4F99A

Human cdc7 kinase in complex with dbf4 and nucleotide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
354
structure length
312
Chain Sequence
KKDIEKLYEAVPQLSNVFKIEDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRWNEVPDEAYDLLDKLLDLNPASRITAEEALLHPFFKDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cell division cycle 7-related protein kinase
publication title Crystal structure of human CDC7 kinase in complex with its activator DBF4.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 312
sequence length 354
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f99A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f99A01
5KMJA 4CV9A 2XKCA 1XH6A 5HTBA 3R71A 2R0IA 2X4ZA 5K5XA 4AE6A 5EYDA 4AN3A 5E91A 2BZKB 3I5ZA 4FEQA 3COKA 4IB0A 3GQLA 4ZZMA 4BKYA 1HCKA 3Q60A 5JZNA 5IQHA 4FKVA 4UMRA 3BLRA 3EQBA 1O6LA 3G0FA 5HCZA 2P0CA 3ZEWA 4RWIA 4E7WA 3OHTA 4PNKA 5CF8A 2WNTA 2WQBA 3BU6A 5D7AA 3COIA 3WI6A 2H96A 4EBVA 4MF1A 4YLKA 2P2IA 5ETIA 4M12A 2XIYA 4I41A 3M1SA 5IA5A 5B2LA 2OXXA 5KMLA 1M17A 3R8MA 4C3RA 3CD3A 2JAVA 3EFWA 3UQGA 2JDVA 4L53A 3CQWA 4MKCA 3V5LA 2HXQA 4S31A 4GK3A 1GJOA 3BV2A 5CNNA 5C8KA 3R6XA 3RAWA 5M57A 2FO0A 4LOOA 3VBQA 3IW4A 3IW6A 2OXDA 3LMHA 5KZ0A 3F5XA 2IWIA 1FMKA 3M42A 3NNXA 1WAKA 2C5OA 3KXHA 1UNLA 3O8PA 4LGGA 1DAWA 4QPMA 2VWBA 2XMYA 1BL6A 4L3PA 2XK4A 1KOBA 5FM3A 2JDSA 4BCQA 4ALUA 4F65A 1R0PA 5M09A 4JLCA 4QYYA 5L6WL 4M15A 1HOWA 5AR2A 2JGZA 3FL4A 2OIBA 5AV3A 2W0JA 2Z2WA 4I20A 1NA7A 1GY3A 2UZLA 3C4FA 4NKAA 5HE0A 4ZAUA 5M56A 2OIDA 4TL0A 2XEZA 1G3NA 2CHLA 2XCKA 4FG9A 3MN3A 4WUAA 4RIWB 4BIDA 2OF4A 1ERKA 1NY3A 2B1PA 1ZMUA 2CPKE 3QWJA 4FSTA 3QRUA 4CLIA 3ZLSA 3U51A 2C69A 4IZYA 2C1AA 3HV3A 1UU8A 2OW3A 3LXPA 5IA2A 4QYEA 2OK1A 3C4EA 4QMVA 2VTSA 4QP2A 5JQ8A 4D4YA 4BN1A 5HD4A 3IK3A 2QKRA 2NPQA 2XIZA 4YNEA 3F61A 5LWNA 3ETAA 4IB1A 2QO9A 4GUEA 4ASZA 2BILB 1UNGA 1DI9A 4OBQA 1J7UA 3DKCA 4ZIMA 1VEBA 5DR2A 1Y57A 2QKWB 4ZSLA 3RK5A 3VS2A 4D2VA 4LV5A 4ANMA 3LCTA 4F9YA 1Q97A 2Z8CA 3QA8A 5LMBA 1JAMA 3WZDA 5J9ZA 2XZSA 5K0KA 1RE8A 4M0YA 1PYEA 1V0PA 4ZTSA 4M68A 3EQIA 4EOIA 4CKJA 3IGGA 4TYHB 1SM2A 2XNMA 1SZMA 3F2AA 5BVEA 1H0VA 1KV2A 3ZBFA 2R3GA 2WU7A 4XJ0A 3CP9A 2X7FA 3OOGA 3QD3A 4FV7A 4IC8A 5LMKA 1MP8A 2YDIA 3NUNA 5CSWA 3UZRA 3KRRA 4O0VA 4A07A 1PHKA 3RJCA 3V51A 5KMNA 3PFQA 3LQ3A 4LG4A 3K2LA 5L2WA 4FTKA 5DIAA 3T3UA 1AQ1A 2X81A 4J95A 5LARA 3DBQA 3BELA 3PE1A 3RVGA 5HHWA 5JKGA 3ODYX 3OVVA 3GCVA 4JS8A 4JVGA 4K18A 5E8WA 4CLJA 5AUZA 3OF0A 3ZS5A 3CD8A 3UP2A 4Q9SA 4BDEA 1YI6A 2BZIB 3U8WA 4OTWA 3ZMMA 3CCNA 3EZVA 3FZRA 4AUAA 1XH9A 4FF8A 1M2PA 4C2VA 3RBWA 4FKJA 1YWNA 4CYJA 5DOSA 3EFLA 3DXNA 3FYJX 1PY5A 4AGWA 5L6PA 5IQGA 3R9DA 3Q9WA 4TTHB 4WT6A 3D15A 5GZ9A 4Z3VA 3U55A 3BYVA 4M7IA 5HNGA 1SNXA 2X2MA 4AN9A 2HZNA 4AOJA 4RG0A 4YZCA 3RPVA 3FAAA 1ZZ2A 3PA3A 4EH7A 2JFLA 3B8RA 5EQPA 2X8EA 2PE1A 3MVMA 2J6MA 4GFMA 5AP6A 3DQXA 3L9LA 4BTJA 3OW3A 4FTOA 2UW9A 4FKIA 2YM7A 3LFSA 4I4FA 1LUFA 4D2PA 4FSYA 3D14A 3BU5A 3NSZA 3LE6A 5DEYA 5FBNC 4L3LA 3OT8A 3UZTA 3FQSA 4G3CA 3F2NA 5CXZA 2YJRA 3JVSA 4G2FA 5EG3A 3DV3A 4J8NA 2X2LA 4WG5A 4FKQA 2GHGA 2I40A 4ASDA 3KXXA 2C68A 4AW2A 3N4UA 1PMEA 2RL5A 4YTIA 3RPRA 1I09A 4KS7A 1OIYA 4FZDB 3PDTA 2QNJA 4FSUA 1OKZA 3NVKI 5A4TA 3GFEA 1XBAA 4DT9A 2UW8A 4DEIA 3UVQA 4E3CA 3SG8A 4DEDA 4ZLZA 4IB5A 3UDBA 4AA4A 4USFA 5CS6A 5HESA 2W5AA 3UIMA 3FJQE 1FVTA 3VO3A 4ZMEA 2X2KA 3WE8A 5AP5A 2RFSA 4KS8A 2ETMA 5CY3A 4GCJA 4QYGA 4WNOA 5FQDC 4FZAB 1ZWSA 3MA6A 3MSSA 4B0GA 4EH3A 1J1BA 4QMYA 4USDA 3R7GA 4IAKA 4X3JA 2WMTA 4A9UA 4PMMA 5J1VA 2JDRA 3KB7A 4XP3A 5KMOA 3O2MA 3DY7A 5A9UA 4QPSA 3TUCA 4XS2A 4LMUA 4X6RA 4NK9A 4FZFB 4U42A 1SVHA 3CIKA 5E92A 2R0UA 4CQEA 3PTGA 4CTCA 4F1OA 4ZTLA 5DR9A 3KKVA 2CNVA 3AT2A 2IVSA 5I9ZA 3QAME 3ORZA 4FNXA 1TQMA 1YW2A 4OUCA 4E6CA 3ORPA 4J7BA 3BGZA 4MEDA 2UZBA 3FI4A 2XEYA 3S3IA 5M44A 4PDOA 5KMMA 3FLYA 4O1OA 4XV3A 4E5AX 5IDNA 2UZDA 4NWMA 4W8DA 4TW9A 1GNGA 4O0TA 4IM3A 4XRLA 3LCSA 4D0WA 4DFNA 3GCPA 5FRIA 3ELJA 4FICA 4KBAA 4XYFA 2ZB1A 3SA0A 3M2WA 2F4JA 3OUKA 3G5DA 1UNHA 4FNYA 4OTHA 5F4NA 4QMWA 4PDPA 3MPAA 4EWQA 3F3TA 2F7EE 2P2HA 5D7VA 4IFCA 2XIXA 5CSPA 4M13A 3PLAE 5HO8A 4FV9A 3OY1A 5JGDA 4OTPA 3DXPA 3E7VA 2EB2A 3UODA 2GNLA 2WMSA 5IEYA 1OECA 4X3FC 3RTPA 4FG7A 3CC6A 1NVRA 3I79A 4JOAA 4YURA 4FKWA 5HICA 4DHFA 2CSNA 3OOMA 5M4IA 5LVLA 3EQFA 3KU2A 4GRBA 3BI6A 5K9IA 3WOWA 4O82A 4BDJA 3ZM9A 2XJ2A 3H30A 4IH8A 4O91A 2F57A 1ZY4A 3EHAA 4D1XA 4FEVA 4G31A 5KHXA 2W5HA 5AUYA 3RNIA 4ZJJA 3LZBA 3DAKA 3HV5A 3RPYA 5L4QA 4EYJA 4N6YA 4RX5A 3S0OA 3KVWA 4HZRA 4V0GA 4ZEGA 4FL1A 1U46A 3BYUA 3TNHA 3TZ8A 1BI7A 3WYXA 2C6OA 4DGNA 3OCGA 2PVJA 1J1CA 1FMOE 1GZNA 1ZARA 3A7JA 3LFFA 5A4EA 1Q8WA 3JR1A 4IEBA 3I0OA 5GHVA 3P5KA 3TIZA 4CFVA 3Q2JA 4UZDA 4X2NA 4RVKA 4BF2A 2WTIA 3DQWA 3FXWA 2PZYA 5CENA 4YZNA 3V5PA 4RBLA 3UQCA 3NGAA 5HVYA 5AP0A 3QL8A 2VNWA 4MH7A 3O7LB 4II5A 2WTCA 3LCOA 2Y4IB 5DRDA 5DN3A 3OY3A 4MBIA 1UKIA 3F66A 5BUIA 5K5NA 1L3RE 4M0ZA 4BDDA 3RZFA 4PPAA 4A9TA 2XKDA 4R77A 3UYTA 3DFAA 3UNZA 3SC1A 1WBPA 4HZSA 4LL5A 4FV2A 4DTBA 3TZ9A 3PG1A 4AA0A 3E8DA 3ZRKA 4YPDA 2UZVA 5H8BA 2ITPA 4NM7A 3Q9YA 2BRGA 2EVAA 2YABA 4JR3A 4XLVA 5AP1A 1PXLA 4EL9A 2JKOA 2J2IB 2V5QA 2XNGA 2GNHA 3S95A 3C0GA 4AT3A 4MF0A 4U6RA 5CU0A 3GEQA 2XK6A 1SMHA 4WNPA 3T8OA 3VBWA 3ZXZA 2HOGA 3A61A 3F6XA 1H1WA 4Y46A 4YJQA 3RWQA 5JFSA 5AMNA 5AUXA 2DYLA 3FSKA 4IZAA 4ZSAA 3R9RA 1H24A 1AGWA 4EZ7A 4A9YA 3KEXA 3OFMA 4FTIA 4EJNA 2LGCA 5ANDA 2QLQA 4AW1A 2ITTA 2YCFA 1BMKA 4I0TA 2YIXA 4JRNA 5CLPA 4BIBA 4N70A 4QNYA 4YJRA 4ACGA 5HGIA 4E5WA 2VTNA 4DEHA 1OIRA 4EH2A 2OJFE 4U44A 3FPQA 3B2TA 4CD0A 4C8BA 3L8VA 4NSTA 3RCDA 4KKHA 1E1VA 2Y9QA 4I5MA 5CZIA 4DEEA 4APCA 5HZNA 5KKRC 3RKBA 2VV9A 1OI9A 1BX6A 4FC0A 4C38A 5TE0A 2E9PA 3QTUA 4O96A 1YXVA 3A60A 5AR4A 4E20A 2XA4A 4LUEA 4AU8A 3N4VA 1M2RA 3TI1A 4W4WA 3UO5A 3RAIA 4FV5A 4DFXE 3NAXA 3QTWA 2VO7A 3AC1A 4MXOA 3VUHA 5KMKA 1OIQA 3ULZA 1Y8YA 2X9EA 1WCCA 2WIHA 3TJDA 1PXMA 3MW1A 3OXZA 4C34A 5DE2A 2BZJA 3TTJA 3D9VA 3TM0A 3H0ZA 5HG8A 3F9NA 5GJDA 3Q5IA 5EOLA 3C0HA 1VZOA 2IZUA 4AACA 3EN5A 4FV4A 4IVDA 3IKAA 4F9WA 1H0WA 5E8TA 2ITYA 2ZV8A 4FTLA 3O17A 3BIZA 4GK4A 3NMUF 2IG7A 1B39A 3D2KA 4YHTA 4ZY5A 3UG2A 4L6QA 3A8XA 4FOBA 3RAKA 4YJUA 3EL8A 5HNBA 3IONA 4V05A 2PZIA 4FIIA 3AMBA 5A4CA 3C9WA 3QXPA 4U40A 5E8SA 1OB3A 2BDJA 4EK5A 2XRUA 4G5JA 4PQNA 3B2WA 3CTJA 2J50A 4DA5A 2VO3A 2VWUA 4J96A 3PY1A 1UWHA 5BVFA 5T68A 5I9VA 3V6RA 3T3VA 5I5ZA 1KE6A 4MWHA 1G8AA 3V5JA 4FV0A 2G2FA 3H3CA 5GIOE 2W5BA 5C01A 2YISA 4J1RA 3LFDA 2VZ6A 5AUUA 3DKFA 4L44A 4C02A 3HMOA 5AM7A 4J53A 3ZUUA 2VGOA 3BQCA 3V5TA 3H9FA 1RQQA 4QQ5A 5IU2A 4QP8A 2Z7QA 4CCBA 4F7LA 5CAUA 2EUFB 4U81A 4RIXA 2YHVA 3PVGA 1XR1A 4BWKA 4ZSGA 2GFSA 4F4PA 2AC3A 5EFQA 4ITJA 3BQRA 4MWIA 4C58A 2WMAA 2OH4A 4K77A 5KE0A 4DTAA 5E90A 4J71A 3DKGA 2CGVA 3OW4A 3QWKA 3IDBA 4CV8A 2XF0A 1RDQE 3KVXA 3E7OA 3E92A 4H3QA 4KABA 1RW8A 2UW3A 3MI9A 4O0SA 2QI8A 4U97A 4D5HA 3NUSA 4MQ2A 3KREA 3FLSA 4JI9A 4W4VA 4BCGA 1A48A 3BBWA 3FBVA 1YDTE 2GNGA 2NP8A 3OROA 3HUBA 5C1QB 1Q8YA 3S00A 5FUTA 3E3BX 1MUOA 4WO5A 4M69B 4RC4A 4CMOA 3QRKA 4ZZOA 1R78A 3WYYA 4GIHA 1XO2B 3V01A 2QQ7A 1YI3A 4FVPA 3NNWA 3QYZA 4PTGA 4TWPA 2B4SB 4XCUA 3GVUA 3LPBA 4C3FA 4D5KA 5HCYA 5L2IA 2CKQA 3W18A 3KRLA 4FKGA 2YZLA 2BIYA 3DB6A 5EW3A 5HX8A 4G5PA 3SLSA 4BKZA 1YXUA 2XYNA 3FQEA 4ZSEA 4FKUA 5C9CA 2CGWA 5ANOA 2W05A 4O7VA 2YIWA 4Y85A 1CDKA 2HCKA 5EM5A 3CGOA 5HD7A 2BHEA 4KKGA 4LGHA 4S33A 2J0IA 5HG9A 2WELA 1GZKA 2GU8A 2QOIA 4TKSA 1M7QA 5HBHA 4BI2A 4OTIA 4CFUA 1PMVA 5B2KA 4DEGA 3A99A 2JKKA 5HQ0A 2VWXA 4FNZA 1NW1A 2QOFA 2VTPA 2YWVA 1BI8A 4K0YA 5EOBA 3NCGA 4F9CA 4XG4A 4IB3A 2DWBA 4RJ5A 5EDPA 3GU6A 3QLGA 3LAUA 4PRJA 2O63A 2ITUA 4MNFA 1YDRE 1CKIA 2QOOA 4YLLA 3PXKA 4GJ3A 4EQUA 2HENA 5D10A 1ZOEA 3GGFA 3U4WA 2WMXA 2W06A 2EXMA 5C8NA 3VW8A 4O0RA 3R7OA 4G6NA 1APME 5FDXA 3IOPA 3R7EA 2W1HA 2GNIA 5J87A 3UIUA 3MTFA 1YHVA 3EN9A 3OXTA 1YVJA 2R3MA 3UO6A 1ZYCA 2Y6MA 3VRZA 4EUUA 4YSJA 1O6YA 1W7HA 3WF7A 4LUDA 3UNKA 4O6LA 3P78A 3FDNA 4QMXA 1IEPA 1K2PA 1PW2A 5AJQA 3LJ1A 3UP7A 1P4FA 3D5VA 2ITXA 2B9JA 4I5PA 3FY2A 4BC6A 2FB8A 1OPJA 4Q9ZA 3LJ2A 4NJ3A 4RZVA 3PY3A 3AC4A 2HZIA 4YBJA 5EK7A 4KIQA 2WOUA 4LOQA 2PL0A 1W98A 2Y7JA 3OBGA 2ONLA 4GW8A 3W2CA 2Z7SA 3FLWA 3PVUA 4ONAA 3V8WA 3A4PA 3PJ1A 4DC2A 4DLJA 3ZO2A 5I9WA 3C13A 5AX3A 3F7WA 4RA4A 1YI4A 2ACXA 1PXJA 2W9ZB 2XIKA 4ITHA 3SOCA 4EC8A 2RIOA 3UOJA 1R1WA 3R8UA 2UW0A 4WA9A 3NUXA 1IA8A 3ZBXA 3VIDA 3HRFA 2WFYA 3FMEA 3UO4A 4EZ5A 3AC3A 3T9IA 4A4OA 5AR7A 4YP8A 2VO0A 5DYJA 4FSZA 4CCUA 3ZFYA 3HGKA 1UVRA 5IISA 4MBLA 2J0MB 3L9NA 4DN5A 5HE3A 4F0FA 4EEVA 4GVJA 3V8SA 4QQTA 2B55A 2RKUA 4QYHA 3S4QA 1S9JA 1Q24A 1YRPA 4KSPA 2R3JA 3DDQA 3FWQA 3I7CA 3OWLA 4HGSA 2G01A 4TNBA 4UWYA 1B6CB 4C7TA 1Y91A 4ZJVA 3VRYA 5TF9A 3WBLA 5CANA 2UZOA 4OAVB 4GT3A 3O50A 2UUEA 5J1WA 5EQYA 4S32A 2CGXA 1FPUA 1M7NA 2WTWA 3ORXA 4EC9A 2O64A 4KIKA 3NYVA 3VVHA 5IUGA 1W0XC 4ZS0A 3BEAA 1WFCA 2W4JA 2JKQA 4QP6A 2R3OA 1KE7A 3SRVA 4B4LA 4J97A 3U6HA 5GIPE 2C0OA 4FTCA 3PVBA 4ASXA 3I0QA 3VC4A 4D0XA 3KF4A 3CKWA 4GVAA 3ZDUA 1E1XA 3FMNA 2PZ5A 3MH3A 2WQEA 3LVPA 4QP4A 4CMTA 3ULIA 3I6UA 2PMIA 5CEQA 2OWBA 3O96A 4EH5A 3KCFA 3ATSA 3F3UA 3Q4ZA 4I6HA 2PSQA 2X39A 4JG6A 4E93A 3MESA 5C26A 1ZYSA 1OL5A 4NIFA 2IW9A 3LJ0A 4AW5A 2Q83A 3MPTA 3EQPA 3SOAA 4I24A 1XQZA 2JDOA 3ENHA 4IAIA 1V0BA 2ITQA 4KBKA 4A9RA 5IQCA 4YTFA 1W82A 4GKHA 4LGDA 4BBMA 4FK6A 5H2UA 1F0QA 4ACHA 4CFMA 3RM6A 3OWPA 3W8LA 4TZRA 3ORNA 3PXQA 3TWJA 2XS0A 3DNDA 3I5NA 3IS5A 4R1YA 1QMZA 5TT7A 5M08A 1REJA 3BHUA 4X21A 3W10A 3Q52A 4IX4A 2QG5A 1CTPE 2B9IA 3AOXA 4MD9E 1JSVA 3HP2A 4Q5EA 3VS6A 3R7UA 4L00A 3PA4A 3HV7A 3QUPA 2XRWA 3UOLA 2XNOA 3TDVA 2BAKA 4AZTA 2RG5A 3R7VA 3K5UA 2H8HA 4JXFA 3ZONA 2WTKC 3V5QA 3DZQA 3P1AA 4XG2A 4EH4A 1GAGA 4F70A 3A62A 2HXLA 4JR7A 5FGKA 1JNKA 3TZMA 4XH6A 4YO4A 1Q99A 5HTIA 3A7FA 2QODA 2PVFA 5DI1A 3L8SA 5CI7A 5FP5A 2C30A 5HVJA 2YACA 5DMZA 3D5WA 2UZNA 2RF9A 3EQDA 3BE9A 4Z9LA 3UZPA 4CEGA 4L3JA 2H34A 2I0HA 3PP1A 3QZGA 4FKTA 4Y83A 3ZZEA 2C5VA 1A06A 4R3PA 2OFVA 4RZWA 3TL8A 3QZIA 5AFVA 3LIJA 3RNYA 2O65A 1MRYA 2YM4A 2PE0A 3IPHA 2OICA 4MHAA 4YTCA 4EORA 1H00A 3PIXA 4LQMA 3RPSA 2CGUA 4BCIA 3U6IA 3EIDA 2PUPA 3L1SA 5E8YA 3QLFA 5ANIA 4TYEA 5LVNA 2J51A 1ATPE 4I5CA 4Z16A 3UVRA 5AX9A 5I9YA 1KE9A 4KNBA 4DGOA 1H25A 3S2PA 5J7HA 3LFEA 3OZ6A 3R00A 4C3PA 5IDPA 5KBQA 4QMMA 2SRCA 3C5UA 2ZDUA 3MS9A 4ZXTA 4BKJA 4YJVA 3SW7A 5CF5A 3HKOA 3FKLA 5D11A 4PWNA 4D1ZA 5EM8A 4EK6A 5HO7A 2ITWA 2UVZA 3F69A 1X8BA 4H36A 2QG7A 4O7TA 2Z7RA 4PL4A 1ZRZA 3ZC6A 4FVRA 3QTZA 2R5TA 4O7SA 4FIGA 3NIEA 4ANOA 1ZMVA 2BZHB 4RJ4A 4FTNA 4XBUA 2WZJA 4DH3A 4N4SA 4QP1A 2PMLX 3H0YA 4F9BA 4W9XA 3OMVA 1STCE 2CNUA 3ID6C 2KULA 1KE8A 2J90A 3AD6A 2VRXA 4PTCA 3HP5A 4FV6A 5LJJA 1L8TA 4C4GA 3ORIA 3SV0A 3BEGA 2B52A 4FIHA 4UBAA 5TO8A 3R28A 5A6NA 1SYKA 2JC6A 2XK7A 4FODA 4FVQA 3BWFA 3PWYA 3HEGA 1Q8UA 3A4OX 4RIYB 2GQRA 2J5EA 3ZFXA 2BR1A 1OUYA 4O7YA 4LMNA 4X3FB 3ENMA 4PMSA 3SG9A 3ZRLA 4IZ5A 4EI4A 4EKLA 2IW6A 3DAEA 4ZTMA 4YHJA 4Y8DA 2QOKA 4A4LA 5JT2A 1NVSA 3G15A 2HY0A 3CTHA 4PV0A 4EH6A 3KA0A 5ETCA 1JKLA 3G33A 4FIFA 2Z7LA 5HOAA 4RIWA 3MVJA 3D83A 3KF7A 4EBWA 3VWAA 3NEWA 4QP7A 3WF9A 1J3HA 4WNMA 4LV8A 4R7IA 4J8MA 3RGFA 4AN2A 3VJNA 3KRJA 2R64A 2UW7A 4XRJA 4ZTNA 3MH2A 2QR7A 5TR6A 2WMRA 4HYUA 5AV0A 3MY5A 4F7JA 5JQ5A 3PXFA 2C6DA 4C57A 1PJKA 4FT5A 3WZJA 4ACDA 5GZAA 4IDTA 4QMPA 4R78A 2V7AA 3AQVA 3G0EA 4RQVA 4HNFA 4F6WA 4U45A 2HWOA 3ATTA 4CFWA 1YQJA 3R01A 2HIWA 4A9SA 2Q0BA 3K3JA 4BDBA 4OTGA 5KHWA 2QO2A 3Q96A 4FEWA 3KCKA 5BMSA 3QQJA 1PXKA 4OT5A 4TYHA 4AF3A 4WKQA 3TN8A 4GT4A 5AWMA 3C4CA 1JVPP 4E6AA 3CY2A 2C5YA 3TV7A 2WMWA 4D4RA 3V5WA 4HGEA 3Q9ZA 3G6HA 3QCXA 2BRNA 1VJYA 3MIYA 4HVHA 2BROA 1AD5A 5KO1A 5M53A 4WOVA 5DT0A 3KULB 3F3WA 3NLBA 5IA4A 5EM6A 2JD5A 5C8MA 5JRQA 1CKJA 4RSSA 3AMAA 4WRSA 4UXQA 2P3GX 5ETAA 4NL0A 2PVYA 5EYCA 3PJ8A 1RJBA 2ETRA 3KXMA 4O84A 1W8CA 2VX0A 4FKSA 3OTVA 4APPA 4FIEA 1GIHA 1IR3A 3BYOA 2EXEA 3NPCA 3DZOA 3G2FA 1XKKA 2W1ZA 1DI8A 4EH8A 3IW8A 3Q6WA 4V04A 3P23A 2G2IA 3RINA 4BWXA 5AP7A 2FGIA 3P9JA 3QALE 4IWDA 4JBVA 2NRUA 3ZLXA 5AIRA 4CT2A 3OCBA 1OMWA 4K9YA 3BLHA 3DU8A 4JBQA 1DS5A 5LCKA 3VS0A 2E2BA 3QX4A 4WHZA 5DT4A 3Q04A 4TWNA 2HY81 3PJ2A 5DPVA 3H4JA 3WE4A 4C4FA 5KKRB 4C37A 2X8IA 3MTLA 3WARA 2XBAA 3WZUA 4FGBA 1Y6AA 2ZM4A 4M14A 1GOLA 4ZTRA 2I0YA 2JLDA 1XH5A 3D5UA 4RFZA 5FXQA 5H9BA 1I44A 4GSBA 4UWCA 4XLIA 5FTGA 4CRSA 4O7RA 3QQUA 4N57A 1Z57A 3DTWA 4MCVA 4O22A 3H9OA 4FV3A 3CKXA 2OG8A 4FOCA 4NJDA 3VF9A 3ZDIA 3FZOA 2UZWE 2J0JA 3TUDA 1ZY5A 4UYNA 3PPZA 2W1IA 3GT8A 4NM3A 4GEOA 3BV3A 3DBEA 1ZMWA 2W99B 4I6QA 4L9IA 2X6EA 3CGFA 5GINE 4NT4A 2Y6OA 4FUXA 4XG7A 2VUWA 4PPCA 4Z7GA 4QPAA 2AC5A 3O23A 3NZ0A 4DFUA 3DOGA 3HMMA 1O9UA 1Q61A 3NRMA 4X2JA 5LMKC 3QRJA 4GT5A 4IVBA 3ZFMA 4KRDA 5HNIX 2NRYA 2V62A 1LEZA 2W1DA 2VTJA 4O2PA 4FYOA 5L2QA 1URWA 4BDGA 1S9IA 3HNGA 3HLLA 4BHZA 3GUBA 3MV5A 3EQRA 2XYUA 4GG5A 3TIYA 4C36A 2VTMA 3BHYA 4WNKA 3TNWA 5IZFA 4EH9A 2BKKA 1Q8TA 3QBNA 2GHLA 5EHYA 4IX5A 4M84A 4UMQA 3AD5A 4XG8A 4QMTA 3VJOA 3A2CA 3HRCA 5JFXA 4MXYA 4XOYA 4E26A 4X2GA 3AG9A 4RPVA 3F7ZA 4DH1A 3NYOA 2R2PA 5BVNA 4JIAA 2VO6A 3BHVA 3DJ5A 4FSNA 4CVAA 3E64A 4JAIA 3UC3A 5BUEA 3RK7A 4GIIA 4FTQA 2QCSA 2UV2A 4OBPA 3TTIA 3VAPA 4F0GA 3MJ2A 4IX3A 5JMSA 2VU3A 2JITA 4G6OA 3VUIA 2OGVA 4CFNA 3LMGA 3MJ1A 4FTTA 3P7BA 3GCSA 5AR5A 2OXYA 1IRKA 3E8NA 5CT0A 1LP4A 4DGLC 1ZYLA 4YPSA 4EOSA 5L8KA 5J5TA 4F08A 3MA3A 5BYZA 1ZZLA 1UU7A 2B54A 2QC6A 3F82A 1QL6A 5HG5A 3IGOA 3VHEA 4PUZA 2C4GA 4HVGA 2W4OA 5CAOA 4IFGA 4L67A 1UA2A 3UJGA 3IO7A 3OXIA 5E1SA 4RA5A 1Q4LA 3ERKA 1XJDA 2XVDA 4EK8A 4CGAA 1YOMA 2XJ1A 4QTAA 4U8ZA 4FGRA 4R3CA 3VUGA 4FL2A 1QPJA 4D9UA 4CKRA 4LL0A 4DEBA 5CALA 1OGUA 3IG7A 3CQEA 2YIYA 5KMIA 2UVXA 4B99A 4FKOA 2WIPA 5CTPA 3ANQA 2UW5A 2ZYBA 4DAWA 5CU6A 3IQ7A 1F3MC 2KTYA 2VTRA 4O1PA 3FMDA 2VWVA 2OJIA 3K5VA 2OH0E 2QO7A 2XH5A 1V0OA 3KXNA 3U4UA 3TXOA 3UNJA 3KRXA 2R9SA 1BUHA 4RT7A 3E8EA 3HZTA 1UV5A 2OJJA 2A1AB 2QU5A 4YHFA 4EOLA 4G3DA 3UQFA 1QPCA 4EHZA 4L45A 4FT7A 2CKPA 4B6LA 3REPA 4IM2A 3FL5A 4LI5A 5J8IA 3JY0A 3JYAA 4CZYB 3GENA 4RJ3A 4EHGA 5CEPA 3PWDA 4D58A 4YBKA 2JEDA 2PMOX 4XP2A 1JOWB 4I23A 2XM8A 2E9UA 4I22A 2ZB0A 3TV6A 4O7LA 3VS3A 3MFSA 4GYIA 4MK0A 4UWBA 5D41A 3WIGA 5ANEA 3U9CA 3EN4A 2UW4A 3R8PA 4BI1A 5CVHA 4P5ZA 2WTDA 4E5BA 5AA8A 3ZLYA 3OUNB 4H1MA 2OZAB 3HV6A 1PF8A 5F94A 1WBTA 2Y8OA 4X7QA 4I0RA 2OI4X 4HNIA 4AP7A 2WTJA 2R3KA 3MVLA 2VWIA 2OKRA 5M51A 4L42A 3VQHA 3SQQA 2BALA 4OT6A 4TY1A 4AG8A 2YN8A 3BPRA 2FH9A 2W96B 3PYYA 4CFXA 2C0IA 3Q4CA 5CZHA 5IMXA 4UZHA 3E62A 4C4EA 4KA3A 4PF4A 4KIPA 5AAGA 4U41A 3UBDA 3HUCA 3NUPA 4EWHA 4RC2A 4BCHA 3DTCA 3ZSHA 1Q62A 4ANSA 3Q3BA 5DRBA 5HIBA 3FHIA 4HPTE 2B9FA 4IHPA 4K2RA 4I1ZA 3AMYA 4AW0A 4H05A 2PE2A 3MYGA 5AAEA 2C6IA 2YAAA 4FK3A 4MQ1A 4BRXA 4D1SA 1FGKA 4M97A 4FTRA 3HL7A 3EH9A 4KB8A 3RALA 4IACA 1XHAA 1Y6BA 3N51A 3SVVA 5EYMA 4IAZA 2W7XA 5BVWA 4NM5A 5DHJA 4FA2A 2BHHA 4QMOA 2REIA 1ZAOA 4OW8A 2YM8A 3HMIA 4TPTA 2ZJWA 3TACA 1TVOA 3HV4A 3CEKA 4IWQA 4XG9A 4XX9A 4U3ZA 2PU8A 3Q5ZA 3DBCA 5E7RA 4F6UA 4UMUA 4CZTA 4A4XA 2ERKA 3QZHA 2RSVA 4Q5HA 1SVGA 5IQEA 4MXZA 3LM5A 2YA9A 3ZU7A 4NW6A 1M52A 1WZYA 1OITA 4WSYA 3D5XA 3E5AA 4WUNA 3UMXA 3RHKA 5AM6A 3C7QA 3AC2A 3LW0A 4H58A 3SW4A 1J7IA 3H9RA 1VYWA 2W17A 4HCTA 5FTOA 4QMLA 1YDSE 4EYMA 2O2UA 1IA9A 3P0MA 4TRLA 3RWPA 2XJ0A 3R8ZA 4U79A 5CU2A 3EMGA 3W2SA 5M4FA 4DT8A 2WU6A 5LXMA 3QQGA 3AT3A 3I60A 5DLSA 2H9VA 5E9EA 2J4ZA 5K4IA 3QQLA 4UMTA 4I3ZA 3LFNA 2P4IA 3BGPA 3BYSA 3G51A 3JVRA 5DG5A 3IDPA 4O81A 3JS2A 5BPYA 3LXKA 1OL1A 3OP5A 4BHNA 5HLPA 3QF9A 4JQ8A 4AE9A 1U54B 4FSRA 2YCQA 2ITNA 3SX9A 3W2OA 4AOTA 1XBCA 4ITIA 4E6DA 4F1TA 1PXOA 4YJSA 5CEOA 5LOHA 1H08A 4BYJA 1LPUA 3GOKA 2J7TA 3QCYA 4AFJA 4NZWB 4OTQA 1R3CA 3E8CA 4BCOA 5DEWA 3VF8A 3QX2A 3NS9A 1EH4A 3NNVA 4EOJA 1OPLA 5BMMA 2GFCA 4NTSA 1Q3DA 5JZJA 5CVFA 4NCTA 2J0LA 2IZRA 4F7NA 1WVWA 2GNJA 2PUUA 3F88A 4BZDA 2WXVA 4EK3A 4DE4A 1WMKA 3FI2A 4FV8A 4BFMA 5EI2A 4RX8A 4NU1A 2X7OA 3NUUA 3W8QA 1ZOGA 5CU4A 5M55A 4YC8A 4YGAA 2R7IA 3LLTA 3TKUA 4O7NA 3FLZA 4IIRA 3PRFA 4RRVA 2BRHA 4QMSA 4LFIA 4R5YA 4QOXA 1YHSA 3OCTA 3PUPA 3UC4A 4CSVA 4YU2A 3QKKA 1V1KA 3UIBA 2CJMA 4MNEB 2WTKB 1JPAA 4C59A 4RMZA 3OWKA 5D9HA 3FXZA 5HORA 3UG1A 4D4VA 1MQ4A 1K3AA 3MFTA 2QU6A 4XV9A 5CSXA 3RZBA 2GHMA 1NVQA 5HKMA 3CBLA 2C3KA 1H1RA 4AWIA 5HX6A 2CN8A 3LM0A 3UMWA 4MYGA 3MBLA 2EU9A 3AXWA 5CAPA 4XG6A 3ZHPC 3RPOA 5HIEA 3C50A 2R3RA 1GIJA 3UOHA 2GDOA 4XEYA 3U9NA 5AV2A 3II5A 3HA8A 4O6EA 4RC3A 4TNDA 1W83A 2XKEA 2C6KA 4P5QA 4G16A 2ZOQA 4M69A 4JQ7A 3R04A 4BZNA 2ZMDA 4EOPA 2BRBA 4DH8A 1ZXEA 2VGPA 3EOCA 3NCZA 5J95A 2JFMA 1H28A 1MQBA 2VTTA 5HCXA 1TQPA 5A3XA 1YWRA 3R8LA 4F64A 2QOLA 3W16A 2F7XE 5LMAA 5FM2A 5I9XA 5KBRA 2IVUA 3MPMA 3ORTA 5AP3A 3UPXA 4ANBA 1KWPA 1P5EA 3QGWA 5JFWA 3DCVA 3NDMA 3R9HA 4XG3A 4MTAA 4XBRA 3WIKA 3ANRA 3POZA 3HAMA 2VWWA 3GBZA 3QTRA 1ZYDA 4IBMA 4AT5A 2C5NA 4MXXA 4A06A 3PA5A 3HRBA 4I21A 2ZMCA 3OS3A 3E87A 4NEUA 3ROCA 3V3VA 3ZO3A 3R9NA 4R3RA 5M4CA 3LFCA 4DFLA 2PK9A 1SVEA 4TYGA 3EB0A 2CN5A 4GMYA 1DM2A 5CSHA 3QKLA 3P7CA 5FP6A 4DG2E 4B9DA 5EHLA 3C4WA 2GS6A 1K9AA 4BZOA 3TUBA 2C3LA 3D4QA 3QD0A 5DFPA 4Z7HA 5AEPA 2R3IA 3ZZWA 5LVOA 4R5SA 3KL8A 1OKVA 5G6VA 2C6LA 3FZ1A 4ZLOA 4TWOA 3VBYA 4FKPA 1KE5A 1WBVA 2A0CX 4HJOA 3IOKA 4P7EA 2VTQA 5H3QA 5M4UA 3LMIA 4J98A 3MH0A 4BCPA 3CJGA 3I6WA 4RQKA 2I7QA 4QMQA 4S34A 2HZ0A 2GPHA 3GC7A 4QMZA 3AGLA 1OUKA 2WTVA 4ZK5A 1H27A 3SDJA 4V01A 4BDFA 3TJCA 1B38A 5J7BA 5FBOA 4YUQA 2WGJA 2JAMA 5I9UA 5A54A 2OLCA 4JAJA 3D7TB 3KK8A 3B8QA 4AZEA 2GCDA 4ANQA 1U59A 5L6OA 4BVUA 2F9GA 2HZ4A 1ZLTA 3DJ6A 3KXGA 3ZCLA 3IECA 2B0QA 3AC8A 3GI3A 4PP9A 1UU3A 3G90X 4XV1A 4QT1A 4BCJA 3CY3A 4GH2A 2RFDA 3QRTA 4FTMA 3FHRA 4C61A 3EKKA 3QU0A 5T3QA 4OBOA 2Y4PA 1VYZA 4PPBA 1WVXA 4DCEA 2V7OA 4B7TA 5CWZA 3A7GA 4AFEA 2IZSA 4HYHA 2VD5A 2GMXA 3GC9A 2FA2A 5GZ8A 5FLFA 1PXIA 1UWJA 1TKIA 5DBXA 1LR4A 2PULA 1PXNA 3R7IA 3JPVA 5CEMA 1Q3WA 2OF2A 3FXXA 5AP4A 3GU8A 2CKOA 2RFEA 4FG8A 4JDIA 4WBBB 5F1ZA 5ANJA 2YITA 4YZMA 4CXAA 5EKNA 5IQFA 4RVMA 5ACBC 3QZFA 3R83A 4G17A 2PPQA 4PDYA 1ND4A 5CT7A 2XIRA 4E4LA 3QTIA 1R0EA 4JT3A 4C62A 5LQFA 2QHNA 4F9AA 5KZIA 5CU3A 4ACMA 2CCIA 3TNQB 5EDQA 3E63A 4I93A 5IG1A 1BYGA 2PHKA 3FSFA 2CKEA 1P14A 5IQDA 1H8FA 4ANNA 2R3LA 3ORKA 4IW0A 4PDSA 4UALA 4I4EA 4PTEA 3NW7A 2YFXA 4NTTA 3Q9XA 4BDHA 3PP0A 2VNYA 3DFCB 5A4LA 2XUUA 4U0IA 4ZOGA 2CLXA 4X2KA 2PY3A 1Y8GA 4ERKA 3ZSGA 5JH6A 2PUIA 2A4LA 2C6MA 5DWRA 3JXWA 2VX1A 4RFMA 2ETKA 4KUJA 4QD6A 4HVDA 2YIQA 2PZPA 2PYWA 2VN9A 3PXYA 4BDIA 5EH0A 4XP0A 2ITVA 2O3PA 4RIOA 3L8PA 4U80A 5DH3A 3QQFA 5EI6A 4O0YA 5IH5A 3FPMA 4B8LA 2QD9A 2G9XA 2W1GA 3PLSA 4RGJA 4Y5QA 5GJFA 2I0VA 1Q8ZA 4OTFA 5CEKA 4HGTA 3D2IA 2FUMA 2BTSA 2EXCX 3DKOA 4FEXA 4ERWA 3A8WA 3ZSIA 2ONLC 1JSTA 4S30A 3CSVA 3DB8A 4L8MA 3ZYAA 4L01A 4HVIA 2C0TA 5BYLA 4I0SA 3QUEA 4BYIA 2PUNA 4W9WA 3WF8A 3LCKA 2BDFA 4E4NA 5D12A 2WKMA 3PXRA 5DT3A 4BBFA 3Q32A 3QHRA 3RMFA 3C4XA 3QRIA 4H3BA 2XKFA 3MVHA 2HWPA 2FSOX 3NIZA 4FYNA 3FY0A 5CQWA 3EYGA 5IQAA 2OSCA 2O0UA 2YM6A 3QGYA 3LLAA 4J99A 4QNAA 1IG1A 5FXSA 1YWVA 2VX3A 4EOMA 4DF3A 1WBWA 3KFAA 3P4KA 5HTCA 4FSWA 4IJPA 4IWPA 3W33A 2F49A 3C4ZA 3KMWA 4AZVA 4KWPA 3NR9A 3OCSA 3QC4A 2J5FA 5HE1A 4GYGA 3HYHA 4QTDA 3I1AA 3O0GA 4JDHA 3R8VA 3VBVA 3EFKA 3FYKX 3C0IA 4MAOA 3R7YA 1IAJA 3RAHA 5DNRA 4JQEA 3ZXTA 4IVCA 1MRUA 4AOIA 3PSDA 1OL6A 3RP9A 3UVPA 5CVGA 5IUHA 3QQHA 2R3QA 4KKEA 3ALNA 4RJ8A 3P08A 4FSMA 5CXHA 2GS7A 4X6QC 3QXOA 3FV8A 2DS1A 2XB7A 3CLYA 3I81A 3VNTA 3TDWA 5FXRA 2XNEA 4UX9A 4BICA 1OM1A 5C4LA 4FR4A 4LRJA 4IAYA 3W55A 5CF4A 2C3IB 3OTUA 2UVYA 1T46A 1FOTA 3O71A 1WBOA 1YHWA 3NWWA 4GU9A 3LHJA 3QD2B 5B0XA 3MB6A 3OC1A 3ZC5A 3Q4UA 3COMA 2VWYA 4MVFA 4ID7A 3W1FA 5HBJA 3R1SA 4M3QA 5K3YA 3FMKA 3R02A 3TV4A 2WQOA 3UPZA 2JBPA 2X0GA 2IPXA 4K11A 2X9FA 3PG3A 3GU4A 5AR3A 5HBEA 4GKIA 3WZEA 5IA1A 2W1CA 3R63A 3HA6A 2QHMA 2QOHA 5EHOA 5FG8A 2BMCA 2C3JA 2OO8X 5HLWA 3PJCA 3F2RA 4RWKA 3BHHA 4FKRA 3DLZA 4CFFA 3KMMA 3UYSA 2O5KA 2WMVA 3QTQA 4FNWA 5FEDA 2BVAA 5T6KA 5J9YA 4H1JA 1TQIA 4P90A 4YZBA 1LEWA 4EUTA 1CKPA 1ZOHA 5JSMA 4E6QA 3SXFA 5CX9A 2XK8A 2OJGA 4IADA 4K33A 4E4MA 1G8SA 4M67A 3QFVA 4QYFA 2UZUE 3DDPA 4YTHA 5DGZA 3EQGA 3ZUVA 2BKZA 4AZSA 3MIAA 4XHKB 2WMUA 5HG7A 4R7BA 1H4LA 1DAYA 4LYNA 4BDCA 1Q41A 3G9NA 4QP3A 5L3AA 2V0DA 4YJNA 4RIYA 3BGQA 4L46A 2A19B 3H10A 4U9AA 4X3FA 4BWPA 3QCQA 4BCFA 4LRKA 4F63A 4EJ7A 3NX8A 2P33A 3CR0A 2Z02A 5E8UA 5ANKA 1YOLA 2WMQA 4RWLA 3CTQA 4FZ7A 3OD6X 3BX5A 5AIKA 3SHEA 4LRMA 4D2RA 3E93A 2CNQA 2HELA 3GXLA 4M8TA 2GSFA 2QOBA 3BBTB 3P79A 3HVCA 4BCKA 5JGBA 1CSNA 4PNIA 3U54A 4AT4A 4DGGA 5LCJA 5BVDA 4RJ6A 3GP0A 1GZ8A 1OVEA 4JNWA 5EM7A 3GC0A 1YXSA 4PL3A 3CS9A 4IAFA 5DA3A 5TOZA 1BKXA 5GNKA 3HDNA 3KMUA 4K8AA 3RK9A 5AV4A 4O7ZA 4ACCA 3ZO4A 3VW6A 3QTSA 3CPCA 2IZTA 4Y5HA 4K1BA 4WG4A 4ZLYA 4GL9A 2E9NA 3QC9A 2BAQA 5H8EA 4BGQA 4QRCA 4G6LA 1OPKA 3LKMA 3SAYA 4AXAA 2VAGA 1OL7A 3W2PA 2XP2A 3A7IA 4UB7A 3FMJA 2IVTA 3MFRA 2FYSA 4JJRA 5L8LA 3LFAA 1A9UA 2WD1A 4JL9A 4PP7A 2NNWB 4FL3A 1WBSA 1XH4A 3C5IA 3PZEA 2E9VA 5F9EA 3VBXA 4IE9A 4IMYA 2W4KA 3DNEA 4AGUA 1IAHA 5ACKA 3W2RA 2R3NA 4O21A 5CI6A 3IW5A 3PIZA 4D55A 1CMKE 4JBPA 5IA0A 3ZM4A 1FVVA 3KULA 5IF1A 5AP2A 2FSMX 3R9OA 3AT4A 1PMUA 3DPKA 5EDRA 3RHXA 3QUDA 2RG6A 3KN5A 4YJOA 4BTKA 1KOAA 3TKHA 5BYYA 2X7GA 2IVVA 2WQMA 1HCLA 3PZHA 4JRVA 4TXCA 2JIUA 3R21A 1U4DA 4L52A 2HW7A 5A14A 4YMJA 5A4QA 3U87A 2OZOA 4YO6A 5I0BA 4AS0A 4DLIA 5HU9A 3ZTXA 3DLSA 3W32A 2VTLA 5FEQA 2X8DA 4RWJA 3ZO1A 2PZRA 5CEIA 2YCSA 3PPKA 5AV1A 4ALVA 4O83A 2G2HA 3GOPA 3R2YA 3BE2A 3VS5A 1JWHA 4HCVA 3WF6A 2XK3A 3LXLA 4WRGA 3KY2A 4FTJA 4F1MA 4ZS4A 4BCNA 4UMPA 5M06A 4EQCA 2BPMA 5C27A 1PMNA 3PPJA 4G34A 1NXKA 5HLNA 4TYIA 1JQHA 3SGCA 3EKNA 4D9TA 1JKSA 3CQUA 4HGLA 3BCEA 3ZUTA 2F2CB 4GFOA 4BIEA 4C33A 5JRSA 4MD8E 4V0GB 2C6TA 4G3FA 1OBGA 2BFYA 2XM9A 3GNIB 3NW6A 5I4NA 4BTFA 5IKWA 3JY9A 4BBEA 3PIYA 5I3OA 1VR2A 5IQIA 3ET7A 3BWJA 4BDAA 3OEFX 4ZZNA 2BUJA 2GNFA 2GQSA 4BDKA 3EQHA 3LFBA 2HYYA 4FTAA 3AGMA 1FINA 4USEA 4NM0A 2XNBA 5EKOA 5FTQA 3THBA 4IANA 4C4JA 2QLUA 3ACKA 4YC3A 5M07A 4OAUC 5HIDA 2ZM1A 2ZAZA 4F0IA 3WILA 5B2MA 4O0UA 2WHBA 4N6ZA 4E4XA 3ORMA 2B53A 4S2ZA 2OFUA 4Y95A 5C03A 1H07A 2FSTX 1YOJA 4H39A 2BDWA 4PY1A 4D4SA 3C51A 5D1JA 5AUWA 2WPAA 5JGAA 2HAKA 1XH7A 4FT3A 5ANGA 4LM5A 3VHKA 2FSLX 4ENXA 3GCQA 5ICPA 5IPJA 4HPUE 4QTCA 1KUTA 2BIKB 3PXZA 3AD4A 4DINA 3R30A 2BFXA 2XK9A 1FGIA 3R1YA 2R3HA 3RCJA 2I6LA 3A7HA 3DBDA 2CLQA 3DGKA 3FLQA 3MDYA 3OWJA 4LOPA 4UXLA 2Z60A 3CXWA 3PRIA 5HVKA 1SNUA 4FUYA 4L7SA 4UV0A 4FT0A 5FD2A 5JK3A 3N4TA 3SXSA 5IEXA 3O8UA 4O38A 4R6VA 4G1WA 1FVRA 4YJTA 2WEVA 4EOKA 1M2QA 3KXZA 2NO3A 2XCHA 2X4FA 4W8EA 2YIRA 3DT1A 4MXCA 4EONA 5LVPA 4IAAA 3TCPA 4F6SA 1P4OA 3QHWA 4ZY6A 4ASEA 3PVWA 3LFQA 3KC3A 1JLUE 3JUHA 2WQNA 4Z55A 2F2UA 2WEIA 4L7FA 4JX3A 5CASA 4ARKA 3EN6A 2C1BA 3K3IA 4X0MA 3GFWA 4P4CA 4QMUA 2OU7A 3GCUA 4XV2A 2PMNX 3KN6A 3TEIA 2WAJA 4O2ZA 4FEUA 2CCHA 3VUDA 2WOTA 4ALWA 4G9CA 3VUMA 2YM3A 4GG7A 5DR6A 4GV1A 3N9XA 4DYMA 3P7AA 1UU9A 4B8MA 5KCVA 2YCRA 1XH8A 4U43A 4C35A 2BAJA 5IH4A 3F3VA 3FE3A 3L8XA 3ACJA 3L9PA 2YAKA 3MFUA 4RLLA 3V6SA 3HX4A 1OKYA 4KRCA 3CJFA 2VTHA 5K0XA 2AUHA 3ZLWA 2B7AA 3MB7A 4FKLA 1PYXA 3DK7A 4NH1A 1KSWA 2YERA 4DG3E 4YLJA 5BQ0A 3BRBA 2W1EA 4FBXA 4HCUA 4TWCA 3P86A 2DQ7X 3FUPA 4CG9A 5AUVA 3DK3A 2YM5A 1M14A 4UYAA 3IW7A 1YXTA 4Y72A 4CRLA 3VULA 4E73A 2HW6A 3O51A 4QO9A 3FI8A 2PVHA 1Q5KA 3BYMA 3KGAA 4TYJA 5AAFA 3E88A 4OGRA 4C4HA 4CQGA 4DBXA 1IASA 2A2AA 4GK2A 3NYXA 2BCJA 3UOKA 4NFNA 2JBOA 4DFYA 3ODZX 3R1NA 4FX3A 4C0TA 5HU3A 4FT9A 3F3ZA 4ZTQA 3D7ZA 3SD0A 4AGDA 3UE4A 4I6FA 4DGMA 3PSBA 3LXNA 4AZWA 4OR5A 2IW8A 4ANLA 2PVRA 3D0EA 4GS6A 4DG0E 1BL7A 4IJ9A 5KX8A 3R0TA 3QQKA 4WD5A 1OZ1A 4ZSJA 3OG7A 4K6ZA 2WMBA 2ZM3A 1PXPA 2BTRA 2YDJA 4AA5A 2YWPA 4ZY4A 1PRYA 1JKTA 3NYNA 1E9HA 1W84A 4YNOA 2P55A 4JG8A 2JDTA 2OZAA 1PKGA 2GTMA 3EWHA 3CPBA 4RIXB 5KUPA 4C2WA 4BGHA 3BLQA 4CZUA 2PVNA 2WO6A 3HAVA 2XNNA 1JKKA 3EYHA 3R22A 4ZP5A 5CAVA 5C4KA 3HDMA 4KSQA 4WG3A 3DA6A 1T45A 4AX8A 5FWKK 4F7SA 4MBJA 4XOZA 3LQ5A 2PVKA 2GTNA 3VS7A 1O6KA 2PTKA 2PVLA 5E8XA 4D28A 4R1VA 4BI0A 3GQIA 5BUJA 4BY9E 3L9MA 4OTRA 3DAJA 3KRWA 4OTDA 4RFYA 2QURA 5JFVA 4BCMA 2O8YA 4UN0C 2Y0AA 3E3PA 4L68A 4I92A 2B9HA 5BVKA 1YKRA 4JDJA 1H01A 4RLKA 4RVTA 5AR8A 1UKHA 1JSUA 2LAVA 2UW6A 3FQHA 4AQCA 4DH7A 4BTMA 5HE2A 3SKCA 4O7WA 5CSVA 3RM7A 4CT1A 4DTKA 4L43A 4CTBA 2QVSE 4W4XA 3FZPA 4HVSA 3M11A 3TZ7A 4DITA 5HO6A 3NW5A 4DH5A 2RGPA 4BR3A 4ZTHA 2VWZA 3R2BA 4CYIA 4D2TA 5GJGA 4GUBA 4O86A 3VUTA 1QCFA 4EZ3A 4GFGA 1XWSA 4HYSA 5B7VA 3ORLA 3ITZA 3EQCA 2G1TA 5BX0A 5IQBA 4I5HA 4I6BA 4XMOA 5I3RA 3FEGA 1R39A 2ZDTA 3O8TA 4FIJA 2J9MA 1FQ1B 3TG1A 2EWAA 4QP9A 2E9OA 4IVAA 4EKKA 5IA3A 4UY9A 3G9LX 4PL5A 4GJ2A 4JDKA 4CKIA 2EB3A 2JKMA 3LQ8A 4WIHA 4IZ7A 4U5JA 5EW9A 4CMUA 3ZH8A 3EN7A 3QKMA 4J52A 3R73A 4YJPA 5CAQA 1OKWA 3VUKA 5E8VA 2W9FB 4AGCA 3GU5A 4CG8A 4O0XA 1CM8A 4NUSA 2R3PA 3F5PA 4NW5A 3VN9A 4C4IA 4D2SA 3Q2MA 3PY0A 5IH6A 5J9LA 2CMWA 4KBCA 4QTBA 2OJ9A 3MY0A 4YSMA 2Y4IC 3K54A 4IX6A 4EQMA 5A46A 3QA0A 1WBNA 5EW8A 3RI1A 5LVMA 4QMNA 4NYEA 3OEZA 2IJMA 1U54A 4MD7E 4RX7A 4YC6A 4JX7A 1QPDA 2F7ZE 3TKIA 1J7LA 2ZVAA 1H26A 4W4YA 5EQEA 4ZJIA 2ZV9A 5H8GA 2QR8A 2JIVA 3POOA 4JBOA 2GS2A 4P2KA 3VQUA 3FZSA 3HMPA 4F09A 5CF6A 5IMEA 4IWOA 5CNOA 3KQ7A 5F95A 3BHTA 4RJ7A 2YDKA 3V8TA 3PSCA 3MY1A 2G15A 3DBFA 1H1PA 3COHA 3ROYA 2FVDA 2JIIA 2H6DA 3QYWA 5A6OA 2ZV7A 4KINA 4KD1A 3FC2A 3S1HA 3NAYA 1P2AA 5AUTA 4G9RA 4H3PA 4DBNA 3PJ3A 2Q0NA 4JIKA 5F20A 2YZAA 4FMQA 1KV1A 2I1MA 2IO6A 2R4BA 5ETFA 4OLIA 4N0SA 5CQUA 4EK4A 4Y73A 4HW7A 3BZ3A 1QPEA 1H1SA 4MNEA 4DFZE 2CDZA 4RX9A 1MRVA 2W1FA 4IDVA 3UTOA 4MX9A 4YZ9A 2DUVA 4GU6A 4KIOA 3TT0A 3NVMB 1PKDA 4HYIA 3QTXA 5TKDA 3V04A 1GIIA 2VTAA 4DFBA 2YLFA 4RVLA 5CYIA 3LCDA 3W2QA 3Q4TA 3LOKA 4ORKA 1G5SA 2QONA 4JG7A 5DVRA 1Z5MA 3FKNA 4O0WA 3MWUA 3WF5A 3QD4A 4YZDA 3QCSA 1F5QA 4KIKB 4EHVA 3HECA 5L8JA 3SXRA 4PX6A 2I0EA 3Q53A 5JN2A 3SRVB 3OT3A 5HEZA 5BVOA 1U5QA 4G3GA 3UGCA 3FMHA 2HK5A 3KK9A 2RFNA 1FBNA 3AC5A 3I4BA 5EYKA 3G6GA 5G1XA 4FTUA 4WSQA 5J5SA 2A27A 3VS1A 3D94A 3OBJA 3DXQA 2PWLA 3FZTA 3C1XA 5E1EA 1BLXA 3DS6A 2BRMA 3O7LD 2X6DA 3NNUA 4NFMA 3UIXA 5IUIA 4UEUA 1WVYA 4NIFB 2GQGA 2J0KA 4Q2AA 2AYPA 5JEBA 5K4JA 1OL2A 1REKA 3GB2A 3U6JA 5L2SA 4FZ6A 4FE2A 4NKSA 5AA9A 2V22A 3ZRMA 2R3FA 4QTEA 3FC1X 3MH1A 4XNEA 4EOOA 4NCTC 5IEVA 5ITAA 4YR8A 3EZRA 4TN6A 4QQCA 3VBTA 3PE2A 1URCA 4AZFA 5HI2A 2VTOA 3FKOA 3IDCA 4O27B 1JBPE 4CNHA 4E1ZA 4E8AA 2OIQA 4HOKA 4TT7A 5E8ZA 3EL7A 3BKBA 1H1QA 2C6EA 2ZV2A 4PMTA 4R8QA 4ENYA 5KNJA 4F99A 3F5UA 4R7HA 1Z9XA 2XBJA 2XNPA 3F5GA 1ZYJA 4M66A 3MGYA 2QOCA 5FDPA 4FV1A 3FMMA 4U3YA 2VTIA 2ERZE 3BU3A 3Q6UA 4DCAA 3FI3A 5BNJA 4DEAA 4IM0A 3NUAA 4X2FA 5L2TA 4ZMFA 4BL1A 3HMNA 1U5RA 4PMPA 3I7BA 3VS4A 5LWMA 3D7TA 4QQJA 2V55A 2C5XA 2ITZA 4EHEA 1GZOA 3WZKA 1J91A 3CE3A 4WBOA 4D2WA 2OBJA 5J79A 5FEEA 5EI8A 2YLEA 4IC7A 4MXAA 3TNPC 4IXPA 1OBDA 3DJ7A 3GU7A 2C47A 1NT2A 2PVMA 3EJ1A 3R1QA 3NUYA 4G3EA 3GC8A 3ZOSA 4XUFA 4BGGA 2X1NA 1OIUA 1XBBA 2WB8A 4I94A 4U7ZA 2UZTA 3T9TA 5AADA 2ITOA 3ALOA 3DK6A 2IN6A 4IQ6A 4AAAA 4KAOA 2YJSA 4FSQA 4A7CA 3ZEPA 2YEXA 5E4HA 3TNIA 2UZEA 2R7BA 1YXXA 2QOQA 4BB4A 3FMLA 3EFJA 3FLNC 2ESMA 4FI1A 4EOQA
chains in the Genus database with same CATH superfamily
5KMJA 4CV9A 2XKCA 1XH6A 5HTBA 3R71A 2R0IA 2X4ZA 5K5XA 4AE6A 5EYDA 4AN3A 5E91A 2BZKB 3I5ZA 4FEQA 3COKA 4IB0A 3GQLA 4ZZMA 4BKYA 1HCKA 3Q60A 5JZNA 5IQHA 4FKVA 4AXFA 4UMRA 3BLRA 3EQBA 1O6LA 3G0FA 5HCZA 2P0CA 3ZEWA 4RWIA 4E7WA 3OHTA 4PNKA 5CF8A 2WNTA 2WQBA 3BU6A 5D7AA 3COIA 3WI6A 2H96A 4EBVA 4MF1A 4YLKA 2P2IA 5ETIA 4M12A 2XIYA 4I41A 3M1SA 5IA5A 5B2LA 2OXXA 5KMLA 1M17A 3R8MA 4C3RA 3CD3A 2JAVA 3EFWA 3UQGA 2JDVA 4L53A 4DHZA 3CQWA 4MKCA 3V5LA 2HXQA 4S31A 4GK3A 1GJOA 3BV2A 5CNNA 5C8KA 3R6XA 3RAWA 5M57A 2FO0A 4LOOA 3VBQA 3IW4A 3IW6A 2OXDA 3LMHA 5KZ0A 3F5XA 2IWIA 1FMKA 3M42A 3NNXA 1WAKA 2C5OA 3KXHA 1UNLA 3O8PA 4LGGA 1DAWA 4QPMA 2VWBA 2XMYA 1BL6A 4L3PA 2XK4A 1KOBA 5FM3A 2JDSA 4BCQA 4ALUA 4F65A 1R0PA 5M09A 4JLCA 4QYYA 5L6WL 4M15A 1HOWA 5AR2A 2JGZA 3FL4A 2OIBA 5AV3A 2W0JA 2Z2WA 4I20A 1NA7A 1GY3A 2UZLA 3C4FA 4NKAA 5HE0A 4ZAUA 5M56A 2OIDA 4TL0A 2XEZA 1G3NA 2CHLA 2XCKA 4FG9A 3MN3A 4WUAA 4RIWB 4BIDA 2OF4A 1ERKA 1NY3A 2B1PA 1ZMUA 2CPKE 3QWJA 4FSTA 3QRUA 4CLIA 3ZLSA 3U51A 2C69A 4IZYA 2C1AA 3HV3A 1UU8A 2OW3A 3LXPA 5IA2A 4QYEA 2OK1A 3C4EA 4QMVA 4DDGA 2VTSA 4QP2A 5JQ8A 4D4YA 4BN1A 5HD4A 3IK3A 2QKRA 2NPQA 2XIZA 4YNEA 3F61A 5LWNA 3ETAA 4IB1A 2QO9A 4GUEA 4ASZA 2BILB 1UNGA 1DI9A 4OBQA 1J7UA 3DKCA 4ZIMA 1VEBA 5DR2A 1Y57A 2QKWB 4ZSLA 3RK5A 3VS2A 4D2VA 4LV5A 4ANMA 3LCTA 4F9YA 1Q97A 2Z8CA 3QA8A 5LMBA 1JAMA 3WZDA 5J9ZA 2XZSA 5K0KA 1RE8A 4M0YA 1PYEA 3UDZA 1V0PA 4ZTSA 4M68A 3EQIA 4EOIA 4CKJA 3IGGA 4TYHB 1SM2A 2XNMA 1SZMA 3F2AA 5BVEA 1H0VA 1KV2A 3ZBFA 2R3GA 2WU7A 4XJ0A 3CP9A 2X7FA 3OOGA 3QD3A 4FV7A 4IC8A 5LMKA 1MP8A 2YDIA 3NUNA 5CSWA 3TYKA 3KRRA 4O0VA 3UZRA 4A07A 1PHKA 3RJCA 3V51A 5KMNA 3PFQA 3LQ3A 4LG4A 3K2LA 5L2WA 4FTKA 5DIAA 3T3UA 1AQ1A 2X81A 4J95A 5LARA 3DBQA 3BELA 3PE1A 3RVGA 5HHWA 5JKGA 3ODYX 3OVVA 3GCVA 4JS8A 4JVGA 4K18A 5E8WA 4CLJA 5AUZA 3OF0A 3ZS5A 3CD8A 3UP2A 4Q9SA 4BDEA 1YI6A 2BZIB 3U8WA 4OTWA 3ZMMA 3CCNA 3EZVA 3FZRA 4AUAA 1XH9A 4FF8A 1M2PA 4C2VA 3RBWA 4FKJA 1YWNA 4CYJA 5DOSA 3EFLA 3DXNA 3FYJX 1PY5A 4AGWA 5L6PA 5IQGA 3R9DA 3Q9WA 4TTHB 4WT6A 3D15A 5GZ9A 4Z3VA 3U55A 3BYVA 4M7IA 5HNGA 1SNXA 2X2MA 4AN9A 2HZNA 4AOJA 4RG0A 4YZCA 3RPVA 3FAAA 1ZZ2A 3PA3A 4EH7A 2JFLA 3B8RA 5EQPA 2X8EA 2PE1A 3MVMA 2J6MA 4GFMA 5AP6A 3DQXA 3L9LA 4BTJA 3OW3A 4FTOA 2UW9A 3W0QA 4FKIA 2YM7A 3LFSA 4I4FA 1LUFA 4D2PA 4FSYA 3D14A 3BU5A 3NSZA 3LE6A 5DEYA 5FBNC 4L3LA 3OT8A 3UZTA 3FQSA 4G3CA 3F2NA 5CXZA 2YJRA 3JVSA 4G2FA 5EG3A 3DV3A 4J8NA 2X2LA 4WG5A 4FKQA 2GHGA 2I40A 4ASDA 3KXXA 2C68A 4AW2A 3N4UA 1PMEA 2RL5A 4YTIA 3RPRA 1I09A 4KS7A 1OIYA 4FZDB 3PDTA 2QNJA 4FSUA 1OKZA 3NVKI 5A4TA 2A98A 3GFEA 1XBAA 4DT9A 2UW8A 4DEIA 3UVQA 4E3CA 3SG8A 4DEDA 4ZLZA 4IB5A 3UDBA 4AA4A 4USFA 5CS6A 5HESA 2W5AA 3UIMA 3FJQE 1FVTA 3VO3A 4ZMEA 2X2KA 3WE8A 5AP5A 2RFSA 4KS8A 2ETMA 5CY3A 4GCJA 4QYGA 4WNOA 5FQDC 4FZAB 1ZWSA 3MA6A 3MSSA 4B0GA 4EH3A 1J1BA 4QMYA 4USDA 3R7GA 4IAKA 4X3JA 2WMTA 4A9UA 4PMMA 5J1VA 2JDRA 3KB7A 4XP3A 2XAOA 5KMOA 3O2MA 3DY7A 5A9UA 4QPSA 3TUCA 4XS2A 4LMUA 4X6RA 4NK9A 4FZFB 4U42A 1SVHA 3CIKA 5E92A 2R0UA 4CQEA 3PTGA 4CTCA 4F1OA 4ZTLA 5DR9A 3KKVA 2CNVA 3AT2A 2IVSA 5I9ZA 4O4FA 3QAME 3ORZA 4FNXA 1TQMA 1YW2A 4OUCA 4E6CA 3ORPA 4J7BA 3BGZA 4MEDA 2UZBA 3FI4A 2XEYA 3S3IA 5M44A 4PDOA 5KMMA 3FLYA 4O1OA 4XV3A 4E5AX 5IDNA 2UZDA 4NWMA 4MUQA 4W8DA 4TW9A 1GNGA 4O0TA 4IM3A 4XRLA 3LCSA 4D0WA 4DFNA 3GCPA 5FRIA 3ELJA 4FICA 4KBAA 4XYFA 2ZB1A 3SA0A 3M2WA 2F4JA 3OUKA 3G5DA 1UNHA 4FNYA 4OTHA 5F4NA 4QMWA 4PDPA 3MPAA 4EWQA 3F3TA 2F7EE 2P2HA 5D7VA 4IFCA 2XIXA 5CSPA 4M13A 3PLAE 5HO8A 4FV9A 3OY1A 5JGDA 4OTPA 3DXPA 3E7VA 2EB2A 3UODA 2GNLA 2WMSA 5IEYA 1OECA 4X3FC 3RTPA 4FG7A 4DDIA 3CC6A 1NVRA 3I79A 4JOAA 4YURA 4FKWA 5HICA 4DHFA 2CSNA 3OOMA 5M4IA 5LVLA 3EQFA 3KU2A 4GRBA 3BI6A 5K9IA 3WOWA 4O82A 4BDJA 3ZM9A 2XJ2A 3H30A 4IH8A 4O91A 2F57A 1ZY4A 3EHAA 4D1XA 4FEVA 4G31A 5KHXA 2W5HA 5AUYA 3RNIA 4ZJJA 3LZBA 3DAKA 3HV5A 3RPYA 5L4QA 4EYJA 4N6YA 4RX5A 3S0OA 3KVWA 4HZRA 4V0GA 4ZEGA 4FL1A 1U46A 3BYUA 3TNHA 3TZ8A 1BI7A 3WYXA 2C6OA 4DGNA 3OCGA 2PVJA 1J1CA 1FMOE 1GZNA 1ZARA 3A7JA 3LFFA 5A4EA 1Q8WA 3JR1A 4IEBA 3I0OA 5GHVA 3P5KA 3TIZA 4CFVA 3Q2JA 4UZDA 4X2NA 4RVKA 4BF2A 2WTIA 3DQWA 3FXWA 2PZYA 5CENA 4YZNA 3V5PA 4RBLA 3UQCA 3NGAA 5HVYA 5AP0A 3QL8A 2VNWA 4MH7A 3O7LB 4II5A 2WTCA 3LCOA 2Y4IB 5DRDA 5DN3A 3OY3A 4MBIA 1UKIA 3F66A 5BUIA 5K5NA 1L3RE 4M0ZA 4BDDA 3RZFA 4PPAA 4A9TA 2XKDA 4R77A 3UYTA 3DFAA 3UNZA 3SC1A 2NYAA 1WBPA 4HZSA 4LL5A 4FV2A 4DTBA 3TZ9A 3PG1A 4AA0A 3E8DA 3ZRKA 4YPDA 2UZVA 5H8BA 2ITPA 4NM7A 3Q9YA 2BRGA 2EVAA 2YABA 4JR3A 4XLVA 5AP1A 1PXLA 4EL9A 2JKOA 2J2IB 2V5QA 2XNGA 2GNHA 3S95A 3C0GA 4AT3A 4MF0A 4U6RA 5CU0A 3GEQA 2XK6A 1SMHA 4WNPA 3T8OA 3VBWA 3ZXZA 2HOGA 3A61A 3F6XA 1H1WA 4Y46A 4YJQA 3RWQA 5JFSA 5AMNA 5AUXA 2DYLA 3FSKA 4IZAA 4ZSAA 3R9RA 1H24A 1AGWA 4EZ7A 4A9YA 3KEXA 3OFMA 4FTIA 4EJNA 2LGCA 5ANDA 2QLQA 4AW1A 2ITTA 2YCFA 1BMKA 4I0TA 2YIXA 4JRNA 5CLPA 4BIBA 4N70A 4QNYA 4YJRA 4ACGA 5HGIA 4E5WA 2VTNA 4DEHA 1OIRA 4EH2A 2OJFE 4U44A 3FPQA 3B2TA 4CD0A 4C8BA 3L8VA 4NSTA 3RCDA 4KKHA 1E1VA 2Y9QA 4I5MA 5CZIA 4DEEA 4APCA 5HZNA 5KKRC 3RKBA 2VV9A 1OI9A 1BX6A 4FC0A 4C38A 5TE0A 2E9PA 3QTUA 4O96A 3PUFC 1YXVA 3A60A 5AR4A 4E20A 2XA4A 4LUEA 4AU8A 3N4VA 1M2RA 3TI1A 4W4WA 3UO5A 3RAIA 2X0QA 4FV5A 4DFXE 3NAXA 2IF8A 3QTWA 2VO7A 3AC1A 4MXOA 3VUHA 5KMKA 1OIQA 3ULZA 1Y8YA 2X9EA 4QDVA 1WCCA 2WIHA 3TJDA 1PXMA 3MW1A 3OXZA 4C34A 5DE2A 2BZJA 3TTJA 3D9VA 3TM0A 3H0ZA 5HG8A 3F9NA 5GJDA 4I6LA 3Q5IA 5EOLA 3C0HA 1VZOA 2IZUA 4AACA 3EN5A 4FV4A 4IVDA 3IKAA 4F9WA 1H0WA 5E8TA 2ITYA 2ZV8A 4FTLA 3O17A 3BIZA 4GK4A 3NMUF 2IG7A 1B39A 3D2KA 4YHTA 4ZY5A 3UG2A 4L6QA 3A8XA 4FOBA 3RAKA 4YJUA 3EL8A 5HNBA 3IONA 4V05A 2PZIA 4FIIA 3AMBA 5A4CA 3C9WA 3QXPA 4U40A 5E8SA 1OB3A 2BDJA 4EK5A 2XRUA 4G5JA 4PQNA 3B2WA 3CTJA 2J50A 4DA5A 2VO3A 2VWUA 4J96A 3PY1A 1UWHA 5BVFA 5T68A 5I9VA 3V6RA 3T3VA 5I5ZA 1KE6A 4MWHA 1G8AA 3V5JA 4FV0A 2G2FA 3H3CA 5GIOE 2W5BA 5C01A 2YISA 4J1RA 3LFDA 2VZ6A 5AUUA 3DKFA 4L44A 4C02A 3HMOA 5AM7A 4J53A 3ZUUA 2VGOA 3BQCA 3V5TA 3H9FA 1RQQA 4QQ5A 5IU2A 4QP8A 2Z7QA 4CCBA 4F7LA 5CAUA 3VONA 2EUFB 4U81A 4RIXA 2YHVA 3PVGA 1XR1A 4BWKA 4FRFA 4ZSGA 2GFSA 4F4PA 2AC3A 5EFQA 4ITJA 3BQRA 4MWIA 4C58A 2WMAA 2OH4A 4K77A 5KE0A 4DTAA 5E90A 4J71A 3DKGA 2CGVA 3OW4A 3QWKA 3IDBA 4CV8A 2XF0A 1RDQE 3KVXA 3E7OA 3E92A 4H3QA 4KABA 1RW8A 2UW3A 3MI9A 4O0SA 2QI8A 4U97A 4D5HA 3NUSA 4MQ2A 3KREA 3FLSA 4JI9A 4W4VA 4BCGA 1A48A 3BBWA 3FBVA 1YDTE 2GNGA 2NP8A 3OROA 3HUBA 5C1QB 1Q8YA 3S00A 3BL9A 3E3BX 4LDTA 5FUTA 3UDSA 1MUOA 4WO5A 4M69B 4RC4A 4CMOA 3QRKA 4ZZOA 1R78A 3WYYA 4GIHA 1XO2B 3V01A 2QQ7A 1YI3A 4FVPA 3NNWA 3QYZA 4PTGA 4TWPA 2B4SB 4O4CA 3GVUA 3LPBA 4XCUA 4C3FA 4D5KA 5HCYA 5L2IA 2CKQA 3W18A 3KRLA 4FKGA 2YZLA 2BIYA 3DB6A 5EW3A 5HX8A 4G5PA 3SLSA 4BKZA 1YXUA 2XYNA 3FQEA 4ZSEA 4FKUA 5C9CA 2CGWA 5ANOA 2W05A 4O7VA 2YIWA 4Y85A 1CDKA 2HCKA 5EM5A 3CGOA 5HD7A 2BHEA 4KKGA 4LGHA 4S33A 2J0IA 5HG9A 2WELA 1GZKA 2GU8A 2QOIA 4TKSA 1M7QA 5HBHA 4BI2A 4OTIA 4CFUA 1PMVA 5B2KA 4DEGA 3A99A 2JKKA 5HQ0A 2VWXA 4FNZA 1NW1A 2QOFA 2VTPA 2YWVA 1BI8A 4K0YA 3NFGB 5EOBA 3NCGA 4F9CA 4XG4A 4IB3A 2DWBA 4RJ5A 5EDPA 3GU6A 3QLGA 1TFFA 3LAUA 4PRJA 2O63A 2ITUA 4MNFA 1YDRE 1CKIA 2QOOA 1W2CA 4YLLA 3PXKA 4GJ3A 4EQUA 2HENA 5D10A 1ZOEA 3GGFA 3U4WA 2WMXA 2W06A 2EXMA 1XMLA 5C8NA 3VW8A 4O0RA 3R7OA 4G6NA 1APME 5FDXA 3IOPA 3R7EA 2W1HA 2GNIA 5J87A 3UIUA 3MTFA 1YHVA 3EN9A 3OXTA 1YVJA 2R3MA 3UO6A 1ZYCA 2Y6MA 3VRZA 4EUUA 4YSJA 1O6YA 1W7HA 3WF7A 4LUDA 3UNKA 4O6LA 3P78A 3FDNA 4QMXA 1IEPA 1K2PA 1PW2A 5AJQA 3LJ1A 3UP7A 1P4FA 3D5VA 2ITXA 2B9JA 4I5PA 3FY2A 4BC6A 2FB8A 1OPJA 4Q9ZA 3LJ2A 4NJ3A 4RZVA 3PY3A 3AC4A 2HZIA 4YBJA 5EK7A 4KIQA 2WOUA 4LOQA 2PL0A 1W98A 2Y7JA 3OBGA 2ONLA 4GW8A 3W2CA 2Z7SA 3FLWA 3PVUA 4ONAA 3V8WA 3A4PA 3PJ1A 4DC2A 4DLJA 3ZO2A 5I9WA 3C13A 5AX3A 3F7WA 4RA4A 1YI4A 2ACXA 1PXJA 2W9ZB 2XIKA 4ITHA 3SOCA 4EC8A 2RIOA 3UOJA 1R1WA 3R8UA 2UW0A 4WA9A 3NUXA 1IA8A 3ZBXA 3VIDA 3HRFA 4O4DA 2WFYA 3FMEA 3UO4A 4EZ5A 3AC3A 3T9IA 4A4OA 5AR7A 4YP8A 2VO0A 5DYJA 4FSZA 4CCUA 3ZFYA 3HGKA 1UVRA 5IISA 4MBLA 2J0MB 3L9NA 4DN5A 5HE3A 4F0FA 4EEVA 4GVJA 3V8SA 4QQTA 2B55A 2RKUA 4QYHA 3S4QA 1S9JA 1Q24A 1YRPA 4KSPA 2R3JA 3DDQA 3FWQA 3I7CA 3OWLA 4HGSA 2G01A 4TNBA 4UWYA 1B6CB 4C7TA 1Y91A 4ZJVA 3VRYA 5TF9A 3WBLA 5CANA 2UZOA 4OAVB 4GT3A 3O50A 2UUEA 5J1WA 5EQYA 4S32A 2CGXA 1FPUA 1M7NA 2WTWA 3ORXA 4EC9A 2O64A 4KIKA 3NYVA 3VVHA 5IUGA 1W0XC 4ZS0A 3BEAA 1WFCA 2W4JA 2JKQA 4QP6A 2R3OA 1KE7A 3SRVA 4B4LA 4J97A 3U6HA 5GIPE 2C0OA 4FTCA 3PVBA 4ASXA 3I0QA 3VC4A 4D0XA 3KF4A 3CKWA 4GVAA 3ZDUA 1E1XA 3FMNA 2PZ5A 3MH3A 2WQEA 3LVPA 4QP4A 4CMTA 3ULIA 3I6UA 2PMIA 5CEQA 2OWBA 3NFFB 3O96A 4EH5A 3KCFA 3ATSA 3F3UA 3Q4ZA 4I6HA 2PSQA 2X39A 4JG6A 4E93A 3MESA 5C26A 1ZYSA 1OL5A 4NIFA 2IW9A 3LJ0A 4AW5A 2Q83A 3MPTA 3EQPA 3SOAA 4I24A 1XQZA 2JDOA 3ENHA 4IAIA 1V0BA 2ITQA 4KBKA 4A9RA 5IQCA 4YTFA 1W82A 4GKHA 4LGDA 4BBMA 4FK6A 5H2UA 1F0QA 4ACHA 4CFMA 3RM6A 3OWPA 3W8LA 4TZRA 3ORNA 3PXQA 3TWJA 2XS0A 3DNDA 3I5NA 3IS5A 4R1YA 1QMZA 5TT7A 5M08A 1REJA 3BHUA 4X21A 3W10A 3Q52A 4IX4A 2QG5A 1CTPE 2B9IA 3AOXA 4MD9E 1JSVA 3HP2A 4Q5EA 3VS6A 3R7UA 4L00A 3PA4A 3HV7A 3QUPA 2XRWA 3UOLA 2XNOA 3TDVA 2BAKA 4AZTA 2RG5A 3R7VA 3K5UA 2H8HA 4JXFA 3ZONA 2WTKC 3V5QA 3DZQA 3P1AA 4XG2A 4EH4A 1GAGA 4F70A 3A62A 2HXLA 4JR7A 5FGKA 1JNKA 3TZMA 4XH6A 4YO4A 1Q99A 5HTIA 3A7FA 2QODA 2PVFA 5DI1A 3L8SA 5CI7A 5FP5A 2C30A 5HVJA 2YACA 5DMZA 3D5WA 2UZNA 2RF9A 3EQDA 3BE9A 4Z9LA 3UZPA 4CEGA 4L3JA 2H34A 2I0HA 3PP1A 3QZGA 4FKTA 4Y83A 3ZZEA 2C5VA 1A06A 4R3PA 2OFVA 4RZWA 3TL8A 3QZIA 5AFVA 3LIJA 3RNYA 2O65A 1MRYA 2YM4A 2PE0A 3IPHA 2OICA 4MHAA 4YTCA 4EORA 1H00A 3PIXA 4LQMA 3RPSA 2CGUA 4BCIA 3U6IA 3EIDA 2PUPA 3L1SA 5E8YA 3QLFA 5ANIA 4TYEA 5LVNA 2J51A 1ATPE 4I5CA 4Z16A 3UVRA 5AX9A 5I9YA 1KE9A 4KNBA 4DGOA 1H25A 3S2PA 5J7HA 3LFEA 3OZ6A 3R00A 4C3PA 5IDPA 5KBQA 4QMMA 2SRCA 3C5UA 2ZDUA 3MS9A 4ZXTA 4BKJA 4YJVA 3SW7A 5CF5A 3HKOA 3FKLA 5D11A 4PWNA 4D1ZA 3BL7A 5EM8A 4EK6A 5HO7A 2ITWA 4LV7A 2UVZA 3F69A 1X8BA 4H36A 2QG7A 4O7TA 2Z7RA 4PL4A 1ZRZA 3ZC6A 4FVRA 3QTZA 4FJVA 2ZFYA 2R5TA 4O7SA 4FIGA 3NIEA 4ANOA 1ZMVA 2BZHB 4RJ4A 4FTNA 4XBUA 2WZJA 4DH3A 4N4SA 4QP1A 2PMLX 3H0YA 4F9BA 4W9XA 3OMVA 1STCE 2CNUA 3ID6C 2KULA 1KE8A 2J90A 3AD6A 2VRXA 4PTCA 3HP5A 4FV6A 5LJJA 1L8TA 4C4GA 3ORIA 3SV0A 3BEGA 2B52A 4FIHA 4UBAA 5TO8A 3R28A 5A6NA 1SYKA 2JC6A 2XK7A 4FODA 4FVQA 3BWFA 3PWYA 3HEGA 1Q8UA 3A4OX 4RIYB 2GQRA 2J5EA 3ZFXA 2BR1A 1OUYA 4O7YA 4LMNA 4X3FB 3ENMA 4PMSA 3SG9A 3ZRLA 4IZ5A 4EI4A 4EKLA 2IW6A 3DAEA 4ZTMA 4YHJA 4Y8DA 2QOKA 4A4LA 5JT2A 3KIOC 1NVSA 3G15A 2HY0A 3CTHA 4PV0A 4EH6A 3KA0A 5ETCA 1JKLA 3G33A 4FIFA 2Z7LA 5HOAA 4RIWA 3MVJA 3D83A 3KF7A 4EBWA 3VWAA 3NEWA 4QP7A 3W0NA 3WF9A 1J3HA 4WNMA 4LV8A 4R7IA 4J8MA 3RGFA 4AN2A 3VJNA 3KRJA 2R64A 2UW7A 4XRJA 4ZTNA 3MH2A 2QR7A 5TR6A 2WMRA 4HYUA 5AV0A 3MY5A 4F7JA 5JQ5A 3PXFA 2C6DA 4C57A 1PJKA 4FT5A 3WZJA 4ACDA 5GZAA 4IDTA 4QMPA 4R78A 2V7AA 3AQVA 3G0EA 4RQVA 4HNFA 4F6WA 4U45A 4JMQA 2HWOA 3ATTA 4CFWA 1YQJA 3R01A 2HIWA 4A9SA 2Q0BA 3K3JA 4BDBA 4OTGA 5KHWA 2QO2A 3Q96A 4FEWA 3KCKA 5BMSA 3QQJA 1PXKA 4OT5A 4TYHA 4AF3A 4WKQA 3TN8A 4GT4A 5AWMA 3C4CA 1JVPP 4E6AA 3CY2A 2C5YA 3TV7A 2WMWA 4D4RA 3V5WA 4HGEA 3Q9ZA 3G6HA 3QCXA 2BRNA 1VJYA 3MIYA 4HVHA 2BROA 1AD5A 5KO1A 5M53A 4WOVA 5DT0A 3KULB 3F3WA 3NLBA 5IA4A 5EM6A 2JD5A 5C8MA 5JRQA 1CKJA 4RSSA 3AMAA 4WRSA 4UXQA 2P3GX 1W2DA 5ETAA 4NL0A 2PVYA 5EYCA 3PJ8A 1RJBA 2ETRA 3KXMA 4O84A 1W8CA 2VX0A 4FKSA 3OTVA 4APPA 4FIEA 1GIHA 1IR3A 3BYOA 2EXEA 3NPCA 3DZOA 3G2FA 1XKKA 2W1ZA 1DI8A 4EH8A 3IW8A 3Q6WA 4V04A 3P23A 2G2IA 3RINA 4BWXA 5AP7A 2FGIA 3P9JA 3QALE 4IWDA 4JBVA 2NRUA 3ZLXA 5AIRA 4CT2A 3OCBA 1OMWA 4K9YA 3BLHA 3DU8A 4JBQA 1DS5A 5LCKA 3VS0A 2E2BA 3QX4A 4WHZA 5DT4A 3Q04A 4TWNA 2HY81 3PJ2A 5DPVA 3H4JA 3WE4A 4C4FA 5KKRB 4C37A 2X8IA 3MTLA 3WARA 2XBAA 3WZUA 4FGBA 1Y6AA 2ZM4A 4M14A 1GOLA 4ZTRA 2I0YA 2JLDA 1XH5A 3D5UA 4RFZA 5FXQA 5H9BA 1I44A 3BLAA 4GSBA 4UWCA 4XLIA 5FTGA 4CRSA 4O7RA 3QQUA 4N57A 1Z57A 3DTWA 4MCVA 4O22A 3H9OA 4FV3A 3CKXA 2OG8A 4AXEA 4FOCA 4NJDA 3VF9A 3ZDIA 3FZOA 2UZWE 2J0JA 3TUDA 1ZY5A 4UYNA 3PPZA 2W1IA 3GT8A 4NM3A 4GEOA 3BV3A 3DBEA 1ZMWA 2W99B 4I6QA 4L9IA 2X6EA 3CGFA 5GINE 4NT4A 2Y6OA 4FUXA 4XG7A 2VUWA 4PPCA 4Z7GA 4QPAA 2AC5A 3O23A 3NZ0A 4DFUA 3DOGA 3HMMA 1O9UA 1Q61A 3NRMA 4X2JA 5LMKC 3QRJA 4GT5A 4IVBA 3ZFMA 4KRDA 5HNIX 2NRYA 2V62A 1LEZA 2W1DA 2VTJA 4O2PA 4FYOA 5L2QA 1URWA 4BDGA 1S9IA 3HNGA 3HLLA 4BHZA 3GUBA 3MV5A 3EQRA 2XYUA 4GG5A 3TIYA 4C36A 2VTMA 3BHYA 4WNKA 3TNWA 5IZFA 4EH9A 2BKKA 1Q8TA 3QBNA 2GHLA 5EHYA 4IX5A 4QDEA 2X0PA 4M84A 4UMQA 3AD5A 4XG8A 4QMTA 3VJOA 3A2CA 3HRCA 5JFXA 4MXYA 4XOYA 4E26A 4X2GA 3AG9A 4RPVA 3F7ZA 4DH1A 3NYOA 2R2PA 5BVNA 4JIAA 2VO6A 3BHVA 3DJ5A 4FSNA 4CVAA 3E64A 4JAIA 3UC3A 5BUEA 3RK7A 4GIIA 4FTQA 2QCSA 2UV2A 4OBPA 3TTIA 3VAPA 4F0GA 3MJ2A 4IX3A 5JMSA 2VU3A 2JITA 4G6OA 3VUIA 2OGVA 4CFNA 3LMGA 3MJ1A 4FTTA 3P7BA 3GCSA 5AR5A 2OXYA 1IRKA 3E8NA 5CT0A 1LP4A 4DGLC 1ZYLA 4YPSA 4EOSA 5L8KA 5J5TA 4F08A 3MA3A 5BYZA 1ZZLA 1UU7A 2B54A 2QC6A 3F82A 1QL6A 5HG5A 3IGOA 3VHEA 4PUZA 2C4GA 4HVGA 2W4OA 5CAOA 4IFGA 4L67A 1UA2A 3UJGA 3IO7A 3OXIA 5E1SA 4RA5A 1Q4LA 3ERKA 1XJDA 2XVDA 4EK8A 4CGAA 1YOMA 2XJ1A 4QTAA 4U8ZA 4FGRA 4R3CA 3VUGA 4FL2A 1QPJA 4D9UA 4CKRA 4LL0A 4DEBA 5CALA 1OGUA 3IG7A 3CQEA 2YIYA 5KMIA 2UVXA 4B99A 4FKOA 2WIPA 5CTPA 3ANQA 2UW5A 2ZYBA 4DAWA 5CU6A 3IQ7A 1F3MC 2KTYA 2VTRA 4O1PA 3FMDA 2VWVA 2OJIA 3K5VA 3UDTA 2OH0E 2QO7A 2XH5A 5BV3A 1V0OA 3KXNA 3U4UA 3TXOA 3UNJA 4O7LA 3KRXA 2R9SA 1BUHA 4RT7A 3E8EA 3HZTA 1UV5A 2OJJA 2A1AB 2QU5A 4YHFA 4EOLA 4G3DA 3UQFA 1QPCA 4EHZA 4L45A 4FT7A 2CKPA 4B6LA 3REPA 4IM2A 3FL5A 4LI5A 5J8IA 3JY0A 3JYAA 4CZYB 3GENA 4RJ3A 4EHGA 5CEPA 3PWDA 4D58A 4YBKA 2JEDA 2PMOX 4XP2A 1JOWB 4I23A 2XM8A 2E9UA 4I22A 2ZB0A