4F99A

Human cdc7 kinase in complex with dbf4 and nucleotide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
354
structure length
312
Chain Sequence
KKDIEKLYEAVPQLSNVFKIEDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRWNEVPDEAYDLLDKLLDLNPASRITAEEALLHPFFKDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division cycle 7-related protein kinase
publication title Crystal structure of human CDC7 kinase in complex with its activator DBF4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 312
sequence length 354
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f99A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f99A01
3QGYA 1MRUA 5ETAA 3RCJA 4D2SA 2GHGA 4W9WA 4CLIA 4FT7A 3MV5A 4NU1A 3VJOA 2RG6A 4A07A 3PLAE 1Q3WA 4AQCA 3BYUA 4AW5A 1Q8TA 2X7FA 1OIYA 2UUEA 2XNNA 5C26A 3KY2A 4XOZA 2C47A 3PP0A 3MA3A 2A19B 4IB0A 3DBDA 4LG4A 4D9UA 4EQUA 4G17A 4EL9A 4UWBA 2W1ZA 3G51A 3FSKA 3CIKA 4G31A 5J79A 2O65A 2VTOA 3A4OX 3WF7A 3LMGA 2WMAA 3GFWA 1OKVA 2BAQA 4AW2A 5GJDA 2R3IA 4I6QA 4G3CA 3RPSA 4TRLA 4FT0A 3WBLA 1BL7A 4JAIA 3C1XA 5ETFA 4D9TA 1FGIA 3LMHA 2VTLA 5IDPA 2WMTA 4JX3A 4KRDA 3O7LD 4ANOA 2XRWA 4IJPA 4KB8A 3NVMB 2B9IA 4RX7A 4QPSA 5E8YA 1WBVA 5CNNA 2QNJA 2IZSA 4PDOA 2BHEA 4YO4A 1CKPA 1RW8A 3LCOA 3OTUA 1XWSA 4A9SA 1XBCA 1AD5A 3GCPA 5AV2A 3ZLXA 4EH3A 4J95A 5HKMA 2R3LA 4OAVB 3DJ6A 3QYWA 3ATTA 4DCAA 1U54A 3KK8A 4JR7A 1V0PA 2XEYA 4M14A 3NIZA 3L9PA 3Q3BA 3O71A 3P79A 2C4GA 3EKKA 2BFXA 4GMYA 1OVEA 4D4VA 2WQOA 5AUXA 4P2KA 4BCQA 2I1MA 4AOIA 2BDWA 5AV3A 4WG5A 4FTTA 3ZUTA 5HG5A 2GNHA 2QR8A 3SDJA 4F7LA 2Z02A 3FI2A 2CMWA 4TWOA 2XIRA 3KMWA 5AR4A 4YNEA 4E4LA 4NM0A 4BL1A 2UW0A 5HO6A 1RQQA 3GC7A 3OHTA 4OTWA 3VRYA 5A14A 5KMOA 5IQAA 3E7OA 5CEPA 4RA5A 3HMOA 2XH5A 4E6AA 2YEXA 5BX0A 5D11A 3IGOA 2GPHA 1H24A 5EH0A 4CSVA 2GTMA 4UYAA 2VO7A 2PMIA 3FQSA 3CC6A 4QP1A 5I9XA 5L3AA 2WGJA 4UALA 4Z16A 5M09A 4C2WA 3D7ZA 5HVJA 4CQEA 2AC5A 1XBBA 5JRSA 3QYZA 5DLSA 2V7AA 1IAHA 5C8NA 1PJKA 3SRVA 5TR6A 2UW4A 3PVUA 5LVOA 3KRXA 4XV3A 2C0IA 4EQMA 3TT0A 5CS6A 4EOPA 5JZJA 4GIHA 4C38A 3DFCB 2CKEA 4H39A 2X39A 1H01A 2AUHA 4MD7E 4O1PA 4DH1A 1PXKA 4FR4A 4II5A 4MK0A 4IZAA 4A06A 1BUHA 5JEBA 3DBEA 3P7BA 4CKJA 3FY2A 3EL7A 4FKSA 3TUCA 2QOLA 4FG8A 4EOMA 4GT3A 3ORLA 5BVFA 5BYZA 2QU5A 4BCIA 3ZOSA 5HZNA 3F2AA 2OICA 3DAJA 3CCNA 3GUBA 4O7SA 3LE6A 3DNDA 5EM5A 2C6KA 3R7VA 3JR1A 3ZO1A 4ACCA 2FSLX 4RJ5A 3E63A 3I5NA 1Y6AA 4U44A 2OSCA 4H3PA 1SVEA 3BHUA 4F65A 4X6RA 1KOBA 1FVVA 3NNUA 4RWKA 5CU6A 3NNXA 2LAVA 3WF9A 1YHSA 2C6LA 2WQEA 3UVQA 4AA0A 5IZFA 2W4KA 3ZXTA 4B6LA 5M08A 1JAMA 2B53A 4O7VA 2RFSA 4C3FA 5DT4A 4C37A 3H9RA 4XEYA 5BPYA 5CASA 3DBCA 3E7VA 4M3QA 4FTOA 2GFSA 2F4JA 4W4WA 4F9YA 3NZ0A 3OWLA 5H2UA 5J95A 3HECA 5F95A 3KB7A 1P5EA 5I4NA 4JT3A 5IUGA 4CRLA 2OFVA 4F7SA 4XV1A 3NAYA 1FPUA 5HX8A 1QPDA 2OIQA 2QLUA 2RFNA 3GCSA 2IW9A 5JK3A 2B9JA 5J8IA 3BYSA 3RCDA 3TKIA 2WAJA 1UNGA 3OCTA 4EH5A 4I94A 3ALNA 4O7ZA 2QO9A 2ETKA 4YPDA 2R3GA 2QHMA 3RI1A 3VS0A 2ETRA 1L3RE 3PIXA 2C30A 1CM8A 3CR0A 5DE2A 3CTJA 4ZSAA 3R8ZA 4FIFA 2B7AA 3ZRLA 3DCVA 1H1QA 2F2UA 3TNWA 4R3PA 4AP7A 3ZC6A 4DGNA 2I0HA 2VO3A 3U9CA 1LP4A 5B0XA 5TOZA 4ID7A 1ZXEA 1T46A 2Z7LA 3POOA 4GU9A 4XRLA 3OG7A 5DPVA 3FLQA 4ANNA 4L00A 3DJ5A 5A3XA 5E8TA 2HCKA 3E87A 3F2NA 3R1QA 4AN2A 1LR4A 4E5AX 3FPMA 3U51A 1J91A 2WEIA 2YIQA 4YC8A 4JLCA 3EFJA 4QTAA 4RFMA 5AAGA 3QLGA 3E88A 3DB8A 3P08A 3RHKA 4NFMA 5DNRA 3R9OA 5E9EA 1WVXA 1PY5A 2R3FA 4PPCA 1PMUA 2UVZA 5AA9A 3VBWA 3FKLA 3L8PA 5CLPA 1ZMUA 3CQEA 5FBNC 3FXZA 2YHVA 3HRCA 3P7AA 3IOPA 3LCDA 5DRDA 4FEXA 5D41A 2OJGA 3CTQA 2BILB 2VTAA 3ALOA 3QD2B 4L8MA 5AJQA 3RNYA 5I3RA 3R7YA 5FLFA 3EIDA 2C5NA 2F2CB 5EW9A 4UMQA 2PUIA 5HIEA 4O6LA 3OXTA 2XK4A 3SOAA 4D2RA 5HLNA 5TT7A 3OZ6A 1S9JA 3Q32A 3A61A 4K18A 4FKQA 4AF3A 5IMXA 4PRJA 4DTBA 4K33A 3QTXA 4IMYA 3BX5A 2F49A 3MJ1A 5AADA 2VX1A 4HOKA 1U54B 2V0DA 3WZKA 3REPA 3I1AA 3QQKA 5BVEA 3ZLWA 3UC4A 3KXXA 4TNDA 1ZOHA 2YAAA 3P7CA 3GQIA 4YNOA 1XQZA 3GU8A 2GHLA 3UPXA 2XZSA 4MHAA 3R7GA 2I0VA 3NNWA 4ANLA 4ZLZA 5M55A 4KS8A 2O3PA 3EJ1A 2WMXA 1OI9A 2JLDA 4YBJA 1DM2A 3UGCA 3CBLA 3DZOA 4DH5A 3EQPA 1JVPP 3GI3A 4EYMA 2YAKA 4QQ5A 4CCBA 4JQ7A 4S34A 4NFNA 4BDKA 5GIOE 2GU8A 2QO2A 4OTIA 4KSPA 2WMWA 5IMEA 2ZB1A 4UN0C 1ZZ2A 3QF9A 1GY3A 3HX4A 3NUYA 2XIYA 2PY3A 3C0GA 2WQBA 5KZIA 4R3CA 3MN3A 5EDRA 3RM6A 3SRVB 3AT3A 3ZU7A 2I40A 3PVGA 5AV4A 1OKYA 4HYHA 3DK7A 5CEMA 1E1VA 2YFXA 4GU6A 1PYEA 3AC4A 4LRJA 2X9EA 4UV0A 1U5RA 3CKXA 3TTJA 2E9UA 3TZ7A 5FEDA 3ACKA 4QMXA 3UIMA 4BBFA 2XIXA 3R04A 5CT0A 2PVFA 3PA4A 4O0SA 3V51A 1G5SA 4BI1A 5FP5A 4EKKA 4U5JA 4L6QA 4KNBA 2R3QA 3ZONA 1WMKA 2W7XA 3DXNA 2JC6A 3FLYA 2R5TA 3FBVA 5CEQA 4TY1A 4KABA 5C8KA 1YDSE 3AT4A 3Q96A 3R02A 1XJDA 2CCHA 5HOAA 4BZOA 3FXWA 1WBTA 2BIYA 4HCVA 3OCGA 2BZIB 2YITA 4FTKA 2VWWA 3HV3A 4KRCA 3L8VA 4CRSA 4D2WA 3GC0A 3GCUA 3IOKA 3LFCA 1NT2A 4QPAA 4WO5A 2VWBA 4Z3VA 3NW5A 4FL1A 2P0CA 4MCVA 2QKWB 4XLIA 5BUEA 5CF5A 2YDJA 5EI2A 3R7EA 3NUXA 4NUSA 2YLFA 4ZZMA 2W9FB 4KBCA 3S4QA 2H6DA 4TYIA 3EQRA 3KKVA 3KVXA 4FTUA 4TT7A 5ANGA 3NEWA 3BEAA 4K1BA 2X8EA 4G1WA 3AC2A 3PZHA 4RJ3A 5CENA 2C6EA 4XNEA 5ETIA 4QMQA 4YR8A 4FZDB 2QLQA 4XX9A 3MY0A 2H96A 4NEUA 3ODZX 4YJNA 5GJGA 2YIWA 2V5QA 5E1SA 2VU3A 4FEQA 4JR3A 4EI4A 5IQIA 3Q9XA 1DI9A 4TWCA 3CY3A 4ZEGA 4IC7A 4RZVA 5HICA 2PULA 4YHTA 4N70A 5C4LA 4QMPA 5FEEA 3CLYA 2ERZE 4AW1A 5EM8A 1PMVA 1ZY5A 4AOJA 4RFYA 4D2PA 1X8BA 4E6DA 2Z7RA 3F5GA 4IX5A 3I6UA 4GUEA 5F94A 4GEOA 1TKIA 3QZHA 5TKDA 4EYJA 3DTWA 4FSMA 5HBHA 3R9HA 4IH8A 4PDPA 4RIOA 4IX4A 2DS1A 4RQKA 4YJQA 4ANSA 2WELA 4FKLA 4ZJJA 3KULA 5KHWA 2VX3A 3AGMA 1Q99A 2PU8A 4NK9A 3V5PA 2W17A 3ZEPA 3LM5A 1XBAA 4WRGA 2QO7A 4I6FA 1KWPA 2OJ9A 4FUYA 3G6GA 4RIXA 2QOFA 3R73A 5A4LA 2J5EA 2VTIA 3R6XA 4L53A 4QQCA 4GK2A 5L6WL 1TQMA 3VF8A 2P2HA 3E5AA 5AP4A 3T3UA 4FNWA 4I0RA 4RX5A 3QD0A 3ZFMA 1F5QA 4QTBA 3V5WA 3F69A 3CKWA 4HZRA 5K4JA 3VC4A 4AA5A 3LJ1A 4MXYA 3CJGA 1YXTA 3IG7A 5EYMA 5HNGA 5IUHA 2QOBA 3ORMA 4IM3A 3R22A 4IIRA 4Z7HA 4HYIA 3SKCA 3SLSA 2YM3A 3R0TA 5K3YA 4QMLA 3SXSA 1H1RA 3FJQE 2Y4IB 3OWPA 4N4SA 3FI8A 1GIHA 3R7IA 5AA8A 3DDPA 4KBAA 3DOGA 4RA4A 1H1PA 2F9GA 3UQFA 1Q8UA 1QPCA 4FSTA 4FTJA 4DAWA 4IZ7A 5LVMA 2AC3A 2BAJA 4OGRA 4H3BA 1Q8YA 3R00A 5FTOA 4DC2A 4JVGA 2F7EE 3UBDA 3ZO4A 4LMNA 3KMMA 2W1HA 3UIBA 5HX6A 3S0OA 1G8SA 2OF4A 5JRQA 3QX4A 4FV1A 3WARA 1EH4A 3ETAA 2P33A 4FSWA 4IWQA 2WB8A 3BZ3A 3CQUA 3O8PA 3QTSA 3FZSA 2BALA 3K5UA 5EYCA 3CE3A 2GS6A 3VHKA 4EHVA 1OIRA 5LQFA 3I7BA 1SVGA 3G0EA 5L8KA 2XCHA 3L8SA 4AN9A 2VWVA 3VJNA 1SMHA 3D0EA 5AM7A 1YXXA 3CGFA 3WI6A 3MPAA 4U42A 4EK4A 3U8WA 4XP0A 5B2KA 3WIKA 4X3FB 4FEUA 1WVWA 3VQUA 2PUUA 3WF5A 4NWMA 5IQFA 2PE2A 2C3KA 2UW3A 4GJ3A 4U41A 3HV4A 2A2AA 3VS2A 1GIJA 2PVJA 3SV0A 1Q8WA 2OBJA 4ALUA 3O17A 2VTNA 4AE6A 3GC8A 2FB8A 3VQHA 1DI8A 1KV2A 1B39A 2OWBA 4I41A 1KE9A 4IB1A 1YXVA 4AGWA 4E6QA 5IA5A 4ZY4A 4CV8A 5C27A 2ONLC 5HG8A 3NRMA 1UNLA 3QQFA 3M1SA 4U3YA 4UZDA 3BEGA 3DGKA 5JN2A 4AWIA 2DQ7X 3FQHA 2F7XE 5KBRA 3TJDA 3DK3A 4MH7A 5GNKA 4F9AA 1HCKA 1GZKA 2FH9A 2GCDA 3C4FA 1CKIA 4G16A 4RSSA 3F88A 2C5YA 2J0IA 1HOWA 2X8DA 3OFMA 4JDIA 4NZWB 3ROCA 4AN3A 3KF7A 2GS7A 3FZPA 4X3FC 4R6VA 3ULIA 3GEQA 1W98A 1OL5A 3IKAA 2OIDA 4JAJA 3UMXA 2QCSA 4PL5A 3LKMA 3V3VA 1JSTA 1U5QA 1NW1A 3EFLA 4C4HA 4BIBA 5BVKA 2C69A 3O50A 2B9HA 3NUSA 2C0TA 5AUWA 2ZV9A 4NM5A 3IONA 3RGFA 3TCPA 5HU9A 4L7SA 2UW6A 2OO8X 1WCCA 2H9VA 1NXKA 2CGXA 2WTDA 4YLKA 2WXVA 4QYHA 3K2LA 4BWXA 4DYMA 2PZYA 3C51A 4CT1A 4BVUA 4L45A 3DLSA 2C3LA 2WTIA 5DMZA 4Z55A 3H0YA 3Q6UA 3KRRA 4BF2A 1ZAOA 3N51A 4JL9A 2QOHA 2PZPA 2XBJA 3WILA 4B8LA 4GL9A 4L52A 4CFFA 3GENA 4Y95A 4M69A 4QTEA 5IEYA 1YHVA 4DGOA 4DE4A 4J7BA 4F6UA 4RGJA 3MJ2A 4CFMA 3LJ0A 3SD0A 2UW5A 4DFYA 3L9MA 3TNQB 4J53A 4X0MA 4IWPA 4ANQA 4RX8A 5IA2A 5HE1A 3VS6A 1WBPA 4HYUA 3UZRA 3PJ3A 4XJ0A 3COKA 4E20A 3RAWA 4A4LA 2RL5A 3WZUA 1PYXA 1W7HA 4FC0A 4AZFA 5K5NA 4QQTA 2R7IA 3KULB 3TKHA 1JLUE 4MXZA 2Y6MA 5AR3A 2R2PA 5K0KA 2PVNA 4RJ8A 2VTTA 4MQ1A 1Y6BA 3GOPA 4GH2A 4XG2A 2XNEA 3VRZA 4BHZA 2HAKA 3VW6A 3Q2JA 4LGDA 3DT1A 2CKOA 5BNJA 3E3BX 3T9IA 5IA1A 5EW3A 3NYXA 3V5QA 2VV9A 3UNKA 2XF0A 4OTHA 2JDOA 3E8DA 5I9ZA 5DHJA 2WIHA 3RAHA 3S95A 1OKWA 3A7FA 4RRVA 5ANIA 4DGMA 3PE1A 3D15A 4QD6A 2B1PA 3WZJA 4V0GA 3C0HA 1IAJA 1H07A 4IB3A 3OTVA 4M66A 5HVYA 3FZTA 4EORA 2HZIA 1MP8A 3LXNA 3AT2A 2CNQA 1M2QA 4MKCA 4YJUA 5CVHA 4HGLA 4F99A 1W82A 4C0TA 4FZAB 3QFVA 2BKZA 5J5TA 2BAKA 1IG1A 3F3ZA 4RWLA 2YM5A 4HVHA 3ACJA 3BKBA 4FTLA 4LQMA 4FEWA 3BGPA 1H08A 4IAAA 4F0IA 1Q61A 1FOTA 5AIKA 3R9NA 3WF8A 4YTFA 3GGFA 1YQJA 5CSPA 3SGCA 1P4FA 1YXUA 4KIPA 4ACMA 5IEXA 4O2PA 1QMZA 3CEKA 4HGTA 3QXPA 4IWOA 3PY1A 1R0EA 3K54A 4FKTA 5HI2A 3DQWA 5CSHA 5T68A 5EM6A 3RAIA 3HUCA 4BKJA 3ZFYA 4GVAA 3LCKA 3OP5A 4YO6A 1GIIA 4Y73A 4BGHA 3R1YA 2YDIA 1CSNA 3EN9A 4DEBA 4ZMEA 2BROA 5FBOA 5HCXA 3R1NA 4CEGA 4ASXA 2JIVA 4L43A 2J0JA 4QO9A 4OBQA 2CKQA 5IQDA 4DFXE 3G5DA 1KE8A 2QONA 2SRCA 4DFLA 3BU5A 2CCIA 4FGBA 2E9PA 1RE8A 1ZMVA 4FK6A 3V5TA 4B99A 2W96B 5AEPA 2WU6A 5EI6A 2C5XA 2R3OA 3E62A 1QPEA 2YWVA 1H8FA 3NS9A 2X1NA 2CDZA 1GJOA 3QRUA 4BDJA 4CKRA 2FGIA 3UIUA 3I60A 1DAWA 4J97A 5CU3A 1YI4A 1BMKA 1FBNA 3ZLSA 4F7JA 4DTAA 2X2KA 3ORPA 1M14A 3C5UA 3LHJA 5AX9A 4A4XA 3R2YA 2OJJA 2C5VA 4BTFA 3P9JA 4W8EA 5ACBC 2WPAA 5BMSA 3LQ3A 3QZIA 2QHNA 4FKOA 3OMVA 4O27B 4X3JA 4F9CA 3VS1A 1Q41A 4BZNA 5M07A 1PKGA 1SM2A 3W2QA 4RZWA 3BQCA 4C59A 4O91A 2VGOA 4FNXA 5BUJA 2ITUA 3CGOA 4W4YA 2UZOA 3EQCA 2WQNA 3FL5A 3HMPA 3UODA 4ALVA 4F63A 5A6OA 4NYEA 1U59A 3H9FA 3LPBA 1HCLA 4XG7A 4EHZA 4J99A 2ITVA 2YZAA 3C4ZA 1ZLTA 3LIJA 1ZOEA 5HBEA 4ERWA 3KGAA 4FSNA 4LRKA 4EH8A 4BCJA 4BCGA 4FOCA 3SQQA 4USEA 2ITWA 2VD5A 2R3NA 3AOXA 3R9DA 4HVDA 3HL7A 4WD5A 5L6PA 2IG7A 1OB3A 2DUVA 2R4BA 3H4JA 5CQWA 2J6MA 3U4UA 4BDEA 4F0GA 5HD4A 1WBWA 4ITJA 4QP6A 4JDJA 2UZNA 4KBKA 3QLFA 4AX8A 3M2WA 3PPKA 3TTIA 4I4EA 5L4QA 2C68A 2ZDTA 4ZLYA 2VZ6A 5LXMA 5HLWA 4O0VA 2QQ7A 3TV4A 4X21A 1TQPA 2YDKA 4IDTA 4WUNA 4QP8A 3UNJA 5A6NA 4O7LA 4YU2A 3E8CA 4M69B 4K8AA 4C2VA 3EQBA 4I0TA 5E8UA 1Y8GA 4FT3A 3T8OA 3HMNA 4TPTA 2JBPA 5D7VA 1KSWA 4O0WA 1BL6A 3DJ7A 3ZC5A 3GU6A 3TUBA 3C4XA 1XKKA 2VTSA 3UO4A 5M57A 4WBBB 4FICA 3VS7A 1JBPE 1L8TA 3PTGA 4O84A 3KXMA 1Z5MA 5CF6A 1YW2A 4IEBA 4CKIA 3KRJA 4E26A 4EWHA 4I22A 1H0WA 1OL6A 4FKGA 2OLCA 3O8TA 2VRXA 1UU3A 5CWZA 2XJ2A 5C03A 4HPUE 3Q4TA 4ASEA 4GKHA 1PXIA 1YKRA 4O0TA 1PXOA 3ZUVA 3AQVA 2XJ0A 4DGLC 4KKGA 5HORA 1OIQA 5FQDC 3U9NA 4BZDA 3JVSA 4H05A 4IB5A 4BICA 4KSQA 3R71A 2BPMA 2JKKA 4W8DA 5F20A 4C36A 3TM0A 2EVAA 1OPKA 1YDRE 3I4BA 2Y9QA 3HDNA 1VYZA 3ORNA 4V0GB 3VUMA 2X9FA 5KMIA 5A4TA 4KKEA 3UIXA 4MF0A 3LCTA 2GDOA 4K6ZA 5EM7A 2YM7A 3FLNC 4AE9A 3II5A 4AFEA 5DA3A 5ETCA 4A9TA 3FYKX 4U7ZA 4GW8A 3VULA 4DEIA 2GHMA 2XIZA 3G2FA 1PXNA 4UB7A 4ARKA 2R64A 4Y83A 4AU8A 5A9UA 5CAPA 4MTAA 2WIPA 3MIYA 3ORIA 5E1EA 5DWRA 3HAVA 2EUFB 4NL0A 3UOJA 3A7GA 1ATPE 2HY81 2XNPA 1W8CA 3Q60A 5CI7A 5DN3A 3G90X 3D94A 1E9HA 3LFBA 4YTIA 3K5VA 1RJBA 2W0JA 2JAVA 2W4OA 3QKKA 4ONAA 5G6VA 3G0FA 5AP2A 4USFA 3QKMA 5H8BA 3MESA 4FG7A 4FKIA 4G6NA 5F1ZA 4GS6A 4BIDA 4ANMA 3V6SA 3F7ZA 2C6TA 3FZ1A 3UP2A 2ZV2A 4GJ2A 3EQFA 4O2ZA 3ELJA 4TL0A 2Y6OA 4AUAA 2VWUA 3QD3A 2X2MA 3DZQA 3F3WA 3R63A 5A4CA 1YRPA 4HVSA 2GSFA 1LUFA 5IH6A 5AUVA 4WOVA 4U9AA 2WMUA 4WIHA 4E3CA 3F7WA 4F64A 4R7BA 4P5QA 3MH2A 3KA0A 4JBQA 5DGZA 5AUYA 3PVBA 4EKLA 4ZS0A 3HLLA 5HIBA 3RMFA 1T45A 4BYIA 4C4IA 5ICPA 4Q5HA 1W83A 4PNKA 5DVRA 4IX3A 1B6CB 3Q2MA 2VUWA 1GNGA 4O81A 2XCKA 1OKZA 1PXPA 3VS5A 2VGPA 5JH6A 4BGGA 4TTHB 3CSVA 5CYIA 4HCTA 4RVTA 4QTCA 4I1ZA 2UZLA 4IFGA 2J7TA 3RP9A 3GCQA 3QTUA 4R1VA 4LUEA 4ZSJA 4TYEA 2OZOA 3AC8A 3RK7A 1PMNA 5GJFA 3CD3A 1R39A 4G3GA 4P90A 2VTHA 2X4ZA 3UPZA 2JIIA 3OY3A 2OFUA 1H1WA 3FL4A 3K3JA 4DG2E 3Q4UA 2IZTA 2QOOA 3LOKA 4M0ZA 3DBQA 4PMTA 5CSXA 1JSUA 3IDBA 2WMQA 2ZM1A 4I3ZA 5DOSA 2G2FA 5J1WA 4ZK5A 4LRMA 3UYTA 4JDKA 3W8QA 4XV2A 3OCBA 5AAFA 3ZZWA 2FO0A 4ORKA 5J9LA 4BIEA 2C0OA 4S30A 5FD2A 3FSFA 2ITZA 3D5UA 3MYGA 2YIYA 3QTRA 4FTNA 4JI9A 2OXYA 4PTEA 3SXRA 3ZXZA 4HPTE 4AZWA 2YIRA 4MXCA 4IFCA 5AP1A 3RZFA 3WF6A 2KULA 3IW8A 4I5CA 2CNUA 2G15A 3RALA 3MI9A 5DR2A 2IW8A 3MVMA 3QTQA 2QOCA 2ZVAA 2CJMA 4KIOA 3HEGA 4YTHA 3ZSIA 5B2LA 3KXNA 5E90A 1MUOA 3QHWA 4GYIA 3RPOA 3THBA 3ZH8A 5LCKA 4FNZA 4NTSA 3JS2A 1UKIA 3IW7A 3NSZA 1JQHA 2XNBA 2ZV8A 3IW6A 3C50A 3D14A 2YJSA 4E7WA 4RFZA 4NH1A 4FV3A 4EOJA 2BZKB 3KN5A 4FF8A 2JDVA 1MRYA 3AMAA 4FTRA 4RIYA 4ZLOA 3D5WA 4FSYA 4LGHA 4KA3A 4IACA 2XA4A 4E8AA 1K3AA 3DFAA 4F9BA 5JFVA 4ANBA 3QRTA 4TXCA 1M17A 2RIOA 4ZMFA 4O0RA 3VO3A 1B38A 5A4EA 4C34A 3L9NA 1PF8A 1CKJA 1Q3DA 4FT5A 3GU4A 3LFFA 3SC1A 3MH1A 4EWQA 3PXQA 2BRMA 2J90A 4Y8DA 3S2PA 4O83A 4HW7A 3ZCLA 2FYSA 3PA5A 5GZ9A 1NVQA 2VO0A 1JKLA 2C6MA 4FKPA 4X2FA 4DG3E 5I3OA 5IISA 4O82A 5ANEA 2JDSA 1J1CA 3LVPA 2ONLA 4FKJA 3BHVA 2OZAA 5M06A 3I7CA 3O7LB 4HZSA 2H34A 2RFEA 3UDBA 5L2IA 2PMOX 5J87A 3UZTA 3FDNA 3R8VA 4D0WA 2QG5A 3D83A 3NNVA 1XH6A 5ANKA 4U0IA 3CJFA 4CYJA 4JJRA 2HYYA 1UU7A 3RHXA 1V1KA 4X3FA 2IZRA 2J9MA 4FNYA 4KAOA 4NW5A 3ZS5A 4DHFA 4F1MA 3LFEA 3SVVA 4IM2A 4YC6A 5FDXA 4JBVA 3PY0A 5AUZA 4C35A 2HZNA 5DT3A 4D1ZA 3DU8A 4G3FA 4L7FA 3FMNA 3BV2A 4PQNA 3DXPA 3R8MA 5IG1A 4HCUA 3EL8A 2OI4X 3R01A 3H30A 3RNIA 4XHKB 2OJFE 4MF1A 5C9CA 2W1IA 1ZMWA 4EK5A 3W16A 2UW8A 1Y8YA 3OW4A 2UZUE 3OT3A 5LVLA 3FHRA 5A54A 2CNVA 4C3RA 5CAUA 1R78A 3PG1A 5HO8A 5L2SA 1UWHA 2FA2A 3HMMA 4FV2A 4RVKA 3IQ7A 2W1FA 3W32A 1H1SA 3OW3A 3QQHA 3QUPA 3HZTA 3V5JA 4F6WA 3QALE 3VUHA 5HTCA 3HUBA 4JXFA 1R0PA 3ZFXA 3F61A 4AOTA 2GQSA 3FV8A 4N6ZA 2BVAA 4TWNA 2YCRA 4IE9A 4IQ6A 4U81A 1GZNA 2C6OA 4TN6A 3DTCA 4BR3A 3GT8A 2R9SA 3A7HA 1FGKA 3C9WA 1BX6A 2CGVA 3EKNA 4CMUA 2RSVA 4XG3A 5AFVA 5JFSA 4L9IA 4MXAA 1H26A 4RJ7A 5JSMA 5EKNA 3MB7A 4I0SA 2YCSA 5CT7A 4C4GA 3O2MA 2EB3A 4FSZA 3Q9YA 3W1FA 1G3NA 4BDBA 5GZ8A 3AD4A 2J4ZA 4QYGA 2R7BA 4RLLA 5HE2A 4E4NA 3U6HA 3TWJA 4QMZA 2PVRA 3SX9A 4LV5A 1BKXA 2OU7A 4FL2A 4FIJA 4NT4A 3PA3A 1ZY4A 2ZYBA 3S00A 3CPBA 2FVDA 4C62A 5KMLA 3P78A 4BRXA 5ANJA 4U80A 4BCMA 3UP7A 2JIUA 2IJMA 3BE2A 4L46A 4EOSA 4BTJA 4HYSA 4C02A 4CMOA 3W18A 2OIBA 3V5LA 2YJRA 4H1MA 2UW7A 4D2TA 3QC9A 4O86A 4FVRA 4D28A 2JFLA 3C13A 3KRLA 3W2PA 3ATSA 5E4HA 3ORZA 2WFYA 3EQHA 3QA8A 3EQDA 5AUTA 4FIHA 4XOYA 2ITNA 3GXLA 5EI8A 4M12A 5C8MA 4DGGA 4EOQA 3C5IA 3DXQA 5CEIA 5J7BA 5KCVA 4BTKA 3VVHA 2RF9A 3GCVA 1UV5A 2QOKA 5H3QA 3ZLYA 5LMKA 3ODYX 4B0GA 5GHVA 4W4XA 3TN8A 3VUKA 4AA4A 4DN5A 4IVCA 5EYKA 4TYHB 4YJRA 2NRUA 5BVOA 4DITA 1E1XA 4FI1A 3KMUA 4RWIA 4C4JA 5FM3A 3G9LX 3Q6WA 3R1SA 3DKCA 5F4NA 4GT4A 3EN5A 4E93A 3Q5IA 2E2BA 4CZUA 4BBMA 4CTBA 4YZDA 4KD1A 4AAAA 3E64A 4RIYB 4FIGA 3NCZA 4WRSA 5HIDA 1YWRA 4EH6A 3OT8A 4WT6A 3E92A 4C7TA 4M0YA 2ITXA 2X0GA 4ZSEA 2CHLA 5TF9A 1Y91A 3EZVA 2VTJA 2WTVA 3VBQA 4FL3A 4FG9A 4U6RA 3FEGA 2Q0NA 4EH4A 1J7IA 2BHHA 2KTYA 3CP9A 3PZEA 2WQMA 4J1RA 4ZP5A 4GUBA 1M2RA 3IGGA 3WE8A 2BRHA 2X7OA 5K9IA 5ANOA 5ACKA 4FTMA 5CU2A 4Y46A 2GQRA 3IECA 3VIDA 3FMHA 5DFPA 4RC3A 4X2JA 3W2OA 3FXXA 2W5HA 4LUDA 4FVQA 2EWAA 4APPA 1K9AA 4DINA 1ZYSA 1OL1A 2OZAB 2XKCA 4NKAA 5AWMA 5E91A 1GZOA 5IA0A 5D9HA 2QC6A 3BWFA 4XG4A 4EEVA 4D1SA 3E3PA 1ERKA 1CDKA 4IAIA 4UX9A 2HWOA 1AGWA 4FV5A 4QYFA 4D58A 2XK3A 3RJCA 1J7LA 3NGAA 3QTIA 1FMKA 4UWCA 5FDPA 4WNKA 2F7ZE 4M84A 5BQ0A 4JIKA 1J3HA 5CNOA 4FT9A 2Z8CA 1JOWB 2R0IA 4X6QC 4KIKB 3FAAA 3SG9A 2VNWA 3FWQA 3KXHA 2GMXA 5FGKA 3Q52A 4EZ3A 5BYYA 2W1EA 2RKUA 5GIPE 1TVOA 1IA8A 4FA2A 4ASDA 4IANA 1Z9XA 3KK9A 2WKMA 5CF8A 4O38A 2ZM4A 3BYMA 3H0ZA 4J98A 5CTPA 3HNGA 3UQGA 3WZDA 5J7HA 3RVGA 4O7TA 4P4CA 1URWA 3ZHPC 4I24A 3QXOA 4PX6A 3K3IA 5LVNA 4IX6A 3FLSA 5T6KA 3FMMA 4CNHA 2QVSE 4BI0A 4MYGA 5HCZA 4EONA 3KF4A 3PJ1A 3DB6A 2R3RA 3BWJA 5T3QA 1XR1A 4GYGA 3UOHA 2ITTA 4JDHA 2XKEA 2QG7A 4QYEA 3TNIA 2FUMA 3QTZA 1VEBA 4TYJA 2EXCX 4G34A 2EB2A 3D2KA 3BRBA 3EB0A 3IO7A 3ZO3A 4DBXA 1WBOA 3PJ2A 3ZMMA 4DA5A 3FMEA 4OTFA 2YM8A 4AACA 2BTSA 1M7NA 4RVLA 4NSTA 2EU9A 5EKOA 4XH6A 4S31A 4RVMA 5I0BA 2Y0AA 3GB2A 3GQLA 4FSUA 1YOMA 4MVFA 3PIYA 5JMSA 2W99B 3DK6A 3BQRA 3VHEA 2Z60A 3UOLA 4QMNA 2H8HA 5KMMA 4ZZOA 2J51A 1PXMA 4GCJA 2G9XA 1A06A 4NW6A 5I9YA 3DKFA 1YWVA 4BCHA 4AT3A 4F08A 4QP7A 3I0QA 3OY1A 4BWPA 4BI2A 3F5XA 4K0YA 5AX3A 2YABA 2OF2A 3BGZA 3A7IA 3QD4A 4YSMA 4FOBA 1RDQE 4PWNA 4E1ZA 5FG8A 1LEZA 5EHOA 4DEDA 3DY7A 4ENXA 3ZBFA 2ZB0A 2PMNX 2BRNA 4Y5HA 4G3DA 2HK5A 1PXLA 2W5BA 4BDGA 4EH9A 3C0IA 4EZ7A 5CANA 3QGWA 4MXOA 1V0BA 2Z7SA 1P2AA 2UZBA 5M56A 3GU5A 4AXAA 4IJ9A 1AQ1A 4MBIA 2ZMDA 2IVVA 3R7UA 4ACHA 1DS5A 4HGEA 4ZJVA 2PPQA 2PZRA 3PFQA 1TQIA 3B8QA 1IEPA 5CZIA 2P55A 4G3EA 2JKOA 2WU7A 4KKHA 4FV7A 3NLBA 5F9EA 2A1AB 1KOAA 3H9OA 4IWDA 4O0XA 3V01A 4DG0E 4CLJA 3MTLA 5DR9A 1S9IA 4G5PA 4UXQA 4PP7A 1Q4LA 4UZHA 4CG9A 4OR5A 2HY0A 3NUPA 4RT7A 3EOCA 3QX2A 2PL0A 2XM9A 3RWPA 4ASZA 5KHXA 1OBGA 4I92A 1O6KA 2YM4A 2IN6A 3NR9A 4L42A 3ZYAA 2PUNA 4F1OA 2W4JA 3F2RA 1F3MC 2Q0BA 1YOJA 2JDRA 3HGKA 5DR6A 4EK8A 2HWPA 2IZUA 2BUJA 2J5FA 3KXZA 4WSYA 4BCOA 5E7RA 4CFUA 2C6IA 2O63A 3QUDA 1WAKA 3QA0A 3MPMA 5EQEA 3ZRKA 3W2SA 2XNOA 4BY9E 1FVRA 5EW8A 4M8TA 5HO7A 2IPXA 4S2ZA 4GK3A 2XB7A 2PWLA 4U3ZA 4BWKA 5LMKC 3DPKA 2J2IB 4I5MA 5E8XA 1J7UA 2RFDA 2JBOA 5LOHA 2UZDA 5JZNA 1Q8ZA 2XM8A 4PPAA 4XG6A 2WHBA 3Q04A 4IDVA 4BFMA 3I6WA 4EHGA 3DDQA 1YDTE 1WVYA 2ZDUA 3C7QA 5C1QB 3DAEA 3TZ9A 1PMEA 3Q9WA 3PXZA 3HV6A 2R3KA 1NA7A 2YA9A 3NYOA 5IU2A 5HQ0A 3ET7A 3MWUA 4WNMA 3MSSA 4EBWA 5J5SA 2B55A 3TEIA 4GVJA 4IZYA 3B8RA 2OGVA 4J96A 5CAQA 1GZ8A 3MA6A 3A7JA 3DBFA 2QD9A 3PWYA 3PJ8A 3VNTA 4EC9A 3PE2A 4L67A 3ZSGA 3BIZA 5L2WA 5IH5A 1U4DA 2UVYA 3Q4ZA 4IZ5A 4F0FA 3TIYA 3C4EA 2YISA 2YWPA 2YM6A 1Q97A 3LFSA 3KRWA 3N9XA 4U40A 3W33A 4CXAA 2W05A 2CSNA 4C4EA 3LLTA 1FQ1B 2ZM3A 5DT0A 5HLPA 2R3PA 4J8NA 5I5ZA 1URCA 4CYIA 4DTKA 5FXRA 1JSVA 3NCGA 4YP8A 4C33A 3RPYA 4NTTA 3VUTA 2XK9A 2XBAA 5EG3A 3U4WA 2BFYA 1OM1A 2IVSA 2VTRA 4GFMA 4LL5A 3DAKA 5CXZA 3FLWA 1SZMA 5HE3A 2HOGA 3NIEA 3FI4A 4JG7A 4ZAUA 4BKYA 5AR8A 4M67A 4R7IA 4U97A 3RK9A 4AZTA 3UVPA 4GK4A 4XYFA 4R3RA 1Q62A 3A8XA 4KIQA 1XH4A 4ZZNA 2YCQA 5AMNA 1BI8A 3NUNA 3PWDA 3VF9A 3U6JA 3QC4A 2WTCA 3UO6A 5C01A 4BYJA 3FC1X 3ROYA 2CPKE 4A7CA 2AYPA 4CFWA 3AD5A 2IO6A 1NVRA 5AM6A 3PSDA 4JG8A 4NM7A 3BHYA 2OH4A 3MB6A 3ULZA 4EBVA 4YTCA 5JQ8A 3TDWA 3RPVA 2PTKA 2PVMA 3O8UA 3LXLA 3ZBXA 4DEAA 4MD9E 5I9WA 3LFDA 4CZTA 4O96A 4EJNA 4PTGA 3NYNA 4EOLA 4I6BA 3BV3A 3D2IA 5HG9A 2BR1A 3ZEWA 2W1GA 5J1VA 3I79A 4YJTA 4LYNA 4PY1A 5CEKA 3TDVA 3PIZA 5DBXA 4B8MA 2W1DA 4K2RA 4OTPA 2BIKB 4D5KA 4RPVA 3OOMA 3BBWA 4RG0A 4UMPA 1LEWA 2XP2A 2PVKA 4AT4A 3MVHA 2GFCA 3D4QA 4TYGA 4JG6A 1SNXA 2JEDA 3GC9A 4QRCA 4DEGA 2B52A 1SVHA 4J8MA 2E9NA 5AP5A 3KC3A 3V04A 4JBOA 3JPVA 3D5VA 1ZYCA 4OAUC 1V0OA 2YZLA 4R8QA 5KNJA 2NRYA 3ITZA 3PXKA 1YI3A 4W9XA 4QP2A 3G15A 5IQGA 3DQXA 4CT2A 1XHAA 3GU7A 2FSOX 2ITQA 4AT5A 4M13A 4EK3A 5HESA 4ZS4A 5DIAA 2IW6A 1OL2A 5FXSA 5AR5A 4RWJA 4PV0A 3S1HA 4O21A 2QODA 5FP6A 4U79A 5CXHA 3PXRA 2V62A 3LZBA 4YUQA 3LQ8A 4ZTHA 3EH9A 5HG7A 4QMWA 3D7TA 3MW1A 4FGRA 4YLJA 2DWBA 3AMYA 4WA9A 4Y72A 4WKQA 4YJOA 4WG4A 3OVVA 2OG8A 5CZHA 4FTAA 3FYJX 4L68A 3UJGA 4DFNA 3KVWA 5K4IA 4Z9LA 4PDYA 3ENMA 4YMJA 4JIAA 1IA9A 1YHWA 3ORXA 5HNBA 2NO3A 4LOOA 1UA2A 4PMSA 5IF1A 4EQCA 3MDYA 1IASA 3GFEA 4KS7A 2O64A 3NX8A 2VX0A 4K11A 3KREA 4L3JA 4ZTNA 3P23A 3TZ8A 2G01A 1UU9A 2OXXA 4ZTSA 3UZPA 5AUUA 3ZSHA 4DFZE 4LMUA 4S32A 3V6RA 2GS2A 1WFCA 3MH3A 4WNOA 1ZWSA 3SOCA 2JDTA 4Z7GA 3N4TA 4N57A 3QQJA 4ENYA 5KUPA 3C4WA 2NNWB 4RC4A 3BYOA 4X7QA 2EXEA 2RGPA 2XK7A 2Y4PA 4DT8A 3KCFA 2JGZA 3BHTA 1OECA 1O6LA 3FQEA 3TJCA 4G5JA 4BCKA 5CU0A 3AXWA 3M11A 3E8EA 5KKRB 3OBJA 4I93A 3VW8A 3MFSA 4YZ9A 1H27A 4FIEA 5FEQA 5M44A 4R77A 4E73A 2HW6A 4MBJA 4QMTA 5IQBA 5HCYA 3SXFA 3WYXA 3AC5A 2YLEA 2V55A 4OTDA 1ZRZA 2VWIA 2WZJA 3P86A 4FYOA 4I6HA 4KINA 2A4LA 2ZJWA 3TG1A 4NCTA 1JPAA 5AAEA 1Q5KA 4BCNA 3PDTA 3QZGA 1OPLA 5IUIA 4FZ7A 2V7OA 3ZTXA 2VTMA 4HJOA 4CG8A 4PUZA 5I9VA 3BCEA 3RBWA 1K2PA 1REKA 1J1BA 2LGCA 4IW0A 3FKOA 2ZOQA 4PPBA 4PL3A 5EYDA 3TXOA 3UOKA 5KKRC 4FEVA 3MFRA 1KE7A 1PRYA 2X7GA 4FKVA 3BLRA 4D4RA 4Q9ZA 3TL8A 4EUTA 4JQ8A 3DS6A 5IQHA 3IW5A 5E8SA 3EWHA 2VO6A 3JYAA 3HRFA 2VAGA 2CGUA 4MEDA 1XH9A 3FI3A 5CVFA 3MIAA 5JFWA 3HRBA 4OLIA 5L8LA 5EK7A 4HGSA 2UVXA 3CPCA 3TKUA 4XUFA 4D4SA 4D1XA 4ZY5A 1R1WA 5GINE 4CFNA 2E9OA 4NJDA 4YURA 4XG9A 3MTFA 2YCFA 4YJPA 1OPJA 4RJ6A 3R21A 4ITIA 3KU2A 1NY3A 4YGAA 5TE0A 4D4YA 4BCPA 2W5AA 4FZFB 4NIFA 4F09A 3QCYA 4UBAA 4XRJA 3BLHA 4FV6A 3W2RA 4ITHA 3R8LA 4E5BA 2REIA 5CAOA 4GFOA 3QCSA 2CN5A 3G9NA 1STCE 1GOLA 4Q2AA 4OTQA 2VWYA 3WOWA 3H10A 2WOUA 3KQ7A 3UG1A 4E5WA 2XNMA 3UTOA 2XMYA 2QURA 3P0MA 5BUIA 5M4UA 1CTPE 4BGQA 1BYGA 4FBXA 4X2KA 4DEHA 3LMIA 4ZSGA 4LFIA 2G2HA 3HMIA 3OS3A 2PYWA 4JOAA 2EXMA 4PL4A 4J71A 5CVGA 1YXSA 2Z2WA 3MY5A 4BDCA 1WBNA 2WMRA 5HNIX 3TACA 4B4LA 1OL7A 4G9RA 2VNYA 2XK8A 3SA0A 4QYYA 2ZV7A 3FLZA 5DEYA 4FKWA 1APME 4YHFA 3UYSA 1LPUA 4FSQA 4TKSA 1UU8A 5LWNA 4BDAA 3HA6A 4JS8A 5DEWA 3UMWA 1Y57A 3EN6A 4TYHA 4YC3A 2E9VA 5HHWA 1OUYA 4LOQA 3VBXA 3W55A 1YWNA 4FODA 2HXQA 4G2FA 3QQGA 4GRBA 4I20A 5E92A 3OD6X 2JD5A 2X8IA 4PDSA 1H28A 2NPQA 5AV1A 3R2BA 5LMAA 2WO6A 1JWHA 2PUPA 2WEVA 5DI1A 1REJA 1ZARA 1UWJA 4AW0A 3NVKI 4IVAA 3F5UA 3BLQA 4XS2A 4A9YA 2QR7A 4F7NA 1NVSA 5CX9A 4C58A 4CFVA 3EZRA 5JKGA 1MQBA 5EFQA 3ANRA 3QQUA 3D7TB 1YI6A 3FY0A 3VS3A 2I7QA 3EN7A 3VUIA 4CD0A 2OKRA 3UVRA 1UVRA 2R3JA 4G6OA 4GG7A 4OBPA 2XVDA 1UKHA 3QRIA 4RBLA 4OUCA 4F1TA 5FTQA 2YACA 3BU6A 3OWKA 2PVLA 4E4MA 2W1CA 4QP9A 3A4PA 4QOXA 5FRIA 5D12A 3W10A 3CY2A 3HYHA 4W4VA 5IA3A 2HZ4A 4R1YA 4AS0A 5M51A 3NPCA 4PMMA 4C8BA 3IW4A 4MBLA 3W8LA 2GNJA 4V04A 4ACGA 3F66A 4Y85A 3VS4A 5LMBA 3CTHA 3CS9A 1OMWA 3LFAA 1UNHA 4L44A 5I9UA 5IEVA 2C1AA 3GOKA 2HENA 4O7YA 3MY1A 1M7QA 3NDMA 4ZTMA 3VUGA 3SW7A 3JUHA 4QP4A 4EH2A 4FUXA 4PNIA 3KFAA 4BHNA 4UMUA 5IH4A 3A8WA 5JGBA 4DF3A 3EN4A 4R7HA 1I09A 1ZYDA 2UZWE 4IADA 1Q24A 3IS5A 1JNKA 2J0MB 4IAFA 3MFTA 3QHRA 4WG3A 3I0OA 4YZNA 4YZCA 4KIKA 2GQGA 2ITYA 5B7VA 2WTWA 4QQJA 4YJSA 5LWMA 4XBRA 4I5HA 4C57A 5L2TA 5A46A 5A4QA 4FKUA 3HDMA 4LV8A 5JGDA 4FKRA 4FYNA 1YOLA 4Y5QA 2QU6A 3PPZA 2IVUA 5EQYA 2R3HA 1XH8A 5E8ZA 4RJ4A 4MWIA 5D10A 3ANQA 1M2PA 1Z57A 2CLQA 1MQ4A 1XO2B 2I0EA 3DA6A 2HXLA 3LAUA 4QMSA 4A9UA 3ZM9A 2C3IB 4CGAA 2J50A 1P4OA 3EQGA 4I23A 3BPRA 5L8JA 3ORKA 1XH5A 3OBGA 4C3PA 4M7IA 4RIWA 4MWHA 5E8WA 5KE0A 3JY9A 4BDFA 3S3IA 4QNAA 4XCUA 1KUTA 3QKLA 4LGGA 3Q4CA 5FTGA 4NM3A 2PHKA 4RX9A 4GV1A 4DEEA 1H0VA 2WMBA 4DH7A 2PZIA 4H58A 1KV1A 2VTPA 4LL0A 5CEOA 2OK1A 3R8UA 3UC3A 4NCTC 3PVWA 4DCEA 4DH8A 4YLLA 3B2TA 3EHAA 4ACDA 3I5ZA 4G6LA 3PLSA 3AG9A 3T9TA 4F4PA 4GSBA 3GNIB 4EOIA 5DH3A 3COIA 4IBMA 1W84A 3QRKA 4NIFB 2WMSA 4KWPA 2WNTA 3LM0A 1WBSA 3SAYA 4YSJA 5AP7A 2DYLA 2O8YA 3F82A 3UG2A 4EJ7A 2C6DA 3PY3A 5AP0A 2HIWA 3L9LA 2IWIA 4F70A 5HVKA 3UNZA 2WMVA 2Z7QA 3ZDIA 4JNWA 4UWYA 3EFKA 5IDNA 4BBEA 3OROA 2A0CX 1ZYLA 2UV2A 5K0XA 1A9UA 4QPMA 4S33A 4I4FA 4U8ZA 2WD1A 3EQIA 4XP3A 2BZHB 3UQCA 1VYWA 2QI8A 5EHYA 4FIIA 3VBYA 4RC2A 1H00A 2JITA 2PK9A 3RKBA 3DKGA 4UMRA 3D5XA 4R5YA 2ZAZA 4ZSLA 4AZVA 2XYNA 3FC2A 5KX8A 2Q83A 4V01A 3B2WA 3BELA 1CMKE 4WSQA 3OXIA 4QMMA 3GP0A 2A27A 2CGWA 2VTQA 3QCQA 4TWPA 2JFMA 2X6EA 4MAOA 3FPQA 4AGUA 3UE4A 1O9UA 3ERKA 4C61A 1H25A 3EFWA 5EDQA 2BKKA 2QOIA 3KEXA 5IQEA 3NWWA 5LJJA 3NYVA 3HV5A 4FV8A 3OEZA 4MQ2A 3V8TA 2CLXA 4BCFA 4DLJA 4JQEA 2XEZA 3U55A 2FSMX 5BVNA 2JKMA 3R28A 4Q5EA 5HE0A 1KE6A 1OUKA 3COMA 5AR2A 3EYGA 4XBUA 3KL8A 4E4XA 4X2GA 5M4IA 3D9VA 3ID6C 2B4SB 4GIIA 2VN9A 5D7AA 5HD7A 1FINA 3N4UA 5E8VA 4DFBA 4EK6A 4FMQA 3NW7A 4CTCA 3AD6A 5AP6A 3RAKA 3PYYA 2R3MA 3TI1A 1VJYA 2PE1A 4M15A 3GVUA 4FTCA 3COHA 4GT5A 5L2QA 5CU4A 5BYLA 2O2UA 4BN1A 3BU3A 3FUPA 1OIUA 1JKSA 3PG3A 4H36A 1ZOGA 3QUEA 3MVLA 2ITPA 5K5XA 2C1BA 3Q5ZA 5EOLA 5IQCA 3GBZA 3KXGA 4IHPA 5CF4A 3R8PA 3A2CA 5CSVA 4WBOA 1GAGA 3PRIA 3TNPC 5ANDA 4O7RA 3ENHA 3QBNA 4USDA 2GNFA 4AFJA 3R9RA 4A4OA 4IAKA 4CV9A 2Y8OA 5EQPA 5FM2A 4UY9A 3PXFA 3TNHA 4O7NA 2UZTA 2HW7A 4UYNA 5EDPA 1M52A 2WTKB 3QTWA 4DH3A 1OZ1A 4O7WA 2X81A 4BC6A 5H8GA 4QT1A 4RMZA 2OH0E 4WHZA 1P14A 4I21A 4HVGA 2XUUA 3F5PA 3FZOA 2UZEA 3CQWA 3QAME 5KO1A 2CN8A 4P5ZA 4YZMA 4LOPA 3JXWA 3VBVA 1XH7A 3IK3A 4HNIA 5GZAA 1F0QA 3BE9A 3TV7A 4U43A 3Q9ZA 5HBJA 2BTRA 4MXXA 3IDCA 4MD8E 4C4FA 2XRUA 3UO5A 4QTDA 2Y4IC 4XV9A 5L6OA 3NW6A 4YBKA 4FE2A 4ZTQA 5BVDA 3BGQA 3ZM4A 3FMKA 3VN9A 4D0XA 2I6LA 5JGAA 3OXZA 5J9ZA 2IVTA 2B0QA 4RIWB 2WTKC 3RPRA 3RZBA 3MH0A 5M4FA 3T3VA 4GG5A 2UW9A 3QWJA 4IM0A 5AR7A 4EUUA 4ZIMA 3BI6A 3HAMA 4D5HA 3WZEA 3LXPA 3Q53A 3R83A 2I0YA 3PSBA 4XMOA 4BDDA 2GNIA 1YVJA 3OEFX 3AC3A 3PJCA 5EOBA 3G6HA 4QP3A 4B7TA 3F3UA 3VWAA 4RLKA 3HV7A 1QCFA 4ZTRA 4O0UA 3TIZA 3BHHA 3PPJA 2V22A 4CVAA 2UZVA 4BKZA 3H3CA 2BDFA 4BDHA 3HP2A 4N6YA 4O0YA 5DG5A 2QKRA 5KBQA 3CXWA 3WE4A 3FMDA 4R5SA 3KN6A 4B9DA 5KMNA 4TW9A 1OBDA 5CY3A 1DAYA 3LQ5A 3PP1A 1KE5A 4I5PA 3QZFA 2XNGA 4MNEA 4IVDA 5ITAA 3ZZEA 1BLXA 2JKQA 3LXKA 4JRVA 2XYUA 5HTIA 3FE3A 3QL8A 1VZOA 4CMTA 4GKIA 5G1XA 4PMPA 4APCA 4FV4A 4L3LA 2GNGA 2PMLX 3MBLA 1SNUA 2G1TA 3DKOA 3WIGA 3G33A 1OITA 1R3CA 5B2MA 3MGYA 3W2CA 2WOTA 1JKTA 3ZO2A 1QPJA 2PZ5A 2HELA 5DRBA 2PVYA 3TZMA 4QMYA 3POZA 4ZY6A 3R7OA 5JQ5A 2X4FA 4UXLA 3NUUA 3OCSA 3OC1A 4JX7A 5AP3A 4AG8A 4EOOA 1ZYJA 1IR3A 4OT6A 5FWKK 5CALA 3V8SA 3R30A 4FZ6A 1PKDA 1FVTA 5CQUA 1PXJA 3PUPA 4JBPA 3JY0A 4A9RA 5H8EA 2BCJA 3SHEA 3FKNA 3U54A 1IRKA 3DNEA 3OWJA 3TUDA 3F3TA 3LJ2A 4IAZA 1I44A 2PSQA 2XJ1A 4GFGA 2GNLA 4EZ5A 2O0UA 5C4KA 3MPTA 2YERA 1QL6A 4LI5A 4WUAA 4BB4A 4U45A 4K9YA 2QOQA 5HEZA 3C4CA 2FSTX 3LCSA 5D1JA 3A62A 2BRBA 4IC8A 3U87A 5JT2A 3O96A 3L1SA 5AIRA 2XKDA 2OW3A 4E6CA 5JFXA 4EHEA 4NJ3A 3BBTB 4AGDA 3F6XA 4D2VA 1JKKA 4QMUA 2CKPA 3ORTA 3TV6A 5DYJA 4OT5A 4ZTLA 1ZZLA 3HKOA 3IPHA 3RTPA 3NUAA 4RIXB 5M53A 2C5OA 3BYVA 4RQVA 4MX9A 3VAPA 5TO8A 3RM7A 2X2LA 4DFUA 3A60A 4QMOA 4O6EA 2B9FA 5EHLA 2BZJA 4CQGA 3E8NA 5M4CA 2R0UA 1U46A 5AV0A 3VUDA 3WYYA 3FMJA 4G9CA 4J52A 4PTCA 5IA4A 2VWZA 3O51A 5J9YA 4ZJIA 2P3GX 1FMOE 4FK3A 4LM5A 4AZEA 4CCUA 3HVCA 3A99A 4XP2A 4FTQA 3LW0A 4EC8A 4JRNA 2ESMA 4H1JA 2J0KA 4QMVA 3QCXA 3QU0A 2XIKA 5FXQA 4EOKA 3OF0A 2X6DA 3RINA 4EH7A 3M42A 5LARA 4L3PA 2B54A 3FHIA 4R78A 4KUJA 1SYKA 4MNFA 3OOGA 2XS0A 3AGLA 4N0SA 4PP9A 1G8AA 4DLIA 4OBOA 4CFXA 2NP8A 4ZOGA 4UMTA 2ACXA 1H4LA 3F3VA 4XLVA 4K77A 2GTNA 2YN8A 4QNYA 3ZRMA 5KMJA 4IAYA 4YJVA 1O6YA 2F57A 3PXYA 3KCKA 3PRFA 5CSWA 2BRGA 4AGCA 4V05A 3LFNA 5IKWA 2PVHA 4M97A 4YZBA 3E93A 4F6SA 3U6IA 3AMBA 5BVWA 1OGUA 4ZXTA 4IVBA 4DT9A 4ERKA 3ZUUA 3NMUF 4AZSA 3SW4A 2OXDA 4FV0A 4O22A 3OUKA 5CI6A 5LVPA 3LLAA 3QRJA 4YHJA 3HP5A 3NAXA 3FZRA 2OJIA 3AC1A 2G2IA 4NKSA 3OUNB 4D55A 2J0LA 4FV9A 3DLZA 2RG5A 5IPJA 4DBNA 2W06A 4TNBA 4OW8A 3JVRA 4L01A 4FX3A 5BMMA 3V8WA 4Q9SA 4X2NA 1BI7A 3MVJA 4F9WA 2WTJA 5CAVA 5LCJA 2ZMCA 3HA8A 2VWXA 2ETMA 2ITOA 3DV3A 4M68A 3RWQA 4OTRA 2PE0A 3SG8A 4XG8A 5H9BA 5KMKA 4UEUA 3ZDUA 4OTGA 3VBTA 4HNFA 5HU3A 3EMGA 4BDIA 1W0XC 4FTIA 3PSCA 4WNPA 1MRVA 3P1AA 4PF4A 4P7EA 3RK5A 2XKFA 3F9NA 4YPSA 3LFQA 2W9ZB 1A48A 1VR2A 2ERKA 1WZYA 2YIXA 2O5KA 2BMCA 2BDJA 1ND4A 3P5KA 2Y7JA 2P4IA 3QWKA 2C3JA 4FVPA 4FSRA 4H3QA 4O1OA 4HVIA 3N4VA 2XK6A 3IDPA 3CD8A 4BTMA 5KZ0A 3O23A 4MNEB 3EYHA 3O0GA 2HZ0A 4TZRA 3I81A 3L8XA 5HTBA 2P2IA 2JAMA 3P4KA 4CZYB 5HGIA 4ALWA 5FUTA 3QQLA 3MFUA 1PHKA 3MS9A 4IXPA 3FMLA 1PW2A
chains in the Genus database with same CATH superfamily
2X0OA 3QGYA 1MRUA 5ETAA 3RCJA 4D2SA 2GHGA 4W9WA 4CLIA 4FT7A 3MV5A 4NU1A 3VJOA 2RG6A 4A07A 3PLAE 1Q3WA 4AQCA 3BYUA 4AW5A 1Q8TA 2X7FA 1OIYA 2UUEA 2XNNA 5C26A 3KY2A 4XOZA 2C47A 3PP0A 3MA3A 2A19B 4IB0A 3DBDA 4LG4A 4D9UA 4EQUA 4G17A 4EL9A 4UWBA 2W1ZA 3G51A 3FSKA 3CIKA 4G31A 5J79A 2O65A 2VTOA 3A4OX 3WF7A 3LMGA 2WMAA 3GFWA 1OKVA 2BAQA 4AW2A 5GJDA 2R3IA 4I6QA 4G3CA 3RPSA 4TRLA 4FT0A 3WBLA 1BL7A 4JAIA 3C1XA 5ETFA 4D9TA 1FGIA 3LMHA 2VTLA 5IDPA 2WMTA 4JX3A 4KRDA 3O7LD 4ANOA 2XRWA 4IJPA 4KB8A 3NVMB 2B9IA 4RX7A 4QPSA 5E8YA 1WBVA 5CNNA 2QNJA 2IZSA 4PDOA 2BHEA 4YO4A 1CKPA 1RW8A 3LCOA 3OTUA 1XWSA 4A9SA 1XBCA 1AD5A 3GCPA 5AV2A 3ZLXA 4EH3A 4J95A 5HKMA 2R3LA 4OAVB 3DJ6A 3QYWA 3ATTA 4DCAA 1U54A 3KK8A 4JR7A 1V0PA 2XEYA 4M14A 3NIZA 3L9PA 3Q3BA 3O71A 3P79A 2C4GA 3EKKA 2BFXA 4GMYA 1OVEA 4D4VA 2WQOA 5AUXA 4P2KA 4BCQA 2I1MA 4AOIA 2BDWA 5AV3A 4WG5A 4FTTA 3ZUTA 5HG5A 2GNHA 2QR8A 3SDJA 4F7LA 1OGYA 2Z02A 3FI2A 2CMWA 4TWOA 2XIRA 3KMWA 5AR4A 4YNEA 4E4LA 4BJJA 4NM0A 4BL1A 2UW0A 5HO6A 1RQQA 3GC7A 3OHTA 4OTWA 3VRYA 5A14A 5KMOA 5IQAA 3E7OA 5CEPA 4RA5A 3HMOA 2XH5A 4E6AA 2YEXA 5BX0A 5D11A 3IGOA 2GPHA 1H24A 5EH0A 4CSVA 2GTMA 4UYAA 2VO7A 2PMIA 3FQSA 3CC6A 4QP1A 5I9XA 5L3AA 2WGJA 4UALA 4Z16A 5M09A 4C2WA 3AKLA 3D7ZA 5HVJA 4CQEA 2AC5A 1XBBA 5JRSA 3QYZA 5DLSA 2V7AA 1IAHA 5C8NA 1PJKA 3SRVA 5TR6A 2UW4A 3PVUA 5LVOA 3KRXA 4XV3A 2C0IA 4EQMA 3TT0A 5CS6A 4EOPA 5JZJA 4GIHA 4C38A 3DFCB 2CKEA 4H39A 2X39A 1H01A 2AUHA 4MD7E 4O1PA 4DH1A 1PXKA 4FR4A 4II5A 4MK0A 3BL9A 4IZAA 4A06A 1BUHA 5JEBA 3DBEA 3P7BA 4CKJA 3FY2A 3EL7A 4FKSA 3TUCA 2QOLA 4FG8A 4EOMA 4GT3A 3ORLA 5BVFA 5BYZA 2QU5A 4BCIA 3ZOSA 5HZNA 3F2AA 2OICA 3DAJA 3CCNA 3GUBA 4O7SA 3LE6A 3DNDA 5EM5A 2C6KA 3R7VA 3JR1A 3ZO1A 4ACCA 2FSLX 4RJ5A 3E63A 3I5NA 1Y6AA 4U44A 2OSCA 4H3PA 1SVEA 3BHUA 4F65A 4X6RA 1KOBA 4NYEA 1FVVA 3NNUA 4RWKA 5CU6A 3NNXA 2LAVA 3WF9A 1YHSA 2C6LA 2WQEA 3UVQA 4AA0A 5IZFA 2W4KA 3ZXTA 4B6LA 5M08A 1JAMA 2B53A 4O7VA 2RFSA 4C3FA 5DT4A 4C37A 3H9RA 4XEYA 5BPYA 5CASA 3DBCA 3E7VA 4M3QA 4FTOA 2GFSA 2F4JA 4W4WA 4F9YA 3NZ0A 3OWLA 5H2UA 5J95A 3HECA 5F95A 3KB7A 1P5EA 5I4NA 4JT3A 5IUGA 4CRLA 2OFVA 4F7SA 4XV1A 3NAYA 1FPUA 5HX8A 1QPDA 2OIQA 2QLUA 2RFNA 3GCSA 2IW9A 5JK3A 2B9JA 5J8IA 3BYSA 3RCDA 3TKIA 2WAJA 1UNGA 3OCTA 4EH5A 4I94A 3ALNA 4O7ZA 2QO9A 2ETKA 4YPDA 4DHZA 2R3GA 2QHMA 3RI1A 3VS0A 2ETRA 1L3RE 3PIXA 2C30A 1CM8A 3CR0A 5DE2A 3CTJA 3ML1A 4ZSAA 3R8ZA 4FIFA 2B7AA 3ZRLA 3DCVA 1H1QA 2F2UA 3TNWA 4R3PA 4AP7A 3KIOC 3ZC6A 4DGNA 2I0HA 2VO3A 3U9CA 1LP4A 1W2FA 5B0XA 5TOZA 4ID7A 1ZXEA 1T46A 2Z7LA 3POOA 4GU9A 4XRLA 3OG7A 5DPVA 3FLQA 4ANNA 4L00A 3DJ5A 5A3XA 5E8TA 2HCKA 3E87A 3F2NA 3R1QA 4AN2A 1LR4A 4E5AX 3FPMA 3U51A 1J91A 2WEIA 2YIQA 4YC8A 4JLCA 3EFJA 4QTAA 4RFMA 5AAGA 3QLGA 3BL7A 3E88A 3DB8A 3P08A 3RHKA 4NFMA 5DNRA 3R9OA 5E9EA 4DDGA 1WVXA 1PY5A 2R3FA 4PPCA 1PMUA 2UVZA 5AA9A 3VBWA 3FKLA 3L8PA 5CLPA 1ZMUA 3CQEA 5FBNC 3FXZA 2YHVA 3HRCA 3P7AA 3IOPA 3LCDA 5DRDA 4FEXA 5D41A 2OJGA 3CTQA 2BILB 2VTAA 3ALOA 3QD2B 4L8MA 5AJQA 3RNYA 5I3RA 3R7YA 5FLFA 3EIDA 2C5NA 2F2CB 5EW9A 4UMQA 2PUIA 5HIEA 4O6LA 3OXTA 2XK4A 3SOAA 4D2RA 5HLNA 5TT7A 3OZ6A 1S9JA 3Q32A 3A61A 4K18A 4FKQA 4AF3A 5IMXA 4PRJA 4DTBA 4K33A 3QTXA 4IMYA 3BX5A 2F49A 3MJ1A 5AADA 2VX1A 4HOKA 1U54B 4DTAA 2V0DA 3WZKA 3REPA 3TMOA 3I1AA 3QQKA 5BVEA 3ZLWA 3UC4A 3KXXA 4TNDA 1ZOHA 2YAAA 3P7CA 3GQIA 4YNOA 1XQZA 3GU8A 2GHLA 3UPXA 2XZSA 4MHAA 3R7GA 2I0VA 3NNWA 4ANLA 4ZLZA 5M55A 4KS8A 2O3PA 3EJ1A 2WMXA 1OI9A 2JLDA 4YBJA 2XAMA 1DM2A 3UGCA 3CBLA 3DZOA 4DH5A 3EQPA 1JVPP 3GI3A 4EYMA 2YAKA 4QQ5A 4CCBA 4JQ7A 4S34A 4NFNA 4BDKA 5GIOE 2GU8A 1G8JA 2QO2A 4OTIA 4KSPA 2WMWA 5IMEA 2ZB1A 4UN0C 1ZZ2A 3QF9A 1GY3A 3HX4A 3NUYA 2XIYA 2PY3A 3C0GA 2WQBA 5KZIA 4R3CA 3MN3A 5EDRA 3RM6A 3SRVB 3AT3A 3ZU7A 2I40A 3PVGA 5AV4A 1OKYA 4HYHA 3DK7A 5CEMA 1E1VA 2YFXA 4GU6A 1PYEA 3AC4A 4LRJA 2X9EA 4UV0A 1U5RA 3CKXA 3TTJA 2E9UA 3TZ7A 5FEDA 3ACKA 4QMXA 3UIMA 4BBFA 2XIXA 3R04A 5CT0A 2PVFA 3PA4A 4O0SA 3V51A 1G5SA 4BI1A 5FP5A 4EKKA 4U5JA 4L6QA 4KNBA 2R3QA 3ZONA 1WMKA 2W7XA 3DXNA 2JC6A 3FLYA 2R5TA 3FBVA 5CEQA 4TY1A 4KABA 5C8KA 1YDSE 3AT4A 3Q96A 3R02A 1XJDA 2CCHA 5HOAA 4BZOA 3FXWA 1WBTA 2BIYA 4HCVA 3OCGA 2BZIB 2YITA 4FTKA 2VWWA 3HV3A 4KRCA 3L8VA 4CRSA 4D2WA 3GC0A 3GCUA 3IOKA 3LFCA 1NT2A 3NFFB 4QPAA 4WO5A 2VWBA 4Z3VA 3NW5A 4FL1A 2P0CA 4MCVA 2QKWB 4XLIA 5BUEA 5CF5A 2YDJA 5EI2A 3R7EA 3NUXA 4NUSA 2YLFA 4ZZMA 2W9FB 4KBCA 3S4QA 2H6DA 4TYIA 3EQRA 3KKVA 3KVXA 4FTUA 4TT7A 5ANGA 3NEWA 3BEAA 4K1BA 2X8EA 4G1WA 4LDTA 3AC2A 3PZHA 4RJ3A 5CENA 2C6EA 4XNEA 5ETIA 4QMQA 4YR8A 4FZDB 2QLQA 4XX9A 3MY0A 2H96A 4NEUA 3ODZX 4YJNA 5GJGA 2YIWA 2V5QA 5E1SA 2VU3A 4FEQA 4JR3A 4EI4A 5IQIA 3Q9XA 1DI9A 4TWCA 3CY3A 4ZEGA 4IC7A 4RZVA 5HICA 2PULA 4YHTA 4N70A 5C4LA 4JMQA 4QMPA 5FEEA 3CLYA 2ERZE 4AW1A 5EM8A 1PMVA 1ZY5A 4AOJA 4RFYA 4D2PA 1X8BA 4E6DA 2Z7RA 3F5GA 4IX5A 3I6UA 4O4EA 4GUEA 5F94A 4GEOA 1TKIA 3QZHA 5TKDA 4EYJA 3DTWA 4FSMA 5HBHA 3R9HA 4IH8A 4PDPA 4RIOA 4IX4A 2DS1A 4RQKA 4YJQA 4ANSA 2WELA 4FKLA 4ZJJA 3KULA 5KHWA 2VX3A 3AGMA 1Q99A 2PU8A 4AXEA 4NK9A 3V5PA 2W17A 3ZEPA 3LM5A 1XBAA 4WRGA 2QO7A 4I6FA 1KWPA 2OJ9A 4FUYA 3G6GA 4RIXA 2QOFA 3R73A 5A4LA 2J5EA 2VTIA 3R6XA 4L53A 4QQCA 4GK2A 5L6WL 1TQMA 3VF8A 2P2HA 3E5AA 5AP4A 3T3UA 4FNWA 4I0RA 4RX5A 3QD0A 3ZFMA 1F5QA 4QTBA 3V5WA 3F69A 3CKWA 4HZRA 5K4JA 3VC4A 4AA5A 3LJ1A 4MXYA 3CJGA 1YXTA 3IG7A 5EYMA 5HNGA 5IUHA 2QOBA 3ORMA 4IM3A 3R22A 4IIRA 4Z7HA 4HYIA 3SKCA 3SLSA 2YM3A 3R0TA 5K3YA 4QMLA 3SXSA 1H1RA 3FJQE 2Y4IB 3OWPA 4N4SA 3FI8A 1GIHA 3R7IA 5AA8A 3DDPA 4KBAA 3DOGA 4RA4A 3W0RA 1H1PA 2F9GA 3UQFA 1Q8UA 1QPCA 4FSTA 4FTJA 4DAWA 4IZ7A 5LVMA 2AC3A 2BAJA 4OGRA 4H3BA 1Q8YA 3R00A 5FTOA 4DC2A 4JVGA 2F7EE 3UBDA 3ZO4A 4LMNA 3KMMA 2W1HA 3UIBA 5HX6A 3S0OA 1G8SA 2OF4A 5JRQA 3QX4A 4FV1A 3WARA 1EH4A 3ETAA 2P33A 4FSWA 4IWQA 1W2DA 2WB8A 3BZ3A 3CQUA 3O8PA 3QTSA 3FZSA 2BALA 3K5UA 5EYCA 3CE3A 2GS6A 3VHKA 4EHVA 1OIRA 5LQFA 3I7BA 1SVGA 3G0EA 5L8KA 2XCHA 3L8SA 4AN9A 2VWVA 3VJNA 1SMHA 3D0EA 5AM7A 1YXXA 3CGFA 3WI6A 3MPAA 4U42A 4EK4A 3U8WA 4XP0A 5B2KA 3WIKA 4X3FB 4FEUA 1WVWA 3VQUA 2PUUA 3WF5A 4NWMA 5IQFA 2PE2A 2C3KA 2UW3A 4GJ3A 4U41A 3HV4A 2A2AA 3VS2A 1GIJA 2PVJA 3SV0A 1Q8WA 2OBJA 4ALUA 1VLRA 3O17A 2VTNA 4AE6A 3GC8A 2FB8A 3VQHA 1DI8A 1KV2A 1B39A 2OWBA 4I41A 1KE9A 4IB1A 1YXVA 4AGWA 4E6QA 5IA5A 4ZY4A 4CV8A 5C27A 2ONLC 5HG8A 3NRMA 1UNLA 3QQFA 3M1SA 4U3YA 4UZDA 3BEGA 3DGKA 5JN2A 4AWIA 2DQ7X 3FQHA 2F7XE 5KBRA 3TJDA 3DK3A 4MH7A 5GNKA 4F9AA 1HCKA 1GZKA 2FH9A 2GCDA 3C4FA 1CKIA 4G16A 4RSSA 3F88A 2C5YA 2J0IA 1HOWA 2X8DA 3OFMA 4JDIA 4NZWB 3ROCA 4AN3A 3KF7A 2GS7A 3FZPA 4X3FC 4R6VA 3ULIA 3GEQA 1W98A 1OL5A 3IKAA 2OIDA 4JAJA 3UMXA 2QCSA 4PL5A 3LKMA 3V3VA 1JSTA 1U5QA 1NW1A 3W0NA 3EFLA 4C4HA 4BIBA 5BVKA 2C69A 3O50A 2B9HA 3NUSA 2C0TA 2XAOA 5AUWA 2ZV9A 4NM5A 3IONA 3RGFA 2IEWA 3TCPA 5HU9A 4L7SA 2UW6A 2OO8X 1WCCA 2H9VA 1NXKA 2CGXA 2WTDA 4YLKA 2WXVA 4QYHA 3K2LA 4BWXA 4DYMA 2PZYA 3C51A 4CT1A 4BVUA 4L45A 3DLSA 2C3LA 2WTIA 5DMZA 4Z55A 3H0YA 3Q6UA 3KRRA 4BF2A 1ZAOA 3N51A 4JL9A 2QOHA 2PZPA 2XBJA 3WILA 4B8LA 4GL9A 4L52A 4CFFA 3GENA 4Y95A 4M69A 4QTEA 5IEYA 1YHVA 4DGOA 4DE4A 4J7BA 4F6UA 4RGJA 3MJ2A 4CFMA 3LJ0A 3SD0A 2UW5A 4DFYA 3L9MA 3TNQB 4J53A 4X0MA 4IWPA 4ANQA 4RX8A 5IA2A 5HE1A 3VS6A 1WBPA 4HYUA 3UZRA 3PJ3A 4XJ0A 3COKA 4E20A 3RAWA 4A4LA 2RL5A 3WZUA 1PYXA 1W7HA 4FC0A 4AZFA 5K5NA 4QQTA 2R7IA 3KULB 4QDEA 3TKHA 1JLUE 4MXZA 2Y6MA 5AR3A 2R2PA 5K0KA 2PVNA 4RJ8A 2VTTA 4MQ1A 1Y6BA 3GOPA 4GH2A 4XG2A 2XNEA 3VRZA 4BHZA 2HAKA 3VW6A 3Q2JA 4LGDA 3DT1A 2CKOA 5BNJA 3E3BX 3T9IA 5IA1A 5EW3A 3NYXA 3V5QA 2VV9A 3UNKA 2XF0A 4OTHA 2JDOA 3E8DA 5I9ZA 3W0MA 5DHJA 2WIHA 3RAHA 3S95A 3TYKA 1OKWA 3A7FA 4RRVA 5ANIA 4DGMA 3PE1A 3D15A 4QD6A 2B1PA 3WZJA 4V0GA 3C0HA 1IAJA 1H07A 4IB3A 3OTVA 4M66A 5HVYA 3FZTA 4EORA 2HZIA 1MP8A 3LXNA 3AT2A 2CNQA 1M2QA 4MKCA 4YJUA 5CVHA 4HGLA 4F99A 1W82A 4C0TA 4FZAB 3QFVA 2BKZA 5J5TA 2BAKA 1IG1A 3F3ZA 4RWLA 2YM5A 4HVHA 3ACJA 3BKBA 4FTLA 4LQMA 4FEWA 3BGPA 1H08A 4IAAA 4F0IA 1Q61A 1FOTA 5AIKA 3R9NA 3WF8A 4YTFA 3GGFA 1YQJA 5CSPA 3SGCA 1P4FA 1YXUA 4KIPA 4ACMA 5IEXA 4O2PA 1QMZA 3CEKA 4HGTA 3QXPA 4IWOA 3PY1A 1R0EA 3K54A 4FKTA 5HI2A 3DQWA 5CSHA 5T68A 5EM6A 3RAIA 3HUCA 4BKJA 3ZFYA 4GVAA 3LCKA 3OP5A 4YO6A 1GIIA 4Y73A 4BGHA 3R1YA 2YDIA 1CSNA 3EN9A 4DEBA 4ZMEA 2BROA 5FBOA 5HCXA 3R1NA 4CEGA 4ASXA 2JIVA 4L43A 2J0JA 4QO9A 4OBQA 2CKQA 5IQDA 4DFXE 3G5DA 1KE8A 2QONA 2SRCA 4DFLA 3BU5A 2CCIA 4FGBA 2E9PA 1RE8A 1ZMVA 4FK6A 3V5TA 4B99A 2W96B 5AEPA 2WU6A 1TFFA 5EI6A 2C5XA 2R3OA 3E62A 1QPEA 4I6LA 4DHJA 2YWVA 1H8FA 3NS9A 2X1NA 2CDZA 1GJOA 3QRUA 4BDJA 4CKRA 2FGIA 3UIUA 3I60A 1DAWA 4J97A 5CU3A 1YI4A 1BMKA 1FBNA 3ZLSA 4F7JA 4FJVA 2X2KA 3ORPA 1M14A 3C5UA 3LHJA 5AX9A 4A4XA 3R2YA 2OJJA 2C5VA 4BTFA 3P9JA 4W8EA 5ACBC 2WPAA 5BMSA 3LQ3A 3QZIA 2QHNA 4FKOA 3OMVA 4O27B 4X3JA 4F9CA 3VS1A 1Q41A 4BZNA 5M07A 1PKGA 1SM2A 3W2QA 4RZWA 3BQCA 4C59A 4O91A 2VGOA 4FNXA 5BUJA 2ITUA 3CGOA 4W4YA 2A98A 2UZOA 3EQCA 2WQNA 3FL5A 3HMPA 3UODA 4ALVA 4F63A 5A6OA 3AKKA 1U59A 3H9FA 3LPBA 1HCLA 4XG7A 4EHZA 4J99A 2ITVA 2YZAA 3C4ZA 1ZLTA 3LIJA 1ZOEA 5HBEA 4ERWA 3KGAA 4FSNA 4LRKA 4EH8A 4BCJA 4BCGA 4FOCA 3SQQA 4USEA 2ITWA 2VD5A 2R3NA 3AOXA 3R9DA 4HVDA 3HL7A 4WD5A 5L6PA 2IG7A 1OB3A 2DUVA 2R4BA 3H4JA 5CQWA 2J6MA 3U4UA 4BDEA 4F0GA 5HD4A 1WBWA 4ITJA 4QP6A 4JDJA 2UZNA 4KBKA 3QLFA 4AX8A 3M2WA 3PPKA 3TTIA 4I4EA 5L4QA 2C68A 2ZDTA 4ZLYA 2VZ6A 5LXMA 5HLWA 4O0VA 2QQ7A 3TV4A 4X21A 1TQPA 2YDKA 4IDTA 4WUNA 4QP8A 3UNJA 5A6NA 4O7LA 4YU2A 3E8CA 4M69B 4K8AA 4C2VA 3EQBA 4I0TA 5E8UA 1Y8GA 4FT3A 3T8OA 3HMNA 4TPTA 2JBPA 5D7VA 1KSWA 4O0WA 1BL6A 3DJ7A 3ZC5A 3GU6A 3TUBA 4AXDA 3C4XA 1XKKA 2VTSA 3UO4A 5M57A 4WBBB 4FICA 2AEGA 3VS7A 1JBPE 1L8TA 3PTGA 4O84A 3KXMA 1Z5MA 5CF6A 1YW2A 4IEBA 4CKIA 3KRJA 4E26A 4EWHA 4I22A 1XMMA 1H0WA 1OL6A 4FKGA 2OLCA 3O8TA 2VRXA 1UU3A 5CWZA 2XJ2A 5C03A 4QDVA 4HPUE 3Q4TA 4ASEA 4GKHA 1PXIA 1YKRA 4O0TA 1PXOA 3ZUVA 3AQVA 2XJ0A 4DGLC 4KKGA 5HORA 1OIQA 5FQDC 3U9NA 4BZDA 3JVSA 4H05A 4IB5A 4BICA 4KSQA 3R71A 2BPMA 2JKKA 4W8DA 5F20A 4C36A 3TM0A 2EVAA 1OPKA 1YDRE 3I4BA 2Y9QA 3HDNA 1VYZA 3ORNA 4V0GB 3VUMA 2X9FA 5KMIA 5A4TA 4KKEA 3UIXA 4MF0A 3LCTA 2GDOA 4K6ZA 5EM7A 2YM7A 3FLNC 4AE9A 3II5A 4AFEA 5DA3A 5ETCA 4A9TA 3FYKX 4U7ZA 4GW8A 3VULA 4DEIA 1TZDA 2GHMA 2XIZA 3G2FA 3W0PA 1PXNA 4UB7A 4ARKA 2R64A 4Y83A 4AU8A 5A9UA 5CAPA 4MTAA 2WIPA 3MIYA 3ORIA 5E1EA 5DWRA 3HAVA 2EUFB 4NL0A 3UOJA 3A7GA 1ATPE 2HY81 2XNPA 1W8CA 3Q60A 5CI7A 5DN3A 3G90X 3D94A 1E9HA 3LFBA 4YTIA 3K5VA 1RJBA 2XARA 2W0JA 2JAVA 2W4OA 3QKKA 4ONAA 5G6VA 3G0FA 5AP2A 4USFA 3QKMA 5H8BA 3MESA 4FG7A 4FKIA 4G6NA 5F1ZA 4GS6A 4BIDA 4ANMA 3V6SA 3F7ZA 2C6TA 3FZ1A 3UP2A 2ZV2A 4GJ2A 3EQFA 4O2ZA 3ELJA 4TL0A 2Y6OA 4AUAA 2VWUA 3QD3A 2X2MA 3DZQA 3F3WA 3R63A 5A4CA 1YRPA 4HVSA 2GSFA 1LUFA 5IH6A 5AUVA 4WOVA 4U9AA 2WMUA 4WIHA 4E3CA 3F7WA 4F64A 4R7BA 4P5QA 3MH2A 3KA0A 4JBQA 5DGZA 5AUYA 3PVBA 4EKLA 4ZS0A 3HLLA 5HIBA 3RMFA 1T45A 4BYIA 4C4IA 5ICPA 4Q5HA 1W83A 4PNKA 5DVRA 4IX3A 1B6CB 3Q2MA 2VUWA 1GNGA 4O81A 2XCKA 1OKZA 1PXPA 3PUFC 3VS5A 2VGPA 5JH6A 4BGGA 4TTHB 3CSVA 5CYIA 4HCTA 4RVTA 4QTCA 4I1ZA 2UZLA 4IFGA 2J7TA 3RP9A 3UDSA 3GCQA 3QTUA 4R1VA 4LUEA 4ZSJA 4TYEA 2OZOA 3AC8A 3RK7A 1PMNA 5GJFA 3CD3A 1R39A 4G3GA 4P90A 2VTHA 2X4ZA 3UPZA 2JIIA 3OY3A 4MUQA 2OFUA 1H1WA 3FL4A 3K3JA 4DG2E 3Q4UA 2IZTA 2QOOA 3LOKA 4M0ZA 3DBQA 4PMTA 5CSXA 1JSUA 3IDBA 2WMQA 2ZM1A 4I3ZA 5DOSA 2G2FA 5J1WA 4ZK5A 4LRMA 3UYTA 4JDKA 3W8QA 4XV2A 3OCBA 5AAFA 3P5JC 3ZZWA 2FO0A 4ORKA 5J9LA 4BIEA 2C0OA 4S30A 5FD2A 3FSFA 2ITZA 3D5UA 3MYGA 2YIYA 3QTRA 4FTNA 4JI9A 2OXYA 4PTEA 3SXRA 3ZXZA 4HPTE 4AZWA 2YIRA 4MXCA 4IFCA 5AP1A 3RZFA 3WF6A 2KULA 3IW8A 4I5CA 2CNUA 2G15A 3RALA 3MI9A 5DR2A 2IW8A 3MVMA 3QTQA 2QOCA 2ZVAA 2CJMA 4KIOA 3HEGA 4YTHA 3ZSIA 5B2LA 3KXNA 5E90A 1MUOA 3QHWA 4GYIA 3RPOA 3THBA 3ZH8A 5LCKA 4FNZA 4NTSA 3JS2A 1UKIA 3IW7A 3NSZA 1JQHA 2XNBA 2ZV8A 3IW6A 3C50A 3D14A 2YJSA 4E7WA 4RFZA 4NH1A 4FV3A 4EOJA 2BZKB 3KN5A 4FF8A 2JDVA 1MRYA 3AMAA 4FTRA 4RIYA 4ZLOA 3D5WA 4FSYA 4LGHA 4KA3A 4IACA 2XA4A 4E8AA 1K3AA 3DFAA 4F9BA 5JFVA 4ANBA 3QRTA 4TXCA 1M17A 2RIOA 4ZMFA 4O0RA 3VO3A 4AXFA 1B38A 5A4EA 4C34A 3L9NA 1PF8A 1CKJA 1Q3DA 4FT5A 3GU4A 3LFFA 3SC1A 3MH1A 4EWQA 3PXQA 2BRMA 2J90A 4Y8DA 3S2PA 4O83A 4HW7A 3ZCLA 2FYSA 3PA5A 5GZ9A 1NVQA 2VO0A 1JKLA 2C6MA 4FKPA 4X2FA 4DG3E 5I3OA 5IISA 4O82A 5ANEA 2JDSA 1J1CA 3LVPA 2ONLA 4FKJA 3BHVA 2OZAA 5M06A 3I7CA 3O7LB 4HZSA 2H34A 2RFEA 3UDBA 5L2IA 2PMOX 5J87A 3UZTA 3FDNA 3R8VA 4D0WA 2QG5A 3D83A 3NNVA 1XH6A 5ANKA 4U0IA 3CJFA 4CYJA 4JJRA 2HYYA 1UU7A 3RHXA 1V1KA 4X3FA 2IZRA 2J9MA 4FNYA 4KAOA 4NW5A 3ZS5A 4DHFA 4F1MA 3LFEA 3SVVA 4IM2A 4YC6A 2IF8A 5FDXA 4JBVA 3PY0A 5AUZA 4C35A 2HZNA 5DT3A 4D1ZA 3DU8A 4G3FA 4L7FA 3FMNA 3BV2A 4PQNA 3DXPA 3R8MA 5IG1A 4HCUA 3EL8A 2OI4X 3R01A 3H30A 3RNIA 4XHKB 2OJFE 4MF1A 5C9CA 2W1IA 1ZMWA 4EK5A 3W16A 2UW8A 1Y8YA 3OW4A 2UZUE 3OT3A 5LVLA 3FHRA 5A54A 2CNVA 4C3RA 5CAUA 1R78A 3PG1A 5HO8A 5L2SA 1UWHA 2FA2A 3HMMA 4FV2A 4RVKA 3IQ7A 2W1FA 3W32A 1H1SA 3OW3A 3QQHA 3QUPA 3HZTA 3V5JA 4F6WA 3QALE 3VUHA 5HTCA 3HUBA 4JXFA 1R0PA 3ZFXA 3F61A 4AOTA 2GQSA 3FV8A 4N6ZA 2BVAA 4TWNA 2XALA 5BV3A 2YCRA 4IE9A 4IQ6A 4U81A 1GZNA 2C6OA 4TN6A 3DTCA 4BR3A 3GT8A 2R9SA 3A7HA 1FGKA 3C9WA 1BX6A 2CGVA 3EKNA 4CMUA 4AXCA 2RSVA 4XG3A 3VONA 5AFVA 5JFSA 4L9IA 4MXAA 1H26A 4RJ7A 5JSMA 5EKNA 3MB7A 4I0SA 2YCSA 5CT7A 4AAYA 4C4GA 3O2MA 2EB3A 4FSZA 3Q9YA 3W1FA 1G3NA 4BDBA 5GZ8A 3AD4A 2J4ZA 4QYGA 2R7BA 4RLLA 5HE2A 4E4NA 3U6HA 3TWJA 4QMZA 2PVRA 3AKJA 3SX9A 4LV5A 1BKXA 2OU7A 4FL2A 4FIJA 4NT4A 3PA3A 1ZY4A 2ZYBA 3S00A 3CPBA 2FVDA 4C62A 5KMLA 3P78A 4BRXA 5ANJA 4U80A 4BCMA 3UP7A 2JIUA 2IJMA 3BE2A 4L46A 4EOSA 4BTJA 4HYSA 4C02A 4CMOA 3W18A 2OIBA 3V5LA 2YJRA 4H1MA 2UW7A 4D2TA 3QC9A 4O86A 4FVRA 4D28A 2JFLA