3K3JA

P38alpha bound to novel dfg-out compound pf-00416121
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
348
structure length
329
Chain Sequence
b'RPTFYRQELNKTIWEVPERYQNLSPVGSGGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title The Design, Synthesis and Potential Utility of Fluorescence Probes that Target DFG-out Conformation of p38alpha for High Throughput Screening Binding Assay.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 329
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3k3jA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3k3jA01
3GC8A 2H8HA 1A06A 3EQHA 3HRFA 5DIAA 4G6OA 3EN4A 3U9CA 3VS4A 4F09A 3OCSA 2CN5A 2YCSA 3VUMA 3SVVA 4EC9A 4E7WA 4WSQA 4FE2A 2VO7A 2OSCA 3ZLWA 3Q60A 4ID7A 3CXWA 3PY1A 4IB5A 3GVUA 3BHUA 2X9EA 3VJNA 3ZS5A 5EW8A 4HW7A 1KV1A 3SW7A 2YCQA 5HLWA 2OIBA 4PMTA 5E8TA 3RAKA 4E4MA 5I9WA 3HLLA 3H0YA 1Y6BA 4QMTA 3R8LA 4MXAA 3KRJA 5LMAA 2QOOA 4M69A 3QCQA 5HGIA 2C6OA 4FTAA 3BRBA 4QQ5A 3V5JA 5IA0A 3OOGA 3CJFA 3NS9A 4J8NA 2VWVA 2JKKA 3QD2B 3C4EA 3RJCA 3FZRA 5M4FA 4JR7A 4ZK5A 4D0WA 4BDJA 2WMRA 4NM3A 3TKIA 4QMZA 3NUAA 3F6XA 5GJFA 2A4LA 4R3PA 4XG3A 4I94A 2ZV9A 4ENXA 4FGRA 3ZM9A 4AZWA 4DH8A 3EN5A 3P7AA 3COMA 2YIRA 1G5SA 3HKOA 3NLBA 3DAJA 4FTMA 3V8TA 4L46A 2YM7A 4GVJA 5TR6A 1OPJA 5KHXA 3IO7A 2OJIA 4IWDA 4ITIA 2JFMA 2WMAA 5AP5A 3VN9A 1FBNA 3CQWA 3VHKA 4EH6A 1RQQA 4OTHA 4CYJA 4PNIA 4Y5HA 3S0OA 5KZ0A 4ZEGA 5A9UA 3D5WA 2C30A 3MY5A 2YM4A 4GL9A 1LR4A 2ITYA 1SVHA 4AUAA 4R1YA 4ANBA 2YAAA 3OF0A 4B99A 5BPYA 5LJJA 2J0MB 5AR2A 4RFZA 3AGMA 3LQ5A 4C4EA 4CXAA 4HVSA 5CALA 2Y7JA 5AUVA 4PWNA 4KKHA 1H1WA 2FH9A 2QOKA 3TIYA 3SXFA 1ZY5A 4FG8A 3RHKA 2C6EA 3WF9A 4L52A 3ZLYA 4DINA 4MXCA 3DXNA 4DYMA 2W5BA 1F5QA 1PXKA 4I6FA 1KE9A 3GCSA 4C4FA 2WMVA 4C36A 4DBNA 1PMUA 5HTBA 4ZTLA 3SG8A 2ITUA 3W10A 3UNJA 4RWJA 5CZHA 4NW5A 4O1PA 3SHEA 4YC3A 3G9NA 3UO5A 5FUTA 4WBBB 3OWKA 4PUZA 2W1ZA 5IUIA 5FBNC 3QZGA 2ZMDA 2OH0E 2VWXA 5HU3A 4HVDA 4D2VA 3PY3A 1DS5A 3Q5ZA 3EQRA 2X6DA 3FV8A 1VZOA 2CCHA 2CLQA 3NDMA 3QWKA 3FYKX 4ITJA 4IWPA 4YZMA 4NU1A 4U80A 3NVMB 4NYEA 4ALVA 3NUYA 3K3IA 2CNVA 3SV0A 5IPJA 5JQ8A 3DOGA 4XV2A 4JQ8A 4L3LA 4KBAA 5BNJA 4BCGA 2Y4IC 3NYOA 2F2CB 3I5NA 3W1FA 3EQIA 4C3RA 4IXPA 2XIRA 5HNBA 1ND4A 2BZHB 1KOBA 3DY7A 2C3IB 1YXTA 5C4KA 4IX3A 2HAKA 4OTPA 3GU8A 3CY3A 2PK9A 5FDXA 3KN5A 4CD0A 3FLSA 5BVEA 4EI4A 5CF6A 5HBJA 3UQCA 4WA9A 4LV8A 4J95A 3FWQA 4FKRA 3RCJA 3S95A 3FY2A 3LCTA 3FUPA 1H01A 2PVFA 2QU5A 5DT0A 3UVRA 3VS6A 5I0BA 4FSMA 3HYHA 4PDYA 1CSNA 1YHSA 3NW6A 4FTUA 2IZTA 3FC2A 5E8ZA 3ZTXA 3DTCA 5ETAA 3CIKA 5L6WL 4BCQA 3C4WA 4FKVA 3VUGA 4C62A 4O22A 1JKKA 1REKA 4F0FA 5M08A 2VGPA 2YHVA 3DCVA 2C6LA 3T9IA 4E5WA 1Q99A 5EQYA 4FKOA 4AX8A 2VGOA 2G15A 3BIZA 3GFEA 2WMBA 3FQSA 4YJNA 2R2PA 4YZNA 4CG9A 2V7OA 4ZTMA 1X8BA 2J6MA 3N9XA 2WQBA 4M12A 4O0YA 3FPQA 1OIRA 2VZ6A 5JK3A 4AWIA 3R7EA 4Z7GA 3KK9A 3ZO3A 2R0IA 2ZV7A 3UG2A 4PTCA 4IIRA 4ZLOA 3R9OA 4NKSA 4TKSA 2R3KA 4DLIA 1YWRA 5F20A 2YM8A 4AN3A 4PL5A 2XK7A 4KSPA 1F0QA 4BN1A 4FIEA 1BX6A 2ZB1A 3QKLA 3FDNA 1WBNA 3PRIA 1Q5KA 4FKGA 2V5QA 2FSTX 3JPVA 3E8EA 2OKRA 4ZMFA 1XH7A 1FOTA 3AQVA 5C27A 3ORIA 4GT5A 3RHXA 4CCBA 1JSUA 3RM6A 1GIJA 1CTPE 2FSLX 5LOHA 2UZOA 4FKJA 2CSNA 4DGOA 4WRGA 1XKKA 3OCBA 2E9UA 1MQBA 5T6KA 2RSVA 4DGLC 4YU2A 3UTOA 4CYIA 4FTRA 3R7VA 4D2PA 5JGBA 4KINA 4K33A 4L68A 5GJDA 2UW5A 5DN3A 1YHVA 2X7FA 3E92A 5K4JA 5C8KA 4APCA 3MN3A 2WZJA 3OWLA 4A07A 5HTCA 2VUWA 5KKRC 2F7EE 5IMXA 3PP0A 3NPCA 4W4YA 4QYHA 5JGAA 1FPUA 2QU6A 4CQGA 2B7AA 5A4TA 5I3OA 4BKZA 2IWIA 2XMYA 4EKLA 4NIFA 1ZYDA 3WZJA 3OROA 2R3PA 3BHTA 1H28A 3DLZA 3FJQE 4RX5A 5JH6A 3GGFA 3LXPA 4MNFA 4QOXA 1JSVA 4OTDA 3RAHA 5KMNA 4PPCA 2ITWA 5DRBA 1ZYLA 4ZSGA 1WFCA 2XK9A 3KVWA 2QD9A 2J0KA 2FO0A 2SRCA 5C03A 2GQRA 4LM5A 4XHKB 4AFJA 3RTPA 1QPJA 4QQJA 3AXWA 2FYSA 4KNBA 1RJBA 3PXQA 3H10A 3E93A 4TWCA 3CLYA 1W84A 4NTTA 2PTKA 3HL7A 1PRYA 3OG7A 4FIFA 2YEXA 1ZRZA 4IVDA 5T3QA 4IH8A 2ITVA 4HVIA 4YR8A 3MYGA 3OWJA 2PSQA 5FG8A 4F1OA 4IC7A 4MXXA 5LVPA 2B0QA 1DAWA 3BE2A 2PUIA 2PZRA 4GUEA 3ORZA 4P2KA 4BDCA 4XUFA 3UOLA 4ZIMA 4AN2A 3MS9A 3B2TA 3R9DA 3D7ZA 4JG8A 2W4KA 3NCGA 2PVRA 4MH7A 1OUKA 4O2PA 4XG8A 3BGPA 2YCRA 3ORNA 3PJ1A 4YC8A 1HCLA 1PYXA 2X2LA 5FEEA 3EZVA 5D9HA 5HORA 4OTGA 4WNPA 4G1WA 4GUBA 4JR3A 3PFQA 4YPSA 3F3VA 3TJCA 2QO7A 4BC6A 4QMQA 5JGDA 5E1EA 3FZ1A 4H3PA 3C5IA 1FGKA 4DFLA 4I6BA 3A4PA 3I4BA 3F61A 3ZRMA 2PVMA 3FSKA 3R8UA 4GJ2A 4XOYA 2PVLA 4RIYB 4EYMA 4I23A 3TDWA 4LUDA 3MJ1A 4WRSA 3FHIA 5C9CA 3WE8A 4XP2A 3A7JA 2IW6A 3K5VA 2BDJA 5D7AA 4S32A 2OZAA 2XIYA 4E8AA 4YO4A 5IG1A 4R8QA 3QGYA 4I1ZA 4BI1A 3W33A 2WD1A 2HIWA 4ACDA 4EOQA 3O17A 4BIBA 2XNOA 4FIGA 3PIYA 3QTUA 3TUCA 4AXAA 2PUNA 3WZEA 5EKOA 4RIYA 1M2QA 3LLTA 3QA0A 3UE4A 5DR9A 3F9NA 2O3PA 2VTJA 2ITOA 5GHVA 4BCHA 4ACHA 5AUTA 1W7HA 1KOAA 2YA9A 3WF6A 1B6CB 3MI9A 5JMSA 3LFBA 1W83A 2JDVA 3Q9ZA 3ZBXA 4L3JA 3DFCB 4AZFA 3G15A 3C4CA 3CBLA 1PXPA 4MQ1A 3QBNA 3QQGA 1M17A 2C5NA 2R3QA 5E92A 3N4VA 2QOHA 2Y9QA 2CKQA 4HOKA 4OR5A 1XH6A 4OTQA 3R7OA 1ZY4A 4FZAB 2WQEA 2GHMA 5T68A 4IVBA 5M4IA 1ZLTA 3QRKA 2OLCA 4IJ9A 3QHRA 3ORPA 4EOLA 3ZSHA 2OBJA 3FL4A 4QTDA 3O8UA 2Z7QA 5JFWA 4II5A 3MVHA 1JKTA 3ANQA 4IB3A 4YPDA 3ENMA 2IPXA 5BVNA 4GT3A 2I6LA 2XK6A 3I0QA 3R73A 3NYXA 3ORMA 1Y8YA 4GFGA 3W2SA 1ZOGA 4AZVA 3QL8A 2X0GA 3VBVA 3DLSA 4CTCA 2CCIA 3F3UA 1VR2A 4RWIA 4W4VA 5BVFA 5FTQA 2OK1A 3K5UA 4K77A 5CS6A 4JI9A 3HMNA 4FNYA 3A7GA 4KD1A 3SQQA 5IA1A 4LUEA 3HRBA 2J5EA 3MA6A 4G5PA 3UP7A 4A9UA 2G2FA 2GSFA 4EEVA 2KULA 4YGAA 4BCNA 2YACA 5JFVA 3A61A 4UMUA 4V0GB 4F7SA 2WTKB 3G9LX 5DNRA 1JNKA 3KXXA 1WBOA 2WQNA 5FLFA 4CZTA 3LFAA 4NZWB 5DBXA 2DS1A 4E4LA 4PQNA 3DDPA 5BUIA 2CGXA 3F3ZA 4TYHB 3TDVA 5FRIA 1H08A 1OZ1A 4DAWA 5CENA 4FT9A 3KRWA 1WCCA 2VTSA 3D2IA 5DMZA 4X3FC 4AU8A 4EOMA 3E7OA 3C7QA 2HZNA 3ZCLA 3WOWA 5KMOA 2XS0A 3E3BX 4CFVA 1H0VA 4KS8A 5DHJA 3F66A 4DN5A 3N4UA 3QQUA 2OJJA 2NO3A 4IWQA 4CMOA 3OW4A 4O7VA 3VS0A 5M44A 4Q2AA 2FSOX 3VC4A 1T46A 3L9NA 1M7QA 5FP6A 4HGTA 4FEQA 3HV3A 1PY5A 3VUHA 3ZHPC 1OB3A 3ATTA 4RX8A 4XRLA 2FA2A 2WO6A 3POZA 3FLZA 5ANOA 3LFEA 4FSZA 4KWPA 4WNKA 5J7BA 3E8NA 3EFKA 2R4BA 3MA3A 4IDVA 4BKJA 3FL5A 1UV5A 2BROA 3KY2A 5HICA 3CTJA 4O0SA 3ORLA 2R7IA 4JG6A 4BYIA 3P9JA 4DEAA 3QYZA 3CKWA 1J7IA 1YWVA 4S33A 3O51A 4LYNA 4BCIA 4AE6A 2R9SA 4XV9A 4FSUA 4QYFA 3LPBA 3F88A 3PE1A 3CC6A 3ZUUA 3GC9A 3QCXA 4HPTE 4YJTA 3D14A 4IB0A 2JBPA 4BB4A 1MUOA 2XJ1A 1KSWA 5LWNA 4GFOA 4UB7A 1ZAOA 4M66A 5CI7A 4CKJA 4RJ6A 5KZIA 4HCTA 4AGUA 1CM8A 2XCHA 4I0RA 2A1AB 2VTTA 4J98A 3QD3A 3LFSA 4WSYA 2VO6A 4EHEA 5EI8A 4GW8A 4LOPA 3LJ0A 3ZSGA 4CFWA 3OTVA 3DKGA 2EB3A 4RJ5A 1Z5MA 4BRXA 4ERWA 3HV6A 3KU2A 5CLPA 5HE3A 3RZFA 3BKBA 1YI3A 3U6JA 5GZ8A 4OTIA 3NSZA 4AZEA 4EUUA 4MQ2A 1MRUA 1U54B 3NNWA 4DE4A 3PPZA 3HA6A 3NUUA 4O6LA 4UZDA 4WD5A 5HQ0A 1Q61A 3PA5A 1YOMA 1OITA 2VRXA 3IPHA 4O7TA 1H8FA 3OD6X 3LFCA 2OIDA 1WMKA 5TE0A 1XWSA 2WMQA 1Q41A 1KE7A 1Y6AA 3ULZA 3ZO1A 4E6AA 1LEWA 4EUTA 5L8KA 5LCJA 3WI6A 5AA9A 4AT3A 3RPOA 4GV1A 3KCFA 4J8MA 4FG7A 1UNLA 1Q4LA 3BYSA 3MB6A 5CVFA 5I9YA 2IN6A 1BI8A 5E4HA 2XUUA 2E9VA 4DGMA 5DOSA 2NRYA 1BUHA 2DYLA 3HX4A 3HEGA 3IDCA 4PMMA 4Z3VA 4X6RA 2W1CA 2B9HA 5ITAA 1UWHA 3QRTA 2HZ4A 4EOKA 5HE1A 1MP8A 3M11A 4ZJIA 3O0GA 2YDIA 5I4NA 4HVHA 2XBAA 4YHJA 1YW2A 2WTWA 4ZLYA 4EOOA 2X8DA 3COIA 3PXYA 4TYIA 1J91A 2BAQA 4QPSA 5IQAA 3G51A 3FC1X 3KL8A 3MH2A 3CJGA 4MYGA 3H9RA 5FXRA 4BTJA 4U5JA 4G3FA 2XZSA 2IVTA 2YCFA 2PZYA 1I09A 3HV7A 4JIAA 1JKLA 1RW8A 3VRYA 3IW6A 4EH2A 5CSHA 3FQEA 3O23A 5E8YA 3VW8A 2H6DA 3RPVA 2XYUA 4LI5A 4MKCA 1U4DA 3IGOA 3EZRA 1PMNA 4FSTA 4ITHA 3GQIA 4RJ8A 1QPDA 3C51A 4C59A 2Y4PA 4CSVA 1AD5A 4MNEA 3L1SA 2W17A 5AMNA 4RJ4A 4YUQA 4C2WA 4PP9A 4I93A 4JL9A 5HO7A 5D41A 4PMSA 3KXHA 4LGHA 2Y4IB 3KGAA 4FYOA 4E1ZA 3FMEA 4RIWB 3IW5A 3FZSA 3MFRA 3ZUVA 1DI8A 4GMYA 3QF9A 2UW0A 3VHEA 4C3PA 4UX9A 5KCVA 2RFEA 4RC2A 3VBTA 3OMVA 5IQBA 1J1BA 3LXNA 2F4JA 5A46A 3A99A 2HW7A 2OJGA 5DR2A 1LEZA 2ONLA 3S4QA 4L45A 4A06A 4LG4A 4FKTA 3LJ2A 3VUTA 2XB7A 4F7JA 4XBUA 4N4SA 3DQWA 3QQJA 1M14A 4YHFA 3EOCA 3BLRA 1WVYA 2GNJA 3G6GA 3BEGA 4MX9A 3DU8A 3ZYAA 3IECA 3QUPA 4GRBA 4FKIA 4RVKA 5HEZA 4FKPA 4DEEA 2OF2A 5IH5A 1CKJA 3ZU7A 5J87A 3EFJA 4R77A 3QWJA 1STCE 4EOSA 2GDOA 4MXZA 3DGKA 3HA8A 3CQEA 2PVYA 4GT4A 4DLJA 5EDPA 1QL6A 4AE9A 3EH9A 1IAHA 3M42A 3LFNA 2IVSA 2YN8A 3QZIA 5CT7A 4AGWA 5HVYA 3WF7A 2WHBA 3LFFA 4YNEA 5ETIA 1SNXA 2QKWB 5AP0A 4LRKA 1NVQA 3MBLA 5KMLA 1RE8A 2PHKA 3A62A 4JAJA 3C4XA 4L8MA 4LL5A 1WAKA 2VN9A 3EQFA 3AC4A 3BV2A 3PRFA 4DA5A 1E1VA 5HG7A 1UU8A 2BZKB 1TVOA 3IW4A 3DBQA 3EN6A 3A60A 3SX9A 3EIDA 4R3RA 5FTGA 3D2KA 2C3LA 3E63A 3QTSA 4E4NA 4TWPA 3TL8A 4ALWA 5K3YA 4FKSA 3OY1A 2G9XA 2GNGA 2EB2A 4K6ZA 2FSMX 4G3EA 2P0CA 4TNDA 3GNIB 3OOMA 4R1VA 3Q4CA 2QO2A 1P4FA 4Z7HA 4R7BA 1IEPA 2WTIA 5HD7A 4K11A 2BKZA 5JSMA 2Z60A 3FSFA 3WILA 3RINA 4EZ7A 4YSJA 1U46A 5AR5A 4RFMA 2AC3A 4AW1A 3NNUA 4PMPA 1H24A 4D0XA 3G6HA 2OFVA 5L2QA 3D4QA 4BZNA 3IS5A 2YABA 4HCUA 4M8TA 4CEGA 4WO5A 2W1GA 3R8PA 4CMTA 5LMKC 4N57A 4KRDA 1XH4A 4RVLA 3BE9A 3GT8A 3H3CA 4IACA 1SYKA 3P1AA 4LL0A 2H9VA 3K54A 4FV7A 5FDPA 2XJ0A 3GU5A 4XNEA 4ZS4A 3KXNA 3HNGA 5AR7A 2ZYBA 5DA3A 3RCDA 4IB1A 4YJSA 3L8SA 5K0KA 3RI1A 5IQIA 5AP1A 5HD4A 4Z9LA 3MFTA 3DAKA 4FSWA 5EKNA 4QT1A 3UG1A 2WMTA 3WYXA 4HGEA 1P5EA 4O0UA 4F6WA 1APME 2WTDA 2QLQA 5E8XA 4AZTA 3D5VA 3NUSA 3OWPA 4AW0A 4Y85A 4APPA 5EQPA 2UZEA 3QYWA 2CLXA 3DJ7A 5EW9A 3R28A 4NSTA 2GQSA 5J9YA 3RPRA 4WHZA 2V55A 3BQRA 5IF1A 3NX8A 3FMHA 5EOLA 1V0OA 3C4ZA 5C1QB 5C8MA 1H1RA 4YBKA 5I9XA 3I81A 4ZY4A 4FKUA 4HGLA 1R39A 3W32A 3TUDA 3LKMA 2WTVA 3DFAA 2B9FA 3JUHA 3NIZA 4Y83A 3SXSA 4ACGA 2VU3A 4GKHA 3L9LA 3I0OA 3HECA 4FTNA 2YITA 3RK9A 1YXSA 1Y57A 4RMZA 5I9ZA 4EH5A 1ZWSA 2CMWA 4FSYA 2JDOA 3KN6A 4BIDA 5BMMA 4OTFA 1ZOHA 4JVGA 4FTCA 4WKQA 3FMMA 3SC1A 4YHTA 2ITNA 1JBPE 4IC8A 4IAAA 2IZUA 3D7TB 5EDQA 2CGUA 1REJA 2QOLA 3G0EA 4X6QC 1KV2A 2BUJA 3QTIA 3KCKA 4ASXA 4XH6A 2IZSA 4G34A 4BCMA 4MVFA 2WXVA 4DEBA 3DPKA 4LFIA 3ERKA 4KKEA 3N4TA 2XYNA 4ACMA 1H00A 4ENYA 2XNMA 4YJQA 3NW7A 3VF9A 3VBWA 2PY3A 3U4UA 4HYUA 5CASA 3MB7A 3DB8A 1Q24A 1QPEA 4UWBA 2UW8A 4CFFA 4RBLA 4MCVA 5JT2A 5EYMA 4BBEA 4JAIA 4B0GA 2XA4A 1FMKA 2OF4A 4N0SA 4PF4A 4W4XA 3QTQA 3D7TA 4U0IA 5FEDA 4AT4A 4QTEA 2WEVA 4JBPA 1YXUA 3QU0A 3V5WA 3ZFYA 3FLQA 4FTOA 4RG0A 5IQDA 3EQDA 4IMYA 1W0XC 3OP5A 4NW6A 4M7IA 1BL7A 2OFUA 5CX9A 5EM7A 4FNWA 5KMIA 2J0LA 4IQ6A 2UW3A 1UU7A 2YIQA 1V0BA 3I60A 3KXGA 3P08A 3AT3A 3R22A 4FZ6A 4K2RA 3U8WA 2IG7A 3MVMA 4QP1A 4RZVA 5HESA 3KK8A 5AP4A 3RVGA 3VUKA 4E20A 5B2LA 4N70A 2QNJA 2VWWA 2W5HA 2XH5A 5HHWA 2P2IA 5A6NA 2A27A 1YXXA 3A8XA 4C58A 4CFMA 4TWOA 3NNXA 3LOKA 2Y6MA 4KA3A 4AGCA 4BTKA 3UC3A 2UV2A 4DTBA 3QZHA 4RIXB 4ANQA 1S9JA 4JBQA 2BCJA 1WVXA 2O63A 3DZQA 4ZSJA 3VUIA 4EZ3A 3E8CA 3O7LD 1TQMA 3FKLA 2AC5A 5AR8A 5BYZA 5CAQA 4DFBA 3VO3A 2YJSA 4NM0A 5EK7A 3LM0A 4EYJA 5HLNA 2X8IA 1FMOE 3P78A 3AG9A 5LWMA 1ZMWA 1KWPA 2WNTA 4QRCA 4I5HA 3NNVA 3OS3A 5I9VA 3NGAA 5EM6A 3FMKA 4F1MA 2WIHA 4ASDA 4K1BA 2LGCA 2HY81 2RL5A 1WVWA 3P23A 3HAVA 2I0YA 4ASZA 2IW8A 3UOJA 3ATSA 3SRVB 2ONLC 3ROCA 3JXWA 2PE2A 4FR4A 4OTRA 3T8OA 3W8LA 3V5TA 4RIXA 4RC4A 2XF0A 2PULA 4X2GA 3KRRA 2UZBA 2I1MA 4KUJA 4DTAA 5DWRA 1CKPA 4JDJA 3AD4A 4QMVA 4GK3A 3FXWA 4FGBA 4KRCA 4FEUA 3HV5A 2RGPA 5CZIA 1Q3WA 2AUHA 2JDSA 3FKNA 3GFWA 4MBIA 3RKBA 3WE4A 4FZFB 5F95A 2P55A 2PE1A 3BU5A 3H4JA 2ZV2A 4NKAA 3ZMMA 2I0HA 3PJ8A 2YJRA 1Q8ZA 5CU6A 5GJGA 3TNWA 5EYCA 4ZAUA 4BGHA 2NNWB 3O50A 4C0TA 5IH6A 4QMMA 4QP8A 2WTJA 3GC0A 4BY9E 3OBGA 5EYDA 3EQBA 2WMWA 2HK5A 4XG6A 4EH7A 4I41A 4QP4A 4EKKA 3MGYA 5A54A 5CF5A 1BI7A 3UBDA 4CT2A 3F2AA 2X81A 4MBJA 4FVQA 4BBFA 4FV0A 2ZJWA 5AV3A 2B9IA 4K8AA 1GOLA 2GNHA 3QX4A 4QP2A 3LCKA 4ZSEA 4MWIA 4RWKA 3KRLA 1K9AA 1Q8WA 3FI4A 1URWA 5DEWA 1IASA 1UNGA 3UGCA 4BTMA 5J5TA 5D10A 3QX2A 2PUPA 5AP2A 4JBOA 3ZM4A 4GH2A 1ZZ2A 4A9SA 1IA9A 4BWKA 3I1AA 3NCZA 1PF8A 2ERKA 4UMTA 2WGJA 4E73A 4TPTA 4AT5A 3QLGA 4XCUA 2WOTA 2QR7A 3VF8A 4R7IA 1R3CA 2BMCA 3H9OA 5AR4A 4D4RA 4J53A 3SGCA 3UP2A 1YOJA 4FKLA 4FYNA 3FMLA 3GP0A 5K9IA 2YWVA 3BU3A 3HMPA 4L01A 2VTPA 1YDRE 3IDPA 3MFUA 3U87A 1M2RA 2HY0A 3SOCA 3VBYA 4DITA 5BYYA 2E2BA 2XIZA 5ANDA 2KTYA 4BZOA 4YO6A 2HCKA 2VO0A 2W1DA 3QKKA 5AUUA 1OL7A 5FWKK 4GK4A 2Q83A 3N51A 5AX9A 4F70A 2VTLA 5CQUA 3DT1A 4HZRA 4LV5A 3LCDA 4OT5A 2GHGA 3UZRA 2R3GA 3CPCA 3PY0A 3PG1A 4GKIA 4OGRA 4IBMA 2OXXA 1MRYA 1O6KA 3OUNB 4XP0A 3BHYA 4S34A 5HU9A 3VAPA 2AYPA 3FE3A 4XJ0A 4BKYA 3KQ7A 4EQCA 4HPUE 3GU6A 4YZCA 3ROYA 3VRZA 4YTFA 3WYYA 3LMGA 5DR6A 3MSSA 4CZUA 2Z8CA 5CEOA 3SD0A 4K0YA 5L2WA 4C2VA 2GQGA 2VX0A 3B8QA 3TN8A 4DFNA 5K5NA 4B6LA 3D5XA 2O65A 4L67A 1J7LA 4HYHA 4IM0A 3DNEA 1FQ1B 4FA2A 4LRJA 4RIOA 5BVOA 4HYSA 2G2IA 4FL1A 3MDYA 3EL8A 4H1JA 1R0PA 4GYGA 4HVGA 3IONA 2ZAZA 3PTGA 4EHZA 3D9VA 3L9MA 3QC4A 4FG9A 2Q0NA 4L7SA 4TXCA 3R7IA 3NUNA 4DT8A 2C6MA 3E3PA 3CTQA 3SDJA 2ZOQA 4JRNA 4O84A 4R6VA 1NVRA 4BDHA 3FY0A 4FV9A 3SLSA 4A4XA 3LQ8A 2BIKB 5HKMA 4C4HA 3V51A 4IZYA 4YJRA 1B39A 2QOFA 4X21A 5HCYA 4ANNA 4CTBA 5HI2A 4Z16A 2C6DA 2EU9A 2F7ZE 1BMKA 2BAJA 3AC2A 1GZOA 3F69A 3FBVA 4RGJA 2ZM4A 4AQCA 2WIPA 3GU7A 2XEYA 4F08A 4XV1A 2QOIA 3MPMA 3QD0A 1OBDA 4IAKA 2OO8X 4UN0C 1GZ8A 3AT4A 3PSBA 4O6EA 4U3YA 3R8ZA 3RK5A 5D1JA 4BI0A 3PA3A 4QMLA 4IANA 4UMQA 1IRKA 3UPXA 3DB6A 4QP3A 2UZNA 3VNTA 1L8TA 4F9CA 3BWJA 4IM2A 1PYEA 5GZAA 4DC2A 3LE6A 4A9RA 3CR0A 3CE3A 3OY3A 3KC3A 5L4QA 3M2WA 3RWPA 4ANLA 1HCKA 4QMUA 4ZOGA 5M09A 2HXQA 5H8EA 3ALNA 5A4EA 4O83A 4BBMA 5JZJA 2J50A 1BYGA 1J1CA 1NVSA 4KAOA 4FEXA 4CKRA 5CF4A 5DYJA 3MTLA 2A2AA 4AA0A 4DEHA 5G6VA 4EH3A 3AT2A 1YDSE 2OZOA 2X2MA 2XM8A 4GK2A 4L00A 2CPKE 2PPQA 5KHWA 4J7BA 2R7BA 4OLIA 3TV4A 4AAAA 4OUCA 4XG4A 4FTTA 1W8CA 1GJOA 4K18A 1XBAA 4IX4A 3T3VA 2UZVA 4F9WA 3ZRKA 3NVKI 3IQ7A 4KIOA 3WBLA 4JNWA 1H4LA 3I79A 5BQ0A 4FTLA 4XMOA 5DE2A 2J2IB 4FT7A 1YVJA 4DH7A 3PLAE 1DM2A 2BFXA 3FEGA 4FV3A 2GNLA 5EYKA 3HZTA 4RA5A 2PU8A 4KBCA 4U6RA 2BVAA 3ZO2A 1UU9A 2J9MA 3DZOA 1VJYA 4O0XA 3OUKA 2HENA 3FPMA 2QHNA 4MXYA 4U40A 1JKSA 4EK4A 3UQFA 2PMLX 4TY1A 4AN9A 2DWBA 3I6UA 3R7UA 1H07A 3R1YA 4MD8E 3W16A 2OJ9A 4GIHA 3R9NA 4RSSA 3E88A 5HOAA 2XRUA 3I6WA 3KXZA 3A4OX 4FUYA 4PDSA 5AJQA 3W2PA 5A4CA 1YI6A 5E8SA 4O82A 3P86A 4FSNA 4EK3A 2OH4A 4C61A 3QKMA 3ID6C 1OECA 5DLSA 5CXZA 3PVBA 4B8MA 4E6CA 3JR1A 4FNZA 4Y5QA 3E64A 4YMJA 3PVUA 4M13A 4TYJA 2UZLA 3UIMA 4G5JA 1QMZA 3U6HA 4BZDA 3C4FA 5CAVA 4YLJA 3ZSIA 1UA2A 5HVKA 4AOIA 3ORKA 3ODZX 2P3GX 3DK6A 3ITZA 3LM5A 3MY0A 4BDFA 1IG1A 2X4FA 1OKWA 2JITA 2XNEA 3IW8A 3FZTA 4F1TA 4DGGA 3GXLA 3F3WA 5L2IA 1BLXA 1NY3A 1JWHA 1Z9XA 4W9WA 2J5FA 2QODA 4BDAA 3MVJA 2RFSA 3QRUA 1WBSA 2UVYA 5LCKA 4AGDA 3UMXA 1R1WA 3UOHA 4PPBA 4U43A 3A7HA 5LMBA 3ACKA 3UVQA 4V0GA 4F9YA 4QP9A 5M51A 2YDKA 2HWOA 3R83A 2W4OA 4NK9A 4JT3A 2W7XA 3TUBA 3BV3A 4RPVA 3C5UA 4TYHA 3K3JA 4YNOA 4R5SA 5H8BA 4FT0A 5TO8A 3R2BA 3EFWA 4AS0A 3GEQA 4M0YA 5TF9A 2CN8A 2IO6A 4AA5A 3RPYA 2IJMA 4RRVA 4O7ZA 2JFLA 2F57A 4KABA 4XP3A 4OAVB 5BMSA 5CVGA 3V04A 4EOIA 4DH3A 2UUEA 3SA0A 3FZPA 4BTFA 4UWYA 5CU2A 2ITZA 4XX9A 3BELA 4IAZA 1OPKA 5DGZA 2Y8OA 3KMMA 5IMEA 4TRLA 4XG7A 3EWHA 2OIQA 3BBTB 3ZZEA 4L44A 2ETMA 3LCOA 4QD6A 5JQ5A 5CSXA 4JQEA 4EHGA 3OBJA 2G01A 3BBWA 3GCVA 3V5QA 4D9UA 4ZJVA 4RWLA 4JX7A 3OVVA 4A7CA 5AEPA 4EH9A 2HWPA 4GIIA 3BZ3A 4MAOA 3E87A 4C35A 3PP1A 2O0UA 5EOBA 2PL0A 3C1XA 4OBOA 5BVKA 3AC1A 4HCVA 4QMPA 3QC9A 4D4SA 5KMKA 2XVDA 4AF3A 4F99A 5L2SA 4UMPA 2I0VA 2W9FB 1EH4A 1SMHA 3EYGA 3W55A 4GSBA 3JYAA 3PDTA 2BFYA 3MIAA 4U9AA 2ZVAA 2E9OA 3NYNA 4MWHA 4Q5HA 5A3XA 3ZXTA 4KB8A 1LUFA 1L3RE 1CKIA 2VWZA 3R6XA 5HG5A 2ZDUA 2F49A 3DS6A 1YHWA 1PXIA 3FI2A 4N6ZA 4HYIA 4YZ9A 3VWAA 5A4QA 2C1AA 3ALOA 2WEIA 4DG0E 3R1SA 1NW1A 4HGSA 4QTAA 3UYTA 2WMSA 4A9YA 5LVLA 1IA8A 4ASEA 5KUPA 4Z55A 4FODA 3ZO4A 2GPHA 3V8SA 3PJ2A 2XBJA 3R01A 4PX6A 3Q4ZA 3NAXA 1S9IA 2OXDA 5ICPA 5KMJA 1OKVA 2C3KA 2YLFA 3O2MA 4KIQA 4LQMA 3RP9A 3C0GA 3V6RA 5B2MA 3R0TA 3Q9WA 3Q6WA 4FZDB 3SAYA 2UZWE 4QP7A 3M1SA 5AP7A 4E26A 1U54A 4NJDA 5HBHA 4FK6A 3G5DA 3UZPA 5AX3A 2YWPA 4H39A 2WB8A 4M15A 4RX7A 3DTWA 4USDA 3VS2A 4F6SA 1Q97A 2PVNA 4DG3E 1OMWA 2VAGA 3OT8A 1PKGA 3RNIA 4D28A 5AAEA 4IE9A 3OZ6A 2XP2A 4TW9A 2HYYA 2RIOA 3MIYA 3P5KA 4IHPA 4QMSA 4ZTHA 2ITPA 4J71A 3P4KA 1WZYA 1K2PA 4OT6A 2B52A 4QTCA 4V04A 4PTGA 4FTKA 4C38A 1YXVA 2W9ZB 4PDOA 2XRWA 4G3CA 3ZLSA 2DUVA 2VTAA 4FNXA 2PZ5A 3E5AA 2EVAA 5EM8A 2BRGA 5J9LA 4PP7A 4IWOA 3DXQA 5IDNA 5IUHA 2C6KA 2J4ZA 3R02A 2UW6A 2C6IA 2VNYA 2OG8A 2CGVA 4I20A 5AIKA 2BZJA 4ZSAA 2XM9A 3LCSA 4Q5EA 5FQDC 5DEYA 3F5XA 2CJMA 5CAUA 4H3BA 3PZHA 3IDBA 2QR8A 3PPKA 4EL9A 3PJCA 4EBVA 2W06A 2WMUA 3GU4A 4P5ZA 4XEYA 3HUBA 3OEFX 3QCYA 4I0SA 3D5UA 4DEIA 3OEZA 3MH3A 1CDKA 3BYOA 2UZUE 5ACBC 4E5AX 5EH0A 4OBPA 4XBRA 5M4CA 5ANGA 3UNKA 3KRXA 4UYNA 2X7GA 3LLAA 4IVAA 2CGWA 2E9PA 4M14A 4RJ7A 1V1KA 5AUWA 4RIWA 2W1IA 2PUUA 4IVCA 5M57A 3V6SA 5AA8A 5LARA 1GNGA 3RK7A 4D5HA 3OW3A 3QQLA 3RBWA 4MF0A 1OL6A 5C4LA 3V01A 3QHWA 2QG5A 3ACJA 3BHHA 3D83A 4MXOA 2DQ7X 5DT4A 3H0ZA 5AV1A 1Q8YA 3IKAA 4H1MA 4E4XA 3BU6A 3UZTA 4EBWA 3SW4A 5IZFA 4MF1A 3F5PA 4FSRA 1OKYA 2OW3A 3DKFA 5CEMA 3P79A 5L6PA 2WQOA 3UO6A 1SNUA 1BKXA 1Y8GA 4CCUA 5EW3A 4AW5A 4X2NA 4G31A 4IX6A 2ITXA 2UZDA 4HZSA 4EC8A 4O21A 5E8WA 5FD2A 1ZARA 5CAOA 3EFLA 2QKRA 4YLKA 1WBTA 2UZTA 3LMHA 2W1EA 3BLHA 4O7YA 4G16A 4YBJA 4W4WA 3ETAA 3JVRA 4DBXA 2Y6OA 2B9JA 4TTHB 4ZTQA 4WG5A 3QTXA 5BYLA 3FHRA 1M52A 5C01A 3QCSA 3A2CA 1O9UA 3F82A 2G1TA 3BQCA 4F6UA 5JFXA 2GS6A 3PWDA 5HIEA 1M2PA 4OAUC 4KKGA 4QMXA 2PMIA 1J7UA 4FIIA 3HRCA 4YZBA 2I0EA 4O96A 3CQUA 3HP2A 1GZNA 2B53A 2YM3A 5BVWA 3R21A 1LPUA 4Y95A 5IUGA 2UVZA 3OCGA 4BWXA 2EWAA 2XK4A 3H9FA 4Y46A 5KKRB 5GINE 4CLIA 5GIOE 2GS2A 3PYYA 1JSTA 4P7EA 3ZH8A 4DFUA 5AAGA 3BCEA 3AMBA 5CY3A 2WTKC 3O7LB 5K5XA 4RJ3A 2Z7RA 4NTSA 4RVTA 4DF3A 5HLPA 5AR3A 4MK0A 3TG1A 1JVPP 3L9PA 3Q32A 4LOQA 1ZYSA 4X3JA 3EMGA 3BX5A 4XRJA 4CQEA 1VYWA 3A7FA 5IA2A 3NW5A 4DCAA 2VTMA 3AGLA 5LQFA 2RFNA 1U59A 2YIXA 3RMFA 1E9HA 2JC6A 3TTIA 3CPBA 3Q9XA 2JDTA 3VS3A 3D15A 3Q2MA 1W82A 1I44A 4HNIA 4CMUA 5E90A 3OFMA 3HMOA 3GB2A 1ERKA 2BHHA 5L2TA 4TYGA 3TKUA 4O91A 2OGVA 3FMJA 4FMQA 3CSVA 4FEWA 3O96A 1QPCA 2R3RA 2PVKA 4I5CA 4JS8A 4U42A 3ZUTA 4ONAA 4GJ3A 2P4IA 4WNOA 1PXOA 1RDQE 4BDDA 3MFSA 5L3AA 2GTNA 2C1BA 3WIGA 2VTHA 4IAFA 5LVMA 1JPAA 4WT6A 4D1SA 2X1NA 3OTUA 4TWNA 4D55A 1OL5A 1YI4A 1CMKE 1PJKA 4BGQA 1YDTE 4C02A 5A4LA 4BL1A 4YP8A 4J97A 3VJOA 1NXKA 2CNQA 3QALE 3QXPA 4NM5A 4G3DA 3ORXA 3QTZA 4CT1A 3CP9A 3FAAA 2BTSA 2C5OA 2JIVA 5EDRA 4FKWA 4ZY5A 1PW2A 1WBPA 1H1SA 2ZDTA 3RNYA 2R64A 2YIYA 4GG5A 4FVPA 1ZMUA 4JXFA 5CSWA 3FLYA 3TI1A 3ZC6A 4BDBA 5IH4A 4DTKA 1GIHA 3OC1A 2C0IA 3PXFA 2C5VA 3R1NA 4G9RA 4M97A 4PTEA 4RC3A 5DPVA 5HIDA 4FIHA 3QA8A 4D4YA 5DG5A 4X7QA 1XHAA 5TT7A 2BRHA 4NUSA 4BCOA 3BGZA 5EHOA 2Z2WA 4ZTNA 2A0CX 1XQZA 3FZOA 5EHLA 2PE0A 3Q04A 4FOBA 4FV8A 4UYAA 4DH5A 4XYFA 2GS7A 2WELA 4RFYA 2QVSE 3P7BA 4P5QA 4DFXE 3VBQA 2HZIA 4EJ7A 4A4LA 3BYVA 4FL2A 4QP6A 2JIUA 4GU9A 4IDTA 4R5YA 4FV1A 4S2ZA 4F64A 5HCZA 4QNYA 3EKKA 4X2JA 4AFEA 1PKDA 4Y73A 1XH5A 4JOAA 5AIRA 5M53A 1YQJA 4BHNA 5AP3A 2Y0AA 3RAIA 4UALA 4BWPA 4Y72A 4ZZNA 3ET7A 3GQLA 4DH1A 3P0MA 4D2RA 5CNOA 5AUZA 4CGAA 5DVRA 4IEBA 4WIHA 4EK5A 3AOXA 4F7NA 2W05A 5HX6A 2R3OA 2YZLA 3QFVA 3LQ3A 2Z7LA 5HG9A 4MD9E 4GG7A 4LGGA 3U54A 5HTIA 3KEXA 3QQKA 2EXCX 2J51A 3MWUA 2VWYA 5GZ9A 4G17A 1YRPA 3DKOA 4QTBA 1GY3A 2ITTA 3ZRLA 4C7TA 3O8TA 3FMDA 3JY9A 2FB8A 3GBZA 5E91A 3IGGA 2VNWA 4BDIA 2YZAA 4M0ZA 4CNHA 3U6IA 4O7WA 2BALA 1OVEA 2O8YA 4TN6A 2H34A 3C50A 4YURA 4PNKA 3C9WA 4IX5A 5F9EA 2ITQA 4DT9A 3TCPA 3MPAA 1H1QA 3CD3A 3E8DA 1GZKA 1V0PA 3DXPA 2JLDA 5L6OA 4QQCA 5KO1A 3TNPC 3UIXA 2F7XE 3BGQA 4NH1A 5CEIA 3LJ1A 3RM7A 3IW7A 2C47A 4BCJA 2RG6A 3ZFMA 2PVHA 3WF8A 5FEQA 2BRBA 3THBA 3ZEWA 4BF2A 4AG8A 1Q3DA 4GEOA 1DAYA 2XIXA 5JRQA 5LVNA 3S3IA 4FC0A 4PDPA 4WG3A 5CSVA 2Q0BA 5CTPA 3NRMA 4AZSA 2C69A 3TNQB 4C4IA 2R3FA 4BIEA 3V8WA 5HNGA 2WPAA 3ZDIA 4D9TA 1U5RA 4NT4A 3AMYA 4BI2A 5KMMA 2BIYA 4YJPA 1E1XA 3RWQA 4UMRA 3VS7A 2JKOA 3FKOA 3UIBA 3RALA 1O6YA 4C3FA 2REIA 4G2FA 3REPA 4ZLZA 4M3QA 2FUMA 4GYIA 4E6DA 4FV6A 3QUEA 3SXRA 5FXSA 5EQEA 2YLEA 1UU3A 5L8JA 5M55A 2RF9A 2PYWA 1OIUA 4IZ7A 3FI3A 3PPJA 3BWFA 1AQ1A 4ORKA 4WOVA 5AP6A 2YFXA 2W1HA 1QCFA 4TZRA 4EQUA 1A48A 1VEBA 5ANKA 5H3QA 2JKMA 3OT3A 4ZY6A 2IZRA 3C0IA 5AAFA 4X3FB 3SRVA 4IJPA 3EKNA 2Z7SA 5M06A 3VVHA 3QRIA 4XG9A 2XNPA 3MVLA 3R9HA 5JEBA 3A8WA 5CI6A 3T3UA 2QG7A 2R3IA 4JQ7A 1XH9A 4NCTA 5AUYA 3UPZA 1ZYCA 2R3JA 4M68A 4QMWA 1P4OA 3OXIA 1PMEA 4UXQA 4FKQA 4EWQA 5CU0A 2J0IA 3S00A 3GCQA 3UDBA 3Q6UA 4ZJJA 4BCPA 5IQHA 2WFYA 2X39A 3EQPA 3KULB 4MEDA 5H2UA 4EOPA 4GS6A 3ZBFA 4I6QA 5J1VA 2IVUA 5ANJA 1F3MC 3F5GA 3EJ1A 5H9BA 2X2KA 3GENA 2WKMA 4X3FA 5E1SA 4C34A 2GU8A 3BLQA 1PHKA 4XV3A 5C8NA 3CEKA 5CEPA 5I3RA 2IW9A 1UWJA 4HNFA 4U79A 3MW1A 4FV5A 3T9TA 4FV4A 4X2FA 4CFUA 5E7RA 1H1PA 2PMOX 5I5ZA 1M7NA 2C4GA 2UW4A 3MH0A 3PE2A 3EB0A 4MBLA 4K9YA 3GOKA 3H30A 4WUNA 3F2RA 1H25A 2ETRA 5CAPA 3COHA 4ZZOA 3HMMA 3R71A 4U97A 3W2CA 2ACXA 4FZ7A 3KULA 5FP5A 2G2HA 3TJDA 4H58A 1DI9A 1NT2A 4ZSLA 2YM5A 3LFQA 1Z57A 3EN7A 4NIFB 4CVAA 2BDWA 2UVXA 5AFVA 1MQ4A 2UW7A 4O0RA 1W98A 2PMNX 3O8PA 4RQVA 4O2ZA 1YWNA 2VTNA 3II5A 4B7TA 2YAKA 4BYJA 4ANSA 3VS1A 2XIKA 5DFPA 4AACA 2ZM3A 3DBEA 4EJNA 4BCKA 2H96A 3DQXA 2B1PA 2QONA 3LAUA 4OTWA 4BFMA 4L42A 1G3NA 2X4ZA 3E7VA 1KE6A 5E8VA 5ACKA 2X6EA 3UC4A 3AC3A 5AM6A 4BICA 3CKXA 5JZNA 3CD8A 5FGKA 3TT0A 3UQGA 3WARA 4CG8A 4W8DA 4J1RA 3CCNA 2GFSA 4KIKB 4D4VA 4NJ3A 3UVPA 3TTJA 4R78A 3PLSA 5GNKA 4PPAA 4EONA 4L3PA 3LHJA 4B4LA 4F4PA 5KBQA 2EUFB 2ESMA 3HMIA 5DI1A 4JBVA 5M56A 4EH4A 2QOQA 3LFDA 4XS2A 2JAMA 3R04A 3KVXA 4U45A 4F9AA 4BGGA 5BVDA 4FVRA 4X2KA 2GHLA 4WUAA 3EHAA 4I4FA 4Q9SA 4AP7A 4KBKA 3GC7A 3ZXZA 1GAGA 1SVGA 4M84A 4UEUA 2BKKA 2RKUA 2JDRA 3FYJX 4ZTSA 3WZUA 3KMUA 2B55A 4FL3A 3W2OA 3NEWA 2J0JA 3GCPA 3MH1A 4KIKA 3V5PA 3L8XA 3LW0A 3UO4A 2JEDA 1OM1A 2I40A 4ZP5A 3TEIA 1FVRA 4YJUA 4QPMA 4JJRA 1TKIA 1UKIA 1ATPE 3A7IA 4IFCA 5D11A 4Y8DA 5F4NA 4ZTRA 1WBWA 4ALUA 5KNJA 4ZXTA 1P14A 3IG7A 4IW0A 3AD5A 2QLUA 3ODYX 4QYYA 4JDIA 4NFMA 4YLLA 5AUXA 1HOWA 1PMVA 3LZBA 3R2YA 3QQHA 1KUTA 4JLCA 1NA7A 5JFSA 3MJ2A 2VO3A 3IOKA 4TYEA 5HIBA 1YKRA 2E9NA 5HE2A 5JN2A 3QUDA 1XH8A 1A9UA 4L9IA 3KB7A 3LXLA 2OZAB 5J7HA 1UNHA 4DEDA 2WMXA 3ZOSA 3Q53A 2R5TA 3ZFXA 5FM2A 1Q62A 3FLWA 3R30A 3ORTA 2Z02A 3U9NA 4O0TA 5EG3A 4L7FA 4RLLA 2BRMA 4AW2A 4IM3A 4QMNA 2ZMCA 3BYMA 3QGWA 4UV0A 3W2QA 2V0DA 2XEZA 2ERZE 2WAJA 2VTOA 2W1FA 4M67A 4PL3A 1K3AA 3VIDA 5ANEA 1PXMA 3R00A 2OICA 3DBCA 3NUPA 3FXZA 4AOTA 4BHZA 4I5MA 3QTRA 5IDPA 4NWMA 1IR3A 4J52A 4IZ5A 5F1ZA 4C4GA 2WOUA 2HXLA 4CKIA 4EORA 4L43A 4GFMA 2YERA 3POOA 4F0GA 2VTQA 3HGKA 2BDFA 3QXOA 4CZYB 1OKZA 4TT7A 5AADA 3Q5IA 4G6LA 4JDKA 3CY2A 2X7OA 3I7BA 5FM3A 3MPTA 3C0HA 3KKVA 1SM2A 3VUDA 5CVHA 2UW9A 1OL2A 5J9ZA 3HDNA 4H3QA 5LVOA 3PSCA 3TACA 4CFXA 2ETKA 2ZM1A 3TM0A 4F9BA 3Q3BA 3DA6A 1FGIA 4I5PA 5CNNA 3TIZA 4NL0A 2EXEA 4EH8A 3MTFA 2ZV8A 4LOOA 3GI3A 2C5YA 2JKQA 4C37A 5CEKA 4ZMEA 5IQCA 4DFZE 4EZ5A 2HW6A 4OW8A 4FSQA 4U3ZA 3L8PA 2V22A 2VTRA 4TNBA 3P7CA 5IA3A 2CHLA 3MY1A 5IQGA 3IK3A 4FT3A 4FF8A 2C5XA 3CTHA 4JDHA 2C3JA 3V3VA 2GFCA 3U4WA 3RAWA 5M4UA 4YTCA 3ULIA 2WU7A 3NZ0A 5K0XA 1XBCA 4N6YA 1B38A 4U81A 3UMWA 2CNUA 5BUEA 1UKHA 4GCJA 3WIKA 3FI8A 4XLVA 3G33A 3GOPA 1J3HA 4I4EA 4DFYA 2JGZA 2XNGA 4WNMA 4DCEA 5B0XA 1OUYA 3DNDA 2C0OA 4I22A 4YSMA 4A4OA 4L6QA 3VBXA 5CXHA 2JAVA 4EK8A 3TZMA 4C4JA 5FTOA 3LXKA 2YM6A 2PVJA 3Q52A 2A19B 5IQEA 4EK6A 3NWWA 3NMUF 3PIXA 3LMIA 4D1XA 4ANOA 4ERKA 4D1ZA 4ACCA 3UJGA 3ZONA 4O7SA 5IU2A 3DAEA 3ANRA 3PXZA 5J95A 1Y91A 3W2RA 2JD5A 5LXMA 2WTCA 1WBVA 3DDQA 3RZBA 3TV6A 2O5KA 4RQKA 4YTIA 3KA0A 3HDMA 4UBAA 4CV9A 5J79A 1TQIA 3FLNC 4JRVA 3PWYA 1ZOEA 3AC5A 4UZHA 2R3NA 4NCTC 4RZWA 2HELA 3Q4UA 4H05A 2XK3A 2O64A 5CYIA 3R1QA 2J90A 3UODA 4LMNA 1ZZLA 2NP8A 1OI9A 1PXNA 3SKCA 1IAJA 4J99A 2BZIB 3WZKA 4C8BA 1FVTA 2CKOA 3VQHA 5TOZA 5GIPE 2EXMA 3DBFA 2PZIA 3FQHA 3BEAA 4FK3A 5CANA 4PL4A 1T45A 5DH3A 3TZ8A 4D5KA 2QC6A 4DHFA 4F63A 4Q9ZA 2CDZA 5EI6A 2YISA 5HO6A 4FT5A 4EWHA 3TNIA 2F2UA 3S1HA 3NIEA 2GNFA 1G8SA 2FVDA 4D2WA 4IFGA 4JIKA 3PJ3A 5TKDA 4FTIA 4QO9A 3COKA 1TQPA 3TXOA 3VULA 4CV8A 3QZFA 3KF4A 4IADA 2JBOA 3BPRA 5AV4A 3MV5A 4UWCA 5D12A 3DK3A 5L8LA 2CKPA 4MTAA 1OL1A 4XLIA 3DJ6A 3DV3A 4X0MA 5LMKA 5IQFA 4IAIA 2R3HA 2R3LA 2GMXA 5C26A 1U5QA 5CF8A 3G90X 2BR1A 3R7YA 2RFDA 4AA4A 1XO2B 4V05A 2V7AA 3VQUA 5CSPA 4H36A 4UXLA 2B54A 2XKDA 2QO9A 2R3MA 4YTHA 4BCFA 2BRNA 3OCTA 4I0TA 3SOAA 4ARKA 4ZS0A 3KREA 4FEVA 4BVUA 5ETFA 3EYHA 4BR3A 3OXTA 2XNBA 3JY0A 3TKHA 2BAKA 3L8VA 2XKCA 2W0JA 4O0VA 4P90A 1BL6A 2HZ0A 3OHTA 3EQCA 5DRDA 3KXMA 1XR1A 4ZZMA 3WZDA 4PV0A 1GIIA 4FI1A 4B9DA 3QAME 2XKFA 3PVGA 4QPAA 1P2AA 1UVRA 2BHEA 2QCSA 3HUCA 4FBXA 2NPQA 3F5UA 4FICA 2HOGA 3VW6A 3PUPA 5CWZA 3ZLXA 4USEA 1PXJA 3ELJA 2C0TA 4D2TA 4DG2E 5IEXA 4L53A 3LVPA 5HBEA 2OWBA 5EI2A 3QRJA 5HO8A 2QI8A 2RG5A 2W99B 3F7WA 4JG7A 3S2PA 3TZ9A 4BDEA 4F65A 2GNIA 4O38A 5I9UA 3TNHA 1MRVA 4FV2A 4U41A 3I5ZA 2OI4X 4RX9A 2VX1A 5FXQA 2V62A 3OXZA 1KE5A 4G9CA 4DGNA 4I24A 1KE8A 3IOPA 4XG2A 5IA4A 3KMWA 4W8EA 2BTRA 4PY1A 4C33A 1FVVA 3B8RA 2QOCA 5IISA 1ZMVA 4NEUA 3D0EA 1JOWB 4BDGA 4O7RA 5A6OA 4RLKA 4WG4A 4DEGA 2NRUA 3BHVA 5IEYA 5CT0A 3DBDA 1AGWA 3Q4TA 1H27A 3GCUA 4XOZA 3AD6A 3UOKA 3NAYA 1YOLA 4A9TA 5KBRA 4O1OA 4UY9A 1VYZA 2P2HA 5HVJA 4O86A 1H0WA 3QD4A 5HZNA 2WQMA 3QTWA 5H8GA 2VWBA 4LMUA 3I7CA 2VWIA 3O71A 4KSQA 4FOCA 5EHYA 1ZXEA 2YDJA 3PXKA 4NM7A 1SZMA 4I3ZA 4MNEB 3D94A 5JKGA 1OIYA 3HAMA 4FX3A 4MHAA 3DKCA 2X8EA 3TV7A 4G6NA 2P33A 2C68A 4RVMA 4EOJA 5G1XA 5E9EA 4AOJA 2PWLA 5HCXA 3R8MA 4EQMA 3BYUA 5BUJA 4O7LA 4CRSA 4QQTA 1Q8TA 5CU4A 4O81A 3HP5A 2VX3A 3F2NA 3Q9YA 3ZC5A 3DJ5A 3F3TA 1PXLA 2X9FA 3MESA 4YJOA 3PXRA 2QQ7A 4MD7E 2LAVA 3R8VA 3G2FA 5B2KA 3WF5A 5J1WA 3R7GA 3CGFA 2FGIA 2I7QA 3PSDA 2W5AA 4JX3A 4YJVA 3ENHA 1Q8UA 3TWJA 2C6TA 3EL7A 4USFA 3QQFA 4KS7A 2BPMA 3VS5A 3FXXA 5B7VA 3UYSA 5KE0A 2J7TA 4FUXA 1H26A 4FTQA 4E93A 3DK7A 5IA5A 3NR9A 2IVVA 1JLUE 1ZYJA 2W96B 4RT7A 2F9GA 4J96A 3R63A 3GUBA 5K4IA 1OGUA 1R0EA 3AMAA 2R0UA 3C13A 3HV4A 3PG3A 3CGOA 4S30A 3U55A 3ZEPA 2ZB0A 4IZAA 4D58A 5FBOA 3JS2A 5HE0A 4NFNA 4CRLA 3QLFA 4R7HA 2W4JA 3F7ZA 1G8AA 4E5BA 5JRSA 4V01A 4O27B 2GTMA 4E6QA 5A14A 2WU6A 5CU3A 3G0FA 3AC8A 4P4CA 4OBQA 5EM5A 5HG8A 3PIZA 3ZDUA 1LP4A 2VTIA 5D7VA 3W18A 2VD5A 4B8LA 4KIPA 5IKWA 2PZPA 4U44A 2B4SB 2VWUA 4GVAA 4QMOA 3SG9A 5CQWA 3CS9A 4YZDA 3E62A 4C57A 4CFNA 1O6LA 5BX0A 5F94A 3W8QA 4FTJA 3EN9A 4CLJA 3TZ7A 5M07A 5E8UA 4U7ZA 2OJFE 4BDKA 2BILB 4GU6A 1OIQA 2VV9A 2XNNA 3NYVA 3PVWA 4QYGA 4S31A 3NUXA 5AV2A 3UNZA 4F7LA 4YC6A 5ETCA 3PA4A 1SVEA 4I21A 3K2LA 3HVCA 4FIJA 1OPLA 2OXYA 2XCKA 1R78A 5J5SA 4I92A 4R3CA 4ANMA 1JAMA 4G3GA 4PRJA 5AM7A 5AV0A 3RPSA 3R9RA 5KX8A 4O7NA 2QHMA 4LRMA 4HJOA 3UIUA 5J8IA 4D2SA 5DT3A 3B2WA 4QYEA 3RGFA 3KFAA 3PZEA 2QURA 3Q2JA 4TL0A 5HNIX 4E3CA 2QOBA 2XJ2A 3Q96A 4RA4A 3JVSA 3EQGA 5EFQA 1XBBA 2O2UA 3LIJA 5AWMA 4QNAA 4I6HA 4U8ZA 4IAYA 1FINA 4O0WA 3BI6A 3V5LA 5HX8A 4LGDA 4W9XA 3KF7A 4F0IA 1JQHA 5IEVA 1OBGA 3U51A 3FMNA 2XKEA 5CEQA 4QMYA 2CKEA 2GCDA 4WBOA 4EHVA 4M69B 5ANIA 3ZZWA 1XJDA 1URCA 2XK8A 2OU7A 2JIIA 2YIWA
chains in the Genus database with same CATH superfamily
3GC8A 2H8HA 1A06A 3EQHA 3HRFA 5DIAA 4G6OA 3EN4A 3U9CA 3VS4A 4F09A 3OCSA 2CN5A 2YCSA 3VUMA 3SVVA 4EC9A 4E7WA 4WSQA 2XARA 4FE2A 2VO7A 2OSCA 3ZLWA 3Q60A 4ID7A 3CXWA 3PY1A 4IB5A 3GVUA 3BHUA 2X9EA 3VJNA 3ZS5A 5EW8A 4HW7A 1KV1A 3SW7A 2YCQA 5HLWA 2OIBA 4PMTA 5E8TA 3RAKA 4E4MA 5I9WA 3HLLA 3H0YA 1Y6BA 4QMTA 3R8LA 4MXAA 3KRJA 5LMAA 2QOOA 4M69A 3QCQA 5HGIA 2C6OA 4FTAA 3BRBA 4QQ5A 3V5JA 5IA0A 3OOGA 3CJFA 3NS9A 4J8NA 2VWVA 2JKKA 3QD2B 3C4EA 3RJCA 3FZRA 5M4FA 3AKLA 4JR7A 4ZK5A 4D0WA 4BDJA 2WMRA 4NM3A 3TKIA 4QMZA 3NUAA 3F6XA 5GJFA 2A4LA 4R3PA 4XG3A 4I94A 2ZV9A 4ENXA 4FGRA 3ZM9A 4AZWA 4DH8A 2X0OA 3EN5A 3COMA 2YIRA 1G5SA 3P7AA 3HKOA 3NLBA 3DAJA 4FTMA 3V8TA 4L46A 2YM7A 4GVJA 5TR6A 1OPJA 5KHXA 3IO7A 2OJIA 4IWDA 4ITIA 2JFMA 2WMAA 5AP5A 3VN9A 1FBNA 3CQWA 3VHKA 4EH6A 1RQQA 4OTHA 4CYJA 4PNIA 4Y5HA 3S0OA 5KZ0A 4ZEGA 5A9UA 3D5WA 2C30A 3MY5A 2YM4A 4GL9A 1LR4A 2ITYA 1SVHA 4AUAA 4R1YA 4ANBA 2YAAA 3OF0A 4B99A 5BPYA 5LJJA 2J0MB 5AR2A 4RFZA 3AGMA 3LQ5A 4C4EA 4CXAA 4HVSA 5CALA 2Y7JA 5AUVA 4PWNA 4KKHA 1H1WA 2FH9A 2QOKA 3TIYA 3SXFA 1ZY5A 4FG8A 3RHKA 2C6EA 3WF9A 4L52A 3ZLYA 4DINA 4MXCA 3DXNA 4DYMA 2W5BA 1F5QA 1PXKA 4I6FA 1KE9A 3GCSA 4C4FA 2WMVA 4C36A 4DBNA 1PMUA 5HTBA 4ZTLA 3SG8A 2ITUA 3W10A 3UNJA 4RWJA 5CZHA 4NW5A 4O1PA 3SHEA 4YC3A 3G9NA 3UO5A 5FUTA 4WBBB 3OWKA 4PUZA 2W1ZA 5IUIA 5FBNC 3QZGA 1XMLA 2ZMDA 2OH0E 2VWXA 5HU3A 4HVDA 4D2VA 3PY3A 1DS5A 3Q5ZA 3EQRA 2X6DA 3FV8A 1VZOA 2CCHA 2CLQA 3NDMA 3QWKA 3FYKX 4ITJA 4IWPA 4YZMA 4NU1A 4U80A 3NVMB 4NYEA 4ALVA 3NUYA 3K3IA 2CNVA 3SV0A 5IPJA 5JQ8A 3DOGA 4XV2A 4JQ8A 4L3LA 4KBAA 5BNJA 4BCGA 2Y4IC 3NYOA 2F2CB 3I5NA 3W1FA 3EQIA 4C3RA 4IXPA 2XIRA 5HNBA 1ND4A 2BZHB 1KOBA 3DY7A 2C3IB 1YXTA 5C4KA 4IX3A 2HAKA 4OTPA 3GU8A 3CY3A 2PK9A 5FDXA 3KN5A 4CD0A 3FLSA 5BVEA 4EI4A 5CF6A 5HBJA 3UQCA 4WA9A 4LV8A 4J95A 3FWQA 4FKRA 3RCJA 3S95A 3FY2A 3LCTA 3FUPA 1H01A 2PVFA 2QU5A 5DT0A 3UVRA 3VS6A 5I0BA 4FSMA 3HYHA 4PDYA 3W0RA 1CSNA 1YHSA 3NW6A 4FTUA 2IZTA 3FC2A 5E8ZA 3ZTXA 3DTCA 5ETAA 3CIKA 5L6WL 4BCQA 3C4WA 4FKVA 3VUGA 4C62A 4O22A 1JKKA 1REKA 4F0FA 2NYAA 5M08A 2VGPA 2YHVA 3DCVA 2C6LA 3T9IA 4E5WA 1Q99A 5EQYA 4FKOA 3W0MA 4AX8A 2VGOA 2G15A 3BIZA 3GFEA 2WMBA 3FQSA 4YJNA 2R2PA 4YZNA 4CG9A 2V7OA 4ZTMA 1X8BA 2J6MA 3N9XA 2WQBA 4M12A 4O0YA 3FPQA 1OIRA 2IF8A 2VZ6A 5JK3A 4AWIA 3R7EA 4Z7GA 3KK9A 3ZO3A 2R0IA 2ZV7A 3UG2A 4PTCA 4IIRA 4ZLOA 3R9OA 4NKSA 4TKSA 2R3KA 4DLIA 1YWRA 5F20A 2YM8A 4AN3A 4PL5A 2XK7A 4KSPA 1F0QA 4BN1A 4FIEA 1BX6A 2ZB1A 3QKLA 3FDNA 1WBNA 3PRIA 1Q5KA 4FKGA 2V5QA 2FSTX 3JPVA 3E8EA 2OKRA 4ZMFA 1XH7A 1FOTA 3AQVA 5C27A 3ORIA 4GT5A 3RHXA 4CCBA 1JSUA 3RM6A 1GIJA 1CTPE 2FSLX 5LOHA 2UZOA 4FKJA 2CSNA 4DGOA 4WRGA 1XKKA 3OCBA 2E9UA 1MQBA 5T6KA 2RSVA 4DGLC 4YU2A 3UTOA 4CYIA 4FTRA 3R7VA 4D2PA 5JGBA 4KINA 4K33A 4L68A 5GJDA 2UW5A 5DN3A 1YHVA 2X7FA 3E92A 5K4JA 5C8KA 4APCA 3MN3A 2WZJA 3OWLA 4A07A 5HTCA 2VUWA 5KKRC 2F7EE 5IMXA 3PP0A 3NPCA 4W4YA 4QYHA 5JGAA 1FPUA 2QU6A 4CQGA 2B7AA 5A4TA 5I3OA 4BKZA 2IWIA 2XMYA 4EKLA 4NIFA 1ZYDA 3WZJA 3OROA 2R3PA 3BHTA 1H28A 3DLZA 3FJQE 4RX5A 5JH6A 3GGFA 3LXPA 4MNFA 4QOXA 1JSVA 4OTDA 3RAHA 5KMNA 4PPCA 2ITWA 5DRBA 1ZYLA 4ZSGA 1WFCA 2XK9A 3KVWA 2QD9A 2J0KA 2FO0A 2SRCA 5C03A 2GQRA 4LM5A 4XHKB 4AFJA 3RTPA 1QPJA 4QQJA 3AXWA 2FYSA 4KNBA 1RJBA 3PXQA 3H10A 3E93A 4TWCA 3CLYA 1W84A 4NTTA 2PTKA 3HL7A 3NFFB 1PRYA 3OG7A 4FIFA 2YEXA 1ZRZA 4IVDA 5T3QA 4IH8A 2ITVA 4HVIA 4YR8A 3MYGA 3OWJA 2PSQA 5FG8A 4F1OA 4IC7A 4MXXA 5LVPA 2B0QA 1DAWA 3BE2A 2PUIA 2XANA 2PZRA 4GUEA 3ORZA 4P2KA 4BDCA 4XUFA 3UOLA 4ZIMA 4AN2A 1G8KA 3MS9A 3B2TA 3R9DA 3D7ZA 4JG8A 2W4KA 3NCGA 2PVRA 4MH7A 1OUKA 4O2PA 4XG8A 3BGPA 2YCRA 3ORNA 3PJ1A 4YC8A 1HCLA 1PYXA 2X2LA 5FEEA 3EZVA 5D9HA 5HORA 4OTGA 4WNPA 4G1WA 4GUBA 4JR3A 3PFQA 4YPSA 3F3VA 3TJCA 2QO7A 4BC6A 4QMQA 5JGDA 5E1EA 3FZ1A 4H3PA 3C5IA 1FGKA 4DFLA 4I6BA 3A4PA 3I4BA 3F61A 3ZRMA 2PVMA 3FSKA 3R8UA 4GJ2A 4XOYA 2PVLA 4RIYB 4EYMA 4I23A 3TDWA 4LUDA 3MJ1A 4WRSA 3FHIA 5C9CA 3WE8A 4XP2A 3UDZA 3A7JA 2IW6A 3K5VA 2BDJA 5D7AA 1VLRA 4S32A 2OZAA 2XIYA 4E8AA 4YO4A 5IG1A 4R8QA 3QGYA 4I1ZA 4BI1A 3W33A 2WD1A 2HIWA 4ACDA 4EOQA 1W2DA 3O17A 4BIBA 2XNOA 4FIGA 3PIYA 3QTUA 3TUCA 4AXAA 2PUNA 3WZEA 5EKOA 4RIYA 1M2QA 3LLTA 3QA0A 3UE4A 5DR9A 3F9NA 2O3PA 2VTJA 2ITOA 5GHVA 4BCHA 4ACHA 5AUTA 1W7HA 1KOAA 2YA9A 3WF6A 1B6CB 3MI9A 5JMSA 3LFBA 1W83A 2JDVA 3Q9ZA 3ZBXA 4L3JA 3DFCB 4AZFA 3G15A 3C4CA 3CBLA 1PXPA 4MQ1A 3QBNA 3QQGA 1M17A 2C5NA 2R3QA 5E92A 3N4VA 2QOHA 2Y9QA 2CKQA 4HOKA 4OR5A 1XH6A 4OTQA 3R7OA 1ZY4A 4FZAB 2WQEA 2GHMA 5T68A 4IVBA 5M4IA 1ZLTA 3QRKA 2OLCA 4IJ9A 3QHRA 3ORPA 4EOLA 3ZSHA 2OBJA 3FL4A 4QTDA 3O8UA 2Z7QA 5JFWA 4II5A 3MVHA 1JKTA 3ANQA 4IB3A 4YPDA 3ENMA 4F78A 2IPXA 5BVNA 4GT3A 2I6LA 2XK6A 3I0QA 3R73A 3NYXA 3ORMA 1Y8YA 4GFGA 3W2SA 1ZOGA 4AZVA 3QL8A 2X0GA 3VBVA 3DLSA 4CTCA 2CCIA 3F3UA 1VR2A 4RWIA 4W4VA 2IEWA 5BVFA 5FTQA 2OK1A 3K5UA 4K77A 5CS6A 4JI9A 3HMNA 4FNYA 3A7GA 4KD1A 3SQQA 5IA1A 4LUEA 3HRBA 2J5EA 3MA6A 4G5PA 3UP7A 4A9UA 2G2FA 2GSFA 4EEVA 2KULA 4YGAA 4BCNA 2YACA 5JFVA 3A61A 4UMUA 4V0GB 4F7SA 2WTKB 3G9LX 5DNRA 1JNKA 3KXXA 1WBOA 2WQNA 5FLFA 4CZTA 3LFAA 4NZWB 5DBXA 2DS1A 4E4LA 4PQNA 3DDPA 5BUIA 2CGXA 3F3ZA 4TYHB 3TDVA 5FRIA 1H08A 1OZ1A 4DAWA 5CENA 4FT9A 3KRWA 1WCCA 2VTSA 3D2IA 5DMZA 4X3FC 4AU8A 4EOMA 3E7OA 3C7QA 2HZNA 3ZCLA 3WOWA 5KMOA 2XS0A 3E3BX 4CFVA 1H0VA 3W0NA 4KS8A 5DHJA 3F66A 4DN5A 3N4UA 3QQUA 2OJJA 2NO3A 4IWQA 4CMOA 3OW4A 3BLAA 4O7VA 3VS0A 5M44A 4Q2AA 2FSOX 3VC4A 1T46A 3L9NA 1M7QA 5FP6A 4HGTA 4FEQA 3HV3A 1PY5A 3VUHA 3ZHPC 1OB3A 3ATTA 4RX8A 4XRLA 2FA2A 2WO6A 3POZA 3FLZA 5ANOA 3LFEA 4FSZA 4KWPA 4WNKA 5J7BA 3E8NA 3EFKA 2R4BA 3MA3A 4IDVA 4BKJA 3FL5A 1UV5A 2BROA 3KY2A 5HICA 3CTJA 4O0SA 3ORLA 2R7IA 4JG6A 4BYIA 3P9JA 4DEAA 3QYZA 3CKWA 1J7IA 1YWVA 4S33A 3AKKA 4AXEA 3O51A 4LYNA 4BCIA 4AE6A 2R9SA 4XV9A 4FSUA 4QYFA 3LPBA 3F88A 3PE1A 3CC6A 3ZUUA 3GC9A 3QCXA 4HPTE 4YJTA 3D14A 4IB0A 2JBPA 4BB4A 1MUOA 2XJ1A 1KSWA 5LWNA 4GFOA 4UB7A 1ZAOA 4M66A 5CI7A 4CKJA 4RJ6A 5KZIA 4HCTA 4AGUA 1CM8A 2XCHA 4I0RA 2A1AB 2VTTA 4J98A 3QD3A 3LFSA 4WSYA 2VO6A 4EHEA 5EI8A 4GW8A 4LOPA 3LJ0A 3ZSGA 4CFWA 3OTVA 3DKGA 2EB3A 4RJ5A 1Z5MA 4BRXA 4ERWA 3HV6A 3KU2A 5CLPA 5HE3A 3RZFA 3BKBA 1YI3A 3U6JA 5GZ8A 4OTIA 3NSZA 4AZEA 4EUUA 4MQ2A 1MRUA 1U54B 3NNWA 4DE4A 3PPZA 3HA6A 3NUUA 4O6LA 4UZDA 4WD5A 5HQ0A 1Q61A 3PA5A 1YOMA 1OITA 2VRXA 3IPHA 4O7TA 4FRFA 1H8FA 3OD6X 3LFCA 2OIDA 1WMKA 5TE0A 1XWSA 2WMQA 1Q41A 1KE7A 1Y6AA 2XAMA 3ULZA 3ZO1A 4E6AA 1LEWA 4EUTA 5L8KA 5LCJA 3WI6A 5AA9A 4AT3A 3RPOA 4GV1A 3KCFA 4J8MA 4FG7A 1UNLA 1Q4LA 3BYSA 3MB6A 5CVFA 5I9YA 2IN6A 1BI8A 5E4HA 2XUUA 2E9VA 4DGMA 5DOSA 2NRYA 1BUHA 2DYLA 3HX4A 3HEGA 3IDCA 4PMMA 4Z3VA 4X6RA 2W1CA 2B9HA 5ITAA 1UWHA 3QRTA 2HZ4A 4EOKA 5HE1A 1MP8A 3M11A 4ZJIA 3O0GA 2YDIA 5I4NA 4HVHA 2XBAA 4YHJA 1YW2A 2WTWA 4ZLYA 4EOOA 2X8DA 3COIA 3NFGB 3PXYA 4TYIA 1J91A 2BAQA 4QPSA 5IQAA 3G51A 3FC1X 3KL8A 3MH2A 3CJGA 4MYGA 3H9RA 5FXRA 4BTJA 4U5JA 4G3FA 2XZSA 2IVTA 2YCFA 2PZYA 1I09A 3HV7A 4JIAA 1JKLA 1RW8A 3VRYA 3IW6A 4EH2A 5CSHA 3FQEA 3O23A 5E8YA 3VW8A 2H6DA 3RPVA 2XYUA 4LI5A 4MKCA 1U4DA 3IGOA 3EZRA 1PMNA 4FSTA 4ITHA 3GQIA 4RJ8A 1QPDA 3C51A 4C59A 2Y4PA 4CSVA 1AD5A 4MNEA 3L1SA 2W17A 5AMNA 4RJ4A 4YUQA 4C2WA 4PP9A 4I93A 4JL9A 5HO7A 5D41A 4PMSA 3KXHA 4LGHA 2Y4IB 3KGAA 4FYOA 4E1ZA 3FMEA 4RIWB 3IW5A 3FZSA 3MFRA 3ZUVA 1DI8A 4GMYA 3QF9A 2UW0A 3VHEA 4C3PA 4UX9A 5KCVA 2RFEA 4RC2A 3VBTA 3OMVA 5IQBA 1J1BA 3LXNA 2F4JA 5A46A 3A99A 2HW7A 2OJGA 5DR2A 1LEZA 2ONLA 3S4QA 4L45A 4A06A 4LG4A 4FKTA 3LJ2A 3VUTA 2XB7A 4F7JA 4XBUA 4N4SA 1TZDA 3DQWA 3QQJA 1M14A 4YHFA 3EOCA 3BLRA 1WVYA 2GNJA 3G6GA 3BEGA 4MX9A 3DU8A 3ZYAA 3IECA 3QUPA 4GRBA 4FKIA 4RVKA 1W2FA 5HEZA 4FKPA 4DEEA 2OF2A 5IH5A 1CKJA 2X0PA 3ZU7A 5J87A 3EFJA 4R77A 3QWJA 1STCE 4EOSA 2GDOA 4MXZA 3DGKA 3HA8A 3CQEA 2PVYA 4GT4A 4DLJA 5EDPA 1QL6A 4AE9A 3EH9A 1IAHA 3M42A 3LFNA 2IVSA 2YN8A 3QZIA 5CT7A 4AGWA 5HVYA 3WF7A 2WHBA 3LFFA 4YNEA 5ETIA 1SNXA 2QKWB 5AP0A 4LRKA 1NVQA 3MBLA 5KMLA 1RE8A 2PHKA 3A62A 4JAJA 3C4XA 4L8MA 4LL5A 1WAKA 2VN9A 3EQFA 3AC4A 3BV2A 3PRFA 4DA5A 1E1VA 5HG7A 1UU8A 2BZKB 1TVOA 3IW4A 3DBQA 3EN6A 3A60A 3SX9A 3EIDA 4R3RA 5FTGA 3D2KA 2C3LA 3E63A 3QTSA 4E4NA 4TWPA 3TL8A 4ALWA 5K3YA 4FKSA 3OY1A 2G9XA 2GNGA 2EB2A 4K6ZA 2FSMX 4G3EA 2P0CA 4TNDA 3GNIB 3OOMA 4R1VA 3Q4CA 2QO2A 1P4FA 4Z7HA 4R7BA 1IEPA 2WTIA 5HD7A 4K11A 2BKZA 5JSMA 2Z60A 3FSFA 3WILA 3RINA 4EZ7A 4YSJA 3W0SA 1U46A 5AR5A 4RFMA 2AC3A 4AW1A 3NNUA 4DDGA 4PMPA 1H24A 4D0XA 3G6HA 2OFVA 5L2QA 3D4QA 4BZNA 3IS5A 2YABA 4HCUA 4M8TA 4CEGA 4WO5A 2W1GA 3R8PA 4CMTA 5LMKC 4N57A 4KRDA 1XH4A 4RVLA 3BE9A 3GT8A 3H3CA 4IACA 1TFFA 1SYKA 3P1AA 4LL0A 2H9VA 3K54A 4FV7A 5FDPA 2XJ0A 3GU5A 4XNEA 4ZS4A 3KXNA 3HNGA 5AR7A 2ZYBA 5DA3A 3RCDA 4IB1A 4YJSA 3L8SA 5K0KA 3RI1A 5IQIA 5AP1A 2ZFYA 5HD4A 4Z9LA 3MFTA 3DAKA 4FSWA 5EKNA 4QT1A 3UG1A 2WMTA 3WYXA 4HGEA 1P5EA 4O0UA 4F6WA 1APME 2WTDA 2QLQA 5E8XA 4AZTA 3D5VA 3NUSA 3OWPA 4AW0A 4Y85A 4APPA 5EQPA 2UZEA 3QYWA 2CLXA 3DJ7A 5EW9A 3R28A 4NSTA 2GQSA 5J9YA 3RPRA 4WHZA 2V55A 3BQRA 5IF1A 3NX8A 3FMHA 4I6LA 5EOLA 1V0OA 3C4ZA 5C1QB 5C8MA 1H1RA 4YBKA 5I9XA 3I81A 4ZY4A 4FKUA 4HGLA 1R39A 3W32A 3TUDA 3LKMA 2WTVA 3DFAA 2B9FA 3JUHA 3NIZA 4Y83A 3SXSA 4ACGA 2VU3A 4GKHA 3L9LA 3I0OA 3HECA 4FTNA 2YITA 3RK9A 1YXSA 1Y57A 4RMZA 5I9ZA 4EH5A 1ZWSA 2CMWA 4FSYA 2JDOA 3KN6A 4BIDA 5BMMA 4OTFA 1ZOHA 4JVGA 4FTCA 4WKQA 3FMMA 3SC1A 4YHTA 2ITNA 1JBPE 2A98A 4IC8A 4IAAA 2IZUA 3D7TB 5EDQA 2CGUA 1REJA 2QOLA 3G0EA 4X6QC 1KV2A 2BUJA 3QTIA 3KCKA 4ASXA 3TMOA 4XH6A 2IZSA 4G34A 4BCMA 4MVFA 2WXVA 4DEBA 3DPKA 4LFIA 3ERKA 4KKEA 3N4TA 2XYNA 4ACMA 1H00A 4ENYA 2XNMA 4YJQA 3NW7A 3VF9A 2X0QA 2PY3A 3U4UA 4HYUA 3VBWA 3MB7A 5CASA 3DB8A 1Q24A 1ST4A 1QPEA 4UWBA 2UW8A 4CFFA 4RBLA 4MCVA 5JT2A 4BJJB 5EYMA 4BBEA 4JAIA 4B0GA 2XA4A 1FMKA 2OF4A 4N0SA 4PF4A 4W4XA 3QTQA 3D7TA 4U0IA 5FEDA 4AT4A 4QTEA 2WEVA 4JBPA 1YXUA 3QU0A 3V5WA 3ZFYA 3FLQA 4FTOA 4RG0A 5IQDA 3EQDA 4IMYA 1W0XC 3OP5A 4NW6A 4M7IA 1BL7A 2OFUA 5CX9A 5EM7A 4FNWA 5KMIA 2J0LA 4IQ6A 2UW3A 1UU7A 2YIQA 1V0BA 3I60A 3KXGA 3P08A 3AT3A 3R22A 4FZ6A 4K2RA 3U8WA 2IG7A 3MVMA 4QP1A 4RZVA 5HESA 3KK8A 5AP4A 3RVGA 3VUKA 4E20A 5B2LA 4N70A 4BJJA 2QNJA 2VWWA 2W5HA 2XH5A 5HHWA 2P2IA 5A6NA 2A27A 1YXXA 3A8XA 4C58A 4CFMA 4TWOA 3NNXA 3LOKA 2Y6MA 4KA3A 4AGCA 4BTKA 3UC3A 2UV2A 4DTBA 3QZHA 4RIXB 4ANQA 1S9JA 4JBQA 2BCJA 1WVXA 2O63A 3DZQA 4ZSJA 3VUIA 4EZ3A 3E8CA 3O7LD 1TQMA 3FKLA 2AC5A 5AR8A 5BYZA 5CAQA 4DFBA 3VO3A 2YJSA 4NM0A 5EK7A 3LM0A 4EYJA 5HLNA 2X8IA 1FMOE 3P78A 3AG9A 5LWMA 1ZMWA 1KWPA 2WNTA 4QRCA 4I5HA 3NNVA 3OS3A 5I9VA 3NGAA 5EM6A 3FMKA 4F1MA 2WIHA 4ASDA 4K1BA 2LGCA 2HY81 2RL5A 1WVWA 3P23A 3HAVA 2I0YA 4ASZA 2IW8A 3UOJA 3ATSA 3SRVB 2ONLC 3ROCA 3JXWA 2PE2A 4FR4A 4OTRA 3T8OA 3W8LA 3V5TA 4RIXA 4RC4A 2XF0A 2PULA 4X2GA 3KRRA 2UZBA 2I1MA 4KUJA 4DTAA 5DWRA 1CKPA 4JDJA 3AD4A 4QMVA 4GK3A 3FXWA 4FGBA 1OGYA 4KRCA 4FEUA 3HV5A 2RGPA 5CZIA 1Q3WA 2AUHA 2JDSA 3FKNA 3GFWA 4MBIA 3RKBA 3WE4A 4FZFB 5F95A 2P55A 2PE1A 3BU5A 3H4JA 2ZV2A 4NKAA 3ZMMA 2I0HA 3PJ8A 2YJRA 1Q8ZA 5CU6A 5GJGA 3TNWA 5EYCA 4ZAUA 4BGHA 2NNWB 3O50A 4C0TA 5IH6A 4QMMA 4QP8A 2WTJA 3GC0A 4BY9E 3OBGA 5EYDA 3EQBA 2WMWA 2HK5A 4XG6A 4EH7A 4I41A 4QP4A 4EKKA 3MGYA 5A54A 5CF5A 1BI7A 3UBDA 4CT2A 3F2AA 2X81A 4MBJA 4FVQA 4BBFA 4FV0A 2ZJWA 5AV3A 2B9IA 4K8AA 1GOLA 2GNHA 3QX4A 4QP2A 3LCKA 4ZSEA 4MWIA 4RWKA 3KRLA 1K9AA 1Q8WA 3FI4A 1URWA 5DEWA 1IASA 1UNGA 3UGCA 4BTMA 5J5TA 5D10A 3QX2A 2PUPA 5AP2A 4JBOA 3ZM4A 4GH2A 1ZZ2A 4A9SA 1IA9A 4BWKA 3I1AA 3NCZA 1PF8A 2ERKA 4UMTA 2WGJA 4E73A 4TPTA 4AT5A 3QLGA 4XCUA 2WOTA 2QR7A 3VF8A 4R7IA 1R3CA 2BMCA 3H9OA 5AR4A 4D4RA 4J53A 3SGCA 3UP2A 1YOJA 4FKLA 4FYNA 3FMLA 3GP0A 5K9IA 2YWVA 3BU3A 3HMPA 4L01A 2VTPA 1YDRE 3IDPA 3MFUA 3U87A 1M2RA 2HY0A 3SOCA 3VBYA 4DITA 5BYYA 2E2BA 2XIZA 5ANDA 2KTYA 4BZOA 4YO6A 2HCKA 2VO0A 2W1DA 3QKKA 5AUUA 1OL7A 5FWKK 4GK4A 3W0QA 2Q83A 3N51A 5AX9A 4F70A 2VTLA 5CQUA 3DT1A 4HZRA 4LV5A 3LCDA 4OT5A 2GHGA 3UZRA 2R3GA 3CPCA 3PY0A 3PG1A 4GKIA 4OGRA 4IBMA 2OXXA 1MRYA 1O6KA 3OUNB 4XP0A 3BHYA 4S34A 5HU9A 3VAPA 2AYPA 3FE3A 4XJ0A 4BKYA 3KQ7A 4EQCA 4HPUE 3GU6A 4YZCA 3ROYA 3VRZA 4YTFA 3WYYA 3LMGA 5DR6A 3MSSA 4CZUA 2Z8CA 5CEOA 3SD0A 4K0YA 5L2WA 4C2VA 2GQGA 2VX0A 3B8QA 3TN8A 4DFNA 5K5NA 4B6LA 3D5XA 2O65A 4L67A 1J7LA 4HYHA 4IM0A 3DNEA 1FQ1B 4FA2A 4LRJA 4RIOA 5BVOA 4HYSA 3W0OA 2G2IA 4FL1A 3MDYA 3EL8A 4H1JA 1R0PA 4GYGA 4HVGA 3IONA 2ZAZA 3PTGA 4EHZA 3D9VA 3L9MA 3QC4A 4FG9A 2Q0NA 4L7SA 4TXCA 3R7IA 3NUNA 4DT8A 4AXCA 2C6MA 3E3PA 3CTQA 3SDJA 2ZOQA 4JRNA 4O84A 4R6VA 1NVRA 4BDHA 3FY0A 4FV9A 3SLSA 4A4XA 3LQ8A 2BIKB 5HKMA 4C4HA 3V51A 4DDIA 4IZYA 4YJRA 1B39A 2QOFA 4X21A 5HCYA 4ANNA 4CTBA 5HI2A 4Z16A 2C6DA 2EU9A 2F7ZE 1BMKA 2BAJA 3AC2A 1GZOA 3F69A 3FBVA 4RGJA 2ZM4A 4AQCA 2WIPA 3GU7A 2XEYA 4F08A 4XV1A 2QOIA 3MPMA 3QD0A 1OBDA 4IAKA 2OO8X 4UN0C 1GZ8A 3AT4A 3PSBA 4O6EA 4U3YA 3R8ZA 3RK5A 5D1JA 4BI0A 3PA3A 4QMLA 4IANA 4UMQA 3UDSA 1IRKA 3UPXA 3DB6A 4QP3A 2UZNA 3VNTA 1L8TA 4F9CA 3BWJA 4IM2A 1PYEA 5GZAA 4DC2A 3LE6A 4A9RA 3CR0A 3CE3A 3OY3A 3KC3A 5L4QA 3M2WA 3PUFC 3RWPA 4ANLA 1HCKA 4QMUA 4ZOGA 5M09A 2HXQA 5H8EA 3ALNA 5A4EA 4O83A 4BBMA 5JZJA 2J50A 1BYGA 1J1CA 1NVSA 4KAOA 4FEXA 4CKRA 5CF4A 5DYJA 3MTLA 2A2AA 4AA0A 4DEHA 5G6VA 4EH3A 3AT2A 1YDSE 2OZOA 2X2MA 2XM8A 4GK2A 4L00A 2CPKE 2PPQA 5KHWA 3AKJA 4J7BA 2R7BA 4OLIA 3TV4A 1W2CA 4AAAA 1XMMA 4OUCA 4XG4A 4FTTA 1W8CA 1GJOA 4K18A 1XBAA 4IX4A 3T3VA 2UZVA 4F9WA 3ZRKA 3NVKI 3IQ7A 4KIOA 3WBLA 4JNWA 1H4LA 3I79A 5BQ0A 4FTLA 4XMOA 5DE2A 2J2IB 4FT7A 1YVJA 4DH7A 3PLAE 1DM2A 2BFXA 3FEGA 4FV3A 2GNLA 5EYKA 3HZTA 4RA5A 2PU8A 4KBCA 4U6RA 2BVAA 3ZO2A 1UU9A 2J9MA 3DZOA 1VJYA 4O0XA 3OUKA 2HENA 3FPMA 2QHNA 4MXYA 4U40A 1JKSA 4EK4A 3UQFA 1G8JA 2PMLX 4TY1A 4AN9A 2DWBA 3I6UA 3R7UA 1H07A 3R1YA 4MD8E 3W16A 2OJ9A