2YIXA

Triazolopyridine inhibitors of p38
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Synthesis of Inhaled P38 Inhibitors for the Treatment of Chronic Obstructive Pulmonary Disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
total genus 113
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yixA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yixA01
3QZHA 4RT7A 5EOBA 1MQ4A 5E8YA 5IQFA 5KHXA 2WMAA 4O7TA 3NIZA 5LMKC 3FWQA 4XG9A 5K0KA 3ZYAA 2IO6A 3OHTA 3CCNA 3NVKI 4QYFA 2HXQA 1WBTA 3L8SA 2JDRA 3KCKA 4QMTA 3VO3A 4ZSEA 5I3OA 2B9FA 3POZA 1T46A 3UPZA 4QQ5A 2R0IA 1SM2A 2DUVA 5TKDA 4MNFA 4FVQA 3TG1A 3WF6A 4EJNA 4EJ7A 4W8EA 3Q2JA 5CANA 5CSXA 3DK3A 4IWPA 4NW5A 5BVWA 3KXZA 2YERA 3RPVA 4CXAA 2I0EA 5CVGA 3VF9A 5CF8A 5CXZA 4RWJA 1TKIA 5CSWA 4AQCA 5EM6A 5EQPA 3QRUA 2O8YA 3FE3A 2BDFA 2XJ2A 2P0CA 4C3PA 2ZV2A 2YABA 5G1XA 4AA0A 4NYEA 1YXVA 4TKSA 2YCSA 3HECA 3QBNA 5AIRA 4APPA 4RWIA 3OTUA 4I93A 2R3OA 4WSYA 5AUVA 2VTJA 2LAVA 4FKUA 4AZFA 5C8NA 5LWNA 2PPQA 2OW3A 2UZEA 2WOTA 5JFXA 5CWZA 3ROYA 4X3FC 5ETFA 3NEWA 3RAKA 3DZOA 3IECA 1ZWSA 3LMGA 5BVOA 4Z9LA 2IG7A 4AW2A 3ELJA 3BWJA 3FLYA 4Y73A 1PKDA 4G17A 4YBJA 4FKOA 2HWPA 4AX8A 3EKNA 3QQLA 4QTAA 5GZAA 3R04A 4FKQA 5IU2A 4FZFB 4A9TA 3K54A 5ETIA 3PLSA 3OS3A 3EN6A 2PMIA 3C51A 1SVEA 1SNXA 2IZUA 2RFSA 4NH1A 3OG7A 5AP1A 4FSMA 4OTRA 5J1VA 1U5RA 1KWPA 3UC3A 4EH7A 2HWOA 1OUKA 4QPMA 2F7ZE 3GOPA 4FV2A 2FH9A 4PUZA 3OT3A 3V8TA 2B7AA 4QMPA 5A54A 3ZEPA 4R5SA 3Q3BA 3RZFA 3VS7A 4DFZE 1ZRZA 4L3PA 3UQGA 4FTCA 2WMVA 3PIXA 5CAVA 5CF5A 4TT7A 3PXFA 1ERKA 5AEPA 2AYPA 4BCPA 2OH4A 2H6DA 2R3JA 3R8LA 3NNXA 3MTFA 4ZK5A 4O27B 2W0JA 2BAJA 3LCOA 4ASZA 2PMNX 3EB0A 3R9NA 1H01A 2QKRA 4XV9A 3RPYA 1URWA 3HVCA 4BDAA 2E9UA 4I1ZA 4GVJA 4R7HA 3REPA 3VS0A 5IDPA 4DH8A 2XM8A 2CKPA 1OIYA 4DFXE 3ZDIA 1GIJA 3BYOA 5AUUA 2IW8A 3FC2A 4QMOA 5CEPA 3ZHPC 2ZDUA 4KD1A 2ZDTA 2W5BA 4KKHA 1R39A 3I79A 5HHWA 5HIDA 4BZDA 4U8ZA 5ANIA 2XKDA 5H8BA 5JFSA 5ANGA 5DR6A 1NVQA 2PY3A 3QKKA 4IX5A 1R78A 4JRVA 4RX5A 3DA6A 4RIWB 4ZTRA 2OXDA 2GTNA 3MVLA 3NNUA 5CAQA 4CKRA 1UU9A 3WOWA 4DT9A 4EKLA 3UP7A 3FL5A 3UODA 4EOMA 4RJ4A 4RC3A 3NNVA 3RM7A 4HVIA 3D5XA 4MXAA 5HORA 2R3NA 3AT3A 5EHLA 3FLSA 3LCDA 3VW8A 2R3PA 4FT5A 4PNIA 4K2RA 1BX6A 4ANOA 3MVMA 3EN9A 3KFAA 4C3FA 1A48A 4XEYA 2YIXA 2PVNA 2OO8X 3BEAA 4WNMA 3ZRMA 3OROA 2PZRA 1ZYDA 4XV2A 3ZLYA 1Y8GA 3IKAA 2VWZA 2W99B 3MH3A 4ACDA 3Q4CA 4XG8A 2XRWA 3LZBA 4JAIA 4QNYA 3RI1A 3HAMA 5I4NA 3GC0A 3PA3A 3TUBA 4MD8E 2WMBA 4JG6A 4HYIA 3BGZA 1KE9A 2WTDA 4GK3A 3K3IA 4ALUA 3FKLA 5I9YA 3SXSA 3ORIA 4F9WA 3ANQA 4IWQA 3SX9A 2WPAA 3IPHA 4JI9A 4GYIA 2UZVA 4IM3A 4L8MA 5DT4A 3H0ZA 4X6QC 3RP9A 4ZLYA 3QTRA 4F65A 4M12A 1ZZ2A 3IG7A 3QZIA 4ALVA 4DFBA 4CGAA 5AR4A 3HRCA 3AC3A 1Q24A 4GH2A 4FSZA 3UOJA 4MBLA 3EQBA 4HCUA 4EHGA 2E9NA 2VN9A 4Y95A 4X2NA 5KMLA 4H3PA 4H3BA 4JVGA 3D5UA 4FKSA 2JC6A 4JQEA 1KE6A 5CZIA 2B52A 2Q0NA 3AC5A 3FMKA 4NT4A 4FEQA 2RFNA 1BKXA 4V01A 4XBUA 3KRLA 4MCVA 1V0OA 2QLUA 4RX9A 2OU7A 1I09A 5J9ZA 3DFAA 4BWXA 4U97A 2Y8OA 3BYVA 3GT8A 3GU8A 4NIFA 3OW4A 4GYGA 4CZTA 4X6RA 3FUPA 4XHKB 4CFVA 4KA3A 4YTCA 2V7OA 4C57A 5A4LA 4DA5A 4BDIA 2EB2A 3D5WA 4LM5A 3BQRA 3T9TA 1IRKA 5M08A 4C0TA 4BR3A 3QQKA 4KS7A 3ZO3A 4O82A 5BPYA 1KV2A 3TM0A 2QO7A 1Q41A 2OJIA 2JDTA 3FYKX 4G9RA 4FV5A 3IW7A 1TQMA 1GIIA 2C3LA 2PZ5A 5HESA 3UNKA 5F9EA 4D0XA 4G6LA 4QMMA 3VVHA 2EUFB 3I6WA 2A27A 5IH4A 1V1KA 2UW9A 4FTKA 3Q9XA 2GHMA 1REKA 2CNQA 3BBTB 3FI4A 3LFNA 3PJ3A 4ITIA 1DM2A 3QALE 4EEVA 2HELA 3GFEA 3C4FA 2G2IA 3KULA 3LAUA 4O96A 4FZ6A 2YM7A 5C26A 2BILB 4UB7A 4MXYA 4OT5A 4IJPA 5GJDA 3L1SA 2JKMA 4ZTQA 4MQ1A 3F66A 3EYHA 3MY5A 2QOQA 4E6QA 4ANLA 3P7AA 1VJYA 4ZS4A 4O0UA 4HPTE 4U42A 2ZB0A 1XWSA 2NNWB 2WTKB 2HXLA 5CU4A 4JIAA 3TTIA 3QRJA 3FYJX 3QQJA 3SRVB 5HOAA 2QU6A 3P9JA 4G2FA 2PU8A 3NDMA 2YA9A 1QPDA 4O0SA 4FVPA 3O0GA 4CMUA 2X81A 3LQ5A 4ZS0A 1OB3A 4FTJA 3E92A 5ITAA 4TZRA 4O21A 4CV9A 2WU7A 5CEMA 3R1NA 4EOKA 1CMKE 3S95A 4RVTA 5JRQA 5HO7A 2WHBA 4G9CA 2RFDA 4IZAA 2ZM3A 3FBVA 4USEA 5JGDA 3PVGA 4NEUA 4YSJA 4QMLA 4EH4A 5GZ8A 4JDKA 4QYYA 1UV5A 4WG4A 4NZWB 5HU3A 5EKOA 4RJ5A 2XVDA 1H27A 2Z7SA 5AADA 2QD9A 4WUAA 3ALNA 4Y46A 4II5A 4A9UA 5BMMA 4FKLA 4EK6A 4F0FA 3WE8A 4BC6A 3NX8A 3OFMA 2HENA 4WRGA 4ZTHA 5ETAA 5AV0A 4ZSAA 4M14A 3C4ZA 1F0QA 3DDQA 3FZTA 5J5SA 4O38A 2QODA 2WQBA 3GU5A 4AFEA 2OZOA 4KIPA 4E4NA 3A7IA 4OTHA 3C1XA 3H3CA 5D1JA 5HIBA 3CEKA 4IH8A 5IG1A 1XH4A 3QQUA 4PNKA 2JLDA 5KBRA 3ZFMA 4Z16A 3GB2A 2F7XE 4FV4A 5TO8A 4AOTA 3QTUA 3ZUVA 2PYWA 3SGCA 2BRHA 4I0RA 3JXWA 3CTJA 3QF9A 4AGUA 4D4YA 4UX9A 1CKIA 5AX3A 5FP5A 4AUAA 4PMSA 3ZM4A 1IEPA 5HG5A 3QCSA 1XH7A 4AGWA 2JITA 2YIRA 3KMMA 2WKMA 3RKBA 2F7EE 1PXOA 4NFNA 1J7LA 2I40A 3TNQB 3SRVA 2JFMA 4GV1A 4WA9A 5AM7A 3FMNA 3QCYA 4FV1A 3JY0A 2OK1A 2ONLA 2JIVA 5FM3A 4ERKA 4BIBA 2PUNA 4G3DA 4M0ZA 5AR8A 3VQHA 3GC7A 2X6EA 4ZSJA 4U3YA 1OIQA 2P33A 3LXNA 4XG6A 4I0TA 4UWYA 5HO6A 2XIYA 3FY2A 3KVWA 2WD1A 3WIKA 4PDSA 3FLWA 2J5FA 3QA0A 3MVJA 2W1CA 1Y91A 3EJ1A 1BL6A 3NUSA 2UW8A 3IQ7A 2C5XA 4X2GA 4YHJA 3U8WA 4PMTA 4DH5A 3ID6C 4PDYA 5C8KA 3D9VA 2R3LA 3CY3A 3OOGA 4IB0A 1Z57A 4TPTA 3ODZX 3Q9ZA 4CQEA 4L7FA 4BCMA 3V6RA 4YTIA 2PHKA 5IA3A 5EI6A 2CDZA 4F9YA 3FMEA 3R30A 5TR6A 3UZPA 4R6VA 3UE4A 4IAIA 4YJVA 3UMWA 3QD3A 4QP8A 4R7IA 3WZUA 2CHLA 3EMGA 4DGNA 5IMEA 2P3GX 4FIHA 3PY0A 1FVVA 4BGQA 3OEFX 3PG1A 4O7VA 2WIPA 4R1YA 4TTHB 4ERWA 4O7ZA 2UVXA 3NLBA 4MVFA 5K3YA 2O2UA 5BYLA 4U9AA 3TV6A 4X0MA 2BZHB 1W84A 3PP0A 3FLNC 2JGZA 3MPTA 4RGJA 1Q8ZA 4C38A 3BHTA 4NL0A 1MRYA 3W18A 2B4SB 4IZ7A 4F9AA 1Q5KA 4BCGA 1B6CB 3QKLA 2J4ZA 4ITHA 1HCLA 3WF8A 2CKEA 4EQUA 4E7WA 4ITJA 3DJ7A 3PWDA 4PDPA 5CAUA 4OLIA 3GCVA 3IGOA 3W16A 3QX2A 2C5OA 2IZRA 4P4CA 3GCSA 4AXAA 5A14A 4XP0A 4FEVA 4AU8A 3FAAA 2F9GA 4XMOA 3R21A 4O6LA 1M17A 5A6OA 3KULB 3QYWA 3KRXA 3PTGA 4O81A 3HP2A 5HD7A 4NCTA 2V55A 4BL1A 5DN3A 4Z7GA 3L9NA 3DXQA 3DNEA 3G33A 1H0VA 4C4FA 1Z5MA 4EWHA 1XH5A 3EN4A 5GZ9A 2YJRA 4XJ0A 1OBDA 1KOAA 4BDGA 4QNAA 4YLLA 5BX0A 3T9IA 4KSPA 3HMPA 4BI0A 4UMPA 4PL3A 3S2PA 3C9WA 5AP2A 4QP6A 4F08A 3HYHA 3VS4A 4GVAA 3UPXA 4CNHA 4F99A 1NT2A 4EOJA 2GHLA 2ERKA 2VRXA 1PW2A 2OI4X 1KSWA 3RM6A 3ZSIA 4DFNA 5KO1A 2VTHA 3CR0A 3NWWA 1AQ1A 3OXZA 3QTQA 4FR4A 4RC2A 4XG4A 4IANA 3GI3A 5KKRC 3AC2A 3ORZA 5JZNA 2OIBA 3ZEWA 5ANJA 3UOKA 4DCAA 4ASEA 4O22A 2YCFA 2OBJA 4DYMA 2E9OA 3FV8A 4JDHA 2R0UA 4FKTA 3UJGA 4LQMA 3D7TB 1LP4A 2IW6A 4JS8A 4WUNA 3MFTA 4FIIA 4MAOA 4PV0A 5BVDA 4YJQA 3RALA 3TJCA 2R3MA 1IR3A 1WVYA 4F9BA 3TZ8A 3Q2MA 1H1RA 1FOTA 2UV2A 1XHAA 5CVHA 4EOLA 2XKCA 3P23A 3JPVA 4GIIA 2B9JA 3R71A 4H1MA 4A07A 5ACKA 2WMSA 4AT3A 4WHZA 1XO2B 2Y4IB 4M69A 4C33A 1Q3WA 4HYUA 2OZAA 3VS2A 1OL2A 4LYNA 4I23A 3RZBA 2C3KA 3C4XA 2ETMA 4WNPA 5CQUA 3D94A 1YQJA 4LRMA 2OIDA 4TRLA 2YFXA 2NP8A 4A06A 5E8UA 3I0OA 4YR8A 4XH6A 3F69A 3QUPA 4JX3A 4NJ3A 1YXTA 2PVYA 3Q6WA 4GK4A 4BB4A 4BDEA 2PVFA 4KABA 3MY0A 5DVRA 3L8VA 2UW6A 2VO3A 3PWYA 5FWKK 5IKWA 3W1FA 1KE5A 3TJDA 3LFAA 2EWAA 3Q4ZA 4S2ZA 3H4JA 4KRCA 2HCKA 5D10A 4MXXA 3M2WA 5DWRA 4E4LA 4FGRA 3SG9A 5GINE 2UW4A 4E1ZA 1PXNA 2WMWA 5AA8A 1E9HA 3RAIA 2BMCA 4AE9A 4E73A 1OKZA 2ZMCA 4D58A 4FUXA 2JDOA 4CVAA 2JBOA 4I92A 1QCFA 3PSBA 2PZIA 4BKJA 2GS7A 3PXYA 4B7TA 4O7SA 4ARKA 4UALA 4FTUA 3D5VA 3EN5A 4J1RA 3ZU7A 4LRKA 4Z55A 2QG7A 3SW7A 5GJGA 2GPHA 5I9UA 5FLFA 4RPVA 4W4YA 4JBQA 3G2FA 3PG3A 4DEAA 1G8AA 2OXXA 1YI3A 1BMKA 3I7BA 1YWVA 2PVKA 4TY1A 2G9XA 3D7TA 5AX9A 2VU3A 4QTEA 3EH9A 3GOKA 4HGTA 3RHKA 5IH6A 4C58A 2WMUA 5KMKA 4DG2E 1W8CA 2Y9QA 4IB1A 2DWBA 2WEIA 4AT4A 3UNZA 2HAKA 3OF0A 4E8AA 3ORMA 4RVLA 5IH5A 4L6QA 3PRFA 5BVNA 4WNKA 1EH4A 1G3NA 2H96A 4FTQA 1U59A 1UWJA 3LHJA 4G3GA 4ID7A 2F57A 2ITTA 4MHAA 5HNBA 1W98A 3BIZA 2C3IB 4I5CA 4UWBA 2J0JA 4EUUA 3MH1A 3G0FA 5C8MA 2BRNA 3F82A 4IACA 4UYNA 3JYAA 3FHIA 4ZIMA 5HD4A 5IQAA 4J99A 3DPKA 1GOLA 4CZYB 4XV1A 4PPAA 4J95A 4H05A 2UVZA 1GJOA 4DH7A 1G5SA 2YN8A 2H8HA 1H08A 4FIJA 5E8XA 1RJBA 5CSVA 4GL9A 4TYGA 1E1XA 3V01A 3WYYA 4DT8A 3IW6A 1XH9A 2F4JA 4RC4A 4IC7A 3W8QA 3UIBA 3KCFA 4FEUA 3UOHA 1CKJA 4LOPA 5B7VA 4KRDA 1M7QA 5FEDA 4PTCA 3UVPA 1F3MC 2A2AA 3NIEA 3VWAA 1H07A 2IVVA 3ZO1A 3D7ZA 5E4HA 4FKRA 2PVLA 1J3HA 4EOPA 4GJ2A 4DTBA 4YJRA 4WOVA 4FTTA 3DKOA 3MB7A 4QP1A 3NW7A 4L68A 4QP2A 4K9YA 4Q5HA 2QOOA 5AJQA 3QTIA 4FTOA 2GNHA 1A06A 3D83A 4IXPA 3R9OA 2YHVA 3PRIA 3EQIA 3GXLA 3IOPA 4LUEA 2BDJA 4L67A 2C5VA 4FOCA 3TUCA 4ZTLA 4RZWA 3GBZA 3KRJA 2WB8A 3NSZA 3PSCA 4FSYA 4KIKB 4YZBA 3UO4A 2OFUA 3WIGA 2UW0A 2CN8A 5KMJA 4L9IA 3DAJA 3TACA 1H8FA 1SMHA 3CGOA 5KZIA 3BKBA 2CKOA 4Y72A 1T45A 3U6IA 5CU3A 4A9YA 4QMNA 2YISA 3MYGA 5TE0A 4S30A 1FPUA 1MQBA 5DNRA 5A4CA 2VO6A 3N9XA 2W1ZA 3NYXA 4BDBA 4BTMA 5J7BA 5M4FA 3HV7A 2YIYA 3DZQA 3FHRA 4I4FA 3ZOSA 4BY9E 2ZV8A 3BV3A 4ALWA 4D1SA 3PY3A 2HW6A 2CGWA 5M4IA 2QNJA 1PXJA 3MIAA 4WD5A 5CLPA 3Q04A 1UNHA 3ETAA 4AZTA 4HVSA 4AS0A 3RJCA 5IA0A 1OBGA 1AD5A 3BEGA 4U45A 3VBXA 4EK4A 5K5XA 4DLJA 4AZWA 4CT1A 4CCUA 4DG0E 4GIHA 2XUUA 1P5EA 2UZDA 4BYIA 2W9ZB 3R73A 3VBVA 3UZTA 5CAOA 4E4XA 4NSTA 1P2AA 2FB8A 3TCPA 3QRKA 4W4XA 3DNDA 3NVMB 3H9FA 4YPDA 1OVEA 3JY9A 2PE1A 2X8IA 5D12A 1Q61A 5DE2A 4OW8A 4BTKA 5I9WA 4F64A 2OJJA 5KMIA 3WILA 1ZYCA 4NKSA 4F7SA 5LMBA 3HRBA 2OKRA 3CC6A 4TNDA 4O2PA 1PYEA 4DCEA 2YCRA 1WBWA 3EL7A 3P7BA 4QYGA 4ZJVA 5LJJA 3NAXA 4BCQA 2RG6A 3QGYA 4BGHA 4JIKA 4Y83A 3ZBFA 5I0BA 3E8NA 5AR3A 3G5DA 4FZDB 3ERKA 3U4UA 2QURA 4EHVA 3NUNA 2VTOA 5EDQA 1OKVA 3ZZEA 2FYSA 5ICPA 2X7GA 4NTTA 3AD4A 3DT1A 4G1WA 4QPSA 4CFWA 2PVMA 4P5QA 4CTCA 4GT4A 1HOWA 1P4OA 3EQHA 4IMYA 1TVOA 3V5QA 4KUJA 4GU6A 4F6SA 5HO8A 5E9EA 3CKXA 4TYJA 5HKMA 5I9VA 4FYNA 4LRJA 2QONA 2XB7A 3OZ6A 5AFVA 3EFWA 3AT2A 3F7ZA 4U41A 1GIHA 2A1AB 3F9NA 4XP3A 5G6VA 1Y6BA 4AW0A 3QRTA 2QCSA 2YLFA 4XP2A 4FV7A 5IA4A 5HE0A 3B2TA 3KXNA 2ZOQA 4RLKA 1ZARA 3VAPA 3BU3A 5F1ZA 2A19B 2I0VA 2C0IA 4ANSA 4OAUC 5J7HA 2YM8A 1ATPE 3FPMA 3ZCLA 4FKVA 3G90X 4EH6A 4Z7HA 2VNYA 2XBAA 3PY1A 4GCJA 2ETRA 3LFBA 3R8PA 4ANQA 2Q83A 3R9RA 1LR4A 4MWHA 4GJ3A 3UBDA 2QO2A 2REIA 4EH2A 2C68A 4C2VA 4BCFA 4FEXA 3DKCA 4O0YA 3IDCA 5A4QA 1GZ8A 3G51A 3DLZA 2XIXA 4HNFA 4FA2A 5JH6A 1QPJA 4LL0A 3KXXA 3V04A 4YHFA 5IUIA 4GUEA 1M7NA 3GU7A 3ZSHA 2YM5A 3FMMA 3TNHA 4LOOA 1KE7A 5A3XA 2B0QA 3U87A 3NUPA 2GNFA 4TWCA 1YXXA 5CALA 2PULA 3KXMA 3ULIA 4NCTC 4F0GA 2J51A 4OBQA 1PXPA 3V8SA 3BZ3A 4EK8A 1JWHA 4DC2A 3FZ1A 3OXTA 1NW1A 3R9DA 5K9IA 4I21A 5HVYA 2OF2A 3Q96A 5CX9A 1ZYSA 2HZNA 2VGPA 3BLQA 3TV7A 5LVNA 4IZYA 3DXPA 2PUPA 1UU8A 5JSMA 4B8LA 3R1YA 3CD3A 3OMVA 4A4OA 4BKZA 3CLYA 3POOA 3BX5A 2X9FA 4PX6A 5HE3A 2WELA 3F7WA 4TYEA 3RTPA 4IQ6A 4PP7A 4CT2A 4R1VA 1Q8WA 2CKQA 3BHVA 4ZZMA 3ZLXA 3MH2A 3L9MA 2A0CX 1YOLA 5AP3A 5GIOE 3BYMA 2ITWA 3CJGA 5C9CA 2Y6MA 4G6NA 3UC4A 4O84A 4BCNA 4K8AA 5KCVA 2XP2A 1XBBA 4WSQA 2OJ9A 4HPUE 4Y8DA 4C4JA 4P5ZA 3FXZA 4BDFA 1YHVA 3AG9A 4Q9SA 5AV3A 2GFCA 3FKNA 3RCDA 3COMA 3QA8A 4OTGA 3U4WA 1PMVA 4G5PA 3U6JA 4AW1A 5L2WA 5C03A 4RRVA 1TQIA 4CLIA 2YZAA 2ZB1A 3E62A 2F2CB 3FLZA 3EN7A 2RFEA 3IW4A 3UIMA 2GNLA 2ZVAA 4RIYA 5I9ZA 3WARA 3ZXZA 4FX3A 3SOCA 2VWYA 5LVPA 2VUWA 2YM3A 4K0YA 2R3RA 1XJDA 3LIJA 4BCKA 3RVGA 4I6QA 5DEYA 3TN8A 4F9CA 4YTHA 5HIEA 1J1BA 3KK9A 2WO6A 2BIYA 3S3IA 3R8MA 2GS2A 4F6WA 4YP8A 3QC4A 4I41A 4DH3A 3IO7A 1JSTA 1NY3A 4QQCA 2VO7A 2Z02A 4I6FA 4IIRA 1H1QA 1JBPE 2ONLC 3R1QA 4RFZA 3C4WA 4QMSA 5FP6A 2HIWA 3GNIB 4JXFA 1CDKA 2BKZA 4BBFA 3RMFA 4GKIA 3TXOA 4V05A 4D9UA 2XKFA 3TIYA 3FMDA 4YLJA 2W9FB 2XBJA 3GU4A 4AN2A 1JKTA 1OI9A 3EQPA 4L7SA 3R8ZA 2FUMA 5JZJA 2BDWA 2JFLA 2UZUE 4BDJA 4R78A 4ZSLA 4TN6A 4IFCA 2H9VA 1P14A 1RDQE 5L2IA 4YNOA 3C5UA 4N6ZA 3W32A 2CMWA 3JUHA 3UYTA 3IDPA 1M2RA 3A99A 3BRBA 3P79A 3R7GA 3QTXA 4EC9A 2XF0A 3F3UA 4E4MA 4W9WA 1GZOA 2QVSE 2HZ4A 3VW6A 2OZAB 2PE0A 3IS5A 5GHVA 2UW3A 4C7TA 2PK9A 2W4JA 3VRYA 1DAWA 5AAFA 3LFCA 4WRSA 2O3PA 4KIOA 4LUDA 4MKCA 4C2WA 3DAKA 2BUJA 4NUSA 4AF3A 5EHOA 3E7OA 2CCHA 4B99A 2FSLX 2UZBA 5AM6A 3BYSA 2X9EA 4BDHA 3HV3A 3QU0A 3NYNA 2XK8A 3FEGA 3I4BA 4RFMA 5IEVA 5DGZA 5EW9A 3BHHA 4GT5A 4XV3A 4BWPA 4CRSA 2R3QA 3ZBXA 3U6HA 3TZMA 2RKUA 2OWBA 3HV4A 3LM5A 2V0DA 2PL0A 3EYGA 2VWVA 3VUMA 5EQYA 4ZTNA 2J0KA 5E92A 4AWIA 2WQOA 5CEKA 4L42A 5FRIA 3COHA 3Q9WA 3DQXA 5IQHA 3MS9A 4BGGA 3EFJA 4BIDA 4J7BA 4C35A 3VS5A 3PLAE 2PVRA 4IX6A 5E8ZA 4N57A 1PMEA 2VTRA 3FSFA 4J98A 3KRWA 4BN1A 3QGWA 3MW1A 3V3VA 4QT1A 4PTGA 4FV0A 4BIEA 5AA9A 5M4UA 3L8PA 3IONA 4D2RA 4L3LA 5L8KA 5HTIA 4DINA 4USFA 2YM6A 5TF9A 2XK7A 3FQSA 4ASXA 5M44A 1OPJA 2I0YA 4QQTA 5HE1A 4D1ZA 3GC9A 3AGMA 3OWPA 4V0GB 4E6CA 4HVDA 4BI2A 4ACMA 4CTBA 2DQ7X 3AC4A 4C8BA 3I1AA 3JVRA 4RVKA 3BWFA 2AC3A 1IAJA 4U0IA 3A4PA 5M56A 4F4PA 3PSDA 4U80A 2O64A 1K3AA 5KKRB 5E91A 5E7RA 2EXCX 5F95A 3PE2A 2YIQA 4MBIA 2Z60A 5EOLA 3FPQA 3TZ7A 2OJGA 2O63A 3BELA 4HJOA 2ZJWA 3EIDA 5T68A 3Q53A 5IDNA 1QMZA 4FV9A 2XNMA 3DKGA 2R7IA 2HZIA 3F5PA 5E1EA 4DEHA 3QD0A 1XBCA 2HZ0A 4CFFA 4JL9A 1R1WA 3KB7A 1DI9A 3I7CA 5AP6A 1OMWA 3R7EA 1ZOGA 2QKWB 2R3FA 2G1TA 4LOQA 2EVAA 4DE4A 5EH0A 4M8TA 4UWCA 5AP0A 1YRPA 2O5KA 3AC8A 3MA3A 3SXFA 3CSVA 4DBXA 2BHHA 2XEYA 5F20A 4OTWA 1BLXA 4FK3A 1XR1A 4LMUA 3T3VA 4IVBA 4L43A 1GY3A 3MFSA 4FTAA 2CGUA 3GQIA 4QQJA 2W5HA 2J0LA 4ZJJA 4QMZA 3FSKA 1U4DA 3KXHA 3UZRA 4FMQA 5D7VA 4CFXA 3ORNA 4J71A 2CLXA 2J50A 2GFSA 4L00A 4EONA 2VTNA 2WIHA 3I5NA 4BF2A 3FKOA 3P4KA 3UDBA 4DH1A 4ZOGA 4WBBB 1Q62A 4RX8A 5AP7A 4D5HA 4L53A 2GMXA 3OBJA 3Q60A 4JQ7A 5DRDA 4QMWA 2X6DA 4C61A 4ZTSA 3D0EA 3WZJA 3F3VA 4J97A 1SVGA 3QWKA 4FKGA 2WEVA 2AUHA 4TXCA 2XCKA 5JFVA 4YZDA 4TYHB 2CNVA 3UIUA 4EYJA 3PJ1A 2OICA 2R5TA 4RQVA 4OUCA 5M4CA 2BR1A 3F3WA 2G2FA 3P1AA 3E64A 4FIEA 3H9RA 3HA8A 3NR9A 1Q99A 4IHPA 4X2FA 3QX4A 1KE8A 5HNGA 4HYSA 4FUYA 5TT7A 3BGQA 3PVBA 4F1TA 3DS6A 2XEZA 2R3IA 4J52A 5IA1A 2QR7A 4AP7A 3VBTA 3VIDA 3UO5A 2B54A 2QQ7A 4PPBA 3O8PA 4NTSA 4RVMA 5J1WA 3G0EA 3F2NA 2J2IB 1RW8A 5IUHA 4I0SA 4W4VA 3RK7A 5ANOA 1Z9XA 3VUGA 4QTDA 5DR9A 5T3QA 4EZ3A 4D4VA 3QKMA 4I20A 3NUAA 3QFVA 1Q4LA 4EOIA 4JDJA 2HOGA 3FMHA 4AZEA 4GG5A 3HKOA 3R9HA 2W05A 2CGVA 4AGDA 1WBVA 1RE8A 1Y57A 4JBVA 5I5ZA 1OL7A 4CSVA 5T6KA 2ZMDA 3AXWA 5EM5A 3ZRLA 1KOBA 4S33A 5DYJA 3VS3A 2QG5A 1LEWA 3LJ2A 4LMNA 1UVRA 3LFSA 4M66A 3N51A 3H30A 5GNKA 1SYKA 2C3JA 4FNWA 5GJFA 3TNIA 4QP9A 4B9DA 4WKQA 4UY9A 4CFMA 2YACA 4K1BA 5JKGA 3TI1A 3VUHA 3RWQA 5A4EA 1IG1A 5JGBA 4W8DA 4XX9A 4AGCA 2UZLA 1PJKA 4EQCA 4DG3E 3L9PA 3EQDA 2BKKA 4B0GA 4G3FA 5CY3A 2GTMA 1M2PA 1XBAA 2QHMA 1O9UA 3BU6A 3DTCA 3OVVA 5H2UA 2GQGA 4DTAA 4E5AX 3N4UA 3F5XA 3U9CA 2HK5A 3GQLA 3UTOA 3OXIA 5HU9A 4M67A 5CEIA 3WF9A 4ZLZA 1ZOHA 5L8JA 5CU6A 1H24A 3LCKA 3FQEA 4IVDA 4TWNA 4EYMA 4FNYA 3GVUA 4FL3A 4YJNA 1GNGA 5DIAA 4APCA 5I9XA 2JKOA 5EI8A 4HVGA 3ZDUA 5AV4A 4D1XA 4FNXA 3CQWA 4FG7A 5D7AA 4QYEA 5DMZA 5HVKA 3BHUA 3G15A 3HMMA 4PPCA 4DFUA 2C6KA 2JDVA 4FG8A 4XOYA 3A2CA 3G6HA 4IX4A 2OJFE 3MBLA 3KN6A 5KHWA 3I6UA 4FSRA 2QOBA 5AUTA 3FI8A 3LW0A 4F1MA 3O50A 4G3EA 5IQGA 3A8WA 4R3PA 2J0IA 3C13A 4FT3A 5AAGA 2V22A 3HDMA 3Q6UA 5E8SA 3ORXA 5E8TA 1FINA 3R2YA 3ZUTA 3HZTA 4CEGA 2PZPA 3PXKA 4O86A 5CEQA 1H0WA 3E93A 2ITYA 1OITA 4K11A 4YZ9A 5AWMA 2UW5A 5LWMA 1PXKA 4CKIA 4P7EA 4AZSA 3LMHA 4H39A 2J5EA 3BV2A 4QTBA 1UWHA 3MVHA 3QZGA 3D15A 3U9NA 3UYSA 3ZC6A 3ORLA 3TT0A 3F61A 4YJOA 3RAHA 5DFPA 4DEGA 3SAYA 5LMKA 3C0IA 5BYZA 5K4JA 3WZDA 3LCTA 2I7QA 3JS2A 3O51A 4EK5A 4QMYA 2C6LA 2P2IA 3HUBA 2QOLA 3W2QA 5J8IA 3W8LA 4HW7A 2KULA 2WTVA 3DBCA 2J6MA 2ITUA 3HGKA 1QL6A 5M53A 5L4QA 2Z7LA 5FD2A 3MA6A 3CIKA 3SC1A 1JKKA 3TKUA 3V5WA 5CNOA 4CMTA 1PXMA 4YC8A 1SVHA 3LJ1A 2QOIA 2IWIA 3H10A 4EWQA 4RX7A 5ETCA 5EQEA 3CD8A 3OWLA 4JOAA 3W2RA 3LCSA 3LJ0A 1F5QA 5KNJA 2R3KA 2X7OA 5DPVA 1JLUE 3BLHA 3NAYA 1VEBA 4K6ZA 5JK3A 2C5NA 3ZXTA 3I5ZA 3CQEA 3LM0A 1ZY4A 1S9JA 4YZNA 2UVYA 3AMYA 4WT6A 1Q8YA 1W83A 5FDXA 5C1QB 4V0GA 4BCOA 5M55A 1UKIA 4BHZA 3PXZA 5KZ0A 3UOLA 5ANKA 3T3UA 5M07A 4U6RA 5LOHA 1ND4A 2C6MA 3GU6A 3QQHA 4KBKA 4X2JA 2YDKA 4E93A 1PXLA 5HBEA 2QLQA 4UMUA 2EXEA 5CVFA 3L8XA 4FT9A 2C6OA 3KN5A 4E26A 2YWPA 1YDTE 1MUOA 5HG8A 5LARA 3OC1A 2X2MA 1LUFA 2PMLX 5EM7A 5DT0A 4BZOA 2VTPA 1H00A 4WIHA 3V5LA 2C6EA 5LMAA 2VTAA 3IW8A 4BDDA 2RG5A 3OUKA 3O17A 4RJ3A 5CEOA 4YU2A 3P5KA 3FC1X 3FQHA 3OTVA 5A4TA 4CG8A 3ORPA 1M2QA 3E8EA 3SW4A 1FVRA 3CS9A 5LCJA 4EZ5A 4XOZA 5HICA 1Y8YA 5L6WL 3FMJA 1YWNA 3AOXA 4O1OA 3TDVA 5KUPA 4KIKA 4ZXTA 2WTIA 1MRVA 2XS0A 3NYOA 4AAAA 3DBEA 1Q8UA 4YJSA 5B2LA 3D4QA 1IA9A 5CI7A 3DK6A 5JMSA 2W5AA 3BE9A 3R8UA 3P7CA 4O7NA 4L45A 2GHGA 4AZVA 4J53A 2OG8A 2OIQA 2QC6A 2WQMA 3MH0A 3TIZA 3W55A 4NM0A 5LCKA 2BVAA 4L01A 2BZIB 2YAKA 2XJ0A 3DFCB 1UU7A 4QMQA 4USDA 4F63A 5AV1A 3PJCA 4O1PA 2OH0E 3P78A 2Z8CA 3A7GA 4OR5A 3DBQA 2Z7QA 3WZEA 3MIYA 4EHZA 1LEZA 2B53A 2V5QA 4CYJA 2QI8A 2BZKB 5CT7A 3HMOA 3QTZA 4YHTA 1YOMA 4NK9A 4IAZA 4IJ9A 1UKHA 3PFQA 4OTPA 5CQWA 2R4BA 3LLTA 3HV5A 3VN9A 1B38A 3EQCA 1ZZLA 4FZAB 3KGAA 3M42A 4HGSA 4M0YA 4YUQA 2JDSA 3F88A 3O71A 5BVKA 3QUDA 4I3ZA 3ITZA 3DBDA 3B8RA 3Q9YA 2ACXA 2KTYA 2G01A 2XYUA 5HLWA 3R7OA 4PMMA 3R02A 2WZJA 3CPCA 1H1PA 1PMNA 2W96B 5HG7A 5AMNA 3AT4A 1ZXEA 5K0XA 3C0GA 4MH7A 4QRCA 5HX6A 4O7WA 5H8EA 4OT6A 3RBWA 1WBOA 4EH5A 3THBA 4GK2A 3R83A 4EI4A 4Q9ZA 3RHXA 5EKNA 4FSQA 5KMMA 1O6KA 4FVRA 3RNIA 4K77A 1NXKA 1RQQA 4ZZNA 5L2TA 4GKHA 5EW8A 3VF8A 3ET7A 4YTFA 2GSFA 2R2PA 2ZV9A 3FLQA 2Y4PA 1M52A 3DU8A 2Y4IC 3NNWA 3FXWA 4CFNA 4R3RA 2FSOX 4XG7A 4J8NA 1APME 4BI1A 4DITA 2G2HA 3TDWA 4DGLC 1U54B 4HOKA 3ZS5A 3TKIA 3UQCA 3ACJA 1PKGA 2YLEA 1VYZA 4IAFA 5I3RA 1YHWA 3O96A 4C34A 2YITA 2HYYA 3DJ5A 4IAKA 1SNUA 3OBGA 3GGFA 1J7IA 1PYXA 2HW7A 2B1PA 2XNPA 4RA5A 3ZTXA 2IJMA 4KS8A 3QZFA 4RWLA 3LKMA 3K2LA 3BBWA 5HE2A 1OPLA 3UMXA 5IPJA 2IZSA 2IVUA 3EKKA 5D9HA 4U81A 3F3ZA 2CCIA 3W2PA 4GUBA 3ZUUA 4UN0C 4I4EA 3PDTA 1H28A 1H1WA 2J9MA 4HGLA 5BUEA 2BHEA 3CY2A 4O0TA 5HNIX 4FG9A 3A7HA 3RK9A 3IOKA 4JG7A 4DF3A 3E63A 4RIXB 5AUWA 3V8WA 4B6LA 2GQSA 4O7LA 3FZRA 3EQGA 4TWOA 3ZMMA 4EZ7A 2OGVA 5E8VA 4EKKA 4YJTA 2OXYA 4AACA 3UQFA 3ENMA 2UW7A 2XKEA 3KL8A 4RFYA 3AGLA 4RSSA 4DHFA 4R5YA 1FQ1B 2X2KA 1E1VA 5FBOA 4LL5A 4JAJA 2OFVA 3DKFA 3OD6X 2NRYA 3VHEA 4BBEA 4D4SA 3NUUA 5FUTA 2PZYA 3QCXA 3VULA 1UNGA 4ANNA 5L6PA 3UGCA 5CI6A 2W1FA 3IW5A 3LE6A 4FZ7A 2JEDA 3ODYX 3LFEA 4FC0A 3M11A 1WFCA 2VTSA 3COKA 3OW3A 4I5MA 5D11A 3VHKA 1H4LA 2R9SA 4XG3A 4AOJA 2WQEA 3E5AA 5HCXA 1X8BA 5FEQA 1V0PA 4MTAA 4O0WA 5EYKA 4YURA 5BYYA 4FGBA 3UIXA 4FNZA 1W7HA 5AV2A 5FTGA 3A7FA 5CF4A 3IK3A 3ZRKA 1Y6AA 2CGXA 4JNWA 3W2SA 2BFYA 3KXGA 5HVJA 5AIKA 1M14A 4F6UA 3ATTA 1WBSA 3IGGA 3FZPA 5IUGA 2XIRA 3BQCA 3KC3A 4BCIA 3MDYA 2W4KA 4AN9A 2WU6A 3HUCA 1IAHA 2Y7JA 4UEUA 4B8MA 3LXKA 3VUTA 2AC5A 2Z2WA 4H1JA 2XNNA 4XLVA 2WTJA 2UZWE 2P55A 5AP4A 4IX3A 2R3HA 2V62A 1BI7A 3CE3A 1URCA 2P4IA 3QD2B 5DT3A 3RNYA 2CNUA 4BWKA 3HRFA 3OOMA 3O8TA 4G5JA 4MXZA 1OUYA 4NFMA 1BYGA 5KX8A 1OGUA 2YDIA 2ZAZA 3UO6A 4NM5A 4RIYB 4HNIA 3V5TA 3SOAA 5JQ8A 4D2TA 4M7IA 3FI3A 3QCQA 2BROA 2WFYA 3DOGA 4MD7E 3NW6A 4PRJA 4WO5A 2ITPA 4IM0A 4AA5A 2W1DA 4I5PA 4P2KA 4UBAA 2PWLA 4X3JA 4XNEA 4XS2A 5EW3A 5BVFA 5AR7A 2WMXA 2X4FA 4EORA 4OTIA 2W1IA 4PWNA 5M06A 4A4LA 4XLIA 4AW5A 4LI5A 4YBKA 4I5HA 2IN6A 4YJPA 3VS1A 2BAQA 5CXHA 4FICA 4NW6A 2J90A 3A8XA 1UA2A 2C5YA 3BPRA 2NPQA 4Y5QA 3UP2A 4DBNA 5CSPA 3ZLWA 1JQHA 5EYMA 4JBOA 5EG3A 1FMOE 3V51A 5JN2A 2YZLA 2ZM4A 4F7NA 5H9BA 4IB3A 5J87A 2E9VA 4S32A 3E88A 4XRLA 2VD5A 2BPMA 3ULZA 2WMTA 3ROCA 3HNGA 4W4WA 1FMKA 4MYGA 3SQQA 2W7XA 2C47A 3MGYA 4PL5A 1YDSE 4BICA 3LXLA 3PVWA 4MF0A 3E8DA 4L44A 3RWPA 3RCJA 3ANRA 2UZTA 3K3JA 4EQMA 2X1NA 1IA8A 4BVUA 4HCVA 5EK7A 1JNKA 3LQ8A 1YXUA 5LQFA 4P90A 3C4EA 4C3RA 3NGAA 4ZTMA 5JRSA 4G34A 3KEXA 5FTOA 4TNBA 4DEIA 2WXVA 2YWVA 4EOOA 4RG0A 4BCHA 1J91A 5FXRA 2X8EA 4D2WA 4A9RA 2C30A 3OCGA 4QP4A 4AOIA 4CQGA 4CCBA 3JVSA 3OY3A 5EYCA 1JAMA 1L3RE 2UUEA 2UZOA 2VTLA 4MBJA 3EWHA 1XH6A 4YNEA 1U5QA 4R8QA 5AR2A 4OTDA 3ACKA 4H36A 3MJ2A 4O2ZA 3SV0A 4O0RA 4BBMA 4EBWA 2EXMA 3Q5IA 1OL6A 4IC8A 4QTCA 3QTWA 4OGRA 5D41A 3TKHA 4R7BA 2XRUA 4JJRA 4D5KA 4PTEA 3TEIA 4Q5EA 1WAKA 5DLSA 4UZHA 1BUHA 4WNOA 3S4QA 3U54A 4KINA 4JLCA 3BLRA 2RGPA 4V04A 4CZUA 4FYOA 3MTLA 1UNLA 1R3CA 2V7AA 4GFOA 2XCHA 3P86A 4KNBA 4WG3A 5H3QA 3VJNA 4R3CA 4E6DA 4U40A 4UMQA 4M97A 1J7UA 1OPKA 4X3FA 4ANBA 2XMYA 4IDVA 4M68A 1ZYJA 3E8CA 4H3QA 3DTWA 4QP7A 3QRIA 3LFQA 3FI2A 3VJOA 2BALA 4G3CA 1QPEA 5EM8A 1V0BA 4CV8A 3FXXA 3JR1A 5KMOA 4ACHA 3NRMA 2QO9A 2VTTA 3DLSA 4U43A 3KU2A 1DS5A 1K9AA 1DI8A 4Q2AA 4ZEGA 5IQIA 2XK3A 2YJSA 3CTHA 3F5UA 4FTNA 4RBLA 3DK7A 3R6XA 1OM1A 2E9PA 2BTRA 2JAMA 4FV8A 1YI4A 2VWWA 2WOUA 3OT8A 4EK3A 1XKKA 1OIRA 1ZAOA 2F2UA 3BI6A 3B8QA 2C6TA 2A4LA 2BTSA 2QOHA 4LGDA 5M57A 2ETKA 4QO9A 1AGWA 3MSSA 3QQFA 4ZJIA 1H1SA 4PDOA 4F7JA 3KMUA 3MJ1A 1L8TA 4C4GA 1YXSA 3VNTA 1PXIA 4QP3A 3DB8A 1REJA 4JG8A 4ACCA 1A9UA 3EFKA 3RPSA 2OLCA 2ZV7A 3Q4TA 4IE9A 3MFRA 5JGAA 4OAVB 3PZEA 3HX4A 2XK4A 3QQGA 4IDTA 5ANDA 5EDPA 4ACGA 4O7RA 5CU0A 4CLJA 1YKRA 4KKEA 1OZ1A 1ZOEA 2VTMA 3G9NA 4FIFA 4JBPA 5CTPA 3BU5A 3RK5A 3VC4A 4JT3A 1OKYA 1U46A 4NKAA 2VTIA 5BVEA 4PL4A 4H58A 2IVTA 5EHYA 4DGMA 3CPBA 3GCUA 2ITOA 2XIKA 2C69A 4KBCA 4J96A 5BUIA 5ANEA 3MPAA 3VQUA 2ZM1A 3CQUA 3NCGA 4O0VA 2FGIA 5FQDC 3WI6A 4B4LA 4JDIA 3R7YA 4DAWA 3MESA 1VR2A 5FEEA 4WG5A 4E20A 4D0WA 4ZMEA 2BRBA 3EQRA 1GZNA 1WBNA 2C0TA 1S9IA 4JR7A 3SA0A 4DLIA 3DXNA 4LV8A 2R7BA 3LLAA 4ZSGA 2YAAA 3QUEA 4ZP5A 1CTPE 3NCZA 3A60A 2WAJA 2BAKA 4LFIA 3KA0A 5A6NA 4KAOA 2GU8A 4N0SA 2WMQA 4GFGA 4NM7A 5JFWA 2FVDA 2I6LA 5C4KA 5F4NA 5EI2A 3P0MA 4D2PA 4LV5A 4I6HA 3NYVA 2XNEA 4FKWA 2EB3A 4FIGA 2R64A 4RJ8A 3OCBA 3QWJA 4GRBA 4CG9A 4TWPA 4U5JA 1IASA 3O7LB 1YOJA 3GC8A 4S31A 4MXOA 5LVOA 4EOQA 2JIIA 5EFQA 4JRNA 3TL8A 3GFWA 4MK0A 3WBLA 5F94A 3FY0A 4DEBA 3DJ6A 3HEGA 2O65A 1TQPA 4A4XA 5IA2A 4C36A 1PRYA 4BDKA 3RAWA 2XNOA 3SDJA 4D55A 4HVHA 2H34A 2XIZA 1JKLA 2B9IA 1VZOA 4NU1A 3PXQA 5CAPA 3HA6A 2GNIA 4UMRA 3LVPA 4GSBA 4DGOA 3NW5A 3VBYA 4IVAA 5M51A 1OL5A 4TYHA 3DBFA 5JQ5A 3BHYA 3QHWA 2VNWA 5HTCA 4ZMFA 3OUNB 3PP1A 3CP9A 3COIA 3AMAA 5E90A 2FO0A 2R3GA 3QYZA 2X4ZA 4YMJA 5E8WA 3R0TA 1G8SA 3HLLA 4BYJA 2JKKA 2DS1A 3EQFA 4IADA 2ITVA 3GCPA 1WMKA 3QLGA 4E5WA 1MP8A 4OBOA 4RIXA 3SXRA 4JX7A 1WZYA 3QHRA 4PQNA 5HG9A 2WNTA 1JSVA 2Q0BA 1PHKA 2BZJA 4YGAA 3NUXA 3AC1A 4XCUA 2XZSA 4E6AA 3HMIA 2OSCA 3PVUA 3R1SA 1BL7A 5M09A 4IZ5A 4YPSA 4IB5A 2I1MA 4O0XA 4UV0A 2JBPA 4FV3A 2VWXA 3K5UA 2X7FA 3OEZA 4M15A 5HBHA 3NS9A 3TTJA 5KMNA 5DR2A 2FSMX 4LGHA 4RLLA 3AD5A 1BI8A 3EZRA 4EH8A 2F49A 5IMXA 2BIKB 2WGJA 1NVRA 5IQCA 3FJQE 2VZ6A 5AP5A 4O7YA 2C4GA 3LFFA 4L52A 5B0XA 3MV5A 3UVRA 5CYIA 4C4EA 4RJ6A 3HL7A 4BFMA 3QXPA 1WCCA 2XH5A 1CSNA 2JAVA 4Y85A 5KBQA 4FSUA 3O8UA 2XA4A 4FTLA 5EDRA 1GAGA 3D14A 4AFJA 4S34A 4ANMA 1U54A 5HCZA 3PUPA 3KKVA 4FT0A 5DHJA 5B2MA 4FE2A 1YI6A 2WTWA 4MD9E 4NJDA 4A9SA 2HY81 4ORKA 3VS6A 2ITXA 3CXWA 5HQ0A 4N4SA 3RPOA 3W2OA 3FMLA 3AD6A 4AE6A 4EUTA 4R77A 2QOFA 4DEDA 3R22A 4U3ZA 2ITNA 2PMOX 4FK6A 4M84A 4YZMA 3E87A 4FI1A 4GT3A 3T8OA 3TZ9A 4CMOA 5IZFA 1LPUA 5K5NA 3SG8A 2PUIA 2VTQA 2PVJA 5CS6A 3PJ8A 3ZFYA 2VX1A 3O7LD 4FBXA 3K5VA 1Q3DA 2PE2A 4F09A 2ESMA 2X8DA 4O6EA 1JVPP 3ZLSA 2BFXA 2W1EA 2VX3A 5J95A 3KQ7A 5EYDA 4ZZOA 1YVJA 4FTMA 2FA2A 5LVMA 2XM9A 2BCJA 3KY2A 2C1AA 4IAAA 4IBMA 4M3QA 3UVQA 3SHEA 3NPCA 3WYXA 5JEBA 5FG8A 5K4IA 1NVSA 1STCE 4XUFA 5FXSA 1YWRA 3KF4A 3C7QA 3DQWA 2BRMA 2I0HA 2SRCA 3ALOA 4GG7A 3ZC5A 5HTBA 3WF7A 3ZO4A 4F1OA 4ZY6A 5HLNA 2W1HA 4L46A 4C62A 2QOCA 4MQ2A 1ZMVA 2XYNA 3F3TA 3OCSA 4FT7A 5FGKA 2IPXA 3PYYA 2BRGA 2PTKA 2Y0AA 5DH3A 3H9OA 3UG2A 2FSTX 1ZMWA 3FZOA 1QPCA 4K18A 3F2AA 1OECA 4J8MA 4OTFA 4F7LA 4JQ8A 5IEYA 1DAYA 4C4HA 3PE1A 4D9TA 3OWJA 4EH9A 5CASA 5IQEA 1YDRE 4MEDA 4ZY5A 3GENA 3BGPA 3QD4A 2GNGA 3KREA 3VUIA 1J1CA 1ZY5A 4C59A 5A46A 4EOSA 3QC9A 4D2VA 4CRLA 1OL1A 1PF8A 1PY5A 4RJ7A 5CF6A 5HZNA 4UXQA 4F0IA 3NZ0A 4KSQA 3E3PA 3WE4A 3E3BX 3F5GA 3MFUA 3HP5A 1FVTA 3LFDA 3ZH8A 3R8VA 4PY1A 2UZNA 5CZHA 4KKGA 5HLPA 3RPRA 1SZMA 4XRJA 3ZONA 3NMUF 1WVXA 3NUYA 4D2SA 2VWUA 3TUDA 4PMPA 4ENYA 2W1GA 3PPZA 3OP5A 1WBPA 4N6YA 5CT0A 3HAVA 1YHSA 5C01A 3G9LX 1H26A 5IQBA 1JPAA 4NM3A 5IQDA 2GQRA 5J9YA 4BKYA 4ZLOA 2HY0A 4QOXA 3EOCA 4RA4A 2CSNA 3PZHA 3VBWA 4ASDA 3A4OX 4WBOA 4I22A 2X2LA 1WVWA 4YJUA 3OCTA 4PF4A 4LG4A 4I94A 3KF7A 4D4RA 4BCJA 1ZYLA 2O0UA 2RSVA 4XG2A 4X21A 3UNJA 2VV9A 4X7QA 1HCKA 2LGCA 5JT2A 4IW0A 1FGKA 5DRBA 4MF1A 2B9HA 2JIUA 5IISA 4XYFA 2WTCA 5B2KA 3II5A 4K33A 3R7IA 4MXCA 4QYHA 1ZLTA 4L3JA 2VWBA 3LXPA 5HX8A 3DY7A 4OTQA 4O83A 2C1BA 2XJ1A 4RIWA 4BTFA 4EL9A 5AUXA 4QD6A 4BDCA 4UMTA 1P4FA 4UYAA 3WF5A 5HBJA 4HGEA 2CPKE 3VRZA 3R2BA 3MY1A 2IW9A 3C0HA 3A7JA 4QPAA 3OWKA 3F2RA 4E3CA 3CTQA 3QXOA 2ITQA 3LPBA 5C4LA 5HEZA 4TW9A 4YC3A 5ACBC 3KK8A 2ZYBA 3EZVA 3PIYA 3Q4UA 5DI1A 4QMVA 4AT5A 4N70A 3W33A 4DFLA 1JSUA 1UU3A 2C6IA 4FKPA 5IF1A 1JOWB 3PXRA 4IWOA 3O23A 4C37A 2C0OA 3S00A 5BNJA 1VYWA 1XQZA 2GDOA 1OKWA 4KBAA 3V5PA 2G15A 2Y6OA 3HV6A 3UG1A 4F70A 2P2HA 5BMSA 3QLFA 5BQ0A 5FTQA 2JD5A 2X39A 3PPJA 3PA5A 4GW8A 5KE0A 3P08A 4RZVA 2PUUA 5L3AA 4KB8A 4MX9A 1R0EA 4M13A 3LMIA 2QHNA 3F6XA 5IA5A 4GMYA 4LGGA 3V6SA 3GP0A 4DN5A 3BYUA 1B39A 3ZSGA 2CLQA 4DTKA 3LOKA 4C4IA 2E2BA 3FZSA 4GFMA 5FBNC 1NA7A 5GIPE 4FTRA 4FKIA 2XNGA 4NWMA 4NIFB 4FSNA 3TV4A 2J0MB 4AG8A 3DCVA 1Q8TA 3SLSA 4AA4A 4IWDA 4FV6A 4PP9A 3AMBA 3R01A 4Y5HA 2VWIA 2X0GA 2YEXA 3ATSA 4FODA 4CYIA 5E1SA 3AQVA 3ZFXA 2XK9A 4DGGA 4BZNA 2YDJA 4X3FB 4G16A 2RL5A 2IVSA 4CD0A 2WTKC 3I0QA 4U79A 3I81A 2ITZA 4ENXA 2PSQA 3I60A 5AR5A 3FL4A 2GCDA 3D2KA 4I6BA 4MWIA 5DEWA 3QTSA 3VUDA 4AN3A 4DEEA 5IEXA 3S1HA 4U44A 1ZMUA 3BCEA 3M1SA 3ORKA 3V5JA 3GUBA 4ZY4A 3SVVA 4MNEB 4YZCA 1YW2A 2C6DA 4HYHA 2EU9A 4E5BA 3S0OA 3WZKA 2ERZE 5DBXA 1KUTA 3C50A 3DGKA 2RF9A 3O2MA 5H8GA 4EH3A 4IFGA 4G31A 4EC8A 2GS6A 3EHAA 1H25A 5DOSA 4YO4A 5LVLA 3D2IA 4GS6A 4YC6A 3TWJA 5BUJA 3RGFA 4RQKA 4FTIA 3TNWA 5A9UA 2CJMA 2B55A 2YM4A 5DA3A 5L2QA 3MPMA 4D28A 3HDNA 1Q97A 4X2KA 5J5TA 4EBVA 4YLKA 3IDBA 5CSHA 3DDPA 5CNNA 2Z7RA 5FXQA 5HCYA 3U55A 4C02A 1CM8A 4IM2A 3CGFA 4HCTA 3FDNA 4YO6A 4ZAUA 2W4OA 3OY1A 4FF8A 5L8LA 4FL2A 4U7ZA 5CU2A 1KV1A 4A7CA 5HGIA 2OF4A 1PMUA 2NRUA 3DV3A 4KWPA 4HZRA 5AAEA 3BE2A 1XH8A 2YIWA 2VO0A 3Q5ZA 4FSTA 4I24A 4BRXA 4CKJA 2DYLA 3H0YA 4RIOA 1K2PA 4FEWA 3EL8A 3U51A 5J9LA 3GCQA 5LXMA 2W17A 1FGIA 3RINA 3A62A 3N4TA 3DAEA 2WMRA 3PA4A 2XK6A 4HZSA 4G6OA 2NO3A 3PPKA 5DG5A 3MN3A 5C27A 3E7VA 3R28A 3R00A 2QR8A 4RMZA 3MI9A 2VAGA 2YCQA 4O91A 3HMNA 4UXLA 2QU5A 3L9LA 4W9XA 2WQNA 3SD0A 4KIQA 3ORTA 3G6GA 5HI2A 3R63A 4XBRA 2VGOA 3KMWA 4BHNA 5L6OA 3EFLA 1O6LA 4EHEA 3LQ3A 1FBNA 3N4VA 3Q52A 4FOBA 3ZO2A 2QOKA 5TOZA 2W06A 2VX0A 4FKJA 4Z3VA 4MNEA 2PVHA 4QMXA 3Q32A 5AUZA 1MRUA 3VBQA 3PIZA 2IZTA 4DFYA 3QL8A 4UZDA 4GU9A 2RIOA 4CFUA 3R7VA 3C4CA 5J79A 3W10A 4TYIA 3KRRA 5CENA 4BTJA 1OIUA 3ZZWA 3A61A 3MB6A 3DB6A 3MWUA 3VUKA 4OBPA 3C5IA 3TNPC 3CKWA 3R7UA 1JKSA 2GNJA 4FSWA 4TL0A 5FDPA 5AUYA 5FM2A 1O6YA 3PJ2A 2J7TA 2XNBA 4FL1A 3W2CA 3ENHA 4YSMA 4RWKA 3CBLA 4ONAA 3SKCA 1I44A 3QAME 1W0XC 3CJFA 4M69B 1W82A 2CN5A 1GZKA 2JKQA 4IAYA 4IVCA 5L2SA 3B2WA 1CKPA 4GEOA 4QMUA 1R0PA 3ZM9A 3GEQA 4JR3A 4IEBA 3KVXA
chains in the Genus database with same CATH superfamily
3QZHA 4RT7A 5EOBA 1MQ4A 5E8YA 5IQFA 4AXCA 5KHXA 2WMAA 4O7TA 3NIZA 5LMKC 3FWQA 4XG9A 5K0KA 3ZYAA 2IO6A 3OHTA 3CCNA 3NVKI 4QYFA 2HXQA 1WBTA 3L8SA 2JDRA 3KCKA 4QMTA 3VO3A 4ZSEA 5I3OA 2B9FA 3POZA 1T46A 3UPZA 4QQ5A 2R0IA 1SM2A 2DUVA 5TKDA 4MNFA 4FVQA 3TG1A 3WF6A 4EJNA 4EJ7A 4W8EA 3Q2JA 5CANA 3BL9A 5CSXA 3DK3A 4IWPA 4NW5A 5BVWA 3KXZA 2YERA 3RPVA 4CXAA 2I0EA 5CVGA 3VF9A 5CF8A 5CXZA 4RWJA 1TKIA 5CSWA 4AQCA 5EM6A 5EQPA 3QRUA 2O8YA 3FE3A 2BDFA 2XJ2A 2P0CA 4C3PA 2ZV2A 2YABA 5G1XA 4AA0A 4NYEA 1YXVA 4TKSA 2YCSA 3HECA 3QBNA 5AIRA 4APPA 4RWIA 3OTUA 4I93A 2R3OA 4WSYA 5AUVA 2VTJA 2LAVA 4FKUA 4AZFA 5C8NA 5LWNA 2X0QA 2OW3A 2UZEA 2PPQA 2WOTA 5JFXA 5CWZA 3ROYA 4X3FC 5ETFA 3NEWA 3RAKA 3DZOA 3IECA 1ZWSA 3LMGA 5BVOA 4Z9LA 2IG7A 4AW2A 3ELJA 3BWJA 3FLYA 4Y73A 1PKDA 4G17A 4YBJA 4FKOA 2HWPA 4AX8A 3EKNA 3QQLA 4QTAA 5GZAA 3R04A 4FKQA 5IU2A 4FZFB 4A9TA 3K54A 5ETIA 3PLSA 3OS3A 3EN6A 2PMIA 3C51A 1SVEA 1SNXA 2IZUA 2RFSA 4NH1A 3OG7A 5AP1A 4FSMA 4OTRA 5J1VA 1U5RA 1KWPA 3UC3A 4EH7A 2HWOA 1OUKA 4QPMA 2F7ZE 3GOPA 4FV2A 2FH9A 4PUZA 3OT3A 3V8TA 2B7AA 4QMPA 5A54A 3ZEPA 4R5SA 3Q3BA 3RZFA 3VS7A 4DFZE 1ZRZA 4L3PA 3UQGA 4FTCA 2WMVA 3PIXA 5CAVA 5CF5A 4TT7A 3PXFA 1ERKA 5AEPA 2AYPA 4BCPA 2OH4A 2H6DA 2R3JA 3R8LA 3NNXA 3MTFA 4ZK5A 4O27B 2W0JA 2BAJA 3LCOA 4ASZA 2PMNX 3EB0A 3R9NA 1H01A 2QKRA 4XV9A 3RPYA 1URWA 3HVCA 4BDAA 2E9UA 4I1ZA 4GVJA 4R7HA 3REPA 3VS0A 5IDPA 4DH8A 2XM8A 4FRFA 2CKPA 1OIYA 4DFXE 3ZDIA 1GIJA 3BYOA 5AUUA 2IW8A 3FC2A 4QMOA 5CEPA 3ZHPC 2ZDUA 4KD1A 2ZDTA 2W5BA 4KKHA 1R39A 3I79A 5HHWA 5HIDA 4BZDA 4U8ZA 5ANIA 2XKDA 5H8BA 5JFSA 5ANGA 5DR6A 1NVQA 2PY3A 3QKKA 4IX5A 1R78A 4JRVA 4RX5A 3DA6A 4RIWB 4ZTRA 2OXDA 2GTNA 3MVLA 3NNUA 5CAQA 4CKRA 1UU9A 3WOWA 4DT9A 3W0NA 4EKLA 3UP7A 3FL5A 3UODA 4EOMA 4RJ4A 4RC3A 3NNVA 3RM7A 4HVIA 3D5XA 4MXAA 5HORA 2R3NA 3AT3A 5EHLA 3FLSA 3LCDA 3VW8A 2R3PA 4FT5A 4PNIA 4K2RA 1BX6A 4ANOA 3MVMA 3EN9A 3KFAA 4C3FA 1A48A 4XEYA 2YIXA 2PVNA 2OO8X 3BEAA 4WNMA 3ZRMA 3OROA 2PZRA 1ZYDA 4XV2A 3ZLYA 1Y8GA 3IKAA 2VWZA 2W99B 3MH3A 4ACDA 3Q4CA 4XG8A 2XRWA 3LZBA 4JAIA 4QNYA 3RI1A 3HAMA 5I4NA 3GC0A 3PA3A 3TUBA 4MD8E 2WMBA 4JG6A 4HYIA 3BGZA 1KE9A 2WTDA 4GK3A 3K3IA 4ALUA 3FKLA 5I9YA 3SXSA 3ORIA 4F9WA 3ANQA 4IWQA 3SX9A 2WPAA 3IPHA 4JI9A 4GYIA 2UZVA 4IM3A 4L8MA 5DT4A 3H0ZA 4X6QC 3RP9A 4ZLYA 3QTRA 4F65A 4M12A 4DHZA 1ZZ2A 3IG7A 3QZIA 4ALVA 4DFBA 4CGAA 5AR4A 3HRCA 3AC3A 1Q24A 4GH2A 4FSZA 3UOJA 4MBLA 3EQBA 4HCUA 4EHGA 2E9NA 2VN9A 4Y95A 4X2NA 5KMLA 4H3PA 4H3BA 4JVGA 3D5UA 4FKSA 2JC6A 4JQEA 1KE6A 5CZIA 2B52A 2Q0NA 3AC5A 3FMKA 4NT4A 4FEQA 2RFNA 1BKXA 4V01A 4XBUA 3KRLA 4MCVA 2X0PA 1V0OA 2QLUA 4RX9A 2OU7A 1I09A 5J9ZA 3DFAA 4BWXA 4U97A 2Y8OA 3BYVA 3GT8A 3GU8A 4NIFA 3OW4A 4GYGA 4CZTA 4X6RA 3VONA 3FUPA 4XHKB 4CFVA 4KA3A 4YTCA 2V7OA 4C57A 5A4LA 4DA5A 4BDIA 2EB2A 3D5WA 4LM5A 3BQRA 3T9TA 1IRKA 5M08A 4C0TA 4BR3A 3QQKA 4KS7A 3ZO3A 4O82A 5BPYA 1KV2A 3TM0A 2QO7A 1Q41A 2OJIA 2JDTA 3FYKX 4G9RA 4FV5A 3IW7A 1TQMA 1GIIA 2C3LA 2PZ5A 5HESA 3UNKA 5F9EA 4D0XA 4G6LA 4QMMA 3VVHA 2EUFB 3I6WA 2A27A 5IH4A 1V1KA 2UW9A 4FTKA 3Q9XA 2GHMA 1REKA 2CNQA 3BBTB 3FI4A 3LFNA 3PJ3A 4ITIA 1DM2A 3QALE 4EEVA 2HELA 3GFEA 3C4FA 2G2IA 3KULA 3LAUA 4O96A 4FZ6A 2YM7A 5C26A 2BILB 4UB7A 4MXYA 4OT5A 4IJPA 5GJDA 3L1SA 2JKMA 4ZTQA 4MQ1A 3F66A 3EYHA 3MY5A 2QOQA 4E6QA 4ANLA 3P7AA 1VJYA 4ZS4A 4O0UA 4HPTE 4U42A 2ZB0A 1XWSA 2NNWB 2WTKB 2HXLA 5CU4A 4JIAA 3TTIA 3QRJA 3FYJX 3QQJA 3SRVB 5HOAA 2QU6A 3P9JA 4G2FA 2PU8A 3NDMA 2YA9A 1QPDA 4O0SA 4FVPA 3O0GA 4CMUA 2X81A 3LQ5A 4ZS0A 1OB3A 4FTJA 3E92A 5ITAA 4TZRA 4O21A 4CV9A 2WU7A 5CEMA 3R1NA 4EOKA 1CMKE 3S95A 4RVTA 5JRQA 5HO7A 2WHBA 4G9CA 2RFDA 4IZAA 2ZM3A 3FBVA 4USEA 5JGDA 3PVGA 4NEUA 4YSJA 4QMLA 4EH4A 5GZ8A 4JDKA 4QYYA 1UV5A 4WG4A 4NZWB 5HU3A 5EKOA 4RJ5A 2XVDA 1H27A 2Z7SA 5AADA 2QD9A 4WUAA 3ALNA 4Y46A 4II5A 4A9UA 5BMMA 4FKLA 4EK6A 4F0FA 3WE8A 4BC6A 3NX8A 3OFMA 2HENA 4WRGA 4ZTHA 5ETAA 5AV0A 4ZSAA 4M14A 3C4ZA 1F0QA 3DDQA 3FZTA 5J5SA 4O38A 2QODA 2WQBA 3GU5A 4AFEA 2OZOA 4KIPA 4E4NA 3A7IA 4OTHA 3C1XA 3H3CA 5D1JA 5HIBA 3CEKA 4IH8A 5IG1A 1XH4A 3QQUA 4PNKA 2JLDA 5KBRA 3ZFMA 4Z16A 3GB2A 2F7XE 4FV4A 5TO8A 4AOTA 3QTUA 3ZUVA 2PYWA 3SGCA 2BRHA 4I0RA 3JXWA 3CTJA 3QF9A 4AGUA 4D4YA 4UX9A 1CKIA 5AX3A 5FP5A 4AUAA 4PMSA 3ZM4A 1IEPA 5HG5A 3QCSA 1XH7A 4AGWA 2XALA 2JITA 2YIRA 3KMMA 2WKMA 3RKBA 2F7EE 1PXOA 4NFNA 1J7LA 2I40A 3TNQB 3SRVA 2JFMA 4GV1A 4WA9A 5AM7A 3FMNA 3QCYA 4FV1A 3JY0A 2OK1A 2ONLA 2JIVA 5FM3A 4ERKA 4BIBA 2PUNA 4G3DA 4M0ZA 5AR8A 3VQHA 3GC7A 2X6EA 4ZSJA 4U3YA 1OIQA 2P33A 3LXNA 4XG6A 4I0TA 4UWYA 5HO6A 2XIYA 3FY2A 3KVWA 4I6LA 2WD1A 3WIKA 4PDSA 3FLWA 2J5FA 3QA0A 3MVJA 2W1CA 1Y91A 3EJ1A 1BL6A 3NUSA 2UW8A 3IQ7A 2C5XA 4X2GA 4YHJA 3U8WA 4PMTA 4DH5A 3ID6C 4PDYA 5C8KA 3D9VA 2R3LA 3CY3A 3OOGA 4IB0A 1Z57A 4TPTA 3ODZX 3Q9ZA 4CQEA 4L7FA 4BCMA 3V6RA 4YTIA 2PHKA 5IA3A 5EI6A 2CDZA 4F9YA 3FMEA 3R30A 5TR6A 3UZPA 4R6VA 3UE4A 4IAIA 4YJVA 3UMWA 3QD3A 4QP8A 4R7IA 3WZUA 2CHLA 3EMGA 4DGNA 5IMEA 2P3GX 4FIHA 3PY0A 1FVVA 4BGQA 3OEFX 3PG1A 4O7VA 2WIPA 4R1YA 4TTHB 4ERWA 4O7ZA 2UVXA 3NLBA 4MVFA 5K3YA 2O2UA 5BYLA 4U9AA 3TV6A 4X0MA 2BZHB 1W84A 3PP0A 3FLNC 2JGZA 3MPTA 4RGJA 1Q8ZA 4C38A 3BHTA 4NL0A 1MRYA 3W18A 2B4SB 4IZ7A 4F9AA 1Q5KA 4BCGA 1B6CB 3QKLA 2J4ZA 4ITHA 1HCLA 3WF8A 2CKEA 4EQUA 4E7WA 4ITJA 3DJ7A 3PWDA 4PDPA 5CAUA 4OLIA 3GCVA 3IGOA 3W16A 3QX2A 2C5OA 2IZRA 4P4CA 3GCSA 4AXAA 5A14A 4XP0A 4FEVA 4AU8A 3FAAA 2F9GA 4XMOA 3R21A 4O6LA 1M17A 5A6OA 3KULB 3QYWA 3KRXA 3PTGA 4O81A 3HP2A 5HD7A 4NCTA 2V55A 4BL1A 5DN3A 4Z7GA 3L9NA 3DXQA 3DNEA 3G33A 1H0VA 4C4FA 1Z5MA 4EWHA 1XH5A 3EN4A 5GZ9A 2YJRA 4XJ0A 1OBDA 1KOAA 4BDGA 4QNAA 4YLLA 5BX0A 3T9IA 4KSPA 3HMPA 4BI0A 4UMPA 4PL3A 3S2PA 3C9WA 5AP2A 4QP6A 4F08A 3HYHA 3VS4A 4GVAA 3UPXA 4CNHA 4F99A 1NT2A 4EOJA 2GHLA 2ERKA 2VRXA 1PW2A 2OI4X 1KSWA 3RM6A 3ZSIA 4DFNA 5KO1A 3NFFB 2VTHA 3CR0A 3NWWA 1AQ1A 3OXZA 3QTQA 4FR4A 4RC2A 4XG4A 4IANA 3GI3A 5KKRC 3AC2A 3ORZA 5JZNA 2OIBA 3ZEWA 5ANJA 3UOKA 4DCAA 4ASEA 4O22A 2YCFA 2OBJA 4DYMA 2E9OA 3FV8A 4JDHA 2R0UA 4FKTA 3UJGA 4LQMA 3D7TB 1LP4A 2IW6A 4JS8A 4WUNA 3MFTA 4FIIA 4MAOA 4PV0A 5BVDA 4YJQA 3RALA 3TJCA 2R3MA 1IR3A 1WVYA 4F9BA 3TZ8A 3Q2MA 1H1RA 1FOTA 2UV2A 1XHAA 5CVHA 4EOLA 2XKCA 3P23A 3JPVA 4GIIA 2B9JA 3R71A 4H1MA 4A07A 5ACKA 2WMSA 4AT3A 4WHZA 1XO2B 2Y4IB 4M69A 4C33A 1Q3WA 4HYUA 2OZAA 3VS2A 1OL2A 4LYNA 4I23A 3RZBA 2C3KA 3C4XA 2ETMA 4WNPA 5CQUA 3D94A 1YQJA 4LRMA 2OIDA 4TRLA 2YFXA 2NP8A 4A06A 5E8UA 3I0OA 4YR8A 4XH6A 3F69A 3QUPA 4JX3A 4NJ3A 1YXTA 2PVYA 3Q6WA 4GK4A 4BB4A 4BDEA 2PVFA 4KABA 3MY0A 5DVRA 3L8VA 2UW6A 2VO3A 3PWYA 5FWKK 5IKWA 3W1FA 1KE5A 3TJDA 3LFAA 2EWAA 3Q4ZA 4S2ZA 3H4JA 4KRCA 2HCKA 5D10A 4MXXA 3M2WA 5DWRA 4E4LA 4FGRA 3SG9A 5GINE 2UW4A 4E1ZA 1PXNA 2WMWA 5AA8A 1E9HA 3RAIA 2BMCA 4AE9A 4E73A 1OKZA 2ZMCA 4D58A 4FUXA 2JDOA 4CVAA 2JBOA 4I92A 1QCFA 3PSBA 2PZIA 4BKJA 2GS7A 3PXYA 4B7TA 4O7SA 4ARKA 4UALA 4FTUA 3D5VA 3EN5A 4J1RA 3ZU7A 4LRKA 4Z55A 2QG7A 3SW7A 5GJGA 2GPHA 5I9UA 5FLFA 4RPVA 4W4YA 4JBQA 3G2FA 3PG3A 4DEAA 1G8AA 1G8KA 2OXXA 1YI3A 1BMKA 3I7BA 1YWVA 2PVKA 4TY1A 2G9XA 3D7TA 5AX9A 2VU3A 4QTEA 3EH9A 3GOKA 4HGTA 3RHKA 5IH6A 4C58A 2WMUA 5KMKA 4DG2E 1W8CA 2Y9QA 4IB1A 2DWBA 2WEIA 4AT4A 3UNZA 2HAKA 3OF0A 4E8AA 3ORMA 4RVLA 5IH5A 4L6QA 3PRFA 5BVNA 4WNKA 1EH4A 1G3NA 2H96A 4FTQA 1U59A 1UWJA 3LHJA 4G3GA 4ID7A 2F57A 2ITTA 4MHAA 5HNBA 1W98A 3BIZA 2C3IB 4I5CA 4UWBA 2J0JA 4EUUA 3MH1A 3G0FA 5C8MA 2BRNA 3F82A 4IACA 4UYNA 3JYAA 3FHIA 4ZIMA 5HD4A 5IQAA 4J99A 3DPKA 1GOLA 4CZYB 4XV1A 4PPAA 4J95A 4H05A 2UVZA 1GJOA 4DH7A 1G5SA 2YN8A 2H8HA 1H08A 4FIJA 1W2FA 5E8XA 1RJBA 4LV7A 5CSVA 4GL9A 4TYGA 1E1XA 3V01A 3WYYA 4DT8A 3IW6A 1XH9A 2F4JA 4RC4A 4IC7A 3W8QA 3UIBA 3KCFA 4FEUA 3UOHA 1CKJA 4LOPA 5B7VA 4KRDA 1M7QA 5FEDA 4PTCA 3UVPA 1F3MC 2A2AA 3NIEA 3VWAA 1H07A 2IVVA 3ZO1A 3D7ZA 5E4HA 4FKRA 2PVLA 1J3HA 4EOPA 4GJ2A 4DTBA 4YJRA 4WOVA 4FTTA 3DKOA 3MB7A 4QP1A 3NW7A 4L68A 4QP2A 4K9YA 4Q5HA 2QOOA 5AJQA 3QTIA 4FTOA 2GNHA 1A06A 3D83A 4IXPA 3R9OA 2YHVA 3PRIA 3EQIA 3GXLA 3IOPA 4LUEA 2BDJA 4L67A 2C5VA 4FOCA 3TUCA 4ZTLA 4RZWA 3GBZA 3KRJA 2WB8A 3NSZA 3PSCA 4FSYA 4KIKB 4YZBA 3UO4A 2OFUA 2ZFYA 3WIGA 2UW0A 2CN8A 5KMJA 4L9IA 3DAJA 4JMQA 3TACA 1H8FA 1SMHA 4AXEA 3CGOA 5KZIA 3BKBA 2CKOA 4Y72A 1T45A 3U6IA 5CU3A 4A9YA 4QMNA 2YISA 3MYGA 5TE0A 4S30A 1FPUA 1MQBA 5DNRA 5A4CA 2VO6A 3N9XA 2W1ZA 3NYXA 4BDBA 4BTMA 5J7BA 5M4FA 3HV7A 2YIYA 3DZQA 3FHRA 4I4FA 3ZOSA 4BY9E 2ZV8A 3BV3A 4ALWA 4D1SA 3PY3A 2HW6A 2CGWA 5M4IA 2QNJA 1PXJA 3MIAA 4WD5A 5CLPA 3Q04A 1UNHA 3ETAA 4AZTA 4HVSA 4AS0A 3RJCA 5IA0A 1OBGA 1AD5A 3BEGA 4U45A 3VBXA 1TZDA 4EK4A 5K5XA 4DLJA 4AZWA 4CT1A 4CCUA 4DG0E 4GIHA 2XUUA 1P5EA 2UZDA 4BYIA 2W9ZB 3R73A 3VBVA 3UZTA 5CAOA 4E4XA 4NSTA 1P2AA 2FB8A 3TCPA 3QRKA 4W4XA 3DNDA 3NVMB 3H9FA 4YPDA 1OVEA 3JY9A 2PE1A 2X8IA 5D12A 1Q61A 5DE2A 4OW8A 4BTKA 5I9WA 4F64A 2OJJA 5KMIA 3WILA 1ZYCA 4NKSA 4F7SA 5LMBA 3HRBA 2OKRA 3CC6A 4TNDA 4O2PA 1PYEA 4DCEA 2YCRA 1WBWA 3EL7A 3P7BA 4QYGA 4ZJVA 5LJJA 3NAXA 4BCQA 2RG6A 3QGYA 4BGHA 4JIKA 4Y83A 3ZBFA 5I0BA 3E8NA 5AR3A 3G5DA 4FZDB 3ERKA 3NFGB 3U4UA 2QURA 4EHVA 3NUNA 2VTOA 5EDQA 1OKVA 3ZZEA 2FYSA 5ICPA 2X7GA 4NTTA 3AD4A 3DT1A 4G1WA 4QPSA 4CFWA 2PVMA 4P5QA 4CTCA 4GT4A 1HOWA 1P4OA 2AEGA 3EQHA 4IMYA 1TVOA 3V5QA 4KUJA 4GU6A 4F6SA 5HO8A 5E9EA 3CKXA 4TYJA 5HKMA 5I9VA 4FYNA 4LRJA 2QONA 2XB7A 3OZ6A 5AFVA 3EFWA 3AT2A 3F7ZA 4U41A 1GIHA 2A1AB 3F9NA 4XP3A 5G6VA 1G8JA 1Y6BA 4AW0A 3QRTA 2QCSA 2YLFA 4XP2A 4FV7A 5IA4A 5HE0A 3B2TA 3KXNA 2ZOQA 4RLKA 1ZARA 3VAPA 3BU3A 5F1ZA 2A19B 2I0VA 2C0IA 4ANSA 4OAUC 5J7HA 2YM8A 1ATPE 3FPMA 3ZCLA 4FKVA 3G90X 4EH6A 4Z7HA 2VNYA 2XBAA 3PY1A 4GCJA 2ETRA 3LFBA 3R8PA 4ANQA 2Q83A 3R9RA 3W0PA 1LR4A 4MWHA 4GJ3A 3UBDA 2QO2A 2REIA 4EH2A 2C68A 4C2VA 4BCFA 4FEXA 3DKCA 4O0YA 3IDCA 5A4QA 1GZ8A 3G51A 3DLZA 2XIXA 4HNFA 4FA2A 5JH6A 1QPJA 4LL0A 3KXXA 3V04A 4YHFA 5IUIA 3W0OA 4GUEA 4DHJA 1M7NA 3GU7A 3ZSHA 2YM5A 3FMMA 3TNHA 4LOOA 1KE7A 5A3XA 2B0QA 3U87A 3NUPA 2GNFA 4TWCA 1YXXA 5CALA 2PULA 3KXMA 3ULIA 4NCTC 2IF8A 4F0GA 2J51A 4OBQA 1PXPA 3V8SA 3BZ3A 4EK8A 1JWHA 4DC2A 3FZ1A 3OXTA 1NW1A 3R9DA 5K9IA 4O4EA 4I21A 5HVYA 2OF2A 3Q96A 5CX9A 3PFYA 1ZYSA 2HZNA 2VGPA 3BLQA 3TV7A 5LVNA 4IZYA 3DXPA 2PUPA 1UU8A 5JSMA 4B8LA 3R1YA 3CD3A 3OMVA 4A4OA 4BKZA 3CLYA 3POOA 3BX5A 2X9FA 4PX6A 5HE3A 2WELA 3F7WA 4TYEA 3RTPA 4IQ6A 2NYAA 4PP7A 4CT2A 4R1VA 1Q8WA 2CKQA 3BHVA 4ZZMA 3ZLXA 3MH2A 3L9MA 2A0CX 1YOLA 5AP3A 5GIOE 3BYMA 2ITWA 3CJGA 5C9CA 2Y6MA 4G6NA 3UC4A 4O84A 4BCNA 4K8AA 5KCVA 2XP2A 1XBBA 4WSQA 2OJ9A 4HPUE 4Y8DA 2X0OA 4P5ZA 4C4JA 3FXZA 4BDFA 1YHVA 3AG9A 4Q9SA 5AV3A 2GFCA 4MUQA 3FKNA 3RCDA 3COMA 3QA8A 4OTGA 3U4WA 1PMVA 4G5PA 3U6JA 4AW1A 5L2WA 5C03A 4RRVA 1TQIA 4CLIA 2YZAA 2ZB1A 3E62A 2F2CB 3FLZA 3EN7A 2RFEA 3IW4A 3UIMA 2GNLA 2ZVAA 4RIYA 5I9ZA 3WARA 3ZXZA 4FX3A 3SOCA 2VWYA 5LVPA 2VUWA 2YM3A 4K0YA 2R3RA 1XJDA 3LIJA 4BCKA 3RVGA 4I6QA 5DEYA 3TN8A 4F9CA 4YTHA 5HIEA 1J1BA 3KK9A 2WO6A 2BIYA 3S3IA 3R8MA 5BV3A 2GS2A 3ZM9A 4F6WA 4YP8A 3QC4A 4I41A 4DH3A 3IO7A 1JSTA 1NY3A 4QQCA 2VO7A 2Z02A 4I6FA 4IIRA 1H1QA 1JBPE 2ONLC 3R1QA 4RFZA 3C4WA 3W0SA 4QMSA 5FP6A 2HIWA 3GNIB 4JXFA 1CDKA 2BKZA 4BBFA 3RMFA 4GKIA 3TXOA 4V05A 4D9UA 2XKFA 3TIYA 3FMDA 4YLJA 2W9FB 2XBJA 3GU4A 4AN2A 1JKTA 1OI9A 3EQPA 4L7SA 3R8ZA 2FUMA 5JZJA 2BDWA 2JFLA 2UZUE 4BDJA 4R78A 4ZSLA 4TN6A 4IFCA 2H9VA 1P14A 1RDQE 5L2IA 4YNOA 3C5UA 4N6ZA 3W32A 2CMWA 3JUHA 3UYTA 3W0RA 3IDPA 1M2RA 3A99A 3BRBA 3P79A 3R7GA 3QTXA 4EC9A 2XF0A 3F3UA 4E4MA 4W9WA 1GZOA 2QVSE 2HZ4A 3VW6A 2OZAB 2PE0A 3IS5A 5GHVA 2UW3A 4C7TA 2PK9A 2W4JA 3VRYA 1DAWA 5AAFA 3LFCA 4WRSA 2O3PA 4KIOA 4LUDA 4MKCA 4C2WA 3DAKA 2BUJA 4NUSA 4AF3A 5EHOA 3E7OA 2CCHA 4B99A 2FSLX 2UZBA 5AM6A 3BYSA 2X9EA 4BDHA 3HV3A 3QU0A 3NYNA 2XK8A 3FEGA 3I4BA 1ST0A 4RFMA 5IEVA 5DGZA 5EW9A 3BHHA 4GT5A 4XV3A 4BWPA 4CRSA 2R3QA 3ZBXA 3UDZA 3U6HA 3TZMA 2RKUA 2OWBA 3HV4A 3LM5A 2V0DA 2PL0A 3EYGA 2VWVA 3VUMA 5EQYA 4ZTNA 2J0KA 5E92A 4AWIA 2WQOA 5CEKA 4L42A 5FRIA 3COHA 3Q9WA 2A98A 3DQXA 5IQHA 3MS9A 4BGGA 3EFJA 4BIDA 4J7BA 4C35A 3VS5A 3PLAE 2PVRA 4IX6A 5E8ZA 4N57A 1PMEA 2VTRA 3FSFA 4J98A 3KRWA 4BN1A 3QGWA 3MW1A 3V3VA 4QT1A 4PTGA 4FV0A 4BIEA 5AA9A 5M4UA 3L8PA 3IONA 4D2RA 4L3LA 5L8KA 5HTIA 4DINA 4USFA 2YM6A 5TF9A 2XK7A 3FQSA 4ASXA 5M44A 1OPJA 1XMMA 2I0YA 4QQTA 5HE1A 4D1ZA 3GC9A 3AGMA 3OWPA 4V0GB 4E6CA 4HVDA 4BI2A 4ACMA 4CTBA 2DQ7X 3AC4A 4C8BA 3I1AA 3JVRA 4RVKA 3BWFA 2AC3A 1IAJA 4U0IA 3A4PA 5M56A 4F4PA 3PSDA 4U80A 2O64A 1K3AA 5KKRB 5E91A 5E7RA 2EXCX 5F95A 3PE2A 2YIQA 4MBIA 2Z60A 5EOLA 3FPQA 3TZ7A 2OJGA 2O63A 3BELA 4HJOA 2ZJWA 3EIDA 5T68A 3Q53A 5IDNA 1QMZA 4FV9A 2XNMA 3DKGA 2R7IA 2HZIA 3F5PA 5E1EA 4DEHA 3QD0A 1XBCA 2HZ0A 4CFFA 4JL9A 1R1WA 3KB7A 1DI9A 3I7CA 5AP6A 1OMWA 3R7EA 1ZOGA 2QKWB 2R3FA 2G1TA 4LOQA 2EVAA 4DE4A 5EH0A 4M8TA 4UWCA 5AP0A 1YRPA 2O5KA 3AC8A 3MA3A 3SXFA 3CSVA 4DBXA 2BHHA 2XEYA 5F20A 4OTWA 1BLXA 4FK3A 1XR1A 4LMUA 3T3VA 4IVBA 4L43A 1GY3A 3MFSA 4FTAA 4LDTA 2CGUA 3GQIA 4QQJA 2W5HA 2J0LA 4ZJJA 4QMZA 3FSKA 1U4DA 3KXHA 3UZRA 4FMQA 5D7VA 4CFXA 4O4FA 3ORNA 4J71A 2CLXA 2J50A 2GFSA 4L00A 4EONA 4DHIB 2VTNA 2WIHA 3I5NA 4BF2A 3FKOA 3P4KA 3UDBA 4DH1A 4ZOGA 4WBBB 1Q62A 4RX8A 5AP7A 4D5HA 4L53A 2GMXA 3OBJA 3Q60A 1ST4A 4JQ7A 5DRDA 4QMWA 2X6DA 4C61A 4ZTSA 3D0EA 3WZJA 3F3VA 4J97A 1SVGA 4FJVA 3QWKA 4FKGA 2WEVA 2AUHA 4TXCA 2XCKA 5JFVA 4YZDA 4TYHB 2CNVA 3UIUA 4EYJA 3PJ1A 2OICA 2R5TA 4RQVA 4OUCA 5M4CA 2BR1A 3F3WA 2G2FA 3P1AA 3E64A 4FIEA 3H9RA 3HA8A 3NR9A 3PUFC 1Q99A 4IHPA 4X2FA 3QX4A 1KE8A 5HNGA 4HYSA 4FUYA 5TT7A 3BGQA 3PVBA 4F1TA 3DS6A 2XEZA 2R3IA 4J52A 5IA1A 2QR7A 4AP7A 3VBTA 3VIDA 3UO5A 2B54A 2QQ7A 4PPBA 3O8PA 4NTSA 4RVMA 5J1WA 3G0EA 3F2NA 3UDSA 2J2IB 1RW8A 5IUHA 4I0SA 4W4VA 3RK7A 5ANOA 1Z9XA 3VUGA 4QTDA 5DR9A 5T3QA 4O4CA 4EZ3A 4D4VA 3QKMA 4I20A 3NUAA 3QFVA 1Q4LA 4EOIA