRA 3FMJA 5KMJA 4LQMA 4CSVA 4XV2A 3DCVA 3BU6A 3KULA 2E9PA 3KVWA 4BI1A 2YIRA 3OG7A 2RFSA 4XX9A 2NRUA 4ASZA 1U54B 3CR0A 2FSOX 4EOKA 5TO8A 5KBQA 1TQPA 2QR8A 4QPSA 4D0WA 3V01A 5DRBA 3N9XA 4MBLA 4LV7A 2VTJA 3ZLWA 5IH4A 4AXCA 2UVYA 3IDBA 2WTVA 3F61A 3HP2A 4CYIA 3NIEA 1A06A 3NLBA 2PTKA 4AFJA 5E92A 3V51A 2VX3A 5HEZA 3TACA 4E6DA 4HJOA 3SD0A 2VX0A 5AADA 4OBOA 2PK9A 4GT4A 5AP1A 4G3GA 2IZTA 4HCTA 5BVWA 3PXKA 1H08A 5FLFA 3TIZA 5M51A 4FKTA 1WBPA 2A0CX 4AA4A 3QCSA 5CF5A 2QOOA 4XH6A 4FI1A 4RX8A 4DGNA 4ZTMA 5E4HA 3FZPA 3A8XA 4EQUA 3AC3A 4EOMA 4A9RA 2QCSA 5BVNA 3MI9A 3HVCA 3Q6WA 3QRIA 5EFQA 3F3UA 3ZC5A 4CMUA 4FVQA 5J87A 4ENYA 3N4VA 5GINE 4AZTA 4DT9A 4MUQA 4O7WA 3QA0A 1LP4A 4L7SA 2UZWE 4IZ5A 4L01A 3F3WA 4J1RA 5CZHA 2PMLX 2YIQA 5EW8A 5FEQA 2J9MA 1CSNA 4O82A 2ONLC 4G34A 1BX6A 4MEDA 5DH3A 4WRGA 3AKJA 1W84A 2QODA 2QOLA 4KIOA 3ZDIA 3FI2A 3UYTA 1W98A 2VO7A 4J97A 2R2PA 4NJDA 5AWMA 5C4KA 3PVGA 4OT6A 4HCUA 4R3PA 3QTIA 1V0BA 4HYIA 4IJ9A 5EOLA 4DGLC 3LMIA 2BAKA 3D5XA 4AW1A 4F7LA 5IQAA 2QOHA 3AC1A 3D14A 3VS1A 4IAKA 4KNBA 3AD4A 5EHLA 4KWPA 4YTIA 4C4HA 4DG0E 4EHZA 3E7VA 4CFUA 3LCDA 2XYNA 1TQMA 3ANQA 3EQBA 4HZSA 5FWKK 5J95A 2VTOA 3PJ2A 5FGKA 4ALUA 4JL9A 3C0GA 1YI6A 4CFXA 4ENXA 4YSJA 4DE4A 2WTWA 1G8KA 1PXJA 4GYIA 2AYPA 3DBFA 3LQ5A 3QWJA 4RIXB 4RIOA 4V0GA 5FM2A 3RALA 5HTBA 3DKOA 2QG5A 3ODZX 4EOIA 3ATTA 4NIFA 4E6QA 4UYNA 5HBEA 4G1WA 3PE1A 4O0XA 4PDSA 4YJQA 5DT4A 4FTMA 1OMWA 3OBJA 2ITQA 2CN5A 2XK9A 3HV7A 3MPMA 3OEFX 4RMZA 5HCYA 4TTHB 5HQ0A 3CEKA 4FZDB 1HCKA 3QXOA 2OF2A 3RI1A 3R7GA 4ARKA 3NWWA 2YJSA 5EYCA 3ZZEA 4X3FA 4IE9A 2VWBA 1XKKA 2ZB0A 4FNYA 3PPZA 4GFOA 4IVBA 4Y95A 3F6XA 3G6HA 2A27A 3FJQE 3IPHA 4HOKA 4I0TA 4HW7A 3EQPA 4JDIA 2XUUA 4OTPA 4U5JA 5IUHA 4TWPA 3SOCA 2H9VA 1S9JA 2GQSA 3LE6A 3FYKX 4S2ZA 2OIQA 3Q3BA 4XRLA 1PXLA 2W06A 3ORXA 3MFSA 4YHJA 5G1XA 5C8NA 2XJ1A 3SHEA 3NAYA 1UV5A 4IX6A 4FA2A 2WPAA 3UOLA 3H9OA 3BWJA 1H1RA 4WA9A 5KBRA 1PRYA 1E9HA 2B55A 3BYVA 3FLZA 1F3MC 2YAAA 4HPTE 4ZY5A 4NZWB 3KXMA 3LFAA 5CLPA 1J7UA 1ZY5A 1NT2A 3KXGA 4OUCA 1L8TA 4Z9LA 4G6OA 4RVTA 3QTQA 4FT9A 3TZ9A 3WIGA 2YEXA 1Y8YA 2B4SB 2YHVA 4TPTA 3F5UA 1JKSA 4GK2A 4O2PA 2QOFA 2ITOA 2XYUA 2WKMA 3W0SA 5E8WA 4ORKA 2GNHA 4IX3A 4X2KA 4ZTLA 4GUBA 3QUEA 3FL5A 2IVTA 3ZH8A 4K8AA 1FMOE 2WD1A 2KULA 3CD3A 2I40A 2R4BA 3EZRA 5CAUA 5AX9A 5E8UA 3VS7A 3UQFA 4UWYA 1M2QA 2LAVA 5JT2A 2PVNA 3AGLA 4HZRA 4NSTA 1YVJA 5KX8A 2GS6A 3BLQA 5AV2A 1Q8YA 3NRMA 3EN9A 3W55A 2XAOA 3BELA 2WU6A 3DJ6A 5CU0A 3SVVA 1UWJA 3SV0A 4GUEA 1A48A 4QDVA 4M7IA 5F95A 5E8TA 1ZMUA 2X4FA 4XG2A 4XP3A 4BDKA 3OT3A 2W1IA 5L8JA 3LVPA 5GZAA 2BROA 3C4XA 2XK8A 4XG3A 3FE3A 5HORA 1W0XC 3ZM9A 4B0GA 3CC6A 4YPSA 3V04A 4PDYA 2V62A 3O50A 5AV3A 3G51A 5FTGA 3P0MA 4S30A 4YZDA 2VD5A 2F57A 4IDTA 5AR5A 2W5BA 5DVRA 3EFJA 2XM8A 4RZWA 4G6NA 2OBJA 2YCSA 3ORMA 4I94A 2ERZE 3MFRA 1WBSA 2HK5A 3PRFA 2X6EA 4JBVA 3EQGA 2C5XA 2HAKA 4QDEA 4YJTA 5JKGA 2OH0E 1M7QA 2G2FA 2W99B 3DXNA 4WNMA 2JKOA 3LXNA 2QG7A 3RPYA 1NW1A 3UPZA 4YJVA 2E9VA 4QMTA 4AQCA 4IC8A 3BYMA 3PSDA 4AE9A 2UUEA 3UDZA 2CKQA 3PXZA 3CLYA 4O6EA 3DJ5A 1OPJA 4GJ3A 3WYXA 3MY0A 4WUNA 5CF6A 4M69B 2R7BA 2XNOA 3LZBA 3QFVA 4I6FA 4W4XA 4GV1A 3R73A 3DZQA 3MWUA 5DGZA 5EKNA 5HO8A 1NA7A 4O86A 5D11A 1HOWA 4CD0A 5AR4A 2XKFA 2WMRA 4EWHA 3EMGA 2QOIA 4XG4A 4EEVA 4O1PA 3A4PA 2Y6OA 3QTUA 4HYUA 2PYWA 4KIKA 1WVWA 4FGBA 1RQQA 5B2MA 2HWOA 1PXIA 4QP4A 3R28A 2AC5A 3OVVA 2BVAA 4UYAA 4X2FA 4YZBA 2F7EE 4J53A 4FNWA 3OCGA 2F2UA 4WKQA 2P2IA 2W1ZA 3CD8A 4BR3A 4IAAA 1XBBA 3FLQA 4TYHB 3VC4A 1Q97A 1F0QA 3AT4A 3MYGA 1X8BA 3G5DA 4PNKA 5BX0A 1IAJA 2RIOA 1QL6A 2YM4A 2Z60A 2BRGA 5H8BA 4CCBA 1Q24A 1FPUA 2CKEA 4O0VA 5CAPA 2YDKA 4RGJA 3JR1A 1JKKA 2C68A 5E7RA 3V6SA 3P08A 3A7FA 1YWRA 3A7JA 3FMNA 4EHGA 4FICA 4FL3A 4UZHA 3DXQA 5EYKA 4IAIA 5B2KA 4LUDA 3TKUA 2O65A 4L52A 3HZTA 2R3OA 3QWKA 4LM5A 4WSQA 4EUUA 4P90A 4X6RA 4F6UA 3IGGA 4CZUA 5A4QA 3IG7A 3W0PA 3F82A 1O6YA 3HUBA 4CKJA 3JY0A 3HKOA 2OXDA 3CE3A 2QO9A 4YZNA 1BL6A 3KU2A 4ITIA 5AV0A 2QOQA 4AT3A 3GOKA 4MTAA 3FPQA 2XMYA 3OS3A 5E1SA 3ZFYA 4YJPA 5D41A 3JY9A 3DBQA 3ULZA 3QHWA 3TV7A 2Z2WA 4FIHA 3FC2A 4F0FA 4MBJA 2BIKB 3FKNA 1W2CA 3E8DA 1KOBA 5D7AA 3ZLXA 4ID7A 3SDJA 3OUKA 4XBUA 4D58A 3C5UA 5GJGA 4AGWA 4FZ6A 1XH6A 5HU3A 3OXTA 2ZFYA 4ANSA 3ZMMA 3KRLA 2XJ0A 3PSCA 2B9FA 3PWYA 3P7BA 3ANRA 4D9UA 3Q9XA 2YM8A 3VIDA 1PF8A 4F6WA 2YJRA 2ZV7A 3EHAA 4WD5A 4BGQA 4N6YA 3CKWA 1DM2A 4IAYA 3GVUA 3HV4A 2UZNA 4TNDA 5AV1A 3TNIA 3TI1A 4EC8A 5EI8A 3LCSA 1W2FA 4IVCA 4I92A 2JLDA 4TT7A 1PYEA 3UO4A 5JFVA 1EH4A 3Q6UA 1JSVA 4MNEA 3OY3A 3PRIA 2XANA 2YM3A 4G3CA 3ZCLA 1Q5KA 4WO5A 5FM3A 2PY3A 3RBWA 2X8DA 2W5AA 2OG8A 4RT7A 5FP6A 1OM1A 4BDAA 5AUUA 5J5SA 3UIXA 4TL0A 4XV3A 1YXSA 4H36A 4WG4A 2YLFA 3EWHA 5K4JA 4DYMA 3I5NA 4PF4A 4IW0A 4O0UA 1ZMWA 3ODYX 5DA3A 5ANGA 4I6QA 2CSNA 2VWXA 2YCQA 3R9NA 1IG1A 3DK7A 4HPUE 1CKIA 3SG9A 3EH9A 3FLWA 3POOA 4YBJA 1DS5A 2R3GA 5D9HA 1T46A 3CJGA 3RK5A 4NTSA 4BDHA 4EQMA 3FV8A 4J8NA 4GCJA 4DLJA 4IFCA 5B0XA 1XQZA 3QXPA 2BZIB 4YR8A 4DLIA 2C6LA 4HYSA 3VUMA 4U3YA 3WE4A 4B8MA 3A62A 4M15A 4DTAA 2OZAA 4QYHA 5CENA 3E7OA 3DBDA 3IK3A 4QTCA 4F09A 5CASA 2B9IA 2UW9A 4FKPA 3HMOA 3CSVA 5JFXA 4O7LA 4XNEA 3FSFA 3I6WA 2P33A 4ZLZA 3RTPA 5HTIA 3TXOA 5FD2A 3E8NA 4BCFA 3ALOA 5LXMA 3PYYA 2BTRA 4RIWA 5ANEA 3Q5IA 3ROCA 4CFVA 4V01A 4X2NA 4ASXA 3TZ7A 4Y73A 2O2UA 3DB8A 1YOLA 2UVXA 3DFAA 4XV9A 5BVFA 3SGCA 4NKAA 4YPDA 2P55A 2W4JA 4YURA 3UZRA 1H4LA 3G0EA 4JMQA 5CF4A 1GZNA 3VQHA 1KSWA 3B2WA 2JD5A 5LWMA 3PXYA 3MB6A 4FR4A 4O4FA 3OW3A 3U9NA 4E1ZA 4GU6A 2DWBA 2PVLA 2WTDA 1ZXEA 2EB2A 3QTWA 4LYNA 5J5TA 4D4RA 1H0WA 1ZARA 3F7WA 4JS8A 3A61A 3MGYA 4QP3A 4BI0A 5BUJA 1AGWA 3I7BA 2H8HA 4DH7A 2HOGA 2HCKA 2VTQA 3FQEA 4DEEA 2VTLA 5I0BA 4IANA 5KCVA 2C5YA 2X4ZA 1JAMA 2HELA 3HNGA 4XP2A 3THBA 4BTFA 5LVPA 4JX7A 5JZJA 4MF1A 4CFMA 1JKLA 3K5UA 4O2ZA 2X0QA 5K4IA 4FSUA 2C6OA 5FXRA 4OAVB 5BQ0A 5EK7A 5CEPA 4IWOA 3PDTA 1PY5A 4C58A 4AW5A 1VR2A 4R7HA 3DLZA 3MV5A 4GMYA 2REIA 2NPQA 2OJ9A 3V6RA 1PHKA 4UN0C 3K3JA 4JDKA 4ZTRA 5ETIA 3PIZA 3RPVA 4QP7A 3LCTA 3MA6A 5HKMA 2YERA 4LL0A