4F99A

Human cdc7 kinase in complex with dbf4 and nucleotide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
354
structure length
312
Chain Sequence
b'KKDIEKLYEAVPQLSNVFKIEDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRWNEVPDEAYDLLDKLLDLNPASRITAEEALLHPFFKDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division cycle 7-related protein kinase
publication title Crystal structure of human CDC7 kinase in complex with its activator DBF4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 312
sequence length 354
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f99A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f99A01
3OBJA 5M51A 2A4LA 2J51A 3HAMA 3A7GA 3PE1A 5JFSA 4E6AA 5EQPA 2RG5A 4RFMA 4CZTA 5ETAA 4F0GA 5JFVA 3PA3A 4O27B 4LYNA 4TWOA 3UIBA 2VD5A 4NEUA 3DBCA 5KZIA 3C5IA 4EYJA 2X9EA 3LQ5A 1M2QA 3PPZA 4Z7HA 5D12A 5FP5A 3MVJA 1PXKA 3ZDUA 2WQBA 5K4IA 1S9JA 3K5VA 3TV6A 5EM7A 4PTCA 5FXQA 3EL8A 3LKMA 4G3DA 2BDFA 3BEGA 4UMPA 4G17A 5IA2A 2C47A 2G2FA 4AFEA 4MD8E 1PMEA 1OPKA 2X7FA 4S31A 2ZYBA 3I5NA 4IWDA 4WSQA 1XR1A 3FPMA 3KN6A 1QPDA 5AUYA 5LCJA 2FSOX 1YWRA 5TOZA 1B39A 4EUTA 5L6OA 3O7LB 3R02A 3QKMA 1H08A 4NM0A 3ZHPC 3LQ3A 4QQJA 1ZY4A 4O0TA 3VS3A 2O3PA 3T3VA 1ZMUA 5HGIA 3FMHA 2JAVA 1OL7A 4Q9ZA 2B0QA 5J1WA 2R4BA 3FI4A 2OICA 3CTHA 3FSFA 5T68A 3WOWA 3DAEA 4H58A 2WMSA 3MH2A 3QTXA 4S34A 4FKUA 4AE9A 1YDRE 5LMAA 5KO1A 3RM7A 2F57A 4I5PA 5DFPA 3NYXA 3QKLA 4B6LA 3FMLA 4XG4A 3AD4A 2ZM1A 5BUIA 4KKGA 4NKSA 3LPBA 4PPCA 4EZ5A 3LIJA 4NL0A 3G5DA 3KF7A 4FKWA 3B8RA 4C34A 2R3JA 3QC4A 2BCJA 4RJ5A 5EFQA 3KK8A 3OC1A 2BILB 3NUXA 3PZEA 4BZNA 1W82A 4GUEA 4EOLA 3SOCA 3LQ8A 4JX3A 4ANNA 3ZRKA 3BLQA 1JAMA 3FMEA 4RWKA 3FHIA 2SRCA 2QVSE 2VGOA 4RJ8A 4RVMA 3UOKA 3R6XA 4B0GA 4BCKA 1JPAA 5I9UA 4RX7A 4I6FA 3FZPA 3E5AA 2H34A 3KMMA 2QOOA 2P33A 3ZXZA 1VEBA 4CG9A 1E1XA 3QL8A 4JRVA 5L2QA 4TYJA 2XEYA 4GCJA 3BGQA 2V5QA 3F3WA 2ITQA 3AC1A 4RLLA 2ZJWA 4G5PA 5J79A 2Z7RA 4DINA 3CIKA 3EH9A 4A9YA 1STCE 2WAJA 2ITUA 4P7EA 2VWVA 1XBAA 5EHOA 4XLIA 5FM2A 5HE3A 2B9IA 3H30A 4UYAA 3F88A 3UVRA 1OPLA 5I9VA 4LG4A 5KKRC 3PJ8A 2J7TA 3BU5A 4IX4A 4Y5QA 3VQHA 3JXWA 2WMVA 5CEQA 4L45A 4D1SA 4GK3A 4W4YA 4DT9A 5BVWA 3GCQA 3LLAA 4YTIA 2W96B 3UIMA 5CAPA 4NT4A 1JVPP 2XRUA 4BR3A 2IVVA 4WG4A 3OCGA 3I6UA 2R3PA 3K3IA 4IB3A 2ZB0A 4O0YA 3LOKA 3MGYA 4FZ6A 3VAPA 1FMOE 4L3LA 5ANKA 5GIPE 5I0BA 2CHLA 2HELA 2H96A 5K0XA 3R73A 2YCQA 2EXMA 3CQWA 3QQHA 4CV9A 5HD7A 3Q4UA 4Y73A 2IW6A 3RKBA 3DT1A 2GTMA 4E6CA 2YCRA 3BIZA 2VX1A 3GOKA 4YZCA 4USDA 3MESA 2UZOA 4QP1A 3RI1A 3VBQA 3PVWA 4BDDA 2P0CA 4O7TA 4YJPA 2WTDA 2R3OA 3RNYA 2R0UA 3ERKA 4M7IA 4O81A 3GOPA 4FOBA 3FMJA 2JD5A 3G6HA 5HO6A 2WMUA 3QZIA 3BZ3A 4EBVA 5I5ZA 5JZJA 2R64A 2PPQA 2CGXA 5E7RA 2XZSA 4J71A 2YA9A 5EK7A 3NEWA 3S0OA 1J1BA 3IPHA 3GI3A 3SDJA 1Q8YA 2PY3A 3QTIA 2J5EA 4CCUA 2IZUA 2VX0A 2Y6MA 4LGDA 4KNBA 2G01A 4ANSA 1Q3WA 3N9XA 1MRUA 2GQSA 3PSCA 4EEVA 2UW9A 4UY9A 3MB6A 4FV0A 1QPJA 4FYNA 3TTIA 3NMUF 3DJ7A 1J1CA 2W1DA 4AW0A 2PZIA 1YI6A 2R3KA 3MFUA 4DFBA 3NUYA 4O22A 1WBPA 3PXFA 2PTKA 4FTIA 4FICA 4I22A 1Q97A 4UWBA 4F0FA 3DJ5A 3F82A 5HG7A 3VF9A 4ALVA 3ID6C 3FYKX 1Y57A 2YZLA 2J5FA 2OJ9A 2XK7A 2OKRA 5EI2A 2VWWA 4NM7A 1UKIA 3NYVA 3ORPA 2PK9A 4RFYA 4WG5A 4O1OA 3BELA 4MD9E 3RGFA 4JR7A 3UIXA 4NW5A 3VUHA 2QONA 3D7TB 4BB4A 3AT4A 4WSYA 3PWYA 5FTQA 2Q0BA 4GKIA 2PUNA 3U4WA 3ZRMA 2VU3A 3G0FA 1VZOA 4V05A 1BKXA 4HYHA 5BVEA 1BX6A 4EBWA 3UQCA 2QOFA 3A61A 3LCSA 3DQWA 3V3VA 5ICPA 2CKQA 2ZOQA 2H8HA 3CP9A 3GBZA 4YR8A 4MYGA 4O91A 1KUTA 2XIZA 4II5A 4C62A 3ZBXA 4ZS0A 2W1CA 3ZCLA 3ZO1A 4CRLA 3MVHA 1UV5A 3M2WA 4IE9A 3QXOA 3QTZA 4O0XA 1Q62A 4QQ5A 4O84A 4QPMA 2C5VA 5AM6A 3UVQA 4M12A 3ZO4A 4DLIA 4XLVA 5C8MA 1UKHA 3FXXA 4FV7A 3SW4A 4B4LA 4USEA 5EOBA 3OEZA 3PJ1A 4FIJA 3GFWA 3PXQA 4RLKA 4TYHA 4KS7A 4X7QA 3W2SA 3FI3A 4U9AA 3AMAA 3PP1A 2C68A 2WFYA 4RIWB 5DYJA 4YBKA 5AA9A 2AC5A 3RP9A 3TKIA 3CD8A 4I5MA 5C4LA 2BRBA 5IDPA 1H24A 3EHAA 3E64A 3O7LD 3ANRA 4HVHA 2NNWB 4ALWA 3ZMMA 5TO8A 4RGJA 4C2WA 5C03A 5IU2A 3ULZA 3PDTA 3QYZA 2CNQA 4O7ZA 1Q61A 4GYIA 5GZAA 2UVZA 3FLZA 4FGRA 4DT8A 2UW6A 5M44A 3KB7A 4OAVB 1Q41A 3TZ9A 1GNGA 4YJRA 3C51A 4YTHA 4CSVA 2EU9A 2ITYA 5AR5A 5IQAA 3PUPA 1VR2A 2OF2A 2VTSA 3GU7A 3QFVA 4GIHA 4B7TA 3UIUA 2C3LA 4DTAA 3COIA 5CSXA 1TQIA 3MBLA 4XBUA 5E1SA 3R8ZA 2QR7A 3W2OA 4DYMA 3I6WA 3C13A 2WIPA 3FMDA 3TKUA 1NY3A 4AN2A 4E1ZA 4UXQA 5J87A 5KBQA 5GINE 4EOKA 4JDJA 4R3RA 1KSWA 3ZEPA 5LMBA 1X8BA 2C5OA 4KRCA 2FSTX 2YABA 1CMKE 3BE2A 4ZJIA 4BTKA 5IH6A 4G1WA 1KE6A 3PVBA 4N4SA 3LXLA 4CQEA 4YMJA 4C7TA 2QHMA 4DG3E 3KULA 2I6LA 2PHKA 3PJ2A 4FT9A 4D2WA 1I44A 1UNHA 4ZY4A 2OH4A 3DDQA 3KA0A 4GMYA 4QPAA 4Y95A 4XG8A 3E8CA 3G51A 1IA8A 4A9SA 2QU6A 2YHVA 3Q9YA 3A62A 5AP4A 2O64A 5B2KA 2CPKE 5HD4A 3EZRA 4QP2A 1U4DA 1GY3A 4E4MA 1GAGA 2R3IA 4AGCA 1MP8A 3Q4TA 3AOXA 3ZZWA 3FL5A 5I9ZA 2BAKA 3HVCA 4QP7A 3QA0A 3TUDA 4AZVA 2GSFA 3V8TA 3BHUA 5AR2A 2LGCA 5KBRA 3WZDA 3GB2A 5EM5A 4MK0A 3LFCA 5DVRA 3SV0A 4BBMA 3MIYA 2ITPA 2W06A 4L7SA 4BDIA 2VTLA 2WO6A 2B54A 2FB8A 3EB0A 3KRWA 3MFTA 4JDHA 3DS6A 3KF4A 2PZRA 4JQ8A 4L9IA 5I3OA 1YKRA 5H8BA 4BYJA 3F3TA 3R7GA 5H8EA 3ZLXA 3M42A 5A14A 4OTFA 4BF2A 5TT7A 4EH5A 4Z9LA 3AD6A 4ANOA 3C4FA 2OSCA 1FINA 3OT3A 4BDBA 2XH5A 2OJIA 3LJ2A 3NIZA 4J97A 4FTKA 3S3IA 4EHEA 3DZOA 1OPJA 3R71A 3UQFA 3OFMA 2JKKA 3P0MA 4O21A 3L9NA 1WBTA 2R5TA 4QP9A 3TNIA 3RCDA 2ZV2A 4O6LA 4M67A 4Y83A 3AC2A 1UVRA 2C1AA 1WBOA 3FLYA 3NUUA 1LPUA 4IX3A 4LUDA 3TACA 3HL7A 1ND4A 2X81A 1P14A 2YM4A 4FKPA 4PX6A 1PF8A 3HNGA 3ORIA 1SYKA 4TW9A 3TL8A 1JNKA 3CR0A 3FZ1A 3MY1A 5I9WA 2XS0A 1W8CA 5C26A 4GYGA 2UZLA 2QURA 2UZVA 1K3AA 2V7OA 2RFSA 4JAIA 1OKZA 4F9WA 4D2SA 3FBVA 4L8MA 1OUKA 3L8VA 4IADA 2DWBA 3AD5A 4PV0A 4BCGA 5I4NA 4S2ZA 3D5XA 3U6JA 5K3YA 4J95A 3OUKA 5EI6A 4LOPA 3EN4A 4JG8A 3RPRA 3C7QA 3TXOA 5BQ0A 4MQ2A 1P4FA 4NUSA 3C1XA 4C36A 2OW3A 5JZNA 2FH9A 3MN3A 4E4LA 4GFMA 4O0WA 4JXFA 5L2IA 4L44A 3BHTA 3FKOA 1GOLA 3PXYA 3FDNA 2Z02A 4QO9A 2WD1A 4QRCA 3OVVA 4X6RA 4HOKA 4FEQA 4DFNA 3MTFA 3JY0A 5HQ0A 2WNTA 3KCFA 3V5PA 2ITOA 3KULB 1NA7A 4KD1A 1ZXEA 5FM3A 2Z60A 4RX5A 4QNYA 5EW9A 3CSVA 2X2KA 2XYUA 2VAGA 3AT2A 4ZK5A 5IA0A 2GMXA 2CNVA 1PHKA 3UNKA 1MUOA 3HX4A 1ZAOA 3MY5A 3II5A 3ZTXA 4EOMA 1KE5A 4FEVA 2CNUA 4KBCA 4W4VA 3TDWA 3N4VA 4YPSA 3V8WA 2VWUA 2WELA 4F9AA 1H1RA 3WE8A 1YWNA 3JUHA 2VTJA 4RRVA 3C0GA 3RZFA 4HZSA 4YNEA 3T9TA 3K54A 1H0WA 3MY0A 3W1FA 2REIA 4D2TA 1XQZA 2XB7A 3Q4CA 2QG5A 2XIYA 4D55A 1ZOEA 4U80A 4F6UA 4CGAA 4YJUA 3KFAA 3OXTA 4EHZA 4QMSA 3T9IA 3FZSA 4CTCA 4AG8A 2BHHA 3ITZA 4I1ZA 3CE3A 2ZV7A 2NPQA 4UMQA 3E8DA 3PWDA 5JFXA 4GH2A 2GNIA 4XBRA 3D5UA 3F7WA 5ANIA 2J2IB 4O7YA 2OZOA 2W4OA 1MQ4A 3MH3A 4IVCA 4CT1A 2ITZA 4G6NA 2G1TA 4UMTA 4RG0A 4AWIA 4BRXA 4EH8A 5BYLA 2PZYA 3NW5A 4IH8A 4TL0A 5BYZA 5M4IA 2Y9QA 5FWKK 2ZM4A 2PMNX 4U3ZA 3OWLA 2B55A 2IZTA 3CD3A 4I6HA 3VHKA 5HEZA 2Z2WA 4M84A 3QRTA 3O96A 3QRKA 4O7RA 3R2YA 3LLTA 4R3CA 4I41A 2UZTA 4DEEA 2P2IA 3ZSHA 3KXZA 5CXZA 2X8IA 3DCVA 3OOMA 1SNXA 4APPA 1XH7A 1PKGA 1Q8ZA 3C50A 3UZTA 1PXOA 4KWPA 1XBBA 4DGLC 5E8XA 4TPTA 2ITXA 2ITVA 4DG0E 3LJ1A 3U9NA 4BN1A 4C37A 2ACXA 4C58A 3HUBA 1JKSA 3JVRA 1U54B 3NGAA 3DZQA 4JG7A 1XHAA 2BZKB 3DFCB 4QMUA 5J8IA 2YWPA 4WG3A 3DTCA 3HRFA 2RFDA 5M07A 3D0EA 4S32A 4CXAA 4NCTA 4YJVA 4E5WA 4L01A 4RZVA 4NZWB 4ACMA 5M55A 4XJ0A 3RK7A 3OY3A 2W5BA 4BI1A 3WILA 2C3IB 3DLZA 3QQGA 2O2UA 1Q3DA 1ZYJA 3UO6A 2QOIA 3QHWA 3G0EA 3ZUTA 3RZBA 4PMSA 3RAIA 1YXTA 5L6WL 4AZEA 2QI8A 2PMLX 2ZMDA 3HA6A 3BYOA 2GNFA 2OJGA 3ZO2A 2Y8OA 4DCAA 5GJGA 4C35A 4E93A 5BUJA 5KMLA 5IA5A 4JRNA 1XH9A 3O51A 3RNIA 4NWMA 4BHZA 4D9TA 3QLFA 4NKAA 4XG3A 3BCEA 2VGPA 4DH8A 3D14A 3ET7A 4FKRA 3QC9A 2NRYA 4KABA 5CT0A 2HW6A 2RGPA 4FV5A 2F2CB 3TCPA 5K4JA 4RA5A 3DXPA 5M4CA 5A6NA 3RCJA 5C01A 4GL9A 2WTVA 5K5NA 3DBDA 5K5XA 2UW4A 2BIYA 3F5XA 1Y8YA 2OJFE 3LXKA 5A4QA 4G3EA 3DAKA 4U81A 1Z5MA 2Y4IB 5FUTA 4CFWA 2WMAA 4BIDA 3KREA 1M2RA 3FE3A 4QTDA 3EWHA 3EFWA 4JT3A 3NR9A 4FUYA 4W9WA 3QCQA 4YTFA 5IZFA 3UPZA 4FTUA 1YHWA 1YOMA 2I0EA 3IK3A 3VN9A 5HVKA 2J0LA 3A8XA 3WF9A 5CY3A 4S30A 4AOJA 2UZWE 3WE4A 4R5SA 5A6OA 2PVMA 4BL1A 5A9UA 5DRDA 5IQDA 1ZWSA 3V51A 2AC3A 3TZMA 1Y8GA 2VTTA 2XYNA 1SM2A 5DH3A 3VW6A 4H3PA 3FLWA 4CYIA 2F7ZE 3GQLA 4J8MA 3TEIA 2BDJA 3MA6A 5ANOA 5JSMA 2W7XA 2BTRA 5HCYA 4DEIA 4BDEA 5HKMA 4OTQA 4E5BA 3HZTA 3AGMA 4AS0A 3QD4A 3FY0A 4AU8A 4F1OA 3U6HA 3ZUUA 3R1YA 1GJOA 4TNDA 2PVFA 2VTHA 5F1ZA 4R1VA 3DY7A 3S95A 2C6EA 3HECA 3NUSA 4EQMA 4I6QA 2C69A 4FIEA 2ONLC 4QOXA 4UB7A 5IISA 3PIYA 1YDTE 3FYJX 1BMKA 4J52A 3ULIA 1F0QA 4O7WA 4RJ6A 4BZOA 3OP5A 2RL5A 4QMTA 3TUBA 1PYXA 3ZSGA 3NUPA 3I4BA 2VTQA 4Q9SA 3PJ3A 3VS5A 4BY9E 2F2UA 3A99A 3UG1A 4RVLA 3G90X 3Q2MA 4FOCA 4I0RA 4J1RA 5EHYA 3ENMA 4ZSEA 4ZZOA 3A7IA 3Q60A 3QLGA 1ATPE 3QD3A 2QCSA 4AW1A 1FMKA 3A7HA 3NW7A 2JFMA 4FI1A 4X3FA 3W32A 4A4LA 2CLXA 3A2CA 4FTQA 3R83A 3L9LA 3VS2A 4GVJA 1OL6A 3TUCA 2QU5A 4LRKA 4KSQA 1OL2A 4YLJA 5CSWA 4ANLA 1REJA 2VO0A 3IS5A 4BDKA 3W8QA 3DTWA 4FNXA 3ROYA 3W33A 1V0PA 4BWXA 3KXGA 4I21A 4U40A 4FVPA 3DKGA 1F3MC 2QOKA 5CF5A 1J91A 4D2VA 5AP6A 4C57A 3U8WA 5M57A 5AX9A 2PYWA 5KMOA 1KE8A 5AUVA 1XH4A 2CKOA 4BTFA 2GS2A 3PA5A 5LWNA 2XF0A 3PJCA 5CS6A 4R5YA 4N57A 3FZRA 4MD7E 4ACHA 3IKAA 4FZ7A 2XCKA 2ZDUA 5HBJA 2E9OA 4TTHB 4NM5A 5E8VA 2WOTA 4N70A 3TWJA 4IAZA 2C5XA 3DNDA 4ALUA 4JBPA 1JQHA 2A0CX 4MEDA 3WYYA 4JS8A 2QOCA 2XVDA 3UOHA 5HU9A 2QR8A 5JQ8A 2BMCA 5CNOA 5L8JA 2IZRA 2PMIA 1UU8A 3FPQA 4DEAA 3UVPA 4AT5A 3KQ7A 1FQ1B 3ENHA 4BDGA 3NYOA 4F6WA 2XRWA 2BFYA 5EM8A 5JN2A 3GC8A 4ANBA 4CFXA 4YUQA 4OAUC 3ZSIA 5J5TA 4IAYA 3IW4A 4FZFB 5FRIA 5DT0A 4PMMA 2X4ZA 3GC0A 3PRIA 4FSZA 2YERA 1TQPA 4OTGA 2RKUA 4D5HA 4DEHA 3E3BX 1NVQA 3I60A 4UYNA 3U55A 4O96A 3IOPA 5F20A 4QMXA 2JEDA 3Q5IA 1DI8A 5CZHA 4DN5A 3ZM4A 3OW3A 2CCHA 4EJNA 4L46A 4WO5A 1LR4A 4DCEA 4Q2AA 4OTIA 3COMA 5DEYA 4ZTMA 4F63A 5KMMA 4Z55A 3DPKA 4D4RA 1XO2B 3HRCA 4CMOA 3FHRA 3U54A 3IG7A 3PVUA 4CT2A 3P5KA 3WIKA 2WMXA 3R9OA 1W98A 2QG7A 2W1EA 5AR3A 1IR3A 2W1ZA 4IZ7A 2QOLA 5EQYA 4IEBA 3VULA 4YTCA 4R78A 4JJRA 3A4PA 3WBLA 4HW7A 5A4EA 3MVMA 1UA2A 4CFVA 5H8GA 4EWHA 4OGRA 3LMIA 5HIBA 2W4JA 3SXFA 3WF7A 2EVAA 1TKIA 2R3RA 2R3MA 4C4JA 2X6EA 1ZARA 1FGKA 3QHRA 4XP2A 5M53A 4FTRA 4I92A 2V7AA 2CSNA 3MI9A 4X3FB 2ERKA 3RTPA 4CLIA 4AZWA 3UDBA 4FTOA 3ZLSA 3R00A 3V6SA 3E62A 4BKYA 4CNHA 2JIVA 4MBJA 3UQGA 5LQFA 2JIUA 4XNEA 1ZZLA 2UZUE 2V22A 3G2FA 4G31A 4AFJA 1Q99A 3FXZA 3REPA 5BX0A 4ZZNA 4RJ3A 4BZDA 2IVTA 4GT3A 4WD5A 4TNBA 4YNOA 4JBQA 2V0DA 5E90A 4PY1A 3TIYA 1FVVA 1DAYA 1BI7A 5L8KA 3ZBFA 5IA4A 5DGZA 4YHTA 5D7VA 2Z7SA 4WHZA 4EH7A 5JGAA 1U5QA 2IO6A 3DKFA 3PTGA 5DA3A 5HCZA 3VWAA 4CMUA 1IAHA 1PMUA 4HPUE 2WTJA 4FKLA 2ZB1A 5CSVA 1AD5A 2OK1A 3EFKA 4D9UA 3D7TA 3FI8A 5BMMA 3RVGA 4FSMA 5HBHA 2QODA 4IX6A 2OH0E 3UPXA 1YXUA 2R0IA 4FR4A 3SRVB 5IQCA 3BU6A 3P78A 4O38A 1YI3A 3P1AA 4E20A 3KRJA 3IW7A 4ZP5A 5JT2A 3ZC5A 4UMRA 1JKTA 1BL7A 4G6OA 3EIDA 4EH4A 1YHVA 4K77A 4KSPA 2YIQA 3RPYA 4NTTA 3CJGA 2E9UA 5CQWA 3ATSA 1IRKA 2XNPA 4FNYA 1B6CB 3ORLA 2XK3A 5DOSA 3BGZA 4FVQA 4W8EA 2XA4A 5KE0A 3TI1A 1YI4A 3FC2A 4AW5A 3NYNA 1URCA 1OGUA 4EYMA 5EW3A 4CKRA 5CXHA 3CKWA 4FG7A 5HE1A 3ZM9A 2BZIB 4RIWA 5G1XA 4ZS4A 2BVAA 1JSUA 3BU3A 2YLFA 3D4QA 4MBIA 3QGWA 1KE9A 4TWPA 3NZ0A 5HIDA 1G5SA 1UNLA 3CC6A 1ZZ2A 4FSNA 1QPEA 4FTTA 4K11A 5CYIA 3VF8A 2QHNA 2GS6A 3BWJA 3O8UA 5AR8A 2O63A 4F65A 1PXPA 4H3BA 4IM0A 4FV4A 3I7CA 5HG5A 3ATTA 5E4HA 4FX3A 3TT0A 1XWSA 1M14A 1NVSA 1O9UA 3E8EA 5HICA 1ZRZA 3GU6A 5EKOA 5FGKA 4DGMA 3D9VA 3LFNA 4GS6A 4LV8A 5DR9A 3MVLA 2R3QA 1Z57A 1YXXA 4YJNA 3F66A 3MPTA 5CF6A 3R8UA 2YDJA 4FV3A 3SHEA 5IA3A 4HYIA 4RQVA 4WUNA 4DAWA 1URWA 2WU7A 4BCFA 2BRNA 1W84A 4M68A 2BTSA 2YDIA 3TZ7A 5DLSA 4HCVA 4DFXE 2XNOA 4EONA 3S00A 3GUBA 3UOLA 2P2HA 4LRJA 2BRHA 5HG8A 4RBLA 3R7UA 3KXXA 5M06A 5LVPA 3R7EA 1WBSA 4YGAA 2VN9A 5AADA 5JMSA 3KY2A 3D2KA 4C4IA 3A7JA 2HK5A 5IUHA 2C6KA 4EH9A 1BUHA 1R1WA 5KCVA 4RX8A 5DR6A 4ZTHA 3KXMA 4UX9A 2OFUA 4YJTA 3OCTA 1DAWA 2YAAA 4FZAB 3KN5A 4ID7A 4F9CA 1T46A 2IZSA 2UW7A 3UMXA 4AACA 2PUPA 1QPCA 3BGPA 1FVRA 2CGUA 3V6RA 5CF8A 4CFNA 2P4IA 3C4XA 3AQVA 4DFUA 3U4UA 1W0XC 4QMVA 5H3QA 5IQFA 2QC6A 3QRIA 4ZZMA 3NUNA 4QP3A 3F2AA 4F7LA 3DK6A 5FLFA 5LARA 5FEQA 2W5HA 3UMWA 5FTOA 3PXKA 4IB0A 2DYLA 2QNJA 5EYKA 5D7AA 4AF3A 3QU0A 3IDBA 2GFCA 1H25A 5AV4A 4L7FA 1PXNA 4IFGA 1WBNA 5GHVA 4E4XA 1OIYA 5AIRA 3LXNA 5DWRA 5EM6A 3RAKA 2CJMA 3OWPA 5AMNA 2HZ0A 2J0KA 3RHKA 3UNJA 5AAFA 4KKHA 4O2PA 4EOSA 2PVKA 2X8DA 3QF9A 4LRMA 3HV3A 3SXSA 2PU8A 5CEIA 5IUIA 4Y46A 5HE2A 3EQGA 4NJDA 5JQ5A 2W5AA 2WQNA 4FL2A 5C9CA 4C2VA 4W8DA 4D2RA 4DEGA 4CFFA 3C4ZA 3R7YA 1CM8A 4EOOA 2CN5A 3M11A 3RWQA 5FD2A 1YDSE 4BTMA 4DGNA 3NCZA 5M56A 2BIKB 4ITHA 4AA5A 1UNGA 1W83A 3F2RA 2OIQA 3BBWA 3UOJA 1R3CA 3I79A 2R7BA 4I5HA 3V5QA 4C3FA 2PVRA 4ANMA 3MTLA 3H0YA 5AUXA 3W2RA 2X0GA 5DNRA 5AUUA 1WVXA 4MNEA 3EN5A 4OT6A 1NT2A 4HYSA 3UG2A 4XOYA 3CTQA 4CTBA 3ZO3A 4AE6A 3JYAA 4S33A 3RPSA 5HLNA 4YO4A 2G15A 3FKNA 3QTWA 2QO9A 3C4EA 4I6BA 2GNJA 2YM8A 4LL5A 3KMWA 4J96A 4IZAA 3I5ZA 5AP1A 2RIOA 2VTRA 3VBXA 5IPJA 2WQEA 1OBGA 5LVOA 4OBOA 3E87A 3E88A 2C6MA 2YAKA 1E9HA 3G9NA 2G2HA 3VQUA 5EDQA 4NSTA 1P2AA 3O23A 4FV8A 3Q3BA 5KKRB 1OIUA 3F9NA 4OT5A 4AN3A 4RIYB 3P7AA 2QOQA 3FZOA 2E9VA 5CALA 5HNIX 5JFWA 3U6IA 3VHEA 5BVFA 4A9RA 3HAVA 4TRLA 4YZNA 5IF1A 2Z7QA 3QTSA 2GU8A 2WTKC 2BZJA 3NCGA 4FA2A 2YLEA 4GSBA 2DUVA 5BVNA 3CBLA 4KIPA 1H0VA 2XKEA 4QMYA 4JBVA 3BKBA 1GZKA 1VYZA 5E1EA 3IW6A 3IW8A 3HV6A 3I7BA 4I24A 2VTMA 1ZOHA 4M15A 2QKWB 3KK9A 2XNGA 4YJOA 4WOVA 5DIAA 4F4PA 3MA3A 2X7GA 4OUCA 5EW8A 3ACJA 4NK9A 2GNLA 3TKHA 3W18A 1GIIA 3FAAA 3FLNC 4OBQA 1APME 5DHJA 3ZONA 4C4FA 4D4SA 3BYUA 3SXRA 1H26A 2JBPA 3IOKA 3MH0A 2C3JA 3R21A 3S4QA 5KMNA 4XX9A 3SD0A 3TNHA 4MF1A 2F49A 4CMTA 3ETAA 4QP8A 2X39A 5HU3A 1DI9A 1OECA 2OZAB 3LFBA 4RC2A 4C4EA 3KXHA 4KIOA 5BUEA 3BEAA 4JDIA 4MXOA 4PPBA 4EOJA 3OTUA 5LWMA 1NW1A 3VBYA 4KKEA 2W1GA 2C5NA 3FV8A 1ZYSA 4WA9A 3P4KA 4Y72A 4FKOA 1FOTA 2VO7A 3E8NA 3QUDA 4RVKA 5DPVA 4D5KA 5L3AA 1LUFA 1L8TA 1K9AA 3ZH8A 1OM1A 4YLLA 1PW2A 1R0EA 3CQEA 3H3CA 5CU2A 3CCNA 1H28A 2O5KA 3R1NA 4O0RA 3PSDA 2XJ1A 3UGCA 3N4UA 4NFNA 3PPKA 4B99A 3SG8A 4KIQA 2UUEA 4CZYB 3C0HA 3DXQA 1P4OA 1WZYA 2GHMA 4ASDA 4FKVA 3QWJA 3F2NA 5HORA 1PRYA 4G34A 4EOIA 2JDSA 2ITTA 5CU4A 1KE7A 3ZLYA 4DLJA 2ESMA 4UXLA 4WUAA 2J0MB 4FGBA 4TWNA 4MNEB 4ZY5A 4X2GA 4AT3A 4MXYA 5ANDA 4UMUA 5DG5A 3ZS5A 4IAFA 3KVWA 2PVYA 5M4FA 2ZVAA 4RC4A 3EQPA 2QLUA 3TNQB 4PQNA 1DS5A 3DQXA 2BHEA 2YZAA 2C1BA 5CNNA 3NWWA 3UODA 1U54A 5LMKA 2GPHA 5IQHA 4CFMA 3VIDA 2XBJA 4J98A 5TKDA 4IX5A 2VRXA 2ZV9A 3NDMA 2F7EE 2OU7A 3R8PA 3QQUA 4E73A 1KV1A 4L3PA 3KGAA 4RWLA 1HCKA 4O7LA 3V04A 4RQKA 3R0TA 4QMMA 2XM9A 3OROA 5TR6A 3TJCA 4AAAA 4XG7A 3BHYA 3FZTA 4KS8A 2WIHA 3EJ1A 4E3CA 4IW0A 5HIEA 1WBWA 5DRBA 2XCHA 2WQMA 3AGLA 2IVUA 5AJQA 4FL3A 2EB3A 4W4WA 5TF9A 2R9SA 4O7VA 3P08A 1AQ1A 4I0SA 4FVRA 3SLSA 4GFGA 4N6ZA 4D1ZA 4I4EA 3LAUA 5IEVA 3F6XA 2PVNA 3F5UA 3Q04A 2O0UA 2C6IA 3OW4A 3VJNA 1A48A 5T3QA 2Y7JA 4GVAA 2BUJA 3VS4A 1RE8A 4D1XA 5DBXA 4EQCA 4RJ7A 5B2MA 1OMWA 1SVGA 4JI9A 3EQRA 1ZYDA 5ETIA 2OG8A 4FV6A 3LFAA 1DM2A 3M1SA 4NTSA 4PNKA 3TDVA 3BBTB 4QP4A 1JLUE 3PA4A 4CG8A 2HENA 3AC4A 2XKCA 3EN9A 4TYIA 4GT5A 3DU8A 4GEOA 3OT8A 3BV3A 3TIZA 1R39A 4HGLA 4BKZA 4BBEA 3HV4A 3MDYA 4ZTSA 4M13A 4ZXTA 5IUGA 1U59A 4AX8A 3L9PA 2R3FA 4ACCA 4P2KA 4JNWA 2X2LA 2GCDA 4MNFA 5D41A 3EOCA 4FIFA 4WIHA 1J3HA 4M69B 4WNMA 2JITA 2HYYA 4ZY6A 3NPCA 5IMEA 5L2SA 4A4OA 3FI2A 2YWVA 3QTQA 2I1MA 3R1QA 5L2WA 4IZYA 5CEOA 3AG9A 5CI6A 1EH4A 3CGOA 4U44A 2X4FA 1SNUA 2FYSA 3MW1A 4CQGA 3PZHA 5CWZA 3D2IA 5GNKA 4IBMA 2XK9A 4Y85A 4AUAA 2W9ZB 4J99A 5F95A 2UW0A 4NCTC 4IAKA 3EFLA 4NJ3A 4FG9A 4U5JA 2BKKA 3VS7A 1TVOA 2HXQA 3P79A 4IVDA 2PWLA 4DGOA 3CKXA 5CEPA 3G15A 5J1VA 4U3YA 4O86A 4GU6A 4X21A 3PE2A 2VWZA 1SVEA 3ZYAA 5HCXA 2BAQA 2C30A 2ZM3A 4YSJA 5KMJA 4BDAA 2YISA 4DHFA 2X7OA 2RSVA 3FQSA 5CU3A 2JAMA 4FIHA 3ZC6A 4BGGA 4BGHA 4GG7A 4F7SA 3PG3A 4RWJA 4C4GA 4ZIMA 2WXVA 2PZ5A 3VRZA 2UVXA 4KBAA 5AP3A 3DNEA 3GFEA 3DDPA 3EKKA 2FGIA 3KCKA 4K1BA 4FIGA 4XP0A 4DEBA 3UE4A 4QQTA 3ALNA 5B7VA 5FDPA 5CVGA 3WZUA 1YXSA 4HNIA 4MXXA 2XIRA 2UZNA 3V5JA 3EQCA 3IDCA 4KA3A 4HVIA 3LW0A 4U7ZA 3NX8A 4R8QA 1L3RE 4EOPA 1H01A 4JR3A 2C6TA 2E2BA 4R6VA 3SOAA 3UZPA 1XH6A 3RPVA 5EYCA 3Q96A 5L8LA 5HLPA 2XK8A 2C3KA 3HEGA 2B7AA 3I0QA 4EC9A 3OG7A 2GQGA 5H9BA 4EH2A 4RVTA 4FK6A 5LCKA 4ONAA 2H6DA 2GNHA 3LFQA 4HCTA 4EH6A 1IA9A 4F64A 4PL3A 2ZDTA 4Y8DA 5B2LA 2XBAA 5I3RA 3DV3A 5C8NA 5DR2A 4IIRA 2W4KA 2FA2A 4AN9A 5CF4A 1JOWB 2XJ2A 5LXMA 1V0BA 2IW8A 1OKVA 4BCHA 5IEYA 4BCIA 3AC3A 2GS7A 1OI9A 1PYEA 2HW7A 3EYHA 3OBGA 2XM8A 4RX9A 1FGIA 4BVUA 4DF3A 1CKPA 3C4CA 4XRLA 4IB5A 4MVFA 2RFEA 1PXMA 3PG1A 4F08A 2WMBA 4GT4A 4F70A 4ERWA 3TV7A 2YM7A 3LFSA 1B38A 3BYSA 4M14A 4CEGA 4CLJA 4OTPA 4A4XA 2QLQA 5E8YA 4EKKA 4FKQA 3FL4A 2JDOA 3ZU7A 3R9RA 1Z9XA 2PE0A 4K18A 4PP9A 1J7IA 5AP7A 5KUPA 1IAJA 5HLWA 1GIJA 2VO3A 4BCJA 1KOAA 3H10A 4I3ZA 2A19B 2C0TA 2B9FA 4DTBA 5AEPA 1Q24A 4U41A 4OLIA 4G2FA 4FTLA 2ZV8A 2WMTA 3ANQA 3BYMA 5DN3A 2PZPA 4TZRA 4WBBB 2W9FB 2XJ0A 2C6LA 4X3FC 3TN8A 4EI4A 3AMBA 5AIKA 4HVSA 1RJBA 1QMZA 1YW2A 3G33A 3KEXA 4GK4A 4QMZA 4CYJA 4CZUA 1OZ1A 5AUZA 1SMHA 3DOGA 4MXCA 4EL9A 2YFXA 2YJSA 2PSQA 2VTOA 2XKDA 3QYWA 3LVPA 4DG2E 2I0HA 3CTJA 4ZLOA 3MJ2A 4AP7A 4CKJA 3QQKA 1LEWA 3PY0A 1WMKA 4DFLA 5IA1A 3W16A 4FKSA 3D5WA 3GVUA 5FBNC 1HOWA 1RDQE 3UYSA 5HI2A 4F1MA 3QUEA 2FO0A 1YVJA 2JDVA 5K0KA 4IDVA 4L42A 5CVHA 1MRVA 3ORMA 1ZOGA 4CVAA 4F7JA 4IJPA 1O6YA 2HY0A 2V55A 4B9DA 5A4CA 2FUMA 3H9RA 1Y6AA 3P7BA 3PXRA 4TYGA 4ASEA 3BE9A 3O0GA 1OIQA 5EDPA 3HP5A 4PNIA 2W99B 4MHAA 4XV2A 4BBFA 3H9OA 4QMOA 4XG6A 4JQEA 4BCMA 3O50A 4TWCA 3D15A 3DB8A 2JKOA 3GXLA 4IJ9A 3R63A 5DE2A 3VVHA 1PXIA 3EL7A 3WARA 4FT5A 4AGWA 3IQ7A 2H9VA 2UW5A 5D11A 4BIBA 4A06A 2FSMX 4IXPA 4LL0A 1OKYA 3Q9ZA 4JVGA 1H8FA 1IASA 2WGJA 3GU8A 3QZGA 2IVSA 4QTAA 3TV4A 5IH5A 4I20A 3IW5A 3O17A 3WF6A 4WKQA 4XMOA 1ZYCA 4LUEA 4IC7A 4HYUA 1WVYA 3RALA 4EK6A 2WTCA 3KC3A 4UWCA 3COHA 4YC6A 1OL1A 4XCUA 4JBOA 4A9UA 1RW8A 2VUWA 1TQMA 4L53A 4BIEA 4FKJA 3SRVA 4A9TA 4H05A 4H1MA 5ANJA 2B4SB 4PRJA 3ODZX 4IB1A 4U0IA 3UP2A 2XP2A 3NLBA 4NYEA 3G9LX 4N0SA 1Q4LA 4U97A 2E9NA 3F3UA 4GUBA 4ACGA 5CAVA 4G3CA 5C27A 3LMGA 4XH6A 2GFSA 4QMPA 3OTVA 5JRQA 3QZFA 4ZSGA 3R04A 4FZDB 1R78A 3EFJA 4MF0A 1QL6A 2EUFB 3CEKA 4IVAA 5DT4A 5ANEA 2PULA 3W8LA 3ACKA 2HZ4A 4DH7A 5A4LA 5AA8A 3N4TA 3UC4A 5IQEA 4APCA 3WIGA 5J7BA 2XK4A 1WVWA 2I40A 3FJQE 3DFAA 4QTCA 4RA4A 4YHFA 4O1PA 4BKJA 5HOAA 2W05A 1YHSA 2EXEA 4OBPA 5GJFA 3VUDA 3ZFXA 1WCCA 3E7VA 1M52A 4G9CA 4EJ7A 4EUUA 3DAJA 4LFIA 4D2PA 1ZLTA 2J0JA 3A7FA 4R7HA 4FIIA 4WBOA 4AZTA 3VS0A 1U5RA 1I09A 4QMWA 4B8MA 4I0TA 3JPVA 5AP5A 2XNEA 5BYYA 4RIXB 5DT3A 4MCVA 3DLSA 2A2AA 5AV2A 4JDKA 5DI1A 3VBVA 4H3QA 1LP4A 2ITNA 4DA5A 2PMOX 4EK3A 2AUHA 3DA6A 4YU2A 3ORZA 3EYGA 3MSSA 3R9HA 3IGGA 2RF9A 4BDCA 3I1AA 4HVDA 4BYIA 4GFOA 1A06A 4NIFB 5CI7A 3HDMA 2BALA 4TKSA 5C4KA 5ETFA 4C59A 1JSTA 2YDKA 3PSBA 4X6QC 3CXWA 1CKJA 4H1JA 4JAJA 4DBXA 2WPAA 4RWIA 3VS1A 2Y6OA 5FBOA 4BGQA 4PP7A 3BLRA 3HKOA 4G3FA 4LOOA 4PTEA 5EI8A 5FG8A 3W2QA 4BDFA 4F6SA 5IQGA 3U51A 3GCSA 5IDNA 3RK5A 4RZWA 2V62A 4YZDA 3OXIA 4W9XA 4YO6A 3AT3A 3Q6UA 3RBWA 5L4QA 4ZSLA 5ACKA 3OEFX 4QYYA 2ZMCA 3UNZA 3P7CA 4EKLA 3Q2JA 4XP3A 2OXYA 4XV9A 5ETCA 3UZRA 3R8VA 3BQCA 1OITA 2ETMA 2OWBA 4N6YA 2KTYA 4IQ6A 5DEWA 5GJDA 5HVYA 2XNNA 4PL5A 1OIRA 2R7IA 3L9MA 2B9HA 2ERZE 5FEDA 3HV5A 3ZLWA 4E7WA 4EK8A 4EZ3A 4LGHA 2GTNA 2WQOA 4XG9A 2LAVA 4DFZE 3UO5A 1G8SA 4CRSA 3QCSA 5E92A 4EORA 4GU9A 1H00A 3R7VA 3CY3A 3O8PA 3QD0A 4MWIA 4QQCA 3P86A 3MJ1A 4K2RA 3EZVA 4GJ3A 4BHNA 4MXAA 5E8SA 5BMSA 3NNXA 3QRJA 3BHVA 3ZFYA 3P9JA 5FXSA 3OHTA 4I94A 3UJGA 1XJDA 3VO3A 4G3GA 3FWQA 3F61A 2BFXA 2BZHB 2G9XA 3R01A 4FV1A 4BWKA 3CLYA 1H27A 3HMPA 3LFDA 4KBKA 5KHWA 2CGWA 3QRUA 4ASZA 2J6MA 4L67A 5A3XA 3G6GA 3QUPA 3ORNA 3QZHA 2ETRA 3LHJA 2W1FA 3R9DA 4UN0C 3ZDIA 4IZ5A 3HA8A 1K2PA 2BDWA 3VUMA 4ACDA 4ARKA 5AX3A 3LZBA 3O8TA 4ZOGA 2R3GA 1FVTA 4WT6A 3HMNA 4MH7A 4UV0A 4YSMA 2VV9A 2XIKA 4YJQA 3EQDA 3VJOA 4QP6A 2XMYA 2HOGA 4QD6A 3HUCA 4C33A 2YCFA 4F0IA 5AP0A 4K6ZA 5EG3A 3OD6X 2XNMA 3KRXA 4FMQA 4TXCA 3TNPC 3SG9A 3HLLA 2OLCA 1LEZA 5IMXA 3H0ZA 2IG7A 4D0XA 2YITA 5J7HA 2OI4X 4K33A 1ZMVA 2B52A 4XHKB 3NAXA 4XV3A 3WZEA 4AOTA 4C0TA 2C5YA 5HZNA 2UZBA 4M66A 1CTPE 4LM5A 3HMMA 3UO4A 2VZ6A 4XV1A 4D4VA 2F9GA 4WRGA 2WB8A 4ASXA 4ZLZA 2A1AB 4EC8A 3LFEA 1HCLA 2RFNA 4X2NA 1S9IA 3NIEA 2X9FA 4RIYA 3A4OX 3NNUA 4FSWA 4MBLA 4M8TA 5HG9A 3QA8A 4C38A 2I7QA 4R77A 1M2PA 4L6QA 5F4NA 4O7NA 4Q5HA 4V04A 3EN7A 1P5EA 3C4WA 2Z8CA 4XG2A 4IM3A 3W2PA 1M17A 3MS9A 3O71A 3LMHA 3DKCA 4R1YA 2GHLA 5L6PA 5LVNA 2JDTA 4IWQA 2HZIA 2JGZA 2PE2A 1VYWA 4KINA 4FSTA 3VNTA 5JH6A 4TT7A 1H07A 2WTIA 4GRBA 2GQRA 4EZ7A 5AV1A 3TZ8A 1O6KA 4FSUA 4KAOA 4G5JA 2PL0A 4J8NA 1YWVA 4RIOA 4RT7A 4BC6A 3QX4A 2ETKA 4LI5A 3WZKA 4E4NA 2WKMA 4F09A 5FQDC 3MB7A 4JG6A 3NAYA 3F7ZA 1BL6A 3QCXA 4BWPA 1GZOA 2YM5A 5J9LA 4ZTQA 3OY1A 3JS2A 3POZA 2OZAA 4R7IA 2WOUA 3E3PA 4YC3A 4A07A 3SA0A 2JC6A 2PVJA 3V5LA 5KMKA 4DBNA 1OUYA 4Q5EA 3KXNA 3C0IA 3SQQA 4O82A 3WI6A 1FPUA 3RMFA 4P90A 3NSZA 1XH5A 2QO7A 2FSLX 4GV1A 4LOQA 3UC3A 3VBWA 5J5SA 3IO7A 3BI6A 5AR4A 2VX3A 1IEPA 4AA4A 3MV5A 3CY2A 3PYYA 3TM0A 3RAHA 3B2WA 3R7OA 3SGCA 5G6VA 3NW6A 1H4LA 3D94A 4YPDA 3D7ZA 1YRPA 2O65A 2J9MA 5EDRA 4ZMFA 2QOBA 3VUIA 2QKRA 3L8SA 2HAKA 4QYFA 2CMWA 3ORXA 4GIIA 1XBCA 4WNPA 5HE0A 4ZAUA 3NUAA 4EHVA 3HRBA 2HWPA 4IFCA 4FEXA 2AYPA 1OKWA 3ALOA 2CLQA 3IECA 2ZAZA 3EMGA 5HO8A 3BQRA 2VTAA 5E8WA 3BWFA 2X8EA 4HGSA 2B53A 3MIAA 4HCUA 4FTNA 1ZY5A 2BRMA 2EXCX 3GT8A 3PFQA 4Z7GA 5KMIA 5M08A 2EWAA 5E8UA 4U79A 2C4GA 1PJKA 1WFCA 3GP0A 3VUTA 5J9ZA 2IPXA 3TG1A 5E8ZA 3EQHA 4B8LA 2YIYA 3DXNA 3BPRA 5BNJA 1JWHA 4UEUA 2PE1A 1NVRA 2R2PA 2XKFA 4CV8A 2W17A 5CSPA 5HHWA 4LV5A 3FUPA 4BCQA 4EH3A 4O2ZA 3Q32A 2P55A 4OW8A 4QMQA 2O8YA 3FC1X 5KNJA 2XIXA 3QXPA 3V01A 3WF5A 5LVLA 3C9WA 3FKLA 5TE0A 2YIXA 3BHHA 5HTIA 4V0GA 4YURA 4LQMA 4MXZA 5KHXA 2VTIA 4I93A 4PWNA 1J7LA 4RSSA 4X3JA 4FKGA 4EK4A 5FDXA 5CLPA 3JVSA 1GIHA 2WZJA 5FTGA 4DEDA 2R3NA 4PDSA 1BLXA 1YQJA 4C8BA 1OB3A 3COKA 3BRBA 4R7BA 5FXRA 2CKEA 4AXAA 1YOJA 2JBOA 2YM6A 5IKWA 2QD9A 2UZDA 3PRFA 4C3RA 3OMVA 4FL1A 1Q8TA 5JGDA 3GC7A 2I0YA 2J4ZA 4AZSA 4X2FA 5CSHA 3V5TA 4ZLYA 3PLSA 3GQIA 4R3PA 4KRDA 1YOLA 4DE4A 3D83A 4MQ1A 3P23A 3DK7A 2OIBA 2XK6A 3KRLA 1H1SA 3QD2B 4ENYA 4PL4A 3PPJA 3R8MA 4BCPA 1XKKA 2PVLA 2VWBA 4BFMA 5A4TA 3B2TA 4K9YA 2R3HA 2JFLA 3QKKA 3OZ6A 4YP8A 4QTBA 3FMNA 2YN8A 3R28A 1KWPA 2YJRA 1RQQA 3LJ0A 4PDOA 4FTAA 4L3JA 1CKIA 2BAJA 3S2PA 1CSNA 4FSQA 5CTPA 5HBEA 3PY3A 2WMQA 2NP8A 4X2JA 3SC1A 5CVFA 2JKMA 3V8SA 3FMKA 1KOBA 4IWOA 5CANA 2C0IA 4K0YA 4NFMA 3A60A 4ANQA 4F7NA 3JR1A 1Q8UA 4RC3A 1BYGA 4M69A 4EQUA 2IWIA 3CPCA 3DGKA 1PMNA 2WEIA 4FODA 4BDHA 5GIOE 4HGEA 3OS3A 2UZEA 4IDTA 4P5QA 5CEKA 3FQEA 1MRYA 3LCDA 4H39A 5LOHA 5LMKC 1J7UA 1UU3A 3NVKI 3GC9A 4C3PA 1JSVA 2B9JA 2ITWA 1Q8WA 5IQBA 3R1SA 4IHPA 4FTMA 2X2MA 2VNWA 4JIKA 3EN6A 1GZNA 1XH8A 3T3UA 3U87A 4Z16A 1REKA 2BRGA 5IEXA 4DFYA 3FLSA 5HNBA 5HO7A 3ZZEA 3QWKA 4KIKA 2OJJA 3O2MA 4PPAA 4RPVA 3VW8A 2XEZA 5HVJA 3DB6A 3E92A 5AAGA 4F9BA 1ERKA 1QCFA 5ITAA 1SVHA 3C5UA 5J9YA 4EWQA 4GK2A 3I81A 3DKOA 4MAOA 4QYEA 4PDPA 4K8AA 4ZSJA 4QTEA 2C0OA 4BCNA 4TYHB 4FKIA 3R9NA 3CS9A 2GNGA 4FK3A 4ITJA 4UZHA 5CZIA 4A7CA 3ZFMA 4XRJA 2CCIA 1W7HA 2HZNA 2WHBA 3K2LA 5CX9A 5D9HA 3ZUVA 5CEMA 4ZJVA 5LVMA 1FBNA 4TY1A 3LCOA 4V01A 4HPTE 4CCBA 2I0VA 4CFUA 4FC0A 3F69A 3QAME 3GGFA 4V0GB 4GG5A 5AM7A 2NRUA 3ORKA 4ZSAA 1VJYA 3SVVA 2X1NA 3FEGA 2HXLA 3GCVA 1MQBA 3ELJA 4AZFA 3SX9A 3FMMA 4OTDA 1WAKA 2QOHA 3TNWA 2DQ7X 3R2BA 3ZEWA 2Y4IC 3GU5A 3MYGA 4NW6A 4EHGA 4FEUA 3OXZA 2JDRA 4XEYA 2VWIA 3LM5A 4C61A 1A9UA 2F7XE 4FE2A 3RM6A 1Y6BA 4U8ZA 4AQCA 4J7BA 3HV7A 4EK5A 3MWUA 4FNZA 2X6DA 2VO6A 3DBQA 3Q52A 4O0UA 4ZTLA 3FXWA 3Q9WA 1IG1A 3OF0A 4FTCA 3CPBA 4HJOA 4QMLA 4U42A 4X2KA 3PP0A 3ZXTA 5IG1A 3HGKA 3R8LA 5EKNA 3PY1A 4D58A 4HZRA 4FNWA 5H2UA 5EH0A 1U46A 4M97A 4XYFA 3JY9A 3VUGA 4HGTA 2UV2A 2VTNA 4I23A 5CU0A 3K3JA 3KRRA 4JLCA 3GNIB 1OL5A 5E8TA 5KX8A 3POOA 1Y91A 4IAIA 4GKHA 4AT4A 4C02A 2FVDA 5CAUA 1UWHA 2OFVA 4IAAA 3HDNA 2NO3A 4ERKA 4F9YA 2WTWA 2YCSA 4QYGA 3E63A 3NNVA 4U43A 2CKPA 2OXDA 1CDKA 3HYHA 1O6LA 3RJCA 4IC8A 5AUTA 4XUFA 4L68A 2XNBA 3LE6A 3DJ6A 4OTHA 2UW3A 2YEXA 4FT0A 3SAYA 3LM0A 4YC8A 4WNOA 4XOZA 3VBTA 2WTKB 4FT7A 3MFSA 3HMOA 5CU6A 4OTWA 3MH1A 5EYMA 2Q83A 3NNWA 4FUXA 2Z7LA 3I0OA 4ITIA 3KVXA 4ZMEA 4FV2A 4BICA 4LGGA 4XS2A 5HTCA 3D5VA 3KU2A 3Q53A 1R0PA 4DGGA 2CDZA 3AC5A 4RJ4A 4KIKB 3PIZA 2WEVA 4P5ZA 5IQIA 2C6DA 4DH1A 5C1QB 4YZMA 2OF4A 4YHJA 4BI0A 2F4JA 4G9RA 1H1WA 5AWMA 4FT3A 3LXPA 4I4FA 4I5CA 1M7NA 4FKTA 3TTJA 3ZOSA 3PLAE 3QBNA 4PTGA 3CGFA 3F5GA 5CAQA 3H4JA 3LFFA 4QT1A 3MPMA 1E1VA 4C4HA 4G6LA 4ZTNA 4DH3A 3AC8A 1G3NA 4E6DA 2WMRA 4TYEA 3E93A 4D4YA 4ZJJA 4E26A 3KMUA 3B8QA 4Z3VA 3IDPA 5HX6A 5E91A 3FSKA 3Q6WA 3R30A 3Q9XA 2G2IA 4L43A 4PUZA 1PXLA 5HESA 2IW9A 3R22A 4YZBA 5F9EA 4FEWA 2J0IA 4NH1A 2GDOA 3IGOA 2IJMA 4DTKA 5JRSA 3EQBA 1SZMA 3F5PA 5CENA 5HTBA 4AA0A 5EOLA 2WU6A 3ZRLA 2VWYA 3GENA 4QPSA 2XUUA 3UBDA 2OIDA 4MTAA 3QGYA 1BI8A 1UU7A 3OCBA 2HCKA 1V0OA 1UWJA 3RPOA 3RWPA 3FLQA 4IANA 5J95A 5CAOA 4FSRA 4GW8A 4RFZA 3PXZA 4NU1A 4O7SA 1JKLA 4ENXA 4KB8A 1PY5A 5A54A 4E5AX 1OBDA 3MFRA 4QMNA 3BV2A 4O0SA 2PVHA 4H36A 5BVKA 5ANGA 2CGVA 4PF4A 3CJFA 4F99A 3BYVA 3GCPA 2UW8A 4P4CA 5FP6A 4AGUA 4IWPA 3L8XA 4ORKA 4CD0A 2VNYA 3TJDA 2UVYA 4IACA 2OO8X 4QYHA 3RHXA 1AGWA 5CQUA 4ZEGA 3QX2A 3QQFA 2HWOA 4MWHA 4M0YA 4Y5HA 3GEQA 3H9FA 2KULA 3EQFA 4BDJA 4FBXA 3K5UA 2IN6A 2B1PA 2PUUA 3EQIA 4X0MA 3RK9A 3WF8A 3VS6A 4AGDA 2R3LA 2JLDA 1ZYLA 1NXKA 3L8PA 4M3QA 1H1PA 2YIWA 4YLKA 4D0WA 1ZMWA 4WNKA 3ROCA 4PDYA 2W1HA 5T6KA 3VC4A 4TN6A 5GZ9A 2CN8A 3OWKA 5C8KA 1PMVA 2Q0NA 4MX9A 4U45A 4J53A 3KL8A 3WYXA 4EOQA 5DMZA 3S1HA 3SW7A 2DS1A 2OXXA 3DBEA 5D1JA 5BVDA 4U6RA 4QNAA 3THBA 5IH4A 3F3ZA 1WBVA 2Y4PA 5M09A 3A8WA 2EB2A 1PXJA 3QALE 4BCOA 2J90A 5AUWA 5CT7A 5AAEA 4JQ7A 4D28A 5JKGA 5BVOA 2BROA 3HP2A 3PIXA 2VTPA 3OOGA 5D10A 3RAWA 3W55A 1YXVA 1V1KA 3F3VA 5JGBA 1JKKA 4AOIA 2GHGA 3BLHA 3NRMA 4LMNA 4RIXA 4OTRA 2QO2A 3RINA 1Q5KA 1G8AA 4JIAA 4L52A 3AMYA 5BPYA 4F1TA 1GZ8A 1UU9A 3GU4A 3EKNA 2W1IA 4DC2A 3R7IA 4UBAA 3U9CA 4JOAA 1JBPE 2OGVA 4CKIA 3BX5A 4FTJA 4BTJA 4NIFA 4RMZA 3ORTA 4UZDA 1PKDA 3FQHA 3FY2A 4NM3A 2BR1A 4PMPA 4OR5A 5LJJA 3QQJA 4LMUA 4FSYA 3QCYA 5ACBC 5E9EA 4G16A 4YBJA 3GCUA 3Q5ZA 2HIWA 5AFVA 3MPAA 5K9IA 1F5QA 3UP7A 3AXWA 4JL9A 3WZJA 5I9XA 5I9YA 3VRYA 4KUJA 4UALA 5AR7A 3OWJA 5L2TA 3NVMB 4YZ9A 4O83A 4ZTRA 3W10A 5JEBA 2RG6A 2JIIA 3VUKA 4DITA 3PVGA 4E6QA 2YM3A 4FV9A 2C6OA 4PMTA 5AV3A 5KZ0A 5HNGA 5B0XA 4WRSA 3T8OA 3N51A 4FG8A 5CASA 2HY81 3NS9A 2BPMA 2J50A 3LCTA 2PUIA 4DH5A 3V5WA 2ONLA 1H1QA 5AV0A 2W0JA 4FYOA 4GJ2A 5M4UA 4JX7A 2YACA 5F94A 4O0VA 1T45A 4M0ZA 3OCSA 5FEEA 4IMYA 4L00A 3IONA 3Q4ZA 5HX8A 5AP2A 3HMIA 3OUNB 5JK3A 2VWXA 4IM2A 2WMWA 4YJSA 3ODYX 1KV2A 4FF8A 3E7OA 2Y0AA 4E8AA 3DK3A 4HNFA 2OBJA 5EQEA 3UTOA 2BKZA 3QQLA 3L1SA 4MKCA 4BI2A 3DBFA 3CQUA 1M7QA 2P3GX 1OVEA 2JKQA 3UYTA 3W2CA 3SKCA 4HVGA 4USFA 5A46A 3QTUA 3LCKA 2E9PA 4O6EA 5GZ8A 4IVBA 2QQ7A 4W4XA 2YIRA 3KKVA 2A27A 4AW2A 3QTRA 4UWYA 5EYDA 5EHLA
chains in the Genus database with same CATH superfamily
3OBJA 5M51A 2A4LA 2J51A 3HAMA 3A7GA 3PE1A 5JFSA 4E6AA 5EQPA 2RG5A 4RFMA 4CZTA 5ETAA 4F0GA 5JFVA 3PA3A 4O27B 4LYNA 4TWOA 3UIBA 2VD5A 4NEUA 3DBCA 5KZIA 3C5IA 4EYJA 2X9EA 3LQ5A 1M2QA 3PPZA 4Z7HA 5D12A 5FP5A 3MVJA 3NFGB 1PXKA 3ZDUA 2WQBA 5K4IA 1S9JA 3K5VA 3TV6A 5EM7A 4PTCA 5FXQA 3EL8A 3LKMA 4G3DA 2BDFA 3BEGA 4UMPA 4G17A 5IA2A 2C47A 2G2FA 2A98A 4AFEA 4MD8E 1PMEA 1OPKA 2X7FA 4S31A 2ZYBA 3I5NA 4IWDA 4WSQA 1XR1A 3FPMA 3KN6A 1QPDA 5AUYA 5LCJA 2FSOX 1YWRA 5TOZA 1B39A 4EUTA 5L6OA 3O7LB 3R02A 3QKMA 1H08A 4NM0A 3ZHPC 3LQ3A 4QQJA 1ZY4A 4O0TA 3VS3A 2O3PA 3T3VA 1ZMUA 5HGIA 3FMHA 2JAVA 3O5AA 1OL7A 4Q9ZA 2B0QA 5J1WA 2R4BA 3FI4A 2OICA 3CTHA 3FSFA 5T68A 3WOWA 3DAEA 4H58A 2WMSA 3MH2A 3QTXA 4S34A 4FKUA 4AE9A 1YDRE 5LMAA 5KO1A 3RM7A 2F57A 4I5PA 5DFPA 3NYXA 3QKLA 4B6LA 3FMLA 4XG4A 3AD4A 2ZM1A 5BUIA 4KKGA 3AKJA 4NKSA 3LPBA 4PPCA 4EZ5A 3LIJA 4NL0A 3G5DA 3KF7A 4FKWA 3B8RA 4C34A 2R3JA 3QC4A 2BCJA 4RJ5A 5EFQA 3KK8A 3OC1A 2BILB 3NUXA 3PZEA 4BZNA 1W82A 4GUEA 4EOLA 3SOCA 3LQ8A 4JX3A 4ANNA 3ZRKA 3BLQA 1JAMA 3FMEA 4RWKA 3FHIA 2SRCA 2QVSE 2VGOA 4RJ8A 4RVMA 3UOKA 3R6XA 4B0GA 4BCKA 4LV7A 4QDVA 1JPAA 5I9UA 4RX7A 4I6FA 3FZPA 3E5AA 2H34A 3KMMA 2QOOA 2P33A 3ZXZA 1VEBA 4CG9A 1E1XA 3QL8A 4JRVA 5L2QA 4TYJA 2XEYA 4GCJA 3BGQA 2V5QA 3F3WA 2ITQA 3AC1A 4RLLA 2ZJWA 4G5PA 5J79A 2Z7RA 4DINA 3CIKA 3EH9A 4A9YA 1STCE 2WAJA 2ITUA 4P7EA 2VWVA 1XBAA 5EHOA 4XLIA 5FM2A 5HE3A 2B9IA 3H30A 4UYAA 3F88A 3UVRA 1OPLA 5I9VA 4LG4A 5KKRC 3PJ8A 2J7TA 1TFFA 3BU5A 4IX4A 4Y5QA 3VQHA 3JXWA 2WMVA 5CEQA 4L45A 4D1SA 4GK3A 4W4YA 4DT9A 5BVWA 3GCQA 3LLAA 4YTIA 2W96B 3UIMA 5CAPA 4NT4A 1JVPP 2XRUA 4BR3A 2IVVA 4WG4A 3OCGA 3I6UA 2R3PA 3K3IA 4IB3A 2ZB0A 4O0YA 3LOKA 3MGYA 4FZ6A 3VAPA 1FMOE 4L3LA 5ANKA 5GIPE 5I0BA 2CHLA 2HELA 2H96A 5K0XA 3R73A 2YCQA 2EXMA 3CQWA 3QQHA 4CV9A 5HD7A 3Q4UA 4Y73A 2IW6A 3RKBA 3DT1A 2GTMA 4E6CA 2YCRA 3BIZA 2VX1A 3GOKA 4YZCA 4USDA 3MESA 2UZOA 4QP1A 3RI1A 3VBQA 3PVWA 4BDDA 2P0CA 4O7TA 4YJPA 2WTDA 2R3OA 3RNYA 2R0UA 3ERKA 4M7IA 4O81A 3GOPA 4FOBA 3FMJA 2JD5A 2X0QA 3G6HA 5HO6A 2WMUA 3QZIA 3BZ3A 4EBVA 5I5ZA 5JZJA 2R64A 2PPQA 2CGXA 5E7RA 2XZSA 4J71A 2YA9A 5EK7A 3NEWA 3S0OA 1J1BA 3IPHA 3GI3A 3SDJA 1Q8YA 2PY3A 3QTIA 2J5EA 4CCUA 2IZUA 2VX0A 2Y6MA 4LGDA 4KNBA 2G01A 4ANSA 1Q3WA 3N9XA 1MRUA 2GQSA 3PSCA 4EEVA 2UW9A 4UY9A 3TYKA 3MB6A 4FV0A 1QPJA 4FYNA 3TTIA 3NMUF 3DJ7A 1J1CA 2W1DA 4AW0A 2PZIA 1YI6A 2R3KA 3MFUA 4DFBA 3NUYA 4O22A 1WBPA 3PXFA 2PTKA 4FTIA 4FICA 4I22A 1Q97A 4UWBA 4F0FA 3DJ5A 3F82A 5HG7A 3VF9A 4ALVA 3ID6C 3FYKX 1Y57A 2YZLA 2J5FA 2OJ9A 2XK7A 2OKRA 5EI2A 2VWWA 4NM7A 1UKIA 3NYVA 3ORPA 2PK9A 4RFYA 4WG5A 4O1OA 3BELA 4MD9E 3RGFA 4JR7A 3UIXA 4NW5A 3VUHA 2QONA 3D7TB 4BB4A 3AT4A 4WSYA 3PWYA 5FTQA 2Q0BA 2XANA 4GKIA 2PUNA 3U4WA 3ZRMA 2VU3A 3G0FA 1VZOA 4V05A 1BKXA 4HYHA 5BVEA 1BX6A 4EBWA 3UQCA 2QOFA 3A61A 3LCSA 3DQWA 3V3VA 5ICPA 2CKQA 2ZOQA 2H8HA 3CP9A 3GBZA 4YR8A 4MYGA 4O91A 1KUTA 2XIZA 4II5A 4C62A 3ZBXA 4ZS0A 2W1CA 3ZCLA 3ZO1A 4CRLA 3MVHA 1UV5A 3M2WA 4IE9A 3QXOA 3QTZA 4O0XA 1Q62A 4QQ5A 4O84A 4QPMA 2C5VA 5AM6A 3UVQA 4M12A 3ZO4A 4DLIA 4XLVA 5C8MA 1UKHA 3FXXA 4FV7A 3SW4A 4B4LA 4USEA 5EOBA 3OEZA 3PJ1A 4FIJA 3GFWA 3PXQA 4RLKA 4TYHA 4KS7A 4X7QA 3W2SA 3FI3A 4U9AA 3AMAA 3PP1A 2C68A 2WFYA 4RIWB 5DYJA 4YBKA 5AA9A 2AC5A 3RP9A 3TKIA 3CD8A 4I5MA 5C4LA 2BRBA 5IDPA 1H24A 3EHAA 3E64A 3O7LD 3ANRA 4HVHA 2NNWB 4ALWA 3ZMMA 5TO8A 4RGJA 4C2WA 5C03A 5IU2A 3ULZA 3PDTA 3QYZA 2CNQA 4O7ZA 1Q61A 4GYIA 5GZAA 2UVZA 3FLZA 4FGRA 4DT8A 2UW6A 5M44A 3KB7A 4OAVB 1Q41A 3TZ9A 1GNGA 4YJRA 3C51A 4YTHA 4CSVA 2EU9A 2ITYA 5AR5A 5IQAA 3PUPA 3W0NA 1VR2A 2OF2A 2VTSA 3GU7A 3QFVA 4GIHA 4B7TA 3UIUA 2C3LA 4DTAA 3COIA 5CSXA 1TQIA 3MBLA 4XBUA 5E1SA 3R8ZA 2QR7A 3W2OA 4DYMA 3I6WA 3C13A 2WIPA 3FMDA 3TKUA 1NY3A 4AN2A 4E1ZA 4UXQA 5J87A 5KBQA 5GINE 4EOKA 4JDJA 4R3RA 1KSWA 3ZEPA 5LMBA 1X8BA 2C5OA 4KRCA 2FSTX 2YABA 1CMKE 3BE2A 4ZJIA 4BTKA 5IH6A 4G1WA 1KE6A 3PVBA 4N4SA 3LXLA 4CQEA 4YMJA 4C7TA 2QHMA 4DG3E 3KULA 2I6LA 2PHKA 3PJ2A 4FT9A 4D2WA 1I44A 1UNHA 4ZY4A 2OH4A 3DDQA 3KA0A 4GMYA 4QPAA 4Y95A 3W0SA 4XG8A 3E8CA 3G51A 1IA8A 4A9SA 2QU6A 2YHVA 3Q9YA 3A62A 5AP4A 2O64A 5B2KA 2CPKE 5HD4A 3EZRA 4QP2A 1U4DA 1GY3A 4E4MA 1GAGA 2R3IA 4AGCA 1MP8A 3Q4TA 3AOXA 3ZZWA 3FL5A 5I9ZA 2BAKA 3HVCA 4QP7A 3QA0A 3TUDA 4AZVA 2GSFA 3V8TA 3BHUA 5AR2A 2LGCA 5KBRA 3WZDA 3GB2A 5EM5A 4MK0A 3LFCA 5DVRA 3SV0A 4BBMA 3MIYA 2ITPA 2W06A 4L7SA 4BDIA 2VTLA 2WO6A 2B54A 2FB8A 3EB0A 4QEBA 3KRWA 3MFTA 4JDHA 3DS6A 3KF4A 2PZRA 4JQ8A 4L9IA 5I3OA 1YKRA 5H8BA 4BYJA 3F3TA 3R7GA 5H8EA 3ZLXA 3M42A 5A14A 4OTFA 4BF2A 5TT7A 4EH5A 4Z9LA 3AD6A 4ANOA 3C4FA 2OSCA 1FINA 3OT3A 4BDBA 2XH5A 2OJIA 3LJ2A 3NIZA 4J97A 4FTKA 3S3IA 4EHEA 3DZOA 1OPJA 3R71A 3UQFA 3OFMA 2JKKA 3P0MA 4O21A 3L9NA 1WBTA 2R5TA 4QP9A 3TNIA 3RCDA 2ZV2A 4O6LA 4M67A 4Y83A 3AC2A 1UVRA 2C1AA 1WBOA 3FLYA 3NUUA 1LPUA 4IX3A 4LUDA 3TACA 3HL7A 1ND4A 2X81A 1P14A 2YM4A 4FKPA 4PX6A 1PF8A 3HNGA 3ORIA 1SYKA 4TW9A 3TL8A 1JNKA 3CR0A 3FZ1A 3MY1A 5I9WA 2XS0A 1W8CA 5C26A 4GYGA 2UZLA 2QURA 2UZVA 1K3AA 2V7OA 2RFSA 4JAIA 1OKZA 4F9WA 4D2SA 3FBVA 4L8MA 1OUKA 3L8VA 4IADA 2DWBA 3AD5A 4PV0A 4BCGA 5I4NA 4S2ZA 3D5XA 3U6JA 5K3YA 4J95A 3OUKA 5EI6A 4LOPA 3EN4A 4JG8A 3RPRA 3C7QA 3TXOA 5BQ0A 4MQ2A 1P4FA 4NUSA 3C1XA 4C36A 2OW3A 5JZNA 2FH9A 3MN3A 4E4LA 4GFMA 4O0WA 4JXFA 5L2IA 4L44A 3BHTA 3FKOA 1GOLA 3PXYA 3FDNA 2Z02A 4QO9A 2WD1A 4QRCA 3OVVA 4X6RA 4HOKA 4FEQA 2NYAA 4DFNA 3MTFA 3JY0A 5HQ0A 2WNTA 3KCFA 3V5PA 2ITOA 3KULB 1NA7A 4KD1A 1ZXEA 5FM3A 2Z60A 4RX5A 4QNYA 5EW9A 3CSVA 2X2KA 2XYUA 2VAGA 3AT2A 4ZK5A 5IA0A 3W0OA 2GMXA 2CNVA 1PHKA 3UNKA 1MUOA 3HX4A 1ZAOA 3MY5A 3II5A 3ZTXA 4EOMA 1KE5A 4FEVA 2CNUA 4KBCA 4W4VA 3TDWA 3N4VA 4YPSA 3V8WA 2VWUA 2WELA 4F9AA 1H1RA 3WE8A 1YWNA 3JUHA 2VTJA 4RRVA 3C0GA 3RZFA 4HZSA 4YNEA 3T9TA 3K54A 1H0WA 3MY0A 3W1FA 2REIA 4D2TA 1XQZA 2XB7A 3Q4CA 2QG5A 2XIYA 4D55A 3UDZA 1ZOEA 4U80A 4F6UA 4CGAA 4YJUA 3KFAA 3OXTA 4EHZA 4QMSA 3T9IA 3FZSA 4CTCA 4AG8A 2BHHA 3ITZA 4I1ZA 3CE3A 2ZV7A 2NPQA 4UMQA 3E8DA 3PWDA 5JFXA 4GH2A 2GNIA 4XBRA 3D5UA 3F7WA 5ANIA 2J2IB 4O7YA 2OZOA 2W4OA 1MQ4A 3MH3A 4IVCA 4CT1A 2ITZA 4G6NA 2G1TA 4UMTA 4RG0A 4AWIA 4BRXA 4EH8A 5BYLA 2PZYA 3BLAA 3NW5A 4IH8A 4TL0A 5BYZA 5M4IA 2Y9QA 5FWKK 2ZM4A 2PMNX 4U3ZA 3OWLA 2B55A 2IZTA 3CD3A 4I6HA 3VHKA 5HEZA 2Z2WA 4M84A 3QRTA 3O96A 3QRKA 4O7RA 3R2YA 3LLTA 4R3CA 4I41A 2UZTA 4DEEA 2P2IA 3ZSHA 3KXZA 5CXZA 2X8IA 3DCVA 3OOMA 1SNXA 4APPA 1XH7A 1PKGA 1Q8ZA 3C50A 3UZTA 1PXOA 4KWPA 1XBBA 4DGLC 5E8XA 4TPTA 2ITXA 2ITVA 4DG0E 3LJ1A 3U9NA 4BN1A 4C37A 2ACXA 4C58A 3HUBA 1JKSA 3JVRA 1U54B 3NGAA 3DZQA 4JG7A 4O4DA 1XMMA 1XHAA 2BZKB 3DFCB 4QMUA 5J8IA 2YWPA 4WG3A 3DTCA 3HRFA 3TMOA 2RFDA 5M07A 3D0EA 4S32A 4CXAA 4NCTA 4YJVA 3VONA 4E5WA 4L01A 4RZVA 4NZWB 4ACMA 5M55A 4XJ0A 3RK7A 3OY3A 2W5BA 4BI1A 1XMLA 3WILA 2C3IB 3DLZA 3QQGA 2O2UA 1Q3DA 1ZYJA 3UO6A 2QOIA 3QHWA 3G0EA 3ZUTA 3RZBA 4PMSA 3RAIA 1YXTA 5L6WL 4AZEA 2QI8A 2PMLX 2ZMDA 3HA6A 3BYOA 2GNFA 2OJGA 3ZO2A 2Y8OA 4DCAA 5GJGA 4C35A 4E93A 5BUJA 5KMLA 5IA5A 4JRNA 1XH9A 3O51A 3RNIA 4NWMA 4BHZA 4D9TA 3QLFA 3PFYA 4NKAA 4XG3A 3BCEA 2VGPA 4DH8A 3D14A 3ET7A 4FKRA 3QC9A 2NRYA 4KABA 5CT0A 2HW6A 2RGPA 4FV5A 2F2CB 3TCPA 5K4JA 4RA5A 3DXPA 5M4CA 5A6NA 3RCJA 5C01A 4GL9A 2WTVA 5K5NA 3DBDA 5K5XA 2UW4A 2BIYA 3F5XA 1Y8YA 2OJFE 3LXKA 5A4QA 4G3EA 3DAKA 4U81A 1Z5MA 2Y4IB 5FUTA 4CFWA 2WMAA 4BIDA 3KREA 1M2RA 3FE3A 4QTDA 3EWHA 3EFWA 4JT3A 3NR9A 4FUYA 4W9WA 3QCQA 4YTFA 5IZFA 3UPZA 4FTUA 1YHWA 1YOMA 2I0EA 3IK3A 3VN9A 5HVKA 2J0LA 3A8XA 3WF9A 5CY3A 4S30A 4MUQA 4AOJA 2UZWE 3WE4A 4R5SA 5A6OA 2PVMA 4BL1A 5A9UA 5DRDA 5IQDA 1ZWSA 3V51A 2AC3A 3TZMA 1Y8GA 2VTTA 2XYNA 1SM2A 5DH3A 3VW6A 4H3PA 3FLWA 4CYIA 2F7ZE 3GQLA 4J8MA 3TEIA 2BDJA 3MA6A 5ANOA 5JSMA 2W7XA 2BTRA 5HCYA 4DEIA 4AXFA 4BDEA 5HKMA 4OTQA 4E5BA 3HZTA 3AGMA 4AS0A 3QD4A 3FY0A 4AU8A 4F1OA 3U6HA 3ZUUA 3R1YA 1GJOA 4TNDA 2PVFA 2VTHA 5F1ZA 4R1VA 3DY7A 3S95A 2C6EA 3HECA 3NUSA 4EQMA 4I6QA 2C69A 4FIEA 2ONLC 4QOXA 4UB7A 5IISA 3PIYA 1YDTE 3FYJX 1BMKA 4J52A 3ULIA 1F0QA 4O7WA 4RJ6A 4BZOA 3OP5A 2RL5A 4QMTA 3TUBA 1PYXA 3ZSGA 3NUPA 3I4BA 2VTQA 4Q9SA 3PJ3A 3VS5A 4BY9E 2F2UA 3A99A 3UG1A 4RVLA 3G90X 3Q2MA 4FOCA 4I0RA 4J1RA 5EHYA 3ENMA 4ZSEA 4ZZOA 3A7IA 3Q60A 3QLGA 1ATPE 3QD3A 2QCSA 4AW1A 1FMKA 3A7HA 3NW7A 2JFMA 4FI1A 4X3FA 3W32A 4A4LA 2CLXA 3A2CA 4FTQA 3R83A 1ST0A 3L9LA 3VS2A 4GVJA 1OL6A 3TUCA 2QU5A 4LRKA 4KSQA 1OL2A 4YLJA 5CSWA 4ANLA 1REJA 2VO0A 3IS5A 4BDKA 3W8QA 3DTWA 4FNXA 3ROYA 3W33A 1V0PA 4BWXA 3KXGA 4I21A 4U40A 4FVPA 3DKGA 1F3MC 2QOKA 5CF5A 1J91A 4D2VA 5AP6A 4C57A 3U8WA 5M57A 5AX9A 2PYWA 5KMOA 1KE8A 5AUVA 1XH4A 2CKOA 4BTFA 2GS2A 3PA5A 5LWNA 2XF0A 3PJCA 5CS6A 4R5YA 4N57A 3FZRA 4MD7E 4ACHA 3IKAA 4FZ7A 2XCKA 2ZDUA 5HBJA 2E9OA 4TTHB 4NM5A 5E8VA 2WOTA 4N70A 3TWJA 4IAZA 2C5XA 3DNDA 4ALUA 4JBPA 1JQHA 2A0CX 4MEDA 3WYYA 4JS8A 2QOCA 2XVDA 3UOHA 5HU9A 2QR8A 5JQ8A 2BMCA 5CNOA 4F78A 5L8JA 2IZRA 2PMIA 1UU8A 3FPQA 4DEAA 3UVPA 4AT5A 3KQ7A 1FQ1B 3ENHA 4BDGA 3NYOA 4F6WA 2XRWA 2BFYA 5EM8A 5JN2A 3GC8A 4ANBA 4CFXA 4YUQA 4OAUC 3ZSIA 5J5TA 4IAYA 3IW4A 4FZFB 5FRIA 5DT0A 4PMMA 2X4ZA 3GC0A 3PRIA 4FSZA 2YERA 1TQPA 4OTGA 2RKUA 4D5HA 4DEHA 3E3BX 1NVQA 3I60A 4UYNA 3U55A 4O96A 3IOPA 5F20A 4QMXA 2JEDA 2ZFYA 3Q5IA 1DI8A 5CZHA 4DN5A 3ZM4A 3OW3A 2CCHA 4EJNA 4L46A 4WO5A 1LR4A 4DCEA 4Q2AA 4OTIA 3COMA 5DEYA 4ZTMA 4F63A 5KMMA 4Z55A 3DPKA 4D4RA 1XO2B 3HRCA 4CMOA 3FHRA 3U54A 3IG7A 3PVUA 4CT2A 3P5KA 3WIKA 2WMXA 3R9OA 1W98A 2QG7A 2W1EA 5AR3A 1IR3A 2W1ZA 4IZ7A 2QOLA 5EQYA 4IEBA 3VULA 4YTCA 4R78A 4JJRA 3A4PA 3WBLA 4HW7A 5A4EA 3MVMA 1UA2A 4CFVA 5H8GA 4EWHA 4OGRA 3LMIA 5HIBA 2W4JA 3SXFA 3WF7A 2EVAA 1TKIA 2R3RA 2R3MA 4C4JA 2X6EA 1ZARA 1FGKA 3QHRA 4XP2A 5M53A 4FTRA 4I92A 2V7AA 2CSNA 3MI9A 4X3FB 2ERKA 3RTPA 4CLIA 4AZWA 3UDBA 4DDGA 4FTOA 3ZLSA 3R00A 3V6SA 3E62A 4O4EA 4BKYA 4CNHA 2JIVA 4MBJA 3UQGA 5LQFA 2JIUA 4XNEA 1ZZLA 2UZUE 2V22A 3G2FA 4G31A 4AFJA 1Q99A 4O4BB 3FXZA 3REPA 5BX0A 4ZZNA 4RJ3A 4BZDA 2IVTA 4GT3A 4WD5A 4TNBA 4YNOA 4JBQA 2V0DA 5E90A 4PY1A 3TIYA 1FVVA 1DAYA 5BV3A 1BI7A 5L8KA 3ZBFA 5IA4A 5DGZA 4YHTA 5D7VA 2Z7SA 4WHZA 4EH7A 5JGAA 1U5QA 2IO6A 3DKFA 3PTGA 5DA3A 5HCZA 3VWAA 4CMUA 1IAHA 1PMUA 4HPUE 2WTJA 4FKLA 2ZB1A 5CSVA 1AD5A 2OK1A 3EFKA 4D9UA 3D7TA 3FI8A 5BMMA 3RVGA 4FSMA 5HBHA 2QODA 4IX6A 2OH0E 3UPXA 1YXUA 2R0IA 4FR4A 3SRVB 5IQCA 3BU6A 3P78A 4O38A 1YI3A 3P1AA 4E20A 3KRJA 3IW7A 4ZP5A 5JT2A 3ZC5A 4UMRA 1JKTA 1BL7A 4G6OA 3EIDA 4EH4A 1YHVA 4K77A 4KSPA 2YIQA 3RPYA 4NTTA 3CJGA 2E9UA 5CQWA 3ATSA 1IRKA 2XNPA 4FNYA 1B6CB 3ORLA 2XK3A 5DOSA 3BGZA 4FVQA 4W8EA 2XA4A 5KE0A 3TI1A 1YI4A 3FC2A 4AW5A 3NYNA 1URCA 1OGUA 4EYMA 5EW3A 4CKRA 5CXHA 3CKWA 4FG7A 5HE1A 3ZM9A 2BZIB 4RIWA 5G1XA 4ZS4A 2BVAA 1JSUA 3BU3A 2YLFA 3D4QA 4MBIA 3QGWA 1KE9A 4TWPA 3NZ0A 5HIDA 1G5SA 1UNLA 3CC6A 1ZZ2A 4FSNA 1QPEA 4FTTA 4K11A 5CYIA 3VF8A 2QHNA 2GS6A 3BWJA 3O8UA 5AR8A 2O63A 4F65A 1PXPA 4H3BA 4IM0A 4FV4A 3I7CA 5HG5A 3ATTA 5E4HA 4DDIA 4FX3A 3TT0A 1XWSA 1M14A 1NVSA 1O9UA 3E8EA 5HICA 1ZRZA 3GU6A 5EKOA 5FGKA 4DGMA 3D9VA 3LFNA 4GS6A 4LV8A 5DR9A 3MVLA 2R3QA 1Z57A 1YXXA 4YJNA 3F66A 3MPTA 5CF6A 3R8UA 2YDJA 4FV3A 3SHEA 5IA3A 4HYIA 4RQVA 4WUNA 4DAWA 1URWA 2WU7A 4BCFA 2BRNA 1W84A 4M68A 2BTSA 2YDIA 3TZ7A 5DLSA 4HCVA 4DFXE 2XNOA 4EONA 3S00A 2XAMA 3GUBA 3UOLA 3W0PA 2P2HA 4LRJA 2BRHA 5HG8A 4RBLA 3R7UA 1W2DA 3KXXA 5M06A 5LVPA 3R7EA 1WBSA 4YGAA 2VN9A 5AADA 5JMSA 3KY2A 3D2KA 4C4IA 3A7JA 2HK5A 5IUHA 2C6KA 4EH9A 1BUHA 1R1WA 5KCVA 4RX8A 5DR6A 4ZTHA 3KXMA 4UX9A 2OFUA 4YJTA 3OCTA 1DAWA 2YAAA 4FZAB 3KN5A 4ID7A 4F9CA 1T46A 2IZSA 2UW7A 3UMXA 4AACA 2PUPA 1QPCA 3BGPA 1FVRA 2CGUA 3V6RA 5CF8A 4CFNA 2P4IA 3C4XA 3AQVA 4DFUA 3U4UA 1W0XC 4QMVA 5H3QA 5IQFA 2QC6A 3QRIA 4ZZMA 3NUNA 4QP3A 3F2AA 4F7LA 3DK6A 5FLFA 5LARA 5FEQA 2W5HA 3UMWA 5FTOA 3PXKA 4IB0A 2DYLA 2QNJA 5EYKA 5D7AA 4AF3A 3QU0A 3IDBA 2GFCA 1H25A 5AV4A 4L7FA 1PXNA 4IFGA 1WBNA 5GHVA 4E4XA 1OIYA 5AIRA 3LXNA 5DWRA 5EM6A 3RAKA 2CJMA 3OWPA 5AMNA 2HZ0A 2J0KA 3RHKA 3UNJA 5AAFA 4KKHA 4O2PA 4EOSA 2PVKA 2X8DA 3QF9A 4LRMA 3HV3A 3SXSA 2PU8A 5CEIA 5IUIA 4Y46A 5HE2A 3EQGA 4NJDA 5JQ5A 2W5AA 2WQNA 4FL2A 5C9CA 4C2VA 4W8DA 3KIOC 4D2RA 4DEGA 4CFFA 3C4ZA 3R7YA 1CM8A 4EOOA 2CN5A 3M11A 1G8JA 3RWQA 5FD2A 1YDSE 4BTMA 4DGNA 3NCZA 5M56A 2BIKB 4ITHA 4AA5A 1UNGA 1W83A 3F2RA 2OIQA 3BBWA 3UOJA 1R3CA 3I79A 2R7BA 4I5HA 3V5QA 4C3FA 2PVRA 4ANMA 3MTLA 3H0YA 5AUXA 4BJJA 3W2RA 2X0GA 5DNRA 5AUUA 1WVXA 4MNEA 3EN5A 4OT6A 1NT2A 4HYSA 3UG2A 4XOYA 3CTQA 4CTBA 3ZO3A 4AE6A 3JYAA 4S33A 3RPSA 5HLNA 4YO4A 2G15A 3FKNA 3QTWA 2QO9A 3C4EA 4I6BA 2GNJA 2YM8A 4LL5A 3KMWA 4J96A 4IZAA 3I5ZA 5AP1A 2RIOA 2VTRA 3VBXA 5IPJA 2WQEA 1OBGA 5LVOA 4OBOA 3E87A 3E88A 2C6MA 2YAKA 1E9HA 3G9NA 2G2HA 3VQUA 5EDQA 4NSTA 1P2AA 3O23A 4FV8A 3Q3BA 5KKRB 1OIUA 3F9NA 4OT5A 4AN3A 4RIYB 3P7AA 2QOQA 3FZOA 2E9VA 5CALA 5HNIX 5JFWA 3U6IA 3VHEA 5BVFA 4A9RA 3HAVA 4TRLA 4YZNA 5IF1A 2Z7QA 3QTSA 2GU8A 2WTKC 2BZJA 3NCGA 4FA2A 2YLEA 4GSBA 2DUVA 5BVNA 3CBLA 4KIPA 1H0VA 2XKEA 4QMYA 4JBVA 3BKBA 1GZKA 3UDSA 1VYZA 5E1EA 3IW6A 3IW8A 3HV6A 3I7BA 4I24A 2VTMA 1ZOHA 4M15A 2QKWB 3KK9A 2XNGA 4YJOA 4WOVA 5DIAA 4F4PA 3MA3A 2X7GA 4OUCA 5EW8A 3ACJA 4NK9A 2GNLA 3TKHA 3W18A 1GIIA 3FAAA 3FLNC 4OBQA 1APME 5DHJA 3ZONA 4C4FA 4D4SA 3BYUA 3ML1A 3SXRA 1H26A 2JBPA 3IOKA 3MH0A 2C3JA 3R21A 3S4QA 5KMNA 4XX9A 3SD0A 3TNHA 4MF1A 2F49A 4CMTA 3ETAA 4QP8A 2X39A 5HU3A 1DI9A 1OECA 2OZAB 3LFBA 4RC2A 4C4EA 3KXHA 4KIOA 5BUEA 3BEAA 4JDIA 4MXOA 4PPBA 4EOJA 3OTUA 5LWMA 1NW1A 3VBYA 4KKEA 2W1GA 2C5NA 3FV8A 1ZYSA 4WA9A 3P4KA 4Y72A 4FKOA 1FOTA 2VO7A 3E8NA 3QUDA 4RVKA 5DPVA 4D5KA 5L3AA 1LUFA 1L8TA 1K9AA 3ZH8A 1OM1A 4YLLA 1PW2A 1R0EA 3CQEA 3H3CA 5CU2A 3CCNA 4AAYA 1H28A 2O5KA 3R1NA 4O0RA 3PSDA 2XJ1A 3UGCA 3N4UA 4NFNA 3PPKA 4B99A 3SG8A 4KIQA 2UUEA 4CZYB 3C0HA 3DXQA 1P4OA 1WZYA 2GHMA 4ASDA