2YIXA

Triazolopyridine inhibitors of p38
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title Design and Synthesis of Inhaled P38 Inhibitors for the Treatment of Chronic Obstructive Pulmonary Disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yixA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yixA01
1WBPA 4UYNA 3ZS5A 1H07A 3HV4A 4JI9A 3PIXA 4HYIA 4M68A 4NCTC 4ANSA 3R8VA 5HU9A 3R01A 4KRDA 1IAJA 2XMYA 4NU1A 5CI6A 2CMWA 4C4GA 3KXGA 4IZAA 4EHEA 5D1JA 3OS3A 1BX6A 5FD2A 2CKQA 3Q5IA 4FKIA 2F7ZE 3Q5ZA 4CG9A 2WXVA 2YCRA 2OI4X 3BIZA 4IX6A 5EYDA 4ZSGA 4RIYA 1ZOGA 4LOPA 1TKIA 3RPSA 3Q6UA 3LFBA 4GRBA 2O64A 1RQQA 4IBMA 2XJ0A 4QNYA 3R7OA 2CLXA 5A4TA 2YEXA 4KBAA 3SW4A 3DZOA 1B39A 2BDWA 2Y4PA 3RNYA 3E63A 4X2NA 3HDNA 5LWNA 4FV3A 3UYSA 1UVRA 3RI1A 1H00A 3IS5A 4ZZMA 3VS4A 1W0XC 2R5TA 2HZNA 3OMVA 4I3ZA 4LL5A 4OUCA 2PVYA 3WZUA 3UPZA 3R2BA 2GNIA 2WO6A 4OTRA 1G8AA 3TN8A 5D12A 3HRBA 2JKOA 3OXZA 3UC3A 3V3VA 3NW6A 3CTQA 1H8FA 2BTSA 3QQHA 5EDPA 4RLLA 4TT7A 5E8ZA 3RNIA 1YOJA 4BB4A 4D2SA 5GNKA 3R7VA 2I0HA 3CCNA 3PG3A 4AN9A 4EOJA 3DK7A 4CVAA 1Q3DA 4WNKA 4F7NA 3AC5A 3CJFA 1CKJA 3WILA 1ATPE 3P4KA 3DJ6A 1OIUA 4BDKA 4IB5A 3TL8A 2J2IB 4L01A 3K3JA 3QRTA 5BVFA 2WEVA 4LMUA 1APME 3W2PA 4RWLA 4YO6A 5KBQA 3R9NA 2BFYA 2X8IA 5AR8A 4BHNA 1VR2A 4U6RA 5HO7A 5GJDA 1MQ4A 2UVXA 3VBQA 1H4LA 2XP2A 3Q4CA 3RPOA 2BKKA 2RG6A 4FSTA 2BZHB 5C9CA 4M7IA 4DTBA 3D14A 1BL7A 4BBEA 1DI8A 2IVUA 4YJVA 3MN3A 4OTHA 4EH4A 4EH6A 2JFLA 4QQTA 5LWMA 4AAAA 5HE3A 4YJPA 2OBJA 3U51A 3L8SA 2I0VA 1PXLA 5DMZA 2XNGA 3AD4A 2X2KA 3CTHA 3UIMA 1UV5A 4M8TA 3CKXA 3PWDA 3GU4A 2JEDA 3Q9WA 4YU2A 4RQVA 3N4VA 4MNEB 4EK4A 3EMGA 1Q61A 4UWBA 3HA6A 3A7HA 3T8OA 4EI4A 3TDWA 2PUUA 4BYIA 5FP5A 4YTIA 4DEEA 4YZCA 3ZM4A 4FKRA 2W99B 3QKKA 5C03A 3RK9A 3S1HA 2PK9A 4AF3A 3DA6A 3VC4A 1Q24A 4FKJA 4V0GA 3SXRA 4A4OA 5CTPA 5DI1A 3JVRA 4LV8A 5E7RA 3ULZA 4JS8A 1FVTA 4FK6A 5J9YA 5ANGA 4DH7A 1UNGA 3V6RA 3VWAA 5BPYA 1YHWA 4CSVA 2R3OA 3U6JA 3LCSA 3WIGA 4QP6A 4ZJIA 5JGAA 5EYKA 5I4NA 2XNNA 5EK7A 4F6WA 2BAJA 2C30A 3G33A 4MWIA 1Q5KA 3DPKA 3UNZA 1VYZA 3MVHA 2C0TA 5K3YA 5EQYA 3TACA 2QO2A 3PJ8A 2R3RA 4C2VA 3FQEA 1YWVA 3TZ7A 3TM0A 5EI8A 4KSPA 4RC3A 4IE9A 4M69B 2CNVA 3VUTA 4EOSA 3OCSA 5GIPE 5F9EA 2FSMX 3AC1A 3VBXA 4EH8A 3ALNA 5AUVA 1WVWA 4MXCA 5IA4A 2BZKB 4HNIA 1GNGA 1BKXA 4I6HA 3TG1A 5CAOA 4O7VA 3D7TB 2ZM4A 4BC6A 4Y46A 5IQBA 3F2AA 3IONA 4LUEA 5L2SA 1URWA 3IO7A 2GS7A 4FL1A 3GC8A 3QRUA 3TV4A 5E1EA 4ITHA 1LR4A 4X0MA 5HZNA 4JBPA 2ZB0A 4O7LA 4FSMA 2EXMA 3I6WA 4JG6A 2X4FA 3TZMA 3V01A 5E8XA 2ETMA 4CFNA 4XNEA 2UW8A 4TKSA 4AN2A 4PWNA 3IGOA 4ORKA 4YP8A 4EHZA 2XIKA 5DYJA 4EBVA 1XH6A 4FK3A 3F7ZA 4BCQA 3PVBA 4DN5A 2ZDUA 4IVAA 4QP9A 3RAIA 1KV2A 4MF0A 2WAJA 4DGGA 3D15A 4BI0A 2A1AB 3EKNA 2IZTA 2VO3A 2W05A 3FY0A 4CYIA 3ORMA 2FB8A 5J8IA 2G2IA 2E9NA 1UNLA 3PVWA 5D41A 2C0OA 3DXPA 2YLFA 3LMGA 3TKIA 3FL5A 3AGMA 4QT1A 3A7JA 3Q60A 4JBVA 3F82A 1OI9A 2CSNA 2YM6A 4QTEA 3PXZA 5J7HA 4Z16A 1Q41A 3MTLA 5ANDA 2VWVA 2XK6A 1KOBA 4YZMA 2YA9A 2QOCA 4DH8A 4LRJA 3ZDUA 5FBNC 4JXFA 3AGLA 2UW0A 4F1MA 4JNWA 5L2TA 3HRFA 3QRKA 5E8YA 5IA0A 4KINA 4UWYA 5KNJA 4W4YA 1Y57A 3CS9A 2I0YA 2W5AA 3CR0A 4M13A 5JGDA 3COHA 4WUNA 2C6EA 3QWKA 2PE0A 2YFXA 4WO5A 4B7TA 2JBOA 2YZAA 3ELJA 5TOZA 2UW6A 3MFRA 1U5RA 4EZ5A 4PDYA 4ZTQA 4M0ZA 1G8SA 1L3RE 2WMBA 1OKWA 3FKLA 3VQUA 3ZO2A 1Q62A 3UQFA 4ZY5A 4CLJA 3H10A 2C68A 4YC8A 4RX7A 5J5TA 3VN9A 2R3JA 5FQDC 2WB8A 4EL9A 4AG8A 5BUEA 4BKYA 2Q0BA 1U54A 2ZV2A 3FSKA 4A06A 3S0OA 3MESA 2PMLX 1V0OA 1XH4A 1VZOA 3LM5A 2O65A 1I44A 4UEUA 2IZUA 3QGYA 4FTKA 2WTKC 3RMFA 1OUYA 2IN6A 4YJNA 3GU5A 4C8BA 3R1YA 1SVHA 2F2CB 3NPCA 4QMWA 2WOUA 3E3PA 2YIRA 5JN2A 5C4LA 1PMUA 2IPXA 2OG8A 4AS0A 3VS7A 2W1DA 2PZIA 1XWSA 2CKOA 3HV3A 3VJOA 1U4DA 4DFNA 1Q4LA 3NNWA 3EQGA 1IA9A 3QTZA 4GUBA 4NKAA 5AV2A 3LIJA 4RWIA 5K5XA 5CU3A 3TNIA 3GU6A 5IQCA 4DINA 1Q8YA 3NRMA 3I6UA 4MBJA 3QTIA 4WA9A 4C02A 3ACKA 4BCGA 2PYWA 3QAME 2X9EA 3HAMA 1YXUA 2VTIA 3HAVA 5CSPA 4MQ1A 4Z7GA 3AT4A 3BE9A 2JITA 3R28A 2QHNA 4O1OA 4ZJVA 4IWPA 3ZDIA 2JIVA 3O0GA 4R3PA 1YVJA 4XX9A 3V51A 4O38A 5GZ9A 3R83A 3QZIA 4EZ7A 2ITXA 3R9DA 4BDIA 3Q4UA 3RM7A 3VF9A 3BV2A 4FTIA 1OB3A 2UZVA 2WD1A 2WKMA 3B2WA 2ITPA 4LG4A 3O71A 4XMOA 3RJCA 4AZTA 3NNUA 4WG4A 4G3DA 4YLJA 4BWXA 4H05A 5HOAA 4NM0A 4F0FA 5B2MA 3RGFA 4D4YA 3QX4A 3V6SA 5IQEA 3KRRA 2C3KA 2QO7A 2QLUA 5CWZA 2PVLA 4GKHA 5L6OA 1SMHA 2HWPA 2J5FA 3P79A 4HGLA 5DIAA 3OF0A 4X3FA 3RM6A 1M14A 5LVMA 4P2KA 3UC4A 4E6DA 3R7GA 5C26A 2G01A 4YHFA 3NW5A 2J6MA 4LUDA 5E8VA 4FNYA 1VJYA 2BDFA 1CSNA 3LXKA 4EH5A 5TO8A 5KBRA 3DBDA 4BTJA 4FSZA 4IX4A 1H01A 4C3PA 5LMBA 4OLIA 2Y8OA 1ZMUA 4AA5A 5HCZA 3SG8A 5EI6A 4X6QC 1OPLA 1DAYA 4XOZA 3FXZA 2I6LA 3ORXA 3GP0A 1YHVA 5IUHA 2C3JA 1O9UA 2HCKA 3ACJA 1PMVA 3LQ5A 4IM2A 3UIUA 4QMYA 3DXQA 4HZSA 3C4EA 2X7OA 3UVRA 2XM8A 3EQBA 3NYVA 5CU0A 1FPUA 1UA2A 3SRVB 2YCQA 4EH7A 3WF6A 3COKA 1BYGA 2WMVA 3TEIA 1Y8GA 1M7NA 2VTQA 3BLHA 2IVTA 4BI1A 3PVUA 1EH4A 3ENHA 3QHRA 2C69A 4Y8DA 3QA0A 3VUIA 4BDJA 1H25A 4NTSA 3UODA 4JX3A 2YIXA 1H0VA 5AM6A 4AFEA 3U9CA 4ZMFA 3PJ3A 4GK2A 2XVDA 3BQRA 4NIFB 3BLQA 4Q9SA 5T68A 5DT0A 3QL8A 2QR7A 3IOPA 4I20A 2ITZA 4D0XA 1Q8WA 4U42A 4UMRA 4CNHA 2W1HA 2XUUA 2ETKA 4CFXA 4BF2A 4RJ3A 3RHXA 3MFSA 4GJ3A 2CJMA 4QQ5A 4R3CA 3TJCA 2UZLA 3SV0A 3ZRLA 4FI1A 2PPQA 3ZLWA 4CV9A 2C6KA 5KHWA 5F20A 5KMKA 2OF4A 3QTWA 2WPAA 2BUJA 3F3TA 4ZTLA 3NMUF 1YRPA 2R3KA 3C50A 3QTXA 4D55A 4L6QA 2VTOA 3F61A 4NZWB 4QP3A 3N51A 3NGAA 4YJSA 3WE4A 4AOIA 3QC4A 3G51A 3UNKA 3W1FA 5HTIA 3FZTA 4IDTA 3PG1A 4WRGA 5C27A 3O8PA 1S9IA 2FH9A 4MH7A 1ZOHA 4HVIA 4ZLZA 2HXQA 1ZYDA 3E64A 3R04A 4YNEA 4YGAA 5J1WA 3MA3A 5GINE 3R2YA 5CVHA 3F6XA 1W98A 5AP2A 4CKIA 3NZ0A 5K9IA 4X2JA 3FMJA 3O8UA 4CFFA 4LI5A 1Q8UA 4MQ2A 3C7QA 3NVKI 3WF7A 5HLNA 3G15A 3R63A 3LJ1A 3VUDA 3UMXA 2OJ9A 1Y6BA 4ONAA 4CFVA 2J0MB 3CGOA 3OY1A 3QUPA 5EM7A 3RTPA 4DTAA 5EI2A 4CCUA 4Q5HA 3MY0A 3FZ1A 4QMMA 1SYKA 4F64A 3V5PA 4G3CA 4DEIA 3CD8A 4QMPA 5T6KA 4CV8A 1LP4A 4P5QA 3UP2A 4EJNA 1AGWA 4UB7A 4H3PA 4Q2AA 4BIDA 3KN5A 4TWNA 2J0LA 3RALA 2VWYA 3Q3BA 2VTHA 4ZJJA 1WBSA 5K0KA 4G3FA 2W1GA 4BCHA 4C4FA 4CFMA 4BCJA 5JMSA 4H39A 5DFPA 1OKVA 3B8RA 4BY9E 2YDIA 4B8MA 4ZY4A 4E5BA 2FGIA 2JIUA 5IEXA 2WMAA 4L68A 4O27B 3MS9A 4USFA 4ZTSA 3IOKA 2XK3A 4DAWA 4EH3A 1M2PA 4QTDA 3TJDA 5CEIA 3PSCA 1PXPA 1XBBA 2OXDA 4G6NA 2W9ZB 3FLNC 5FTOA 5BYZA 2W4KA 5EM5A 2JBPA 4QMSA 1OUKA 3VBTA 5CEPA 4FZDB 5FBOA 4HCTA 1OL6A 4UV0A 5IQGA 3F5UA 3SG9A 3OBGA 3BEAA 5CLPA 3LFCA 2BKZA 2FYSA 3BBWA 5ETIA 4ZZNA 4IAIA 3QHWA 4TTHB 5TE0A 3R7UA 2AUHA 5IEVA 1BI7A 4XUFA 2P2HA 3L8VA 4BCFA 5B2LA 2GQRA 3LLAA 2LGCA 5TF9A 4C62A 2JGZA 4E5AX 3HMOA 3LQ8A 3EQCA 4Z3VA 4D0WA 3GC0A 3KU2A 4FSWA 4YJRA 1RDQE 2IW6A 4O0SA 4W8EA 1KWPA 3MI9A 2GQSA 2VWUA 3WYYA 4E7WA 1BUHA 3ZC5A 1FQ1B 5J9ZA 4JOAA 1FVVA 1W83A 3OXTA 3ZTXA 3H9FA 3I0OA 3QALE 4OTWA 2C5XA 3U87A 3OVVA 4D4VA 5HORA 1ZMVA 2WTDA 4FL3A 4GG5A 1YXXA 3AG9A 3E87A 3P1AA 4IWDA 4BDCA 4L45A 4ACDA 4CMTA 3ZHPC 3HECA 4A7CA 2XEZA 4JR7A 4TYJA 1TQIA 3FI4A 4RFMA 3W2SA 4DG0E 1IEPA 4WSQA 4YBJA 4D2PA 3UIBA 4L44A 4YC6A 5JZNA 4EWQA 4O84A 4ARKA 4BN1A 4PP7A 4Q9ZA 4HCVA 3VS3A 4FV0A 4BGHA 4FV9A 5HCYA 3ZXTA 2R3PA 3ANRA 5HVYA 3WI6A 4RVMA 3CQWA 2QG7A 2ITWA 3DFCB 2XIXA 4TNDA 1OL2A 3CSVA 4TY1A 2XCKA 3L9LA 3MB7A 4QYYA 3PSBA 5EOBA 4D4RA 3F5PA 5IG1A 3GQIA 2NPQA 3AC2A 5J95A 3VF8A 3WIKA 2GNJA 5BUJA 5JFWA 2J4ZA 1WVYA 2R3QA 1P5EA 5CSXA 4FEVA 3IECA 3D83A 3KN6A 3FWQA 5IUGA 2XRUA 1ZLTA 4MBIA 3ZLYA 4MXZA 3KL8A 5B2KA 1XQZA 4JDJA 4A9SA 3BCEA 3GC9A 2W4OA 5H3QA 2J5EA 2ZMDA 1UKHA 4O0YA 4KA3A 4X2KA 3NLBA 3OCGA 4W8DA 4F9BA 2GHLA 4BCOA 3FPQA 3KULA 4UMQA 5CZHA 4KRCA 4O0UA 4JRNA 5IH4A 3NVMB 1JOWB 2XNEA 4CT1A 2UUEA 2XF0A 2PTKA 2WOTA 3O50A 4G5PA 4TN6A 3LCDA 2JKKA 3BU3A 3OOGA 5AUTA 5FTQA 5IKWA 3Q2JA 4KKEA 4X3FC 4JG7A 4ASXA 2JFMA 4HOKA 2FVDA 5FM2A 3I1AA 3EB0A 3R7YA 4C3FA 4JG8A 3UOLA 3G0FA 4MD8E 5CENA 2H6DA 4K2RA 3VBWA 4DGMA 5ETFA 5IA2A 4LL0A 4GT5A 3TIYA 2ITYA 4M15A 3O2MA 2BRMA 2C5YA 5EOLA 3BRBA 4N70A 4R6VA 3KF7A 4FSRA 5KKRC 2ERKA 1MRUA 1RW8A 2IVSA 3VUGA 2OLCA 2XIYA 5J9LA 4QP8A 4DFZE 3OP5A 3VS0A 3TKHA 2C1BA 2R7IA 1H28A 3E8EA 2JDTA 3EOCA 3KK8A 4I5PA 3TT0A 5LARA 4C37A 3NCZA 4YJOA 2UW4A 3PJ1A 1FGIA 2P2IA 3L8XA 3RPRA 2QI8A 2YIYA 2Z02A 2GNHA 2O63A 3R73A 3UE4A 1GIHA 1YKRA 2GSFA 3OTVA 4GU9A 3KB7A 2H96A 4FTTA 5HLPA 1U46A 3G6GA 4AW5A 4B6LA 4MXOA 4C58A 1MRYA 1U5QA 2ITVA 4U0IA 5IQFA 3IW7A 3PY1A 3C1XA 3DJ7A 2B1PA 3F7WA 5AUUA 4HNFA 3H0YA 3GENA 4HZRA 3HX4A 3PYYA 4IC8A 3FZSA 4RIYB 2H9VA 4YJQA 5CSHA 3F3UA 1PXMA 1GZNA 2BFXA 2XKCA 3WBLA 2VX0A 5FM3A 3ZO1A 4EKLA 1F5QA 4XLIA 5H8GA 2ERZE 2Z2WA 3ANQA 3UZPA 3MVLA 4TZRA 2H34A 4RG0A 5CF6A 3C4ZA 5K4IA 5IH6A 4A07A 5M06A 4DFBA 2YDKA 2YM5A 5I9ZA 1UU8A 2OJFE 3NUYA 5AP3A 4AN3A 4GIIA 4QTBA 3IDPA 5HI2A 2EU9A 5DOSA 4RJ5A 4Q5EA 5FEQA 5JKGA 3QD2B 3R7EA 5IDNA 1YDTE 3CD3A 5HX6A 2R3IA 3E7OA 4J96A 4NM3A 4QYFA 1OKZA 2OFVA 4IB3A 5JFSA 3I7BA 2VTTA 1LEWA 2C6LA 2W0JA 3FV8A 3PRIA 4F4PA 3NYOA 2DYLA 4LYNA 3EL8A 4TYIA 3VUHA 2LAVA 4FKVA 4IFGA 2EVAA 3HMMA 3T9TA 4ANQA 5EW8A 2CGVA 2PVFA 4XLVA 3QQLA 4YSMA 1PKDA 4V01A 4C33A 4D28A 3R8PA 3MTFA 1OMWA 2BPMA 2XB7A 3G5DA 5DN3A 2PMOX 3UNJA 4BYJA 5HIDA 4C38A 4D2WA 3D9VA 3A61A 4ZSAA 3H4JA 3P7BA 3ENMA 2EB2A 5CNOA 2IVVA 2RIOA 3FBVA 4AE6A 5EG3A 1FBNA 3D5XA 2XH5A 3TUBA 2WHBA 4S30A 4CZYB 4H3QA 3LW0A 4KUJA 4UBAA 4ACHA 3C0IA 3WF9A 4KIKA 3W18A 3QA8A 5AUXA 3C0HA 4A9UA 3QUDA 4UXLA 5AA9A 5M4IA 5GIOE 3HUBA 5HX8A 4DLJA 4QO9A 3AMAA 4ZTHA 3FUPA 1OIQA 1PRYA 2F7EE 1GAGA 2IO6A 4YJUA 3BHYA 4I4FA 3VNTA 4E93A 4EK8A 3BZ3A 4FSQA 3BYSA 4U7ZA 3CXWA 3GEQA 5FDXA 2O0UA 4MCVA 4AZVA 2GNFA 3MY5A 4DEGA 4DH1A 4QMQA 5KUPA 5I0BA 5E4HA 4FTUA 3H9RA 2YABA 3ORNA 3SHEA 1GY3A 5JZJA 4QRCA 4DFUA 4BDAA 2C5OA 3ITZA 4BTFA 3KVXA 2XIRA 2CCHA 5BYYA 2OZAA 1JVPP 2JKQA 3C4FA 2BAKA 2VTPA 4V0GB 4EYJA 5C8NA 4I5CA 3GI3A 1WVXA 3R8LA 3BYUA 4GW8A 3NIEA 3RCDA 4AGDA 4FG8A 4K77A 4F65A 5FUTA 5ETAA 4B4LA 4GT4A 3WZDA 2OICA 3W8LA 5EQPA 2CGXA 4XV3A 3VUMA 4RX5A 4MF1A 4BBFA 4YR8A 3HV6A 4BDEA 3TKUA 4FT7A 1WAKA 5A4EA 5D9HA 3TNWA 2OO8X 5LVLA 3IDBA 4RWKA 5A9UA 4C61A 3UO6A 4BKJA 3AQVA 4NL0A 1H26A 5CEQA 3HNGA 4AGCA 2RSVA 3FC1X 4F9WA 4CRSA 3H30A 3FMMA 2F7XE 4J52A 4ENXA 3PJ2A 3PXYA 1ZY4A 2WIPA 3P23A 3Q53A 1YI6A 1YWNA 1IASA 4O0VA 4U40A 3ET7A 5DPVA 3TNHA 5CXZA 4H3BA 1OBGA 3LFFA 5F95A 3E62A 3MPMA 4L9IA 3MBLA 2VWWA 4O7ZA 4R3RA 1OIYA 2C5VA 2R2PA 4IAFA 1OPJA 4IM3A 3V5TA 3QTSA 3GFWA 4FKUA 2QOIA 5EH0A 4Z7HA 4LV5A 4XBUA 4C36A 2QOKA 4DFLA 3VUKA 1DAWA 1TVOA 4RIWA 5I3RA 5LJJA 2QOHA 2YITA 3KFAA 4FG9A 4MK0A 4XYFA 3DAKA 1MP8A 3QQKA 4EQUA 5HTBA 4O82A 3DTWA 3GCSA 1ZMWA 3BI6A 3FKNA 5EW9A 4U5JA 3EQHA 4NW5A 4YZ9A 2R3GA 1B38A 3PA3A 2QG5A 4TPTA 2RL5A 4USEA 3GT8A 3DBCA 1V0BA 3FHRA 4GYIA 4A4XA 4YC3A 2HENA 3VS2A 1BI8A 3QTUA 4AACA 2GHMA 1M2QA 4FTRA 4ALUA 4WNPA 1FMKA 4X2GA 4D1ZA 3SLSA 4O7TA 2QOBA 1A9UA 2VRXA 3HUCA 4OR5A 1ZYJA 4AZSA 4ZIMA 3ID6C 4QYEA 5L6WL 2PVMA 1PXJA 2X39A 3MPAA 5EDQA 2XNOA 4LFIA 4J95A 4BDGA 3EYHA 3PTGA 1XKKA 3R0TA 2Y4IC 4FV6A 4OBQA 5HE1A 3JR1A 2XK4A 3D2KA 2VN9A 3PP0A 4FKQA 5HBJA 4UMTA 4O7YA 4RWJA 3R30A 3KXMA 2BDJA 4EOLA 5CASA 4OBOA 4QYGA 1H1RA 5IMXA 4BRXA 1SNUA 2YDJA 4Y5HA 1REJA 4N6ZA 4UALA 3R1NA 4GEOA 4R78A 4XP2A 1U54B 3GQLA 4MBLA 4W4XA 5HNBA 3LZBA 3DT1A 4WIHA 3EQDA 2X6DA 1IG1A 5FWKK 1UKIA 2BHHA 3MB6A 3RZBA 4FV2A 4IC7A 4ZSLA 3BYOA 3SXSA 4CEGA 4IMYA 1Y8YA 1ZAOA 4RFYA 5H8EA 3A4PA 4J97A 2BIYA 5K4JA 3SKCA 3OWLA 4BWPA 4L7FA 4GG7A 4FZFB 4GK4A 4M12A 4AE9A 4AW2A 4FKTA 5I9WA 3QYWA 4QYHA 4B8LA 1PXOA 4FIJA 4K0YA 3PA4A 1ZOEA 3KVWA 4FTNA 4RRVA 5DRBA 2ZDTA 3SDJA 4IJPA 1CKPA 3OW3A 4GYGA 4UXQA 4CYJA 4YSJA 3LLTA 3OZ6A 3R22A 5CF4A 1E9HA 2BAQA 1QMZA 3FPMA 3EN7A 3BELA 4YHTA 3VW8A 4E26A 5FXRA 1WBVA 1QPEA 5C1QB 3R8MA 3SAYA 4W4WA 5HIBA 5E9EA 2W06A 2WQNA 5FTGA 4F70A 5AV4A 1RE8A 4JIAA 3LFAA 4F1TA 5M57A 4DH3A 2G2HA 4XS2A 3RCJA 1FINA 5AP4A 1J7LA 3R1SA 4AW1A 1SVEA 3OWJA 5L8KA 2A27A 3GXLA 4I41A 4K33A 3HV5A 4AA0A 3FLYA 3HGKA 1OGUA 5A3XA 1H1SA 5C4KA 5FLFA 4L00A 2XIZA 1XBCA 4IJ9A 4ZP5A 1OL1A 3EIDA 4D1XA 4RFZA 2I1MA 3FXWA 3ATSA 4NT4A 5EYCA 4RZVA 3UZRA 3POOA 3GUBA 1W82A 2WTCA 4LOQA 5HVKA 4AZEA 1K3AA 2VNWA 4J8NA 2AC5A 4EOIA 3SC1A 3FHIA 4LRMA 4O7SA 2YERA 5L2IA 2UZOA 2UZUE 4EH9A 4EOQA 1REKA 4BR3A 4F9CA 4PL4A 5AUWA 1FMOE 1PYXA 2QONA 3OY3A 4GV1A 3UP7A 4S2ZA 4BIEA 2AYPA 4M69A 4FSYA 3MH0A 4DGLC 3KA0A 4YLLA 3OBJA 4CG8A 2YAAA 4S32A 4ZOGA 3IDCA 3VHKA 5HG8A 4L67A 3PRFA 4QP2A 1GIIA 5AIRA 4F7SA 1MRVA 3NCGA 3R00A 3TZ9A 4HGEA 3ZZEA 4B0GA 4ERWA 3NR9A 3PPJA 3NUXA 3GCPA 5J7BA 5BVEA 2BIKB 4HYUA 5J87A 5CSVA 3BWFA 4DFXE 2CN8A 3TTJA 3R9OA 4AZFA 3UG2A 1HCLA 4EWHA 1P2AA 4XRLA 5BNJA 3PY3A 3QU0A 4AGUA 5HD4A 4CKRA 3P0MA 3O17A 4DA5A 2WMXA 5DR6A 3TNQB 5HNIX 3PPKA 5IF1A 3SW7A 4L52A 4MHAA 4AXAA 4R5SA 3W16A 4PX6A 4HVHA 4D2RA 3M42A 4OT5A 4USDA 5LCKA 2YZLA 5M09A 5AX3A 3QRJA 2YWVA 5IZFA 3ZOSA 2C6TA 4TW9A 2WMSA 4C35A 4E6AA 2ZOQA 4ZTRA 1CDKA 3Q6WA 2CDZA 5AV3A 5HBEA 3FQHA 3UGCA 4CKJA 2BVAA 4N0SA 2J0JA 5CS6A 1WZYA 4OTIA 3VULA 3D0EA 4IW0A 1XHAA 2PZPA 3AC3A 3GOKA 4J8MA 5HO6A 4BTMA 2OJJA 5IH5A 1PYEA 3JUHA 4K1BA 3B2TA 3H3CA 3MVJA 3R9HA 3QC9A 2GPHA 1XJDA 2WTIA 3HEGA 3MFUA 3P5KA 3PIYA 2NRUA 4G6OA 4GJ2A 5CVGA 4ASDA 3UQCA 4QP1A 3KCKA 2J50A 1F0QA 3NNXA 2E9UA 5KMIA 5GJGA 3L9MA 3PIZA 3OUNB 1WBNA 2F9GA 5AJQA 4YTFA 4K18A 3ZU7A 2VUWA 3MH3A 3WARA 4RJ7A 1CTPE 2Z60A 3LJ2A 4RX8A 4GMYA 5KZIA 5C8KA 2B0QA 3ZO4A 5CT0A 1PXNA 2C3LA 3NIZA 1YOLA 3JYAA 5AR7A 4TNBA 4BZNA 4O1PA 5HBHA 4JDIA 3Q9YA 4U44A 5E1SA 1PY5A 1YQJA 3EFWA 3U9NA 2HWOA 3I79A 2QHMA 3CC6A 4KIOA 4L46A 3SA0A 5DRDA 1O6LA 4FTOA 1YXTA 1ZYSA 2YIWA 4EUTA 4UX9A 2WU6A 4O2ZA 3WF8A 4PP9A 2XKFA 4YPDA 4ZTNA 3G2FA 3PA5A 2R3LA 5AWMA 5EHYA 4LMNA 4FX3A 1SZMA 2A4LA 4FMQA 3UQGA 4H58A 3NEWA 5A54A 2XNBA 3QUEA 4M66A 4DEAA 4RC2A 1K2PA 3BEGA 1F3MC 2W5HA 2ZV7A 4FT3A 4U3YA 3CTJA 3KRWA 4BZOA 2CPKE 3OXIA 1QCFA 2J51A 3SVVA 3DNEA 1J7IA 2RFSA 5EKOA 3VRZA 4YHJA 3F69A 4FICA 4O0RA 5A6OA 3R9RA 4BDBA 1PXKA 2HZIA 2YWPA 4C4EA 4XG7A 2V7AA 3LVPA 3MPTA 1PXIA 3I60A 3LFQA 5AP0A 4RVLA 4FTMA 4FEXA 2I7QA 3I5ZA 4QMZA 2ETRA 2ESMA 4K8AA 3DKGA 3K2LA 4FIIA 4WUAA 4JBOA 3UVQA 5FDPA 4FSUA 4KAOA 3UG1A 2UW7A 4KS7A 5DEYA 2OFUA 3DAJA 5DVRA 4AA4A 3DZQA 4PTCA 4JR3A 4CTCA 5LVOA 5HU3A 5DLSA 2P4IA 3BLRA 4FNWA 4S33A 3E88A 1J91A 3COMA 4FSNA 4FT0A 1NVSA 2QO9A 4ANMA 2PUNA 4CT2A 3Q52A 5AAEA 2FA2A 2GFSA 3DDQA 3GC7A 5C01A 3W55A 2A2AA 3KY2A 4CCBA 2RG5A 5DH3A 5KCVA 3NYNA 4XG3A 1JBPE 5FXQA 4JBQA 1BMKA 4IAKA 2CGUA 3I4BA 4O2PA 3GBZA 4IVDA 1H08A 3QXPA 2OIQA 3I0QA 2IZRA 2X1NA 1GZ8A 3DJ5A 5FEDA 5G6VA 5BX0A 3DB8A 4E8AA 4CLIA 4B99A 3BHTA 3ORPA 2VX3A 2HIWA 4I6FA 1H1WA 2XKEA 3RK7A 5J79A 4V04A 4GVAA 5AM7A 1KV1A 3OWKA 4L42A 4U97A 4EC8A 3PXFA 1TQMA 4ZMEA 5ANIA 2RFEA 5CYIA 4ZS4A 2VWXA 3IW4A 2VWBA 2ZMCA 4JX7A 4KWPA 3DU8A 4L3JA 3U4WA 4D1SA 4FOBA 3IG7A 3K5UA 5A46A 3EQFA 3II5A 4QP7A 5IA1A 2F4JA 4YURA 4RX9A 5ANJA 3KRXA 5HNGA 4FKWA 4K11A 3Q4TA 4EONA 3BBTB 3JVSA 4FKPA 4X3JA 3DQWA 3KMWA 4ITIA 2E2BA 3K5VA 4FV5A 1URCA 2VV9A 2YISA 4FTAA 5DE2A 4AP7A 5FRIA 2OXXA 4IWOA 3NWWA 3O8TA 2J90A 5IQDA 2UZNA 4RQKA 2B9FA 3KMMA 4AU8A 4CMUA 2VTAA 4ZZOA 4A9TA 4G9RA 2DUVA 4MXXA 4NIFA 5IU2A 1NVRA 2CCIA 2JLDA 2WEIA 3VVHA 4B9DA 3GCVA 3AXWA 4OTQA 3JY9A 3WZEA 4BZDA 4FTJA 2QQ7A 2DWBA 3QCSA 5L8JA 3RVGA 2CLQA 3KXNA 3W8QA 1R1WA 3DBFA 3NAYA 4RA4A 3EFJA 4UZDA 3PXRA 4C3RA 3OCBA 1OIRA 5CEKA 1Y6AA 5ACKA 2VGPA 3OTUA 4FG7A 5IDPA 3FE3A 4BDFA 3W2OA 4DH5A 4N6YA 3PVGA 4RT7A 3TV6A 2YAKA 3E92A 3EN9A 4PPBA 3H9OA 5AP5A 2IW9A 3GU8A 5HO8A 3W2RA 2WMTA 4UYAA 5AAGA 3FLQA 4S34A 4Y95A 2WQBA 4BKZA 5EQEA 2GQGA 5M56A 1VEBA 1JPAA 1P4FA 2HY0A 4C34A 1JKSA 5CAVA 2ZVAA 1JLUE 2UW9A 2HK5A 3JY0A 4KSQA 3HMIA 3A8XA 1M2RA 4HVSA 2VX1A 4OTGA 5EFQA 1TQPA 5BVKA 4APCA 2WQOA 4BI2A 4DITA 3UOJA 4QMTA 4FIFA 2WTJA 4CXAA 3KGAA 1JSTA 1QPDA 4FF8A 4I94A 3E8CA 4CQEA 3G0EA 5HLWA 1LPUA 2R7BA 5ANOA 2C6DA 5E8SA 3NS9A 4EJ7A 3ZLXA 1SNXA 2YLEA 2HELA 5E90A 5HQ0A 3BHHA 4QNAA 4RIXB 2BILB 4EH2A 4XV9A 3TXOA 4ID7A 4YNOA 4R1YA 3SOCA 3E7VA 4U3ZA 3DK6A 4FOCA 3FI8A 3AD5A 3HMPA 3QKMA 3MIAA 3Q96A 4MKCA 4WSYA 3DB6A 3WYXA 4FUYA 1J1CA 1JKTA 4CFUA 4O86A 3F9NA 2ZV8A 2C0IA 4YZDA 5IA5A 4BGGA 5JSMA 4E4MA 4K9YA 1XO2B 4QP4A 2UZDA 2IZSA 4I6BA 1G3NA 4ZTMA 4KIQA 3R71A 3DKFA 4IZYA 1WMKA 4M67A 3FYJX 2W4JA 4IACA 4NW6A 2VD5A 2JAVA 3F66A 3AD6A 5AR3A 3QF9A 3LCTA 3G90X 3KRJA 3OCTA 1L8TA 3QQUA 4IADA 4PMTA 4BTKA 4RJ8A 2BR1A 2ITQA 2E9PA 5L8LA 1PHKA 5HKMA 2HYYA 1ND4A 1M7QA 4CGAA 2UV2A 3E8DA 3OHTA 4TYHA 5KMLA 4UMPA 4IHPA 4W9XA 3ATTA 3CY2A 3VBYA 2OJGA 1JKKA 3CLYA 1QPJA 3Q4ZA 2UW5A 2XA4A 2HXLA 4H1JA 2ZYBA 3MH2A 4XG9A 3R21A 4AQCA 4QMVA 4G16A 4QTCA 4U41A 1HCKA 2VWIA 3DCVA 3VAPA 1ZY5A 3A99A 3RBWA 4OTPA 3VQHA 5IPJA 1UNHA 4FT9A 2WTWA 2WTKB 3HVCA 3VRYA 1BLXA 2A0CX 2ZAZA 3IW6A 3GFEA 3QXOA 5BVNA 3QD3A 3KKVA 2WMUA 1NY3A 4LRKA 1G5SA 4M97A 3AC8A 2CKEA 2V55A 1S9JA 4ALVA 1DM2A 4IWQA 4RBLA 4C2WA 3Q9XA 3O23A 3ZFXA 4FR4A 3ZUVA 4CZTA 4EOMA 5GZAA 4PMMA 4KNBA 4F0GA 3OROA 4ENYA 4NJDA 2R4BA 4XG6A 4L7SA 3RP9A 3PXQA 5HE2A 4AGWA 1GIJA 3CKWA 4U43A 2B4SB 4U45A 3C0GA 2O2UA 3FY2A 4HPUE 5ACBC 3QZGA 1OVEA 2OKRA 5TT7A 2EUFB 4JDKA 5D7AA 1V0PA 1E1VA 1Q97A 1Y91A 1ZZ2A 3EQIA 5GZ8A 2X8EA 4XJ0A 3LOKA 3CP9A 4KIKB 2PZYA 3FZPA 4PNIA 4PDPA 4R77A 4ZK5A 2UZEA 4QMOA 1A06A 4YJTA 4DT8A 4FZAB 4KABA 4WNMA 3D5VA 4EQMA 2W1ZA 2YJRA 3NSZA 4HW7A 2C47A 2GDOA 2O3PA 4R7HA 1J7UA 2XK7A 4RVTA 4ANLA 1CMKE 3SGCA 3LCKA 1O6KA 1YI3A 2Y9QA 3CJGA 5CX9A 4IZ5A 4IVCA 3U54A 5HIEA 5JT2A 2HW7A 4EC9A 2G9XA 2R3HA 1SM2A 3PLAE 3ZSIA 3UVPA 2ITOA 4I4EA 5LCJA 4OW8A 3CEKA 3ZEWA 4F7LA 2VTRA 4FVQA 4MXYA 4YBKA 4ZLYA 5CEOA 5IQHA 2W1EA 4UWCA 5DA3A 3R8ZA 2OIDA 2Z7QA 5KZ0A 2BRBA 1KE5A 4F6UA 4PDSA 3IQ7A 4G2FA 3N4TA 4D9TA 5JEBA 5M4FA 2XYUA 4IB1A 2PUPA 4NKSA 4XP3A 3IW5A 3TTIA 5DR9A 1SVGA 3CPCA 4MXAA 4NFMA 4M3QA 4XCUA 5DT3A 2R64A 3BGPA 5AV1A 5HEZA 4FA2A 4TL0A 5HG7A 2PSQA 3R6XA 2B54A 4KS8A 4PY1A 5DWRA 2UVZA 4JL9A 3ZBXA 3DLZA 4Y83A 4DEBA 2OGVA 4XV1A 2QD9A 2OU7A 2X9FA 2O5KA 3PSDA 3MYGA 3W2CA 1JSVA 4L53A 3ZSGA 1NVQA 3MJ2A 3ZXZA 4GK3A 1IR3A 3ZRMA 5LVNA 1MUOA 4ALWA 2J0IA 3MSSA 2F49A 3KXHA 4CTBA 4F08A 3NX8A 3T3UA 1R0EA 3HV7A 4ZEGA 3KEXA 3FQSA 3R1QA 4NEUA 4WHZA 4IH8A 3OW4A 3JS2A 3QCYA 4AUAA 1IRKA 2G15A 3O51A 3QKLA 5AP7A 1AD5A 2JC6A 5HESA 1ZARA 1OM1A 2OJIA 2R3MA 4FV8A 2HZ0A 2HAKA 3TUDA 2J0KA 5GJFA 2GFCA 2YN8A 5M4UA 4FIEA 3EHAA 4J53A 2W7XA 3NUUA 3NYXA 4RIWB 5A4CA 4TYGA 3AC4A 4H36A 5HD7A 3UMWA 3HA8A 3KQ7A 5CALA 1HOWA 3ALOA 3HYHA 3A8WA 2XNPA 4QPMA 4JJRA 3S4QA 4EK6A 1ZWSA 3RZFA 4WNOA 5M53A 4FIHA 5I5ZA 2BTRA 3HL7A 3OFMA 3QCXA 3IK3A 3LFNA 4I0TA 3DV3A 4NH1A 4OT6A 5CSWA 3ROYA 2ACXA 3R02A 4Y5QA 3KRLA 5IUIA 2XJ2A 5E91A 1UWHA 3V04A 3WOWA 2XM9A 4XP0A 4BCNA 2F2UA 2YACA 5JH6A 3A7FA 4WOVA 3V8WA 3UDBA 2CNQA 5FP6A 4NTTA 2X7GA 2QOLA 4EHGA 4FKSA 2WNTA 3S95A 5K5NA 1M52A 4EOKA 1JNKA 4I1ZA 4FTLA 2CGWA 4MX9A 4C4HA 1R0PA 3FYKX 1PMEA 3P7AA 5FGKA 3ZM9A 4FKLA 3C51A 4G17A 3ODYX 2HY81 3K54A 4XH6A 4MD7E 4ACMA 3W2QA 3GVUA 3BGQA 2WMQA 3MY1A 3JPVA 3PLSA 2I40A 1GZOA 5FEEA 3U4UA 4M84A 5KMNA 2BRGA 4JDHA 4BCMA 4AT3A 2PVNA 5M08A 3QBNA 5CT7A 2BCJA 3EJ1A 4YTHA 5DR2A 5LMKA 5G1XA 5DG5A 3IKAA 2YHVA 2NRYA 5HE0A 4RSSA 4GFGA 2B9HA 2UW3A 4OBPA 4ERKA 3FL4A 5AX9A 2JKMA 2BRHA 3FAAA 5CU4A 4BHZA 3A60A 3ZC6A 4DE4A 5LVPA 2QKWB 4QPSA 4XG2A 3L8PA 3SX9A 4F99A 4FL2A 4FVPA 4YZBA 4NJ3A 5D7VA 5F94A 1VYWA 4QD6A 3ULIA 2WMWA 4JRVA 4O6LA 4PUZA 3RWQA 1YW2A 3QD0A 2GHGA 4ASZA 2PVJA 4MNFA 4FV1A 3RINA 2FSOX 2IW8A 4E4LA 3LPBA 4P5ZA 2W17A 3GOPA 4GUEA 5E8WA 5AUYA 2R0IA 3Q32A 4CQGA 2IG7A 4O7NA 1Q8ZA 1J3HA 4J7BA 3TNPC 3LFDA 4QPAA 4UN0C 3L9NA 2VNYA 3UO4A 2XJ1A 2C5NA 3IW8A 2R3FA 5AUZA 2OXYA 3C5IA 4FE2A 3MGYA 1KE7A 1YDSE 2DS1A 3LCOA 2VO0A 4MAOA 4Y85A 2ITTA 3I81A 4X6RA 3PE1A 4DGNA 3BGZA 5I9VA 2YIQA 3FDNA 4MYGA 2X0GA 1XH9A 3GNIB 2EWAA 3W10A 4A9YA 3DXNA 2JDSA 3ORZA 3FZRA 3S00A 2PL0A 4CMOA 3JXWA 4I22A 3NDMA 3RAHA 4ANOA 2X6EA 4ANBA 4OGRA 3M1SA 2GNGA 4WG5A 1Z57A 2Z7LA 3ZUUA 5FXSA 3C4WA 3CQUA 4TRLA 4FNZA 4OTFA 3AT3A 2P3GX 3KXZA 3OEZA 4I6QA 3LMIA 2VTLA 4BBMA 3PJCA 4JIKA 2X2MA 3MVMA 4D2TA 4MD9E 3AT2A 2QU6A 2XKDA 1I09A 4HGSA 4DCAA 3P78A 4KB8A 4C4JA 3H0ZA 4YLKA 4ZAUA 1T45A 2OWBA 3L1SA 4NK9A 5EYMA 2Q0NA 3D7ZA 5I9XA 3UO5A 3OC1A 5HHWA 4O0TA 3MFTA 2VAGA 4ITJA 4D58A 4JT3A 5L3AA 2XZSA 3CY3A 4NWMA 1E1XA 5T3QA 3R8UA 5CAPA 4MEDA 5ANKA 2R0UA 4BGQA 3DKCA 2REIA 4HYSA 2YM8A 1NW1A 4UMUA 1W7HA 3QQGA 4WT6A 1H1PA 2XYNA 2HOGA 2BZIB 2NNWB 4WRSA 5A4QA 2V62A 3Q2MA 4FZ7A 2P0CA 4Z55A 4JQ8A 4YPSA 1M17A 3FZOA 3UIXA 4TWCA 2VTJA 4YTCA 5LXMA 1QPCA 3ORTA 3TZ8A 4R7BA 4RIOA 5EM6A 5ETCA 2HZ4A 1H1QA 4EOPA 1P4OA 3DKOA 3KCFA 4E73A 3CIKA 3FLWA 3BE2A 4FUXA 3FMNA 3GB2A 4MNEA 2GU8A 3FMDA 4AX8A 4FV7A 3CE3A 4O21A 5D10A 4BCKA 2PVRA 2GMXA 3DBEA 4IAAA 3OWPA 5DGZA 1PMNA 5CAUA 4QMNA 2RGPA 5FG8A 4ACCA 3DQXA 1YOMA 2R9SA 1KE8A 2UZBA 3OD6X 2GCDA 4O6EA 1LEZA 3QLGA 3F3WA 5HCXA 4F09A 3UJGA 1H27A 4G31A 4ZSEA 3ORKA 2OW3A 3COIA 4M0YA 2NP8A 1OZ1A 1OITA 2UZWE 3B8QA 1UU9A 4W9WA 4C7TA 4DT9A 4X3FB 2W1FA 4EK5A 3QGWA 4L8MA 5AV0A 1J1BA 4J98A 4U81A 2PWLA 3VW6A 3LFSA 3BPRA 3TDVA 3P7CA 4GH2A 5H2UA 4ZY6A 3D4QA 4GT3A 2Z7RA 3CQEA 4IIRA 3I5NA 5M4CA 2PZ5A 3GCUA 4NSTA 2JIIA 3M11A 4L3PA 3VHEA 4FKOA 5KKRB 3D7TA 3ZONA 2BRNA 5AFVA 4E3CA 3C9WA 3QWJA 5J1VA 2PUIA 1Z9XA 3DLSA 5I3OA 5A6NA 1JWHA 3QX2A 2ZB1A 1JAMA 4LQMA 3W32A 4I23A 2OH0E 1ZRZA 3PZHA 2Q83A 4BVUA 3EFKA 2JD5A 4KKGA 2OK1A 4P7EA 4X7QA 4AOTA 4QMXA 4C0TA 5TR6A 1XH8A 4JVGA 3EWHA 4FODA 2XS0A 4HJOA 4PMSA 4FC0A 4TXCA 5KMOA 1ZYCA 2Z7SA 4FTCA 2RFNA 3VS5A 3QTRA 3QZFA 4EKKA 3BV3A 5CANA 2Y6OA 3MV5A 5ANEA 1RJBA 3V5JA 1XBAA 2E9OA 3O96A 3PPZA 5I9YA 3OT3A 3FEGA 2PE1A 4EYMA 2QLQA 3LKMA 4LGHA 2JDVA 4IXPA 5M44A 5EKNA 3MJ1A 5GHVA 4O22A 3C4CA 4DHFA 3VBVA 4BWKA 2P55A 2QOOA 3U55A 4WG3A 2PVHA 3ZH8A 3A7GA 4S31A 4WBBB 3U8WA 2VO7A 4FEUA 4P4CA 4R8QA 1Q3WA 4IX5A 2O8YA 2PY3A 2C6MA 3S2PA 1R78A 5J5SA 4E4XA 1UWJA 3KF4A 1ZYLA 2Z8CA 4XBRA 5B0XA 3LMHA 1FGKA 2XBJA 3MA6A 3DOGA 3FLSA 4KD1A 4BICA 4L3LA 5K0XA 4BCPA 4EORA 3L9PA 3POZA 4ZS0A 4IAYA 4RA5A 4UY9A 2WU7A 3AMYA 2W5BA 5E8TA 1B6CB 2RKUA 2WZJA 5BMSA 1ZXEA 4D2VA 2GNLA 5KHXA 4E4NA 3FMEA 2Y7JA 4AWIA 1WBOA 2ZM3A 1ERKA 2GTMA 2VZ6A 3D94A 4GSBA 3P08A 5AEPA 5KMMA 4FIGA 4PPAA 3PWYA 1H24A 3M2WA 2J9MA 5D11A 1KOAA 4BFMA 4C59A 3FSFA 5AA8A 4D5KA 5JQ8A 3GCQA 3FI3A 2YM4A 4EBWA 3F5GA 3FKOA 3E8NA 5CVFA 3V8TA 5L2WA 5LMKC 4Y73A 2VWZA 3RPYA 2WQMA 5I9UA 2OIBA 4OAVB 2FSTX 2W1IA 4I92A 3QD4A 4PRJA 3UOKA 1XH5A 4PV0A 3D2IA 2C3IB 4PTGA 3EYGA 5CF8A 3A7IA 4G34A 1GOLA 2OZOA 3HDMA 4EZ3A 3E3BX 3CPBA 4W4VA 4YO4A 1JQHA 3OG7A 4IVBA 2V0DA 4NFNA 3RKBA 2DQ7X 5F1ZA 3TI1A 4GIHA 4HCUA 2X81A 4F9AA 3LFEA 3WF5A 2QODA 5CQWA 3ZRKA 3ORLA 1X8BA 3MWUA 4YMJA 5CAQA 1DS5A 1KE9A 4HVGA 2XEYA 3LAUA 4RLKA 2OH4A 3DTCA 4FKGA 4EQCA 2A19B 2FUMA 4WD5A 1IA8A 4I93A 4D5HA 2UVYA 2PMIA 4DEHA 5JFVA 1QL6A 2RFDA 4O81A 4PPCA 3NUNA 4FV4A 4G9CA 4RZWA 2JDOA 3BQCA 4I0RA 4X2FA 5E92A 3QZHA 2YCSA 3TCPA 3EL7A 4FBXA 3O7LD 3EN6A 4DCEA 3F2RA 4AT5A 5DT4A 3RAKA 3VIDA 4G5JA 3PP1A 5AR4A 5LMAA 3EH9A 1WBWA 3KMUA 2QURA 2X8DA 2AC3A 4F1OA 2XBAA 3DS6A 3EN5A 3FMHA 4BL1A 2F57A 4J99A 1P14A 1Q99A 4IFCA 3CBLA 2Y0AA 1WFCA 2KTYA 1FOTA 3N4UA 4TYEA 2RF9A 2WQEA 5ITAA 5CU6A 2V5QA 5AADA 3G9NA 4FYNA 4A9RA 4DC2A 4F6SA 4O96A 4AFJA 2ONLA 5A4LA 1YXVA 3FMKA 3ZFMA 5KO1A 3F3VA 3S3IA 4N57A 2B9JA 2B55A 4XRJA 4E20A 3RAWA 2P33A 1KUTA 1JKLA 4HPTE 2WELA 2G2FA 2XCHA 1NXKA 3DGKA 4BCIA 3PZEA 2YM7A 5KMJA 5AIKA 5B7VA 1PW2A 2ITUA 4IAZA 3OOMA 5EM8A 2X2LA 3NAXA 1UU7A 2W9FB 3HP2A 4GS6A 2I0EA 2OSCA 3WZKA 1PKGA 4DGOA 4H1MA 4CZUA 3ODZX 3PFQA 2H8HA 5DBXA 4EHVA 4I5HA 3KC3A 4Y72A 3AOXA 5AAFA 4I0SA 1NA7A 5M55A 5IISA 1A48A 5CNNA 3SRVA 2BMCA 2V7OA 4FZ6A 2QVSE 4GFMA 4R1VA 4XV2A 1NT2A 3PE2A 2C1AA 3KK9A 5IQAA 5KX8A 4G6LA 5BVDA 2GTNA 1O6YA 5DNRA 4DBNA 3QLFA 1W8CA 4FGBA 4FNXA 5BVOA 4O7WA 3F5XA 4GU6A 2QU5A 1ZZLA 5M07A 3DFAA 3F88A 2QNJA 2JAMA 3LXLA 3PDTA 3DY7A 4NCTA 3ZYAA 3IPHA 4RVKA 2B53A 4XEYA 1YI4A 2QCSA 4IQ6A 5HICA 4II5A 4O7RA 3VO3A 4O0WA 3NW7A 4LOOA 4DTKA 3LE6A 2CN5A 1STCE 3V8SA 2XRWA 2ZV9A 4FVRA 5EHOA 4RJ6A 3E5AA 3ORIA 3U6IA 2EB3A 3EZVA 1H0WA 5IQIA 5CZIA 2G1TA 4RMZA 3OEFX 3PXKA 2WIHA 3MW1A 3ZLSA 1OPKA 2Y4IB 4DYMA 3KULB 3C5UA 3QQFA 5AR2A 1T46A 3V5QA 4UZHA 4G3GA 4AOJA 3BU6A 3VJNA 4NM5A 5CF5A 4EEVA 4XG8A 3GGFA 2ZM1A 3ZZWA 1DI9A 3WZJA 3P86A 4KBCA 1GZKA 1UU3A 4TYHB 2E9VA 4FEQA 4GFOA 4IB0A 4AT4A 1YWRA 4AW0A 4NYEA 4MTAA 4G3EA 3W33A 5JFXA 5HGIA 2WTVA 4IANA 2WMRA 3EQRA 3UZTA 2XK9A 5DEWA 4D9UA 1KSWA 4OTDA 2W1CA 4O91A 1IAHA 3BX5A 5JGBA 3A62A 4FGRA 4DLIA 3ZBFA 3LXPA 5AP1A 1XH7A 3O7LB 4BDHA 3VS1A 1Z5MA 3MH1A 4ACGA 4PL5A 5CY3A 3LM0A 2GS2A 3UTOA 2QC6A 2PULA 3RK5A 2VGOA 5HG5A 2X7FA 3PY0A 1K9AA 3SOAA 3D5WA 4TWPA 5H8BA 5CU2A 3REPA 4EK3A 2EXCX 3THBA 4I21A 3FI2A 2UZTA 3BYVA 3HKOA 5HG9A 5HTCA 3MIYA 3QFVA 3K3IA 4U80A 3HP5A 5AMNA 5JRSA 3RWPA 4DEDA 3EKKA 2QOFA 3ZMMA 1AQ1A 3T9IA 1KE6A 4DBXA 5DHJA 4I5MA 4PTEA 3F2NA 2PZRA 3BU5A 4KIPA 4DG2E 4O83A 2WFYA 2B7AA 5CXHA 4GVJA 3C4XA 5F4NA 5L6PA 5LQFA 4WKQA 3OUKA 2C6OA 4F7JA 3N9XA 4A4LA 5BUIA 4XG4A 2FO0A 3EZRA 4ZLOA 4V05A 4APPA 4XHKB 3UYTA 4FEWA 3ZEPA 4BIBA 1JSUA 3GU7A 4JAJA 2PE2A 4X21A 3SD0A 4C57A 2XNMA 5IEYA 2QKRA 2Y6MA 4IZ7A 4EUUA 3ERKA 5IA3A 2QR8A 3E93A 4F9YA 1Q8TA 1YDRE 4I24A 3ROCA 4G1WA 3CGFA 2GS6A 2CKPA 4NM7A 4P90A 3V5WA 1W84A 3HRCA 3T3VA 4CD0A 3RPVA 3TWJA 4N4SA 4PMPA 3QRIA 3OT8A 1PF8A 4F0IA 1R39A 3VS6A 2NO3A 4QMUA 2ITNA 4TWOA 2PU8A 1R3CA 5JK3A 5LOHA 3EFLA 3LXNA 3QQJA 4LGGA 4HYHA 2IWIA 3MDYA 4JQ7A 3DK3A 5H9BA 4EOOA 3A2CA 5CI7A 4DFYA 5BVWA 3NUAA 5L2QA 1LUFA 2EXEA 4K6ZA 4ZXTA 4RC4A 3UPXA 5C8MA 1GJOA 2J7TA 3G6HA 4QOXA 4XOYA 4E6QA 3UOHA 5ICPA 4JAIA 4PDOA 4JLCA 3UBDA 3Q04A 3AMBA 3BKBA 5TKDA 4YUQA 1WBTA 2V22A 4PNKA 3HZTA 2YJSA 1U59A 2HW6A 4M14A 3TUCA 3SQQA 2QOQA 3FJQE 3EQPA 1V1KA 2WGJA 4QQCA 4U9AA 3DNDA 3ZUTA 1CM8A 2VTNA 3IGGA 2BALA 2SRCA 5HVJA 3LHJA 2YCFA 4IEBA 3FC2A 4KKHA 3V5LA 4GL9A 2R3NA 2ZJWA 5BYLA 4QTAA 2W96B 5AR5A 1XR1A 4RIXA 3EN4A 1PJKA 4NUSA 4LGDA 1MQBA 2C4GA 3QCQA 4E5WA 5L4QA 2IJMA 4CFWA 4R5YA 3ZSHA 3HMNA 3KREA 1OL5A 4MWHA 1YHSA 4PF4A 3BYMA 4J1RA 3U6HA 2PVKA 4Z9LA 4IM0A 3ZFYA 5CEMA 1YXSA 4E1ZA 3RHKA 4QQJA 2PMNX 4GKIA 2B52A 2KULA 3A4OX 2OZAB 3R7IA 2VO6A 5CQUA 1BL6A 5JRQA 1CKIA 3BHUA 3HLLA 3NNVA 2CHLA 4JQEA 1WCCA 2YM3A 4RPVA 3TIZA 4DF3A 3QYZA 4WBOA 4IX3A 4YZNA 4BDDA 5A14A 4R7IA 3ZCLA 2X4ZA 5E8UA 3ZO3A 1OKYA 3TV7A 4ANNA 5M51A 1OBDA 4U8ZA 5AP6A 3FXXA 3QTQA 2XK8A 3WE8A 2VTMA 4C4IA 3DBQA 4ZSJA 3PUPA 3FMLA 3D5UA 4FTQA 4U79A 4DG3E 3DDPA 4FYOA 4RGJA 4O0XA 2ONLC 3NUPA 3KXXA 4L43A 2VTSA 5JQ5A 4GCJA 5BMMA 2B9IA 3C13A 4AZWA 2PHKA 5EDRA 2BHEA 3I7CA 4KBKA 4MVFA 1OECA 4IDVA 5BQ0A 3LQ3A 4F63A 4PQNA 3LJ0A 4HVDA 4OAUC 2VU3A 3FLZA 4HGTA 1OL7A 3Q9ZA 2OF2A 4FT5A 5KE0A 4ASEA 4RJ4A 3DAEA 2BZJA 3SXFA 3ETAA 3G9LX 5EHLA 3F3ZA 3BHVA 5IMEA 4LM5A 4D4SA 2FSLX 3P9JA 2JDRA 1FVRA 4QMLA 4PL3A 5EW3A 4CRLA 2CNUA 2C6IA 4E6CA 4J71A 3BWJA 2BROA 3NUSA
chains in the Genus database with same CATH superfamily
1WBPA 4UYNA 3ZS5A 1H07A 3HV4A 4JI9A 3PIXA 4HYIA 4M68A 4NCTC 4ANSA 3R8VA 5HU9A 3R01A 4KRDA 1IAJA 2XMYA 4NU1A 5CI6A 2CMWA 4C4GA 3KXGA 4IZAA 4EHEA 3BL9A 5D1JA 3OS3A 1BX6A 5FD2A 2CKQA 3Q5IA 4FKIA 2F7ZE 3Q5ZA 4CG9A 2WXVA 2YCRA 2OI4X 3BIZA 4IX6A 5EYDA 4ZSGA 4RIYA 1ZOGA 4LOPA 1TKIA 3RPSA 3Q6UA 3LFBA 4GRBA 2O64A 1RQQA 4IBMA 2XJ0A 4QNYA 3R7OA 2CLXA 5A4TA 2YEXA 4KBAA 3SW4A 3DZOA 1B39A 2BDWA 2Y4PA 3RNYA 3E63A 4X2NA 3HDNA 5LWNA 4FV3A 3UYSA 1UVRA 3RI1A 1H00A 3IS5A 4ZZMA 3VS4A 1W0XC 2R5TA 2HZNA 3OMVA 4I3ZA 4LL5A 4OUCA 2PVYA 3WZUA 3UPZA 3R2BA 2GNIA 2WO6A 4OTRA 1G8AA 3TN8A 5D12A 3HRBA 2JKOA 3OXZA 3UC3A 3V3VA 3NW6A 3CTQA 1H8FA 2BTSA 3VONA 3QQHA 5EDPA 4RLLA 4TT7A 5E8ZA 3RNIA 1YOJA 4BB4A 4D2SA 5GNKA 3R7VA 2I0HA 3CCNA 3PG3A 4AN9A 4EOJA 3DK7A 4CVAA 1Q3DA 4WNKA 4F7NA 3AC5A 3CJFA 1CKJA 3WILA 1ATPE 3P4KA 3DJ6A 1OIUA 4BDKA 4IB5A 3TL8A 2J2IB 4L01A 3K3JA 3QRTA 5BVFA 2WEVA 4LMUA 1APME 3W2PA 4RWLA 4YO6A 5KBQA 3R9NA 2BFYA 2X8IA 5AR8A 4BHNA 1VR2A 4U6RA 5HO7A 3UDZA 5GJDA 1MQ4A 2UVXA 3VBQA 1H4LA 2XP2A 3Q4CA 3RPOA 2BKKA 2RG6A 4FSTA 2BZHB 5C9CA 4M7IA 4DTBA 3D14A 1BL7A 4BBEA 1DI8A 2IVUA 4YJVA 3MN3A 4OTHA 4EH4A 4EH6A 2JFLA 4QQTA 5LWMA 4AAAA 5HE3A 4YJPA 2OBJA 1ST0A 3U51A 3L8SA 2I0VA 1PXLA 5DMZA 2XNGA 3AD4A 2X2KA 3CTHA 3UIMA 1UV5A 4M8TA 3CKXA 3PWDA 3GU4A 2JEDA 3Q9WA 4YU2A 4RQVA 3N4VA 4MNEB 4EK4A 3EMGA 1Q61A 4UWBA 3HA6A 3A7HA 3T8OA 4EI4A 3TDWA 2PUUA 4BYIA 5FP5A 4YTIA 4DEEA 4YZCA 3ZM4A 4FKRA 2W99B 3QKKA 5C03A 3RK9A 3S1HA 2PK9A 4AF3A 3DA6A 3VC4A 1Q24A 4FKJA 4V0GA 3SXRA 4A4OA 5CTPA 5DI1A 3JVRA 4LV8A 5E7RA 3ULZA 4JS8A 1FVTA 4FK6A 5J9YA 5ANGA 4DH7A 1UNGA 3V6RA 3VWAA 5BPYA 1YHWA 4CSVA 2R3OA 3U6JA 3LCSA 3WIGA 4QP6A 4ZJIA 5JGAA 5EYKA 5I4NA 2XNNA 5EK7A 4F6WA 2BAJA 2C30A 3G33A 4MWIA 1Q5KA 3DPKA 3UNZA 1VYZA 3MVHA 2C0TA 5K3YA 5EQYA 3TACA 2QO2A 3PJ8A 2R3RA 4C2VA 3FQEA 1YWVA 3TZ7A 3TM0A 5EI8A 4KSPA 4RC3A 4IE9A 4M69B 2CNVA 3VUTA 4EOSA 3OCSA 5GIPE 5F9EA 2FSMX 3AC1A 3VBXA 4EH8A 3ALNA 5AUVA 1WVWA 4MXCA 5IA4A 2BZKB 4HNIA 1GNGA 1BKXA 4I6HA 3TG1A 5CAOA 4O7VA 3D7TB 2ZM4A 4BC6A 4Y46A 5IQBA 3F2AA 3IONA 4LUEA 5L2SA 1URWA 3IO7A 2GS7A 4FL1A 3GC8A 3QRUA 3TV4A 5E1EA 4ITHA 1LR4A 4X0MA 5HZNA 4JBPA 2ZB0A 4O7LA 4FSMA 2EXMA 3I6WA 4JG6A 2X4FA 3TZMA 3V01A 5E8XA 2ETMA 4CFNA 4XNEA 2UW8A 4TKSA 4AN2A 4PWNA 3IGOA 4ORKA 4YP8A 4EHZA 2XIKA 5DYJA 4EBVA 1XH6A 4FK3A 3F7ZA 4BCQA 3PVBA 4DN5A 2ZDUA 4IVAA 4QP9A 3RAIA 1KV2A 4MF0A 2WAJA 4DGGA 3D15A 4BI0A 2A1AB 3EKNA 2IZTA 2VO3A 2W05A 3FY0A 4CYIA 3ORMA 2FB8A 5J8IA 2G2IA 2E9NA 1UNLA 3PVWA 5D41A 2C0OA 3DXPA 2YLFA 3LMGA 3TKIA 2IEWA 3FL5A 3AGMA 4QT1A 3A7JA 3Q60A 4JBVA 3F82A 1OI9A 2CSNA 2YM6A 4QTEA 3PXZA 5J7HA 4Z16A 1Q41A 3MTLA 5ANDA 2VWVA 2XK6A 1KOBA 4YZMA 2YA9A 2QOCA 4DH8A 4LRJA 3ZDUA 5FBNC 4JXFA 3AGLA 2UW0A 4F1MA 4JNWA 5L2TA 3HRFA 3QRKA 5E8YA 5IA0A 4KINA 4UWYA 5KNJA 4W4YA 1Y57A 3CS9A 2I0YA 2W5AA 3CR0A 4M13A 5JGDA 3COHA 4WUNA 2C6EA 3QWKA 2PE0A 2YFXA 4WO5A 4B7TA 2JBOA 2YZAA 3ELJA 5TOZA 2UW6A 3MFRA 1U5RA 4EZ5A 4PDYA 4ZTQA 4M0ZA 1G8SA 1L3RE 2WMBA 1OKWA 3FKLA 3VQUA 3ZO2A 1Q62A 3UQFA 4ZY5A 4CLJA 3H10A 2C68A 4YC8A 4RX7A 5J5TA 3VN9A 2R3JA 5FQDC 2WB8A 4EL9A 4AG8A 5BUEA 4BKYA 2Q0BA 1U54A 2ZV2A 3FSKA 4A06A 3S0OA 3MESA 2PMLX 1V0OA 1XH4A 1VZOA 3LM5A 2O65A 1I44A 4UEUA 2IZUA 3QGYA 4FTKA 2WTKC 3RMFA 1OUYA 2IN6A 4YJNA 3GU5A 4C8BA 3R1YA 1SVHA 2F2CB 3NPCA 4QMWA 2WOUA 3E3PA 2YIRA 5JN2A 5C4LA 2XAOA 1PMUA 2IPXA 2OG8A 4AS0A 3VS7A 2W1DA 2PZIA 1XWSA 2CKOA 3HV3A 3VJOA 1U4DA 4DFNA 1Q4LA 3NNWA 3EQGA 1IA9A 3QTZA 4GUBA 4NKAA 5AV2A 2XANA 3LIJA 4RWIA 5K5XA 5CU3A 3TNIA 3GU6A 5IQCA 4DINA 1Q8YA 3NRMA 3I6UA 4MBJA 3QTIA 4WA9A 4C02A 3ACKA 4BCGA 2PYWA 3QAME 2X9EA 3HAMA 1YXUA 2VTIA 3HAVA 5CSPA 4MQ1A 4Z7GA 3AT4A 3BE9A 2JITA 3R28A 2QHNA 4O1OA 4ZJVA 4AQKA 4IWPA 3ZDIA 2JIVA 3O0GA 4R3PA 1YVJA 4XX9A 3V51A 4O38A 5GZ9A 3R83A 3QZIA 4EZ7A 2ITXA 3R9DA 4BDIA 3Q4UA 3RM7A 3VF9A 3BV2A 4FTIA 1OB3A 2UZVA 2WD1A 2WKMA 3B2WA 2ITPA 4LG4A 3O71A 4XMOA 3RJCA 4AZTA 3NNUA 4WG4A 4G3DA 4YLJA 4BWXA 4H05A 5HOAA 4NM0A 4F0FA 5B2MA 3RGFA 4D4YA 3QX4A 2ZFYA 3V6SA 5IQEA 3KRRA 2C3KA 2QO7A 2QLUA 5CWZA 2PVLA 4GKHA 5L6OA 1SMHA 2HWPA 2J5FA 3P79A 4HGLA 5DIAA 3OF0A 4X3FA 3RM6A 1M14A 5LVMA 4P2KA 3UC4A 4DHZA 4E6DA 3R7GA 5C26A 2G01A 4YHFA 3NW5A 2J6MA 4LUDA 5E8VA 3UDTA 4FNYA 1VJYA 2BDFA 1CSNA 3LXKA 4EH5A 5TO8A 5KBRA 3DBDA 4BTJA 4FSZA 4IX4A 1H01A 4C3PA 5LMBA 4OLIA 2Y8OA 1ZMUA 4AA5A 5HCZA 3SG8A 5EI6A 4X6QC 1OPLA 1DAYA 4XOZA 3FXZA 2I6LA 3ORXA 3GP0A 1YHVA 5IUHA 2C3JA 1O9UA 2HCKA 3ACJA 1PMVA 3LQ5A 4IM2A 3UIUA 4QMYA 3DXQA 4HZSA 3C4EA 2X7OA 3UVRA 2XM8A 3EQBA 3NYVA 5CU0A 1FPUA 1UA2A 3SRVB 2YCQA 4EH7A 3WF6A 3COKA 1BYGA 2WMVA 3TEIA 1Y8GA 1M7NA 2VTQA 3BLHA 2IVTA 4BI1A 3PVUA 1EH4A 3ENHA 3QHRA 2C69A 4Y8DA 3QA0A 3VUIA 4BDJA 1H25A 4NTSA 3UODA 4JX3A 2YIXA 1H0VA 5AM6A 4AFEA 3U9CA 4ZMFA 3PJ3A 4GK2A 2XVDA 3BQRA 4NIFB 3BLQA 4Q9SA 5T68A 5DT0A 3W0RA 3QL8A 2QR7A 3IOPA 4I20A 2ITZA 4D0XA 1Q8WA 4U42A 4UMRA 4CNHA 2W1HA 2XUUA 2ETKA 4CFXA 4BF2A 4RJ3A 3RHXA 3MFSA 4GJ3A 2CJMA 4QQ5A 4R3CA 3TJCA 2UZLA 3SV0A 3ZRLA 4FI1A 2PPQA 3ZLWA 4CV9A 2C6KA 5KHWA 5F20A 5KMKA 2OF4A 3QTWA 2WPAA 2BUJA 4DHJA 3F3TA 4ZTLA 3NMUF 1YRPA 2R3KA 3C50A 3QTXA 4D55A 4L6QA 2VTOA 3F61A 4NZWB 1W2DA 3N51A 3NGAA 4QP3A 4YJSA 3WE4A 4AOIA 3QC4A 3G51A 3UNKA 3W0NA 3W1FA 5HTIA 3FZTA 4IDTA 3PG1A 4WRGA 5C27A 3O8PA 1S9IA 2FH9A 4MH7A 1ZOHA 4HVIA 4ZLZA 2HXQA 1ZYDA 3E64A 3R04A 4YNEA 4YGAA 5J1WA 3MA3A 5GINE 3R2YA 5CVHA 3F6XA 1W98A 5AP2A 4CKIA 3NZ0A 5K9IA 4X2JA 3FMJA 4O4BB 3O8UA 4CFFA 4LI5A 1Q8UA 4MQ2A 3C7QA 3NVKI 3WF7A 5HLNA 3G15A 3R63A 3LJ1A 3VUDA 3UMXA 2OJ9A 1Y6BA 4ONAA 4CFVA 2J0MB 3CGOA 3OY1A 3QUPA 5EM7A 3RTPA 4DTAA 5EI2A 4CCUA 4Q5HA 3MY0A 3FZ1A 4QMMA 1SYKA 4F64A 3V5PA 4G3CA 4DEIA 3CD8A 4QMPA 5T6KA 4CV8A 1LP4A 4P5QA 3UP2A 4EJNA 1AGWA 4UB7A 4H3PA 4Q2AA 1G8JA 4BIDA 3KN5A 4TWNA 2J0LA 3RALA 2VWYA 3Q3BA 2VTHA 4ZJJA 1WBSA 5K0KA 4G3FA 2W1GA 4BCHA 4C4FA 4CFMA 4BCJA 5JMSA 4H39A 2X0PA 5DFPA 1OKVA 3B8RA 4BY9E 2YDIA 4B8MA 4ZY4A 4E5BA 2FGIA 2JIUA 5IEXA 2WMAA 4L68A 4O27B 3MS9A 4USFA 4DDGA 4ZTSA 3IOKA 2XK3A 4DAWA 4EH3A 1M2PA 4QTDA 3TJDA 5CEIA 3PSCA 1PXPA 1XBBA 2OXDA 4G6NA 2W9ZB 3FLNC 5FTOA 5BYZA 2W4KA 5EM5A 2JBPA 4QMSA 1OUKA 3VBTA 5CEPA 4FZDB 5FBOA 4HCTA 1OL6A 4UV0A 5IQGA 3F5UA 3SG9A 3OBGA 3BEAA 5CLPA 3LFCA 2BKZA 2FYSA 3BBWA 5ETIA 4ZZNA 4IAIA 3QHWA 4TTHB 5TE0A 3R7UA 2AUHA 5IEVA 1BI7A 4XUFA 2P2HA 3L8VA 4BCFA 5B2LA 2GQRA 3LLAA 2LGCA 5TF9A 4C62A 2JGZA 4E5AX 3HMOA 3LQ8A 3EQCA 4Z3VA 4D0WA 3GC0A 3KU2A 4FSWA 4YJRA 1RDQE 2IW6A 4O0SA 4W8EA 1KWPA 3MI9A 2GQSA 2VWUA 3WYYA 4E7WA 1BUHA 3ZC5A 1FQ1B 5J9ZA 4BJJB 4JOAA 1FVVA 1W83A 3OXTA 3ZTXA 3H9FA 3I0OA 3QALE 4OTWA 2C5XA 3U87A 3OVVA 4D4VA 5HORA 1ZMVA 2WTDA 4FL3A 4GG5A 1YXXA 3AG9A 3E87A 3P1AA 4IWDA 4BDCA 2AEGA 4L45A 4ACDA 4CMTA 3ZHPC 3HECA 4A7CA 2XEZA 4JR7A 2X0OA 4TYJA 1TQIA 3FI4A 4RFMA 3W2SA 4DG0E 1IEPA 4WSQA 4YBJA 4D2PA 3UIBA 4L44A 4YC6A 5JZNA 4EWQA 4O84A 4ARKA 4BN1A 4PP7A 4Q9ZA 4HCVA 3VS3A 4FV0A 4BGHA 4FV9A 5HCYA 3ZXTA 2R3PA 3ANRA 5HVYA 3WI6A 4RVMA 3CQWA 2QG7A 2ITWA 3DFCB 2XIXA 4TNDA 1OL2A 3CSVA 4TY1A 2XCKA 3L9LA 3MB7A 4QYYA 3PSBA 5EOBA 4D4RA 3F5PA 5IG1A 3GQIA 2NPQA 3AC2A 5J95A 3VF8A 3WIKA 2GNJA 5BUJA 5JFWA 3W0QA 2J4ZA 1WVYA 2R3QA 1P5EA 5CSXA 4FEVA 3IECA 3D83A 3KN6A 3FWQA 5IUGA 2XRUA 1ZLTA 4MBIA 3ZLYA 4MXZA 3KL8A 5B2KA 1XQZA 4JDJA 4A9SA 3BCEA 3GC9A 2W4OA 5H3QA 2J5EA 2ZMDA 1UKHA 4O0YA 4KA3A 4X2KA 3NLBA 3OCGA 4W8DA 4F9BA 2GHLA 4BCOA 3FPQA 3KULA 4UMQA 5CZHA 4KRCA 4O0UA 4JRNA 5IH4A 3NVMB 1JOWB 2XNEA 4CT1A 2UUEA 2XF0A 2PTKA 2WOTA 3O50A 4G5PA 4TN6A 3LCDA 2JKKA 3BU3A 3OOGA 5AUTA 5FTQA 5IKWA 3Q2JA 4KKEA 4X3FC 4JG7A 4ASXA 2JFMA 4HOKA 2FVDA 5FM2A 3I1AA 3EB0A 3R7YA 4C3FA 4JG8A 3UOLA 3G0FA 4MD8E 5CENA 2H6DA 4K2RA 3VBWA 4DGMA 5ETFA 5IA2A 4LL0A 4GT5A 3TIYA 2ITYA 4M15A 3O2MA 2A98A 2BRMA 2C5YA 5EOLA 3BRBA 4N70A 4R6VA 3KF7A 4FSRA 5KKRC 2ERKA 1MRUA 1RW8A 2IVSA 3VUGA 2OLCA 2XIYA 5J9LA 5BV3A 4QP8A 4DFZE 3OP5A 3VS0A 3TKHA 2C1BA 2R7IA 1H28A 3E8EA 2JDTA 3EOCA 3KK8A 4I5PA 3TT0A 5LARA 4C37A 3NCZA 4YJOA 4DDIA 2UW4A 3PJ1A 1FGIA 2P2IA 3L8XA 3RPRA 2QI8A 2YIYA 2Z02A 2GNHA 2O63A 3R73A 3UE4A 1GIHA 1YKRA 2GSFA 3OTVA 4GU9A 3KB7A 2H96A 4FTTA 5HLPA 1U46A 3G6GA 4AW5A 4B6LA 4MXOA 4C58A 1MRYA 1U5QA 2ITVA 4U0IA 5IQFA 3IW7A 3PY1A 3C1XA 2X0QA 3DJ7A 2B1PA 3F7WA 5AUUA 4HNFA 3H0YA 3AKJA 3GENA 4HZRA 3HX4A 3PYYA 4IC8A 3FZSA 4RIYB 2H9VA 4YJQA 5CSHA 3F3UA 1PXMA 1GZNA 2BFXA 2XKCA 3WBLA 2VX0A 5FM3A 3ZO1A 4EKLA 1F5QA 4XLIA 5H8GA 2ERZE 2Z2WA 3ANQA 3UZPA 3MVLA 4TZRA 2H34A 4RG0A 5CF6A 3C4ZA 5K4IA 5IH6A 4A07A 5M06A 4DFBA 2YDKA 2YM5A 5I9ZA 1UU8A 2OJFE 3NUYA 5AP3A 4AN3A 4GIIA 4QTBA 3IDPA 5HI2A 2EU9A 5DOSA 4RJ5A 4Q5EA 5FEQA 5JKGA 3QD2B 3R7EA 5IDNA 1YDTE 3CD3A 5HX6A 2R3IA 3E7OA 4J96A 4NM3A 4QYFA 1OKZA 2OFVA 4IB3A 5JFSA 3I7BA 2VTTA 1LEWA 2C6LA 2W0JA 3FV8A 3PRIA 4F4PA 3NYOA 2NYAA 2DYLA 4LYNA 3EL8A 4TYIA 3VUHA 2LAVA 4FKVA 4IFGA 2EVAA 3HMMA 3T9TA 4ANQA 5EW8A 2CGVA 2PVFA 4XLVA 3QQLA 4YSMA 1PKDA 4V01A 4C33A 4D28A 3R8PA 3MTFA 1OMWA 2BPMA 2XB7A 3G5DA 5DN3A 2PMOX 3UNJA 4BYJA 5HIDA 4C38A 4D2WA 4QDEA 3D9VA 3A61A 4ZSAA 3H4JA 3P7BA 3ENMA 2EB2A 5CNOA 2IVVA 2RIOA 3FBVA 4AE6A 5EG3A 1FBNA 3D5XA 2XH5A 3TUBA 2WHBA 4S30A 4CZYB 4H3QA 3LW0A 4KUJA 4UBAA 4ACHA 3C0IA 3WF9A 4KIKA 3W18A 3QA8A 5AUXA 3C0HA 4A9UA 3QUDA 4UXLA 5AA9A 5M4IA 5GIOE 3HUBA 5HX8A 4DLJA 4QO9A 3AMAA 4ZTHA 3FUPA 1OIQA 1PRYA 2F7EE 1GAGA 2IO6A 4YJUA 3BHYA 4I4FA 3VNTA 4E93A 4EK8A 3BZ3A 4FSQA 3BYSA 4U7ZA 3CXWA 3GEQA 5FDXA 2O0UA 4MCVA 4AZVA 2GNFA 3MY5A 4DEGA 4DH1A 4QMQA 5KUPA 5I0BA 5E4HA 4FTUA 3H9RA 2YABA 3ORNA 3SHEA 1GY3A 5JZJA 4QRCA 4DFUA 4BDAA 2C5OA 3ITZA 4BTFA 3KVXA 2XIRA 2CCHA 5BYYA 2OZAA 1JVPP 2JKQA 3C4FA 2BAKA 2VTPA 4V0GB 4EYJA 5C8NA 4I5CA 3GI3A 1WVXA 3R8LA 3BYUA 4GW8A 3NIEA 3RCDA 4AGDA 4FG8A 4K77A 4F65A 3BLAA 5FUTA 5ETAA 4B4LA 4GT4A 3WZDA 2OICA 3W8LA 5EQPA 2CGXA 4XV3A 3VUMA 4RX5A 4MF1A 4BBFA 4YR8A 3HV6A 4BDEA 3TKUA 4FT7A 1WAKA 5A4EA 5D9HA 3TNWA 2OO8X 5LVLA 3IDBA 4RWKA 5A9UA 4C61A 3UO6A 4BKJA 3AQVA 4NL0A 1H26A 5CEQA 3HNGA 4AGCA 2RSVA 3FC1X 4F9WA 4CRSA 3H30A 3FMMA 2F7XE 4J52A 4ENXA 3PJ2A 3PXYA 1ZY4A 2WIPA 3P23A 3Q53A 1YI6A 1YWNA 1IASA 4O0VA 4U40A 3ET7A 5DPVA 3TNHA 5CXZA 4H3BA 1OBGA 3LFFA 5F95A 3E62A 3MPMA 4L9IA 3MBLA 2VWWA 4O7ZA 4R3RA 1OIYA 2C5VA 2R2PA 4IAFA 1OPJA 4IM3A 3V5TA 3QTSA 3GFWA 4FKUA 2QOIA 5EH0A 4Z7HA 4LV5A 4XBUA 4C36A 2QOKA 4MUQA 4DFLA 3VUKA 1DAWA 1TVOA 4RIWA 5I3RA 5LJJA 2QOHA 2YITA 3KFAA 4FG9A 4MK0A 4XYFA 3DAKA 1MP8A 3QQKA 4EQUA 5HTBA 4O82A 3DTWA 3GCSA 1ZMWA 3BI6A 3FKNA 5EW9A 4U5JA 3EQHA 4NW5A 4YZ9A 2R3GA 1B38A 3PA3A 2QG5A 4TPTA 2RL5A 4USEA 3GT8A 3DBCA 1V0BA 3FHRA 4GYIA 4A4XA 4YC3A 2HENA 4AXFA 3VS2A 1BI8A 3QTUA 4AACA 2GHMA 1M2QA 4FTRA 4ALUA 4WNPA 1FMKA 4X2GA 4D1ZA 3SLSA 4O7TA 2QOBA 1A9UA 2VRXA 3HUCA 4OR5A 1ZYJA 4AZSA 4ZIMA 3ID6C 4QYEA 5L6WL 2PVMA 1PXJA 2X39A 3MPAA 5EDQA 2XNOA 4LFIA 4J95A 4BDGA 3EYHA 3PTGA 1XKKA 3R0TA 2Y4IC 4FV6A 4OBQA 5HE1A 3JR1A 2XK4A 3D2KA 2VN9A 3PP0A 4FKQA 5HBJA 4UMTA 4O7YA 4RWJA 3R30A 3KXMA 2BDJA 4EOLA 5CASA 4OBOA 4QYGA 1H1RA 5IMXA 3BL7A 4BRXA 1SNUA 2YDJA 4Y5HA 1REJA 4N6ZA 4UALA 3R1NA 4GEOA 4R78A 4XP2A 1U54B 3GQLA 4MBLA 4W4XA 5HNBA 3LZBA 3DT1A 4WIHA 3EQDA 2X6DA 1IG1A 5FWKK 1UKIA 2BHHA 3MB6A 3RZBA 4FV2A 4IC7A 4ZSLA 3BYOA 3SXSA 4CEGA 4IMYA 1Y8YA 1ZAOA 4RFYA 5H8EA 3A4PA 4J97A 2BIYA 5K4JA 3SKCA 3OWLA 4BWPA 4L7FA 4GG7A 4FZFB 4GK4A 4M12A 4AE9A 4AW2A 4FKTA 5I9WA 3QYWA 4QYHA 4B8LA 1PXOA 4FIJA 4K0YA 3PA4A 1ZOEA 3KVWA 4FTNA 4RRVA 5DRBA 2ZDTA 3SDJA 4IJPA 1CKPA 3OW3A 4GYGA 4UXQA 4CYJA 4YSJA 3LLTA 3OZ6A 3R22A 5CF4A 1E9HA 2BAQA 1QMZA 3FPMA 3EN7A 3BELA 4YHTA 3VW8A 4E26A 5FXRA 1WBVA 1QPEA 5C1QB 3R8MA 3SAYA 4W4WA 5HIBA 5E9EA 2W06A 2WQNA 5FTGA 4F70A 5AV4A 1RE8A 4JIAA 3LFAA 4F1TA 5M57A 4DH3A 2G2HA 4XS2A 3RCJA 1FINA 5AP4A 1J7LA 3R1SA 4AW1A 1SVEA 3OWJA 5L8KA 2A27A 3GXLA 4I41A 4K33A 3HV5A 4AA0A 3FLYA 3HGKA 1OGUA 5A3XA 1H1SA 5C4KA 5FLFA 4L00A 2XIZA 1XBCA 4IJ9A 4ZP5A 1OL1A 3EIDA 4D1XA 4RFZA 3NFFB 2I1MA 3FXWA 3ATSA 4NT4A 5EYCA 4RZVA 3UZRA 3POOA 3GUBA 1W82A 2WTCA 4LOQA 5HVKA 4AZEA 1K3AA 2VNWA 4J8NA 2AC5A 4EOIA 3SC1A 3FHIA 4LRMA 4O7SA 2YERA 5L2IA 2UZOA 2UZUE 4EH9A 4EOQA 1REKA 4BR3A 4F9CA 4PL4A 5AUWA 1FMOE 1PYXA 2QONA 3OY3A 4GV1A 3UP7A 4S2ZA 4BIEA 2AYPA 4DHIB 4M69A 4FSYA 3MH0A 4DGLC 3KA0A 4YLLA 3OBJA 4CG8A 2YAAA 4S32A 4ZOGA 3IDCA 3VHKA 5HG8A 4L67A 3PRFA 4QP2A 1GIIA 5AIRA 4F7SA 1ST4A 1MRVA 3NCGA 3R00A 3TZ9A 4HGEA 3ZZEA 4B0GA 4ERWA 3NR9A 3PPJA 3NUXA 3GCPA 5J7BA 5BVEA 2BIKB 4HYUA 5J87A 5CSVA 3BWFA 4DFXE 2CN8A 3TTJA 3R9OA 4AZFA 3UG2A 1HCLA 4EWHA 1P2AA 4XRLA 5BNJA 3PY3A 3QU0A 4AGUA 5HD4A 4CKRA 3P0MA 3O17A 4DA5A 2WMXA 5DR6A 3TNQB 5HNIX 3PPKA 5IF1A 3SW7A 4L52A 4MHAA 4AXAA 4R5SA 3W16A 4PX6A 4HVHA 4D2RA 3M42A 4OT5A 4USDA 5LCKA 2YZLA 5M09A 5AX3A 3QRJA 2YWVA 5IZFA 3ZOSA 2C6TA 4TW9A 2WMSA 4C35A 4E6AA 2ZOQA 4ZTRA 1CDKA 3Q6WA 2CDZA 5AV3A 5HBEA 3FQHA 3UGCA 4CKJA 2BVAA 4N0SA 2J0JA 5CS6A 1WZYA 4OTIA 3VULA 3D0EA 4IW0A 1XHAA 2PZPA 3AC3A 3GOKA 4J8MA 5HO6A 4BTMA 3PFYA 2OJJA 5IH5A 1PYEA 3JUHA 3UDSA 4K1BA 3B2TA 3H3CA 3MVJA 3R9HA 3QC9A 2GPHA 1XJDA 2WTIA 3HEGA 3MFUA 3P5KA 3PIYA 2NRUA 4G6OA 4GJ2A 5CVGA 4ASDA 3UQCA 4QP1A 3KCKA 2J50A 1F0QA 3NNXA 2E9UA 5KMIA 5GJGA 3L9MA 3PIZA 3OUNB 1WBNA 2F9GA 5AJQA 4YTFA 4K18A 3ZU7A 2VUWA 3MH3A 3WARA 4RJ7A 1CTPE 2Z60A 3LJ2A 4RX8A 4GMYA 5KZIA 1W2CA 5C8KA 2B0QA 3ZO4A 5CT0A 1PXNA 2C3LA 3NIZA 1YOLA 3JYAA 5AR7A 4TNBA 4BZNA 4O1PA 5HBHA 1TZDA 4JDIA 3PUFC 3Q9YA 4U44A 5E1SA 1PY5A 1YQJA 3EFWA 3U9NA 2HWOA 3I79A 2QHMA 3CC6A 4KIOA 4L46A 3SA0A 5DRDA 1O6LA 4FTOA 1YXTA 1ZYSA 2YIWA 4EUTA 4UX9A 2WU6A 4O2ZA 3WF8A 4PP9A 2XKFA 4YPDA 4ZTNA 3G2FA 3PA5A 2R3LA 5AWMA 5EHYA 4LMNA 4FX3A 1SZMA 2A4LA 4FMQA 3UQGA 4H58A 3NEWA 5A54A 2XNBA 3QUEA 4M66A 4DEAA 4RC2A 1K2PA 3BEGA 1F3MC 2W5HA 2ZV7A 4FT3A 4U3YA 3CTJA 3KRWA 4BZOA 2CPKE