4YJVA

The kinase domain of human spleen tyrosine (syk) in complex with gtc000250
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
270
structure length
263
Chain Sequence
YLDRKLLTLEDKELGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase SYK
publication title Discovery of GSK143, a highly potent, selective and orally efficacious spleen tyrosine kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 263
sequence length 270
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yjvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yjvA01
2FUMA 2HY81 2R4BA 3DKFA 2PPQA 2F9GA 3ZRKA 4XRLA 4R8QA 3ODYX 4XG3A 5CSWA 5LWNA 1OIQA 3D5WA 4ERWA 1XBCA 3O50A 1IA8A 1WVWA 2QD9A 2GQSA 3ETAA 5EDRA 2XCKA 3GGFA 5A9UA 3R1SA 1QPEA 1Y8YA 2J9MA 2HXQA 2V22A 3COKA 5IDNA 4RIXB 5KE0A 2JDRA 1PMEA 3H0ZA 4FL2A 3E8EA 5L4QA 4JXFA 2ITNA 2PUPA 1YI6A 3KFAA 1OKZA 1CKIA 2PZ5A 3CKXA 5HO7A 3MESA 3VBQA 4D4SA 3DAEA 1KOBA 2YAAA 1ZXEA 4FTCA 4I5HA 3EFWA 1URCA 1DI8A 3EL8A 4XV3A 3WF8A 2XNEA 4K11A 2GS2A 2GSFA 3V3VA 4WA9A 2R0IA 3ZH8A 2WO6A 5TR6A 2C0TA 3G51A 4MD9E 4UYAA 3R7VA 4CFMA 5FGKA 3IW7A 3FWQA 4QRCA 3OF0A 1UU3A 3NYNA 3DKGA 2FA2A 1L8TA 5DE2A 3AC8A 3DJ7A 3VBTA 3OBGA 5J87A 2OH4A 5D41A 4FUYA 2UZWE 2IVTA 1Z9XA 2ZMDA 4GG7A 4QMOA 3I6UA 1OL7A 3PXRA 4CZTA 2RG5A 3LLAA 4QP9A 1WMKA 4JG8A 1GIJA 3G90X 4CZUA 5C4KA 1DM2A 2Y4IC 3IQ7A 4Y46A 4L7SA 3UOLA 1SNUA 4U3ZA 4U80A 2JDOA 1V0BA 3FMKA 3KRWA 3MV5A 5AUYA 3TT0A 4IAIA 2W7XA 5FEQA 2Y4IB 5LWMA 4RVKA 1M2PA 3R28A 5IA1A 4H3QA 4ASEA 2J5FA 4FKIA 4BDIA 5IKWA 5LMKC 2FSMX 1U54B 3KRXA 4E6CA 5KHWA 2R5TA 2LGCA 4ANLA 4F1MA 1F5QA 1OL5A 4FG8A 5CT7A 3EQFA 3L1SA 4J52A 4PL5A 5C9CA 3AXWA 3NZ0A 3ZYAA 2RSVA 2P33A 1REKA 3OEFX 2PMIA 3RAKA 3PFQA 2W1EA 3WILA 2YERA 5IQCA 4WNMA 4UXLA 4OTWA 4UXQA 5D10A 3DOGA 4LGHA 4Z7HA 2XNPA 4UY9A 3VIDA 5HIBA 3U6IA 1OBDA 2WMSA 4PY1A 4EH3A 3BYVA 5IH5A 1WCCA 2J5EA 3LCTA 1ERKA 2FO0A 4J1RA 3RALA 2I7QA 1Y91A 2W9FB 3C13A 2OJJA 4F70A 4Y5QA 5JGAA 2UW3A 4FC0A 2R3KA 1UKIA 3NPCA 3RK5A 5HESA 3ULIA 4C58A 3U9NA 4IAKA 3W10A 3OCSA 1GNGA 4FTNA 4RIXA 2HCKA 4F9BA 3LLTA 3GFEA 1F0QA 4NKAA 5DT4A 2WB8A 4FMQA 3TV4A 1Z5MA 4BTKA 4NTTA 1HCKA 5DI1A 4YZBA 3D5VA 5EW3A 3KCFA 4P5ZA 3BHYA 4G3FA 4YC3A 4BIEA 4E5BA 5HG8A 4JIKA 3NR9A 3RWQA 2UZTA 2CLXA 1J7LA 1PHKA 4FT0A 4FV0A 2QURA 3VUKA 2OZOA 1IEPA 2WMWA 3DDQA 3QKLA 3R71A 5H3QA 5CSPA 3UP2A 4IVDA 4X21A 1UWJA 3A61A 4APCA 3KGAA 1GZKA 3LCSA 3MY5A 3MFTA 4M8TA 4O96A 5HVKA 4FTJA 2HY0A 4KS7A 3POOA 3HMMA 4IIRA 1ATPE 3FAAA 3D7ZA 4ALWA 4QP6A 3HYHA 2BRMA 3PSCA 3RAHA 5FD2A 2OJIA 5AP4A 2P4IA 3SLSA 5AV2A 1XH7A 4GV1A 2WTDA 4MWIA 1PXMA 4XG4A 3LXPA 3UC4A 3W2OA 5L2WA 2J4ZA 2YA9A 4S2ZA 4XLVA 4RSSA 3WF7A 1SVGA 4GRBA 3EJ1A 1H4LA 3LXNA 2QOOA 5M56A 2BCJA 3NX8A 2QC6A 4I20A 3FI2A 4EOJA 4CFNA 5HVYA 4GK4A 4DGOA 3LFCA 4KA3A 3DNEA 1DAWA 3NYOA 2JFMA 3PZHA 1JKKA 3VS6A 1SVHA 3MH2A 4KRDA 5DMZA 5TO8A 5G6VA 4WG5A 4IX3A 2UW4A 4DEDA 3EIDA 3PA5A 4GL9A 4GG5A 5BVOA 4A06A 3FLSA 3QHRA 4LRJA 4N6YA 1TKIA 2Z7LA 3B2WA 5AWMA 4TWPA 4DYMA 2Z2WA 5ANIA 1M2QA 2VTTA 3OWLA 3ZSIA 3D2IA 4U3YA 2VGOA 3PSDA 2QHNA 4DN5A 5LMKA 4PL3A 3GU4A 2I0VA 2ZV7A 3I6WA 1YXSA 3RK9A 5IA2A 5KO1A 2JDTA 2R3MA 4HGTA 4JR7A 3EN4A 1PXKA 2VD5A 1R39A 3QCXA 3ACKA 3UYSA 3TV6A 2E9VA 4UWCA 3VC4A 4UMUA 2WMTA 3KF4A 1ZYLA 3CY3A 4U40A 1DAYA 4FIEA 5M4CA 4F0IA 2BPMA 4XG9A 2OZAB 3F9NA 3L9LA 5KCVA 3HX4A 4WNOA 3LIJA 1TQIA 5IUIA 5HORA 2ITUA 5C8NA 5E7RA 5L8KA 1ZWSA 4U81A 5J7HA 5J95A 4DGLC 4NJ3A 3LQ3A 4AUAA 4YZNA 1R0EA 4F08A 1YQJA 3F5XA 4BC6A 5HNGA 4DTKA 5BYYA 2VN9A 2Z7SA 5TE0A 2F2CB 2W5BA 4DTAA 4DFNA 4HVIA 2UVZA 2WXVA 4JAJA 5CQUA 4O7NA 4YPDA 4FNZA 5E8TA 3ZLSA 3HDNA 4O7WA 4PQNA 1Q5KA 2IJMA 4ANOA 2WPAA 2R7BA 3OTVA 4DBXA 5IUGA 1MQ4A 2J0KA 4OLIA 2R0UA 3QRTA 3QX2A 3R2BA 4RX5A 4Y95A 4EH9A 1Q4LA 3IGOA 5B0XA 4FEXA 4C62A 4RQVA 3ENHA 4Y5HA 1Y8GA 4CMTA 2CKPA 2OO8X 2XUUA 4I92A 5HGIA 2X4FA 2R3GA 2DYLA 2A4LA 4WT6A 4NW5A 3PA3A 5CZHA 3AC3A 1BL6A 4TYIA 2BRGA 4BCFA 1KE7A 1ZYSA 3DFCB 2UZBA 3FMLA 3BLHA 3JUHA 3NLBA 4YC8A 4PP7A 3L8PA 4HZSA 5CAUA 2PUIA 1NW1A 3UP7A 3PE1A 2CJMA 4FV2A 4FIFA 2BFXA 3E7VA 3OMVA 5AAFA 3GB2A 4O7LA 5ANOA 4W9XA 2YZLA 2HZ4A 5F20A 3NYXA 4K2RA 2FSLX 3NUYA 3NW6A 4D28A 1W0XC 3C4CA 4ID7A 5A4EA 4L67A 2Q0NA 3TNIA 4O7YA 3Q52A 2B1PA 3ZO1A 3CCNA 4QP1A 3HRBA 1OL2A 5CAVA 4R78A 3PY3A 4TT7A 4CMUA 4E4XA 1FPUA 2X6DA 1UV5A 2W1IA 3MIYA 4I23A 4I6HA 4EH7A 5GZ8A 1JOWB 3BE9A 3VS5A 1FGKA 4NFMA 2VWWA 2VX1A 3AGLA 3LE6A 2GFCA 4UB7A 5LVLA 4BCQA 4E6AA 5EHOA 3W2SA 2YDIA 2UZEA 4GFMA 2VZ6A 2G01A 2JBPA 4LL0A 5AV3A 5HBEA 4DEHA 1H27A 3BYUA 3WZUA 3A7JA 3VJNA 5CANA 5A6OA 5DR9A 3OT3A 3A7FA 5JGBA 3K5VA 3FI4A 2V5QA 4D5KA 4EQMA 4U43A 1VZOA 3O0GA 3RAIA 5CU0A 5HI2A 3Q4ZA 4FV3A 3FZSA 1MRUA 2NRYA 2AYPA 3UPXA 3UZTA 2R3QA 4F1OA 1W98A 1HOWA 3AMBA 2GQRA 2XK4A 4PDOA 5HICA 4P2KA 4NTSA 1XH9A 4GW8A 2C5XA 3GU8A 3HA8A 3FL5A 2OZAA 3SVVA 3BYOA 2BAJA 2VTPA 5HU3A 4F7LA 1JSTA 1P4FA 5IQHA 4DLIA 4GKHA 2VNWA 4QQ5A 5E9EA 3OXTA 1H25A 4KIPA 4TZRA 2XNMA 1OVEA 3ORZA 5HX8A 4IAYA 3DXQA 2ZJWA 4R3RA 3FV8A 4BYJA 2PVFA 5AUXA 3OHTA 1VEBA 2BAQA 4EZ7A 2GMXA 4WSQA 3A60A 4IACA 3EQDA 5HO6A 4H05A 1K9AA 3EFLA 3CPBA 4LOPA 3RJCA 1PF8A 3LJ1A 1W82A 3LJ0A 4EK8A 3HV4A 3NNVA 1DI9A 3MA3A 2JITA 2UW0A 4AA0A 4GFOA 5EQEA 1Q8YA 3ATTA 4P4CA 3RTPA 3GU7A 5DRBA 4O1OA 4JX3A 4U79A 4D2TA 4DEGA 3I1AA 4O2ZA 5LVPA 3PPJA 2GNFA 2R3PA 4TRLA 5ACBC 3NUXA 4QP3A 5AP3A 5AX9A 3N4UA 3DY7A 3U4WA 5CENA 4ENYA 3G0FA 3NUSA 3OP5A 3RWPA 4M13A 4MXOA 1Q8WA 5IH6A 5IU2A 4XOZA 2QO9A 3E3PA 4FTUA 4BIDA 3E8DA 4KKHA 3TNPC 4WUAA 2EU9A 4H1MA 3RHKA 3QQJA 4O0XA 2F57A 2XF0A 1YI4A 3OOGA 4JAIA 3QWJA 5GINE 3L9MA 3K3JA 5M4UA 2JLDA 3TKIA 4IB1A 1CSNA 3PJ1A 3BPRA 4DH7A 4JQEA 5HIDA 3TJDA 4TXCA 2C5NA 2XJ1A 3JXWA 1SMHA 4HCTA 5FM2A 3O8PA 4L68A 5AM6A 3ORKA 1QPJA 1NY3A 2GCDA 3ITZA 2VV9A 5EYCA 5IA0A 2SRCA 4LMUA 4ZLYA 4ASDA 5EFQA 3P0MA 2C5VA 2GNHA 3VUTA 4ZOGA 2O2UA 2VX0A 4HOKA 3KXNA 3ZXZA 2XCHA 3HUBA 4ITIA 4DGGA 3LXLA 4HGEA 4MYGA 3R7UA 4GH2A 3TKHA 3LMHA 3D7TB 4IB0A 4IJPA 4YO6A 2DUVA 4C38A 3QKMA 4M66A 4YJUA 4TTHB 2HYYA 3KL8A 3WOWA 4BZNA 3HAMA 2GNLA 3RNYA 3WE4A 4ASZA 4LM5A 3NS9A 4I4FA 4J53A 4L53A 5D7VA 1H1SA 3NEWA 4IX5A 4C3RA 3N9XA 4WNPA 3DLZA 3Q9ZA 4O21A 5L6WL 1AGWA 2PMLX 4R3PA 5JKGA 1BKXA 4M67A 4G3CA 4EC9A 3C1XA 3VW8A 4UWYA 3DB8A 2WMQA 2BILB 4MTAA 3R8PA 2BKZA 1ZRZA 3GCSA 3HZTA 5AR3A 4B8LA 3DZOA 4NYEA 4K6ZA 1K2PA 4IX6A 4I5MA 3KC3A 4RFMA 3M42A 4RA5A 4CQEA 3QTRA 2CGUA 3TZMA 3UPZA 3N51A 2C30A 1WBSA 4HPTE 2Z7QA 1RJBA 1SNXA 3BX5A 2HK5A 2XNGA 3D83A 5DN3A 5HCYA 5HG9A 4BCHA 4CKIA 4EWHA 3NIEA 4L01A 2J0LA 3EQRA 3QRUA 4KWPA 4QQCA 3MVHA 2C0IA 3WBLA 4EL9A 2GHLA 3I7BA 3TACA 4Q5HA 4ASXA 1J7IA 1YHVA 4J98A 4MXZA 3UNKA 3I0QA 3LM0A 5C01A 2BFYA 4GT3A 5M4FA 2B9FA 4XBUA 1PKDA 3DPKA 4MXCA 2O0UA 2CPKE 4XCUA 4D2RA 3JR1A 5KMJA 2XKEA 4X3FC 5CEPA 3QQFA 2WOTA 5DBXA 4E73A 1ZY4A 2F7XE 4X3FB 4X7QA 3MI9A 3BI6A 3CSVA 4ZLOA 5L3AA 1YI3A 4FTAA 5IF1A 3C4ZA 3ZLXA 2WEVA 4E7WA 4QMPA 3R9HA 3AC2A 2FSOX 5IH4A 3R00A 2HWPA 3PWYA 1GIHA 2FYSA 4MD8E 3VBXA 3GCPA 3S95A 3OXZA 3P7CA 4CTBA 4DT8A 5A54A 2NRUA 4FSYA 3T3VA 4CTCA 3H9RA 3K3IA 3C50A 3UNZA 4JRNA 4DTBA 1XKKA 3BHVA 4FGBA 2IW9A 3NDMA 2F2UA 2E9OA 3FBVA 1NVRA 2KTYA 4RC4A 5CXZA 3FL4A 2CGVA 3FQEA 3IW6A 3MPTA 3KY2A 3QCSA 4FVRA 1LP4A 4R1YA 5A4TA 3SHEA 3G15A 3RMFA 2C6TA 4O0RA 4OR5A 2H9VA 3R6XA 4M3QA 4XRJA 3ZRMA 5IQDA 5HTCA 2G1TA 5ANEA 4AG8A 4XYFA 4X2GA 3IOKA 3FMEA 5J8IA 2VX3A 2YLFA 3RGFA 2XP2A 5KMLA 3HECA 3UDBA 3KRLA 3F3UA 2R3IA 5T68A 3HEGA 4I0TA 3OUKA 1JAMA 2YIQA 3NRMA 4QQTA 1PW2A 1UU7A 4WRSA 5C4LA 2C6IA 5IG1A 4UWBA 2XEZA 4YHTA 5H2UA 4DITA 3FPQA 4K9YA 3ZMMA 2GHMA 4BBFA 3D7TA 3OY1A 5IQEA 4B99A 3GUBA 3P7BA 2OLCA 2C0OA 3D4QA 3F88A 2YISA 3D15A 4EHEA 3PUPA 1U46A 3A7GA 1BI7A 3DJ5A 4HCUA 4C35A 2BDFA 2J6MA 2JKMA 3FKOA 4FV4A 4S31A 4A9RA 5AUTA 4BY9E 4XP2A 2XRUA 3ZC6A 4TYGA 1S9JA 4Q9SA 2OSCA 4TWNA 3F5UA 3QYZA 4DFBA 5AR5A 1SVEA 3FY0A 3Q6WA 4H3PA 2ZB0A 2Q83A 4JJRA 4X2FA 5AAGA 4FA2A 3PIYA 4FTRA 2XBJA 4MVFA 4EBWA 4FK3A 2X81A 3WI6A 4QMNA 3TM0A 1A48A 2B55A 2WTCA 2VO0A 3UJGA 2PY3A 3N4VA 3EQGA 3V5JA 4GYIA 4QMQA 5M51A 3A7HA 1YDSE 2ACXA 3QTQA 3QHWA 3G33A 5H9BA 3GNIB 4BKYA 3UO4A 4D5HA 5CSXA 5AEPA 4I22A 3ID6C 2XB7A 3FYKX 4JBVA 2JC6A 1GZ8A 2XIKA 3QTXA 4TYHB 2BMCA 3AT4A 4LGDA 5E1SA 1P4OA 4QTBA 3V6RA 5JFSA 5CI7A 4YLKA 4KBAA 4PWNA 3ZFYA 2HENA 5AP5A 4FKSA 4X3FA 4YZCA 1YXVA 4XUFA 4GT5A 1OIRA 3ORPA 2O5KA 3Q9WA 3RPVA 1HCLA 2YDJA 1BYGA 2YJSA 4UEUA 4YR8A 4AGUA 5FLFA 3QTWA 2QCSA 3HAVA 2WTIA 1ZY5A 1CTPE 4TWOA 2J0JA 1TQPA 3IW8A 3QTUA 2XIRA 3PDTA 4MXAA 4AW1A 4CV8A 4F7NA 5HIEA 3CGOA 5HE1A 2VRXA 1QPCA 4NM0A 4AGWA 5IPJA 4DA5A 4K33A 1FOTA 2HW6A 4L46A 3PPKA 2IZSA 2IW6A 5EI2A 5GIPE 5IA3A 4HYIA 3COHA 4W9WA 5JZNA 2B9HA 4OBPA 2C5OA 2G15A 3W8QA 5AP0A 1J7UA 1YW2A 2B4SB 2ZM3A 4WBOA 3UMWA 4FI1A 3JY9A 3QC9A 4RX9A 1NVSA 3FMHA 3PXKA 5CU3A 3W55A 3ORTA 3HUCA 2IWIA 1BUHA 4W4YA 4FTTA 1PRYA 4BIBA 1BX6A 1XH4A 1YRPA 3R73A 2VTHA 3QCYA 4HZRA 4M69B 1E9HA 4FT9A 4MD7E 4DAWA 3FLYA 3HKOA 4TYJA 3DK7A 3F7ZA 5JMSA 3GC9A 3OEZA 4GS6A 2ZB1A 5FM3A 3ZO4A 3FI3A 2NNWB 2C1AA 4FTMA 4DHFA 4FKOA 3TL8A 5AUZA 4YUQA 3GQLA 3R7YA 2ESMA 4UALA 4XOYA 4PDYA 5E91A 1FMKA 2B0QA 5AR2A 2CN5A 3SKCA 4JT3A 3ATSA 2WMBA 3M1SA 4QPMA 4HVGA 4ZSAA 3KRRA 4C8BA 4AN2A 3LCKA 3C5UA 3REPA 5HE3A 4J8NA 4AOTA 1W8CA 2Y6OA 4AT5A 3CQUA 1OECA 3HNGA 5EM6A 3VS0A 3PRFA 4X2NA 3TNQB 3V8TA 4ZLZA 5HNIX 2QOQA 4BCGA 5IEYA 1PMVA 5L8JA 4BWKA 3FLZA 2DWBA 4BCIA 4PX6A 2I0EA 3SDJA 2GPHA 4HYSA 2YM6A 2YWPA 3I60A 4GJ3A 4H39A 4QTDA 1V1KA 4HNFA 5J5SA 3MVJA 4FSTA 3E8NA 2IW8A 1Q99A 3TWJA 3UVRA 2CKQA 1ZOHA 2CNUA 3RBWA 2X9EA 3OS3A 4OGRA 4PTEA 4RBLA 3FXZA 3UYTA 4BDEA 4C2WA 4D4VA 2QO2A 4I6QA 1H1QA 1OPKA 3HMNA 4FL1A 3VJOA 1G5SA 2RFEA 3SOCA 5KHXA 4ACCA 1PKGA 4L7FA 3GBZA 3VVHA 4U5JA 3LFNA 4G31A 3WZDA 2EWAA 2X8IA 3BYSA 3LFFA 4TYHA 4WUNA 4HW7A 5JN2A 4OW8A 4CFUA 5KMIA 3BZ3A 5AV0A 3UIMA 3VRZA 4KIOA 2XNNA 4FKJA 1XBBA 3G2FA 4O84A 2HIWA 2XNOA 3R8ZA 3R1QA 3UQFA 2UW9A 1W7HA 2UW5A 4FKRA 2QR7A 3Q9XA 4NT4A 4FOBA 4Z7GA 3K54A 1XO2B 2HW7A 5EHYA 4AE9A 4BTJA 1PY5A 3Q5ZA 5CXHA 4XLIA 1Q3DA 3E5AA 4FKTA 2PHKA 3HMOA 4BN1A 4Y83A 3IPHA 2CLQA 4PRJA 3VBVA 5IISA 3F66A 3NCZA 4JDHA 4II5A 5ANDA 5FXQA 1UNGA 3BHTA 2IZUA 2VWUA 4QMUA 3FUPA 4AGDA 3QL8A 5BVWA 4AX8A 4U45A 3KULB 4DFYA 4QPAA 4HGLA 1JWHA 5EM7A 2YWVA 5E8YA 4I3ZA 3C4FA 1OB3A 4FF8A 3BBWA 3G9NA 3PRIA 3PP0A 3QA0A 2W5HA 3BLRA 3QXPA 4LUEA 3TDVA 2PZYA 3ANRA 5H8EA 1KE5A 3KK9A 4L3PA 3GU5A 5IA5A 3UE4A 2EXEA 2VTMA 1MRVA 2VAGA 4DFLA 2CGXA 5I0BA 4ZSEA 3R7EA 1ZOGA 3JVSA 4MNEB 3U9CA 1XH8A 4CYJA 1JQHA 1IG1A 3MH0A 4PPAA 4RLLA 2GHGA 3QQHA 3WF5A 2BDJA 3LFBA 2UZNA 4LV5A 2W1ZA 3KVXA 2GNJA 2ITVA 4E5WA 4WD5A 3BU6A 4QYGA 3EZRA 4GMYA 3R21A 4DH8A 4O0VA 4XP3A 3IO7A 2I0HA 5IEXA 1KE9A 2WHBA 3SA0A 4QP2A 4U41A 5FTQA 5J1WA 4BGGA 4O7SA 3UBDA 1R0PA 4IAZA 4S32A 5IMXA 3FHRA 3ZUUA 4G5PA 4V0GB 3VUMA 4IVBA 1EH4A 2YFXA 4PUZA 4OTQA 5B2KA 4LFIA 4YLJA 4JX7A 2W4JA 4DEBA 5I9YA 3EB0A 4LOQA 1DS5A 5F95A 4RA4A 3KEXA 4S30A 1YDRE 5G1XA 4U7ZA 3FE3A 4FK6A 4HCVA 3W2QA 4FSMA 3ODZX 3OW3A 4LYNA 3FJQE 2R3RA 4M15A 4RJ5A 4I41A 5BMSA 4FGRA 4PF4A 5DEYA 5AJQA 2OBJA 3UO6A 5DEWA 2XM9A 2PUUA 1O6YA 2R9SA 3EN9A 3LFAA 4X3JA 2R2PA 3SGCA 5CNNA 4PMSA 4O86A 4O6EA 3HRFA 5DFPA 3EFJA 3IDCA 4XH6A 5HNBA 3P23A 4NW6A 4ZP5A 1Q41A 4DE4A 1FVRA 2WU6A 1PXPA 4DINA 2OFUA 3NNXA 4D9TA 4ZY4A 3I5NA 3LFEA 2OKRA 4OTFA 4C59A 5L6PA 5TKDA 2HOGA 4WKQA 3C5IA 2BALA 4G34A 3N4TA 4RGJA 4MHAA 3R01A 4FX3A 3PYYA 5ETAA 5GHVA 3LKMA 3TG1A 3R22A 4JI9A 4IZAA 3U55A 2RL5A 4ANSA 5HCXA 4FTLA 1JBPE 4OTGA 5TT7A 5HU9A 3QXOA 3F5GA 4E6QA 5M08A 3GOKA 4PDSA 3WYYA 5JEBA 1OZ1A 3HMIA 4H58A 3Q4TA 2BIYA 3UQCA 3TN8A 1YXTA 3KULA 2HZ0A 4FKLA 3TTIA 3DBDA 3VUHA 2J0IA 3PSBA 2C47A 4AZWA 2R3NA 2WMUA 2ERZE 3KXHA 3TZ8A 1KWPA 2W17A 2VWYA 2W0JA 1OPLA 3QGYA 4DH5A 4CD0A 4CMOA 3FMNA 4WIHA 4G3EA 3TJCA 1OIYA 4BDKA 3DFAA 5EYKA 4F9AA 2QI8A 2PVYA 2RFSA 3F69A 4L44A 4XEYA 4DH1A 4RWLA 2G2FA 4MNEA 4O91A 2A2AA 5GZAA 5IMEA 3D5UA 2CGWA 2PVKA 3HV6A 3KMWA 4RIOA 1SZMA 4ITHA 4A9YA 1ZMUA 3PJCA 1H1RA 3IKAA 5DGZA 2RFDA 3RZFA 5CT0A 4I21A 2RIOA 4ALUA 4G3GA 2E9UA 2PE0A 2H34A 3F61A 1M7NA 5LVNA 1MUOA 3F3ZA 3QC4A 4D2WA 4ZEGA 1U54A 3MTLA 1J1BA 1ZYCA 2WQOA 4C4GA 2VTNA 1BI8A 4BDAA 1H0WA 1OMWA 1ZAOA 3VS3A 4I0SA 2Y9QA 2XIYA 3OOMA 4FTQA 2QOFA 2ZVAA 1FMOE 4GT4A 4A7CA 4ZJJA 2F4JA 4A9SA 5H8BA 3UODA 2QO7A 5HQ0A 4FT3A 3KN5A 1R78A 3G9LX 3CD3A 3IECA 2YM7A 2X8DA 3LPBA 4IXPA 2WQEA 4DH3A 4M0ZA 5HOAA 2QLQA 1PXNA 4K1BA 4R7BA 2QR8A 5ICPA 4YP8A 1MRYA 3G6GA 3SX9A 3C4WA 5IQIA 2UW6A 5EYDA 3C4EA 3H0YA 2WQBA 4BZDA 3ALNA 2HXLA 2B7AA 3V5QA 4FUXA 4F1TA 2C6EA 4HVSA 1NT2A 2CCIA 3MBLA 4L45A 4UMPA 3QCQA 4KIKB 2XBAA 3QRJA 2R3JA 2W4KA 4IWOA 1O6KA 3C0IA 3DBCA 2OU7A 3ZFXA 4AE6A 3C0GA 1Q8TA 4AT3A 2J50A 4ZJIA 4RX7A 4B6LA 3RI1A 2IPXA 4OTDA 1IAHA 2C3KA 4QYEA 1L3RE 2ZYBA 4WG3A 5CLPA 2V62A 4EOOA 2AC3A 1YWVA 3KMMA 2HWOA 3ACJA 3CQWA 3B2TA 4QMZA 2B9JA 4ZTQA 2P55A 5LXMA 3DNDA 4IDTA 3ZO2A 2RKUA 3OWPA 4J96A 4RC3A 5DHJA 3ZCLA 2VO3A 3GCUA 4QNYA 3WF9A 4EORA 3NUUA 4JBOA 5HG7A 5A4QA 1G3NA 4I93A 4O6LA 3R30A 4M68A 2PVNA 4U6RA 5CX9A 5BVNA 4DBNA 3FZ1A 4QT1A 4W4WA 4GIHA 3QQGA 1GY3A 2YEXA 2A27A 5C03A 3QTZA 4Q2AA 4DG0E 4ANMA 3IONA 1PXOA 5FWKK 2A1AB 2ITPA 4EH4A 4DEEA 3MWUA 1H26A 2PL0A 4ZY6A 2VTIA 5M06A 5A4LA 4GK2A 3ZM4A 4C4IA 3CEKA 3ZBFA 3TI1A 4IB3A 5HCZA 5DRDA 3PTGA 5DR6A 3ZUVA 3QAME 2X7GA 3Q4UA 4RJ7A 5FXRA 4EK6A 3BHHA 3FXWA 2JAVA 3EQPA 1R3CA 4FOCA 4BTFA 1QCFA 4FNYA 3E88A 4YHJA 2WNTA 3KU2A 4IFCA 3LQ5A 4F64A 4NL0A 5K5NA 4IM3A 4BZOA 2ITZA 5CSVA 4W8DA 5EDPA 1OIUA 4EOPA 4G9RA 4GKIA 2ZV8A 3MFSA 3LAUA 4DGNA 3P79A 4G1WA 3TNHA 3EYGA 4KKGA 3QZGA 4QPSA 3ERKA 2C3IB 1J3HA 2PSQA 5CY3A 3MH3A 3VHKA 1Q24A 3HRCA 3A2CA 3A8XA 4IFGA 3QTSA 3BELA 3FLQA 5E90A 4H3BA 4EOLA 3ORIA 4RRVA 3ZC5A 1ZYDA 3HL7A 1OKVA 2WTKB 1PXJA 3AG9A 5FTOA 2WU7A 2IO6A 2QNJA 1P14A 3NUPA 2XK9A 3Q60A 4IBMA 3FMDA 1WBNA 3KXZA 5AMNA 5F1ZA 3T8OA 4YURA 2AUHA 3A99A 3FQHA 4JOAA 3W16A 4IEBA 5HTIA 5KMMA 4UMRA 4FNWA 2XRWA 2W9ZB 3R04A 3DXPA 2PVRA 4ANQA 4NM5A 4RZWA 2PZRA 1J91A 1VR2A 4IWQA 3EYHA 4R6VA 4ACMA 4ANNA 4BCNA 4BFMA 3W8LA 1ZYJA 3SW4A 4X6RA 4BBEA 1I44A 4PDPA 3S4QA 3TKUA 3K2LA 3I4BA 1A9UA 4O22A 5F4NA 4AWIA 3VQHA 5EKOA 3PPZA 2EUFB 4BKZA 4QD6A 5ANJA 3VF8A 4C61A 4AZTA 4YJVA 4KIKA 1E1XA 2VU3A 4ZSGA 3PLSA 1W83A 2RFNA 2QODA 3QFVA 4CZYB 2EXMA 2QOBA 3AOXA 4C33A 5E8SA 1LUFA 5EOLA 2IN6A 5FUTA 4FKQA 3S3IA 5CASA 3F2NA 3LM5A 2JGZA 2WQNA 3UIXA 2QONA 3PVGA 2X39A 4YU2A 1XHAA 3FKNA 2BUJA 3GEQA 4G6OA 3H30A 2QQ7A 2ETRA 3PXQA 4BDHA 4ORKA 5J7BA 3P4KA 2ETMA 3LMIA 4FEUA 3ZXTA 4OAVB 4E20A 4MEDA 3KXGA 5BUEA 4BCOA 5EQYA 4FL3A 3V8WA 2HAKA 3V5TA 4RVLA 4L3LA 2E2BA 4L8MA 3TZ7A 3SXFA 2X1NA 4R7HA 4V01A 4BWXA 4K18A 4ONAA 3SRVB 3ULZA 1NA7A 4B8MA 2QOHA 1JPAA 3EN5A 3UNJA 2IZTA 3ZBXA 1J1CA 3A4PA 2UZVA 3MJ1A 4RJ8A 1TQMA 4S33A 3QLFA 5C27A 3W33A 4EH8A 3DAKA 1P5EA 3PIXA 3VULA 2W99B 2JIIA 3E92A 5GJGA 3VO3A 4A4OA 3FZPA 1ZARA 3Q2JA 2BROA 2UZUE 4AXAA 4F09A 2ITWA 4WNKA 4NUSA 3U8WA 3W18A 4ZS0A 3ZOSA 4D1XA 4CGAA 4YZDA 1OITA 2Q0BA 1SYKA 5I9VA 5D9HA 3OVVA 3POZA 4WOVA 4R3CA 5M53A 4G6NA 2DQ7X 1YWNA 4V05A 4YNOA 4FT7A 5K4JA 3QU0A 4IAFA 3R0TA 2HZNA 4KBKA 3BRBA 5J5TA 4TL0A 3OTUA 1H1PA 4O27B 4FTIA 3QZFA 4QYHA 3TDWA 4FZDB 1WBOA 1PYEA 4FSZA 4NIFB 4U0IA 5DT0A 2OWBA 2G2IA 2F7ZE 3EQBA 3CPCA 4RIYB 4OT5A 1M2RA 4NH1A 1MQBA 4BCMA 4E93A 2W1GA 5I5ZA 1YDTE 2XKDA 4LQMA 5JRSA 5IQFA 5LARA 2IVVA 4GVJA 1A06A 2PK9A 3AMAA 1BMKA 5DT3A 5JSMA 2YIXA 4QMLA 5AP1A 3NW5A 3LOKA 3VBYA 1U4DA 3E64A 1B6CB 3DTWA 4E6DA 2W06A 5AR4A 2ZDUA 4RC2A 3ORLA 4CQGA 4FSQA 2Y8OA 4KS8A 4RWKA 5E1EA 5AR8A 4PL4A 3O17A 5ANKA 3RINA 1O9UA 2P3GX 4I6FA 4GK3A 4G3DA 4J97A 4KNBA 5KMOA 2XK3A 2Y4PA 3DK3A 3DXNA 4JLCA 3UG1A 3W32A 4EH5A 5L2TA 4AW2A 4L52A 2H96A 4CFXA 3QQKA 4PNIA 4IZ7A 4WRGA 4DG3E 4ZY5A 4ANBA 4FKPA 4LOOA 4I5PA 2BR1A 2XVDA 3I79A 3HV7A 2VTAA 3VNTA 5FXSA 3CBLA 4XV2A 1GOLA 5HHWA 4RFZA 3CIKA 4O0YA 4F9YA 2REIA 4MH7A 4PTGA 4YSMA 2CCHA 5I9WA 2JIVA 2QHMA 4ZS4A 4FEVA 4XP0A 3SD0A 3DS6A 5JRQA 2NO3A 4L42A 4O7TA 5KUPA 1CDKA 2WTJA 1U5RA 5ETIA 3W1FA 1RE8A 5IZFA 3S00A 5EK7A 4FKVA 3UO5A 3BGZA 4EJNA 2BRNA 4W4VA 3GCVA 5CQWA 4FYNA 2PTKA 4JRVA 1KE8A 2GDOA 4F7JA 4EONA 4K8AA 4QYFA 2H6DA 3CC6A 4RQKA 4F7SA 5F94A 2C68A 3FC2A 4EYJA 3UG2A 4H1JA 4RIWB 5FG8A 2AC5A 4ZTHA 1H0VA 5BX0A 5AV4A 2DS1A 4AGCA 2JKOA 4YZMA 1KV1A 3ROYA 4A9TA 3OG7A 1V0OA 1NXKA 4LRMA 1FINA 4KIQA 2ERKA 3FMJA 4EKLA 2WMVA 3QRKA 4RMZA 4Y73A 2C6MA 4M0YA 5D11A 3RP9A 2BHHA 2OJGA 2B9IA 3V5LA 2GS7A 3VN9A 1CMKE 4AFEA 3BE2A 4BBMA 2UV2A 4BYIA 1ZMVA 5KMKA 2FGIA 4AZVA 4KSQA 4YLLA 2GS6A 4BI2A 3MW1A 3KRJA 3H4JA 3QZHA 4CV9A 4G5JA 5KBRA 5EW8A 3SXSA 4RWJA 5CZIA 4CG8A 4S34A 5CU6A 1YWRA 5I4NA 3QGWA 2OXYA 2VTQA 2XA4A 1FVVA 3DBEA 2ITTA 3COIA 4FZAB 5EG3A 4BF2A 4C0TA 5J9LA 4M7IA 4C3FA 5JQ8A 2W96B 4CVAA 4NIFA 5CAQA 1Q97A 3SV0A 1M14A 1YHWA 1Q8ZA 1ND4A 2VWBA 1WBWA 2O64A 3CLYA 2C6KA 3QD2B 4WG4A 3IG7A 3U6JA 4ZMFA 4L43A 5A14A 1RDQE 2IG7A 3UOJA 3LW0A 4FEWA 3ORNA 4O0SA 3R83A 4IDVA 4Z9LA 3RNIA 4I0RA 4GFGA 1VYWA 4AZSA 5M4IA 3OC1A 2OF2A 3AQVA 4BRXA 3WZEA 3ZFMA 2C3JA 2V55A 2OK1A 3LJ2A 5JGDA 4N6ZA 1MP8A 1WBTA 4IB5A 2YM5A 4EI4A 3IW4A 3L8SA 4BWPA 4B0GA 2GTNA 4OTRA 3KXMA 5IUHA 2VTJA 3TIYA 2XJ0A 3FXXA 5E8ZA 3Q32A 2X8EA 3A62A 3BQRA 3E63A 4BDBA 4C4EA 4EKKA 4GCJA 5GIOE 4MBLA 4BCPA 3H9FA 3EH9A 2UW8A 4IM0A 4XHKB 4GVAA 1O6LA 4LL5A 3RAWA 2OI4X 4FIJA 3TXOA 3ZONA 2QOKA 1JKLA 4RFYA 3WZKA 4D4YA 5I9UA 5LCJA 3R7GA 2ITYA 2X0GA 3CTHA 1FVTA 2VUWA 2VWZA 1LR4A 2ZMCA 2EVAA 2JAMA 2GTMA 3CJGA 3GC8A 3IDPA 3P7AA 3Q53A 4M12A 4AW0A 3DQWA 3CJFA 5HTBA 2UW7A 3MJ2A 3R63A 5HBHA 2JD5A 1M52A 1Q62A 3RPOA 5EW9A 3NVKI 3BEGA 4U97A 5C1QB 4QP8A 3FYJX 4CKJA 2Z02A 3Q04A 1WVXA 5CVHA 4ZSLA 4W8EA 4DT9A 5L6OA 2E9NA 5JZJA 4JVGA 1UVRA 2F7EE 2PVMA 1Z57A 3MDYA 4NWMA 2B54A 1YVJA 2PMNX 2RG6A 3BKBA 4CNHA 2X2LA 3GFWA 3WARA 2YABA 4IW0A 3MFUA 4KINA 1GZOA 1Y6AA 2JKQA 4UBAA 5CF4A 5M09A 4RIWA 5BYZA 5CNOA 1YXXA 1KOAA 4J7BA 2W1HA 3FLNC 4RJ3A 1GAGA 3EN7A 5AUVA 4AU8A 2IVUA 4IWDA 3DJ6A 1M7QA 3DKOA 5KZIA 5AX3A 4C02A 4ZIMA 4W4XA 1I09A 3AD6A 3VF9A 3KF7A 2BAKA 3Q5IA 4RPVA 5FEDA 4O38A 3F3VA 3QD0A 3KK8A 3ZEWA 4IJ9A 2P2IA 2PUNA 5CTPA 4YGAA 1YKRA 5IDPA 3LCDA 3O8TA 2X7FA 4PMMA 5HD7A 4AT4A 1PMUA 3LCOA 1FQ1B 4CSVA 4USEA 1M17A 5ITAA 2ZDTA 3FKLA 4NU1A 3A4OX 3OD6X 4HYHA 2PWLA 3IDBA 4EOQA 4KRCA 3G6HA 1QPDA 4MCVA 4A4XA 5AA8A 1FBNA 3DLSA 3VBWA 3SAYA 5B7VA 3R9DA 2Y0AA 4BVUA 4BKJA 3PJ2A 4NCTC 3VRYA 4PMTA 4DEIA 2PZPA 4TYEA 2C69A 1NVQA 1X8BA 4HGSA 3ZSGA 4EJ7A 4JBQA 1V0PA 2OIDA 5FRIA 3ZDIA 2OW3A 3OCGA 3RM6A 5CF6A 4EQUA 3DBQA 4BCKA 4FSRA 4NKSA 4WSYA 5EHLA 3F3WA 2LAVA 4YO4A 2PVJA 4I5CA 3E87A 5L2SA 4FV1A 1KE6A 5ANGA 5KMNA 5EH0A 2BKKA 3P9JA 3QLGA 5BVDA 2ZM1A 3MS9A 4XV9A 3U51A 3QTIA 5B2LA 5AP2A 3R1YA 4L3JA 4C4FA 4C2VA 3KKVA 4L6QA 2CKOA 4QMSA 5C8KA 2BDWA 4TKSA 4O0TA 5AM7A 4FVPA 4F4PA 4IVCA 3EFKA 3MH1A 3FZRA 3VUGA 5HD4A 2YIWA 3LFDA 3EN6A 1APME 4PNKA 4JL9A 5ETFA 4EHZA 5GZ9A 4O7VA 3L9PA 4QQJA 4C4HA 4EK5A 3UOHA 3NMUF 3TV7A 2NP8A 3H9OA 4K77A 5HE2A 4TNBA 5DVRA 3EZVA 4USDA 4F6SA 3IK3A 4IAAA 5BUIA 1WBVA 5JT2A 4ARKA 4LI5A 2VTSA 2CHLA 3JS2A 3MB7A 2PVHA 4Q5EA 2UVYA 2XK7A 3SQQA 4ZXTA 3VS4A 3R7IA 1XBAA 4O83A 4GJ2A 4RLKA 5EI8A 2YLEA 1B39A 1WFCA 2X9FA 5LJJA 2J90A 4JG6A 1IRKA 4IM2A 3OCTA 4TPTA 3UGCA 4E3CA 4ZZOA 4QP4A 4EK3A 4LG4A 5E8WA 3GI3A 3FDNA 3H10A 5A3XA 2J0MB 2ITQA 5DH3A 5CEQA 2FB8A 5TF9A 3OBJA 4GYGA 1B38A 4ZTMA 2GU8A 4IC8A 4M69A 4OBOA 3EQHA 1W84A 2XJ2A 3FLWA 4BDFA 2OICA 3QKKA 2OF4A 3CE3A 5FDXA 5JQ5A 5LMAA 3PVBA 4GSBA 1UU9A 1WAKA 3CP9A 4FV6A 4MX9A 3EQIA 3R8LA 3NAYA 4Z16A 2UZLA 3FSKA 4G16A 4QMWA 4X6QC 1YOMA 2O65A 3ZDUA 2EXCX 3BEAA 5HLWA 2XM8A 3NUAA 5EDQA 3D94A 5M07A 4L9IA 4HYUA 5DNRA 2PMOX 3QALE 1XJDA 4CT2A 2X4ZA 1YHSA 2ZV2A 4D0WA 4RJ4A 4R5YA 4UMTA 3EOCA 4H36A 2WGJA 3E3BX 3GCQA 3MY0A 3NUNA 4IWPA 3PVWA 4O0WA 2CKEA 2WMXA 3QUEA 3FQSA 2XKFA 4EWQA 2VTOA 5D1JA 3ZLYA 5CEOA 3AT3A 3C0HA 4O7ZA 4XG2A 2BZHB 4NCTA 4B9DA 3MB6A 3HGKA 3MVMA 2BZJA 2VWXA 3NNUA 5IQAA 3JY0A 3QZIA 3AMYA 4UZHA 4RWIA 4PMPA 3R8VA 4BR3A 4EH6A 1OKWA 4ZTLA 3O8UA 3VW6A 3BV3A 5LOHA 4BL1A 4X2JA 4F6UA 2ONLC 5CF5A 1IASA 2GFSA 3R2YA 1G8SA 5A4CA 4TWCA 3KVWA 3ZHPC 3GC7A 3AC4A 1KSWA 3I81A 4LV8A 4YJTA 5CEMA 2BZKB 3O23A 3FC1X 4YC6A 4BI0A 2EB2A 4PV0A 4QTAA 3V8SA 3W2RA 4YZ9A 3UVPA 3BCEA 5CU2A 4KAOA 5HBJA 2IVSA 4AACA 4IVAA 4JDIA 4MNFA 5KX8A 4XNEA 2YM3A 4Y85A 3GQIA 1OKYA 3ORXA 3CGFA 2OH0E 2Z8CA 4JDJA 4U8ZA 3RCDA 3D9VA 3UVQA 4OUCA 3CS9A 4XBRA 5M55A 3W2PA 4CRLA 3DT1A 4J95A 3R9OA 3PXFA 4MKCA 5EKNA 4UX9A 5E8XA 3SXRA 3ZUTA 1GIIA 5L8LA 4FIGA 4GUBA 4CT1A 1T46A 2PYWA 3ZLWA 3ET7A 2WTWA 4TY1A 1KUTA 3TEIA 2ZM4A 2WD1A 3EL7A 4N57A 1UWHA 5FTGA 1F3MC 2VO7A 1Q61A 3L8VA 4CFFA 4N0SA 4UMQA 4EZ3A 4M84A 2WEIA 4QYYA 5BMMA 3BYMA 4JG7A 2WAJA 3CQEA 4N70A 3KREA 1ZZ2A 3MY1A 4BGHA 2G9XA 5CYIA 5BVEA 3ZS5A 4ALVA 4E26A 5K0XA 3UZRA 4DCAA 4U9AA 4F63A 3Q6UA 3BIZA 3D0EA 3E93A 5CS6A 4IZYA 3UOKA 4EOSA 4E4LA 1P2AA 4LGGA 1YOLA 2BIKB 2XYUA 3V5PA 4CYIA 2PVLA 1KV2A 2YHVA 3V6SA 1XH6A 4PPBA 3EKKA 4GU6A 3C4XA 3CR0A 4CLJA 5BYLA 2PZIA 4R1VA 2NPQA 4V0GA 4WO5A 3PXYA 3OWJA 2C4GA 3ANQA 5AUUA 2B53A 1PYXA 1QMZA 3UC3A 3OY3A 1XWSA 4FEQA 4IZ5A 4FVQA 2PU8A 2YM4A 3S1HA 1H08A 3FI8A 5HE0A 3Q3BA 3PLAE 4BDJA 3K5UA 4MXYA 2ITXA 4X0MA 2G2HA 3ROCA 3LVPA 2OJFE 1WZYA 5BPYA 2CNQA 3ELJA 2OG8A 5D7AA 4ITJA 4MQ2A 2R64A 4K0YA 2OIBA 4AOIA 4DC2A 4F6WA 2A19B 3AC5A 4C34A 4IC7A 4G17A 1GJOA 1UNLA 2QKWB 3PE2A 5IA4A 2XK6A 4JQ8A 5HEZA 5K0KA 4XV1A 1T45A 3QQUA 3QX4A 3LMGA 3IS5A 4ERKA 2PULA 5HKMA 1AQ1A 4QMXA 3KA0A 3QD4A 5KNJA 3QYWA 4Y72A 2CDZA 4YJNA 4AFJA 4M14A 3F2AA 4B4LA 2ONLA 5FBNC 5CALA 4P90A 5M44A 2YCRA 3R1NA 4D58A 2CMWA 4UZDA 4ZSJA 5T6KA 5GJFA 3V01A 4YTFA 3DU8A 4D1ZA 2WZJA 1SM2A 4FYOA 4ZTRA 5AV1A 5CAOA 1Q8UA 2R3FA 2O8YA 3B8RA 3BWJA 4FODA 3TUCA 3AT2A 3F3TA 4IH8A 3KCKA 4QOXA 2V7OA 3VS1A 3WE8A 3L8XA 4KUJA 4E4NA 4BGQA 4IMYA 2BRHA 4GUEA 3S2PA 2XNBA 3GU6A 1OPJA 3NIZA 4OAUC 4QMTA 4F0GA 5DOSA 3E7OA 2CN8A 4DG2E 4FZFB 3MA6A 3PA4A 4YJPA 5HLPA 4AAAA 4PP9A 4DEAA 4HVHA 2RGPA 4TW9A 2WMRA 3VUDA 3ZZEA 1LEZA 5AA9A 2YIYA 4FZ6A 5GJDA 4RZVA 4F0FA 4NM3A 3SC1A 3PVUA 4USFA 2BVAA 2VO6A 4FIIA 3ZSHA 3A7IA 4RX8A 3RPYA 2C1BA 4J99A 3G0EA 3TCPA 5J9YA 2WTVA 4AW5A 5I9XA 3KN6A 5K5XA 3DQXA 1GZNA 1YXUA 5EQPA 3BU5A 1U59A 4EYMA 1ZMWA 4F99A 4CLIA 4BDGA 4CG9A 4DFUA 3TZ9A 3DAJA 2UUEA 4D4RA 4I94A 5HX6A 3SG8A 4E8AA 2XIXA 2WIHA 4AZEA 4J71A 2OXXA 2WTKC 3FZTA 5H8GA 4A4LA 3THBA 2XS0A 4NJDA 3H3CA 5HG5A 2J2IB 4MF1A 1TVOA 1URWA 3SG9A 5AP6A 3HA6A 3MVLA 3V04A 5K4IA 2P0CA 4R77A 2VWIA 4YJOA 2W1DA 3PWDA 2JDVA 4DGMA 3ENMA 4FV7A 5AIKA 3FEGA 3VS2A 3R02A 4JBPA 3TIZA 3ZZWA 4F9CA 3OFMA 5CAPA 5E92A 3UZPA 3HV5A 4A07A 4EBVA 4YTHA 4MBJA 4EK4A 2WELA 2HELA 5JH6A 3D14A 4YBKA 3U4UA 1PMNA 2Z7RA 4BDDA 1H07A 3HMPA 4KABA 3DDPA 3DA6A 5BNJA 4ENXA 2OXDA 2X6EA 5CEKA 4I6BA 3BU3A 4ZMEA 3CKWA 3WYXA 2X2KA 1OUKA 3CXWA 3OCBA 3FSFA 2R3HA 4ZAUA 3Q2MA 5L2QA 5FP5A 1JKSA 4PTCA 4UV0A 3AGMA 3WF6A 5J79A 3NVMB 3P78A 2YITA 5J9ZA 5LVMA 4EC8A 1OM1A 3P1AA 2OIQA 2WOUA 4RVMA 5D12A 5C26A 3G5DA 1ZZLA 4G2FA 4ZZNA 3PY1A 4JDKA 2UZOA 1STCE 3BV2A 4OBQA 1Y6BA 3QQLA 5C8MA 1H00A 5CWZA 5E8VA 3RK7A 2OFVA 2W4OA 4D2PA 3PXZA 3RPRA 5TOZA 5JFWA 3GT8A 5CI6A 3L9NA 2XMYA 3MIAA 5KKRC 4HNIA 2I1MA 5DYJA 4HVDA 5L2IA 3OXIA 3BQCA 4QO9A 4YMJA 5KKRB 1UNHA 5HO8A 1XQZA 2XZSA 2C6OA 3KQ7A 4OTHA 5CVFA 5ETCA 5EI6A 2XH5A 3DBFA 4G9CA 4AA5A 4D2SA 2UVXA 5I9ZA 5DIAA 3F7WA 4AQCA 3HP5A 4BCJA 1XR1A 4XG7A 4CKRA 2V0DA 2VNYA 4M97A 3QWKA 2FH9A 3Q96A 1IAJA 3D5XA 4BB4A 3EHAA 4KD1A 4APPA 5DLSA 4CRSA 2J7TA 4P5QA 2J51A 3UMXA 3MGYA 4FSNA 3R7OA 1R1WA 2QU5A 3QRIA 4E4MA 4YTIA 2GQGA 5E4HA 3EQCA 4PPCA 3M11A 3RVGA 2VTLA 3P5KA 3O2MA 4JR3A 4C4JA 1WVYA 2YDKA 2I0YA 3W2CA 2C5YA 3HVCA 3RKBA 3MFRA 3NW7A 2XEYA 5CSHA 3DKCA 2QVSE 2W1CA 3I5ZA 4QMMA 4QTEA 1AD5A 1JSVA 3PG3A 4FKGA 4EOMA 3I0OA 3MSSA 2WKMA 4R7IA 4D1SA 4WHZA 4EUUA 4MK0A 3KMUA 2PE1A 5A6NA 2W5AA 4Z3VA 3RZBA 5B2MA 4IADA 4O7RA 1OL6A 2VTRA 2BTRA 3SW7A 3DK6A 4FKUA 1OBGA 2VWVA 5HLNA 4G6LA 4IX4A 4FICA 3QF9A 3NNWA 4EUTA 3QD3A 4KSPA 1H28A 5K3YA 4CFVA 3F82A 4D55A 4E5AX 4EOIA 2QKRA 4NZWB 1ZOEA 3UTOA 2BRBA 3PZEA 3D2KA 4MF0A 3O7LB 3S0OA 5FBOA 3CTQA 2C6DA 3VHEA 2FVDA 5A46A 1ZLTA 4FKWA 3TUBA 3ZTXA 1E1VA 3P86A 4EHVA 5IQBA 1JKTA 3AD5A 4MWHA 4TNDA 5GNKA 3C51A 2BTSA 4YTCA 3LHJA 4YNEA 3VAPA 1S9IA 4IHPA 4BI1A 1XH5A 3F5PA 3JYAA 5KZ0A 3HV3A 5BVFA 2C3LA 4I1ZA 4IQ6A 2Y7JA 4DFXE 5JFXA 4NM7A 3UQGA 1OGUA 3U54A 2QG5A 4JQ7A 4BHNA 3VQUA 4GIIA 4XJ0A 3A8WA 2B52A 3QBNA 3U87A 3V51A 5BUJA 3CTJA 3FHIA 2FSTX 3RHXA 1BLXA 5AFVA 3BBTB 4Y8DA 4F9WA 3QUDA 4AP7A 4CXAA 2JKKA 3RM7A 3ZM9A 4DLJA 4LRKA 3OT8A 2CNVA 3AC1A 4I4EA 4FV8A 5DG5A 3COMA 4I24A 3TUDA 4FNXA 3LFQA 4FTKA 2HZIA 4KB8A 3SRVA 5CU4A 3F6XA 4FV9A 4DCEA 1G8AA 4V04A 5FQDC 4XS2A 2KULA 1FGIA 5AR7A 3PJ8A 2V7AA 1YOJA 2QOIA 5BVKA 2R7IA 3OUNB 4AN9A 4FG7A 4BICA 4C37A 3R8UA 2C6LA 5DA3A 2W05A 4TN6A 3GC0A 2ETKA 1CKPA 5EM5A 5FDPA 4DF3A 1OUYA 4HJOA 4MQ1A 3JVRA 2YZAA 4R5SA 4ZTNA 4C36A 4EEVA 2Y6MA 4D2VA 5HVJA 2JFLA 2X7OA 3Q9YA 4AF3A 3NAXA 4J8MA 3I7CA 3FZOA 2OGVA 3O7LD 4MXXA 4NK9A 1UU8A 1OI9A 4BDCA 2YCFA 3NCGA 1RQQA 2UZDA 4JIAA 4OT6A 3GVUA 5LQFA 2E9PA 1CKJA 1JLUE 3NSZA 4FTOA 4P7EA 3TNWA 4EH2A 4FZ7A 3RCJA 4YSJA 3QA8A 2BHEA 2XK8A 4Z55A 4L00A 4RT7A 4YJRA 2XYNA 1JNKA 4RIYA 5LMBA 3O96A 4B7TA 1BL7A 3QUPA 4X2KA 2P2HA 3R8MA 5FEEA 4AZFA 4C3PA 3KB7A 3NGAA 5J1VA 5BQ0A 1QL6A 2A0CX 3LZBA 3MPMA 4GEOA 1RW8A 2ZAZA 4KKEA 4QP7A 4IE9A 4AS0A 3VUIA 5F9EA 4O2PA 3PG1A 4OTIA 2JIUA 4Q9ZA 4C57A 2I40A 1H24A 3GENA 4FR4A 3C9WA 3BGQA 2WFYA 3IGGA 1H01A 3DV3A 4JNWA 3JPVA 1UA2A 3HP2A 3P08A 4ACDA 3M2WA 5ACKA 4A9UA 4F65A 4O81A 2YJRA 4QTCA 2ITOA 3EKNA 3EMGA 3OW4A 3CY2A 4FSUA 1K3AA 4GU9A 3ZU7A 1H8FA 4CFWA 5AADA 4HPUE 4FG9A 2YM8A 4C7TA 2H8HA 4OTPA 4AA4A 4YBJA 4CCBA 2R3LA 4IANA 1Q3WA 2PE2A 3WZJA 2YN8A 4QMVA 4YJQA 5AUWA 2XKCA 4AOJA 5T3QA 3IOPA 5FP6A 4XX9A 3SOAA 3DTCA 3E62A 5AP7A 4CCUA 3HLLA 3PIZA 1PJKA 2JBOA 4RVTA 3DCVA 5AAEA 2XIZA 4E1ZA 5IEVA 5JK3A 3R9NA 4XG6A 2JEDA 4D9UA 4DFZE 2O63A 4O82A 3BHUA 3AD4A 3PJ3A 2YAKA 5DWRA 3MTFA 5I3RA 4EOKA 3FMMA 2ZV9A 3MPAA 4ZZMA 2ZOQA 2O3PA 3LQ8A 4WBBB 3PP1A 4ZTSA 1VYZA 5EM8A 3V5WA 2CSNA 3BGPA 3CD8A 3ZRLA 2IZRA 3NYVA 5CEIA 3EWHA 5EOBA 4EZ5A 2I6LA 3R9RA 5HZNA 2QLUA 2WMAA 4UN0C 3E8CA 3OROA 1OL1A 3T9IA 1CM8A 3UIUA 3MYGA 5LVOA 3WIKA 2WQMA 4FV5A 3F2RA 2VGPA 3T9TA 2Z60A 3DGKA 3LFSA 5DR2A 4FE2A 4U42A 3NWWA 4RG0A 4NFNA 1WBPA 2YACA 4MAOA 1PXLA 4BHZA 4YHFA 3MN3A 4ACGA 4O0UA 3BWFA 4ZK5A 4EQCA 4MBIA 1REJA 3FPMA 3II5A 5I3OA 4FSWA 5E8UA 4D0XA 2GNGA 4YJSA 4AN3A 4ACHA 3GP0A 5CVGA 3U6HA 2QOLA 5LCKA 3OWKA 4FT5A 1LPUA 3ZEPA 1H1WA 3ORMA 4LUDA 4XMOA 1VJYA 2W1FA 5EYMA 3ZO3A 2RF9A 5JFVA 2YCSA 5AIRA 2BZIB 3HDMA 2QU6A 4KBCA 4O1PA 4NEUA 1LEWA 1IA9A 2GNIA 3ALOA 2YIRA 3DZQA 1Y57A 3B8QA 2WIPA 3IW5A 4FBXA 3LXKA 2OJ9A 3TTJA 2JDSA 3T3UA 1JSUA 5DPVA 3PY0A 5M57A 1IR3A 3GXLA 4N4SA 3WIGA 3UIBA 1UKHA 3FY2A 4FIHA 2QOCA 4ZJVA 5K9IA 3Q4CA 4UYNA 3VWAA 3GOPA 3KXXA 1PXIA 5KBQA 4BTMA 3OZ6A 1U5QA 4EHGA 4XG8A 5CF8A 3O71A 1JVPP 3O51A 4JS8A 2YCQA 4CEGA 4RJ6A 3C7QA 4QMYA 4YPSA 3RPSA 3VS7A 3DB6A 3BLQA 4LMNA 4NSTA 2F49A 2R3OA 2QG7A 2EB3A 4U44A 5IQGA 2X2MA 4QNAA
chains in the Genus database with same CATH superfamily
2FUMA 2HY81 2R4BA 3DKFA 2PPQA 2F9GA 3ZRKA 4XRLA 4R8QA 3ODYX 4XG3A 5CSWA 5LWNA 4DDIA 1OIQA 3D5WA 4ERWA 1XBCA 2ZFYA 3O50A 1IA8A 1WVWA 2QD9A 2GQSA 3ETAA 5EDRA 2XCKA 3GGFA 5A9UA 3R1SA 1QPEA 1Y8YA 2J9MA 2HXQA 2V22A 3COKA 5IDNA 4RIXB 5KE0A 2JDRA 1PMEA 3H0ZA 4FL2A 3E8EA 5L4QA 4JXFA 2ITNA 2PUPA 1YI6A 3KFAA 1OKZA 1CKIA 2PZ5A 3CKXA 5HO7A 3MESA 3VBQA 4D4SA 3DAEA 1KOBA 2YAAA 1ZXEA 4FTCA 4I5HA 3BLAA 3EFWA 1URCA 1DI8A 3EL8A 4XV3A 3WF8A 2XNEA 4K11A 2GS2A 2GSFA 3V3VA 4WA9A 2R0IA 2XARA 3ZH8A 2WO6A 5TR6A 2C0TA 3VONA 3G51A 4MD9E 4UYAA 3R7VA 4CFMA 5FGKA 3IW7A 3FWQA 4QRCA 3OF0A 1UU3A 3NYNA 3DKGA 2FA2A 1L8TA 5DE2A 3AC8A 3DJ7A 3VBTA 3OBGA 5J87A 3W0OA 2OH4A 5D41A 4FUYA 2UZWE 2IVTA 1Z9XA 2ZMDA 4GG7A 4QMOA 3I6UA 1OL7A 3PXRA 4CZTA 2RG5A 3LLAA 4QP9A 1WMKA 4JG8A 1GIJA 3G90X 4CZUA 5C4KA 1DM2A 2Y4IC 3IQ7A 4Y46A 4L7SA 3UOLA 1SNUA 4U3ZA 4U80A 2JDOA 1V0BA 3FMKA 3KRWA 3MV5A 5AUYA 3TT0A 4IAIA 2W7XA 5FEQA 2Y4IB 5LWMA 4RVKA 1M2PA 3R28A 5IA1A 4H3QA 4ASEA 2J5FA 4FKIA 4BDIA 5IKWA 5LMKC 2FSMX 1U54B 3KRXA 4E6CA 5KHWA 2R5TA 2LGCA 4ANLA 4F1MA 1F5QA 1OL5A 4FG8A 5CT7A 3EQFA 3L1SA 4J52A 4PL5A 5C9CA 3AXWA 3NZ0A 3ZYAA 2RSVA 2P33A 1REKA 3OEFX 2PMIA 3W0SA 3RAKA 3PFQA 2W1EA 3WILA 2YERA 5IQCA 4WNMA 4UXLA 4OTWA 4UXQA 5D10A 3DOGA 4LGHA 4Z7HA 2XNPA 4UY9A 3VIDA 5HIBA 3U6IA 1OBDA 2WMSA 4PY1A 4EH3A 3BYVA 5IH5A 1WCCA 2J5EA 3LCTA 1ERKA 2FO0A 4J1RA 3RALA 2I7QA 1Y91A 2W9FB 3C13A 2OJJA 4F70A 4Y5QA 5JGAA 2UW3A 4FC0A 2R3KA 1UKIA 3NPCA 3RK5A 5HESA 3ULIA 4C58A 3U9NA 4IAKA 3W10A 3OCSA 1GNGA 4FTNA 4RIXA 2HCKA 4F9BA 3LLTA 3GFEA 1F0QA 4NKAA 5DT4A 2WB8A 4FMQA 3TV4A 1Z5MA 4BTKA 4NTTA 1HCKA 5DI1A 4YZBA 3D5VA 5EW3A 3KCFA 4P5ZA 3BHYA 4G3FA 4YC3A 4BIEA 4E5BA 5HG8A 4JIKA 3NR9A 3RWQA 2UZTA 2CLXA 1J7LA 1PHKA 4FT0A 4FV0A 2QURA 3VUKA 2OZOA 1IEPA 2WMWA 3DDQA 3QKLA 3R71A 5H3QA 5CSPA 3UP2A 4IVDA 4X21A 1UWJA 3A61A 4APCA 3KGAA 1GZKA 3LCSA 3MY5A 3MFTA 4M8TA 4O96A 5HVKA 4FTJA 2HY0A 4KS7A 3POOA 3HMMA 4IIRA 1ATPE 3FAAA 3D7ZA 4ALWA 4QP6A 3HYHA 2BRMA 3PSCA 3RAHA 5FD2A 2OJIA 5AP4A 2P4IA 3SLSA 5AV2A 1XH7A 4GV1A 2WTDA 4MWIA 1PXMA 4XG4A 3LXPA 3UC4A 3W2OA 5L2WA 2J4ZA 2YA9A 4S2ZA 4XLVA 4RSSA 3WF7A 1SVGA 4GRBA 3EJ1A 1H4LA 3LXNA 2QOOA 5M56A 2BCJA 3NX8A 2QC6A 4I20A 3FI2A 4EOJA 4CFNA 5HVYA 4GK4A 4DGOA 3LFCA 4KA3A 3DNEA 1DAWA 3NYOA 2JFMA 3PZHA 1JKKA 3VS6A 1SVHA 3MH2A 4KRDA 5DMZA 5TO8A 5G6VA 1TFFA 4WG5A 4IX3A 2UW4A 4DEDA 3EIDA 3PA5A 4GL9A 4GG5A 5BVOA 4A06A 3FLSA 3QHRA 4LRJA 4N6YA 1TKIA 2Z7LA 3B2WA 5AWMA 4TWPA 2A98A 2Z2WA 4DYMA 5ANIA 1M2QA 2VTTA 3OWLA 3ZSIA 3D2IA 4U3YA 2VGOA 3PSDA 2QHNA 4DN5A 5LMKA 4PL3A 3GU4A 2I0VA 2ZV7A 3I6WA 1YXSA 3RK9A 5IA2A 5KO1A 2JDTA 2R3MA 4HGTA 4JR7A 3EN4A 1PXKA 2VD5A 1R39A 3QCXA 3ACKA 3UYSA 3TV6A 2E9VA 4UWCA 3VC4A 4UMUA 2WMTA 3KF4A 1ZYLA 3CY3A 4U40A 1DAYA 4FIEA 5M4CA 4F0IA 2BPMA 4XG9A 2OZAB 3F9NA 3L9LA 5KCVA 3HX4A 4WNOA 3LIJA 1TQIA 5IUIA 5HORA 2ITUA 5C8NA 5E7RA 5L8KA 1ZWSA 4U81A 5J7HA 5J95A 4DGLC 4NJ3A 3LQ3A 4AUAA 4YZNA 1R0EA 4F08A 1YQJA 3F5XA 4BC6A 5HNGA 4DTKA 2X0QA 5BYYA 2VN9A 2Z7SA 5TE0A 2F2CB 2XAMA 2W5BA 4DTAA 4DFNA 4HVIA 2UVZA 2WXVA 4JAJA 5CQUA 4O7NA 4YPDA 4FNZA 5E8TA 3ZLSA 3HDNA 4O7WA 4PQNA 1Q5KA 2IJMA 4ANOA 2WPAA 2R7BA 3OTVA 4DBXA 5IUGA 1MQ4A 2J0KA 4OLIA 2R0UA 3QRTA 3QX2A 3R2BA 4RX5A 4Y95A 4EH9A 1Q4LA 3IGOA 5B0XA 4FEXA 4C62A 4RQVA 3ENHA 4Y5HA 1Y8GA 4CMTA 2CKPA 2OO8X 2XUUA 4I92A 5HGIA 2X4FA 2R3GA 2DYLA 2A4LA 4WT6A 4NW5A 3PA3A 5CZHA 3AC3A 1BL6A 4TYIA 2BRGA 4BCFA 1KE7A 1ZYSA 3DFCB 2UZBA 3FMLA 3BLHA 3JUHA 3NLBA 4YC8A 4PP7A 3L8PA 4HZSA 5CAUA 2PUIA 1NW1A 3UP7A 3PE1A 2CJMA 4FV2A 4FIFA 2BFXA 3E7VA 3OMVA 5AAFA 3GB2A 4O7LA 5ANOA 4W9XA 2YZLA 2HZ4A 5F20A 3NYXA 4K2RA 2FSLX 3NUYA 3NW6A 4D28A 1W0XC 3C4CA 4ID7A 5A4EA 4L67A 2Q0NA 3TNIA 1XMLA 3Q52A 4O7YA 2B1PA 3ZO1A 3CCNA 4QP1A 3HRBA 1OL2A 5CAVA 4R78A 3PY3A 4TT7A 4CMUA 4E4XA 1FPUA 2X6DA 1UV5A 2W1IA 3MIYA 4I23A 4I6HA 4EH7A 5GZ8A 1JOWB 3BE9A 3VS5A 1FGKA 4NFMA 2VWWA 2VX1A 3AGLA 3LE6A 2GFCA 4UB7A 5LVLA 4BCQA 4E6AA 5EHOA 3W2SA 2YDIA 2UZEA 4GFMA 2VZ6A 2G01A 2JBPA 4LL0A 5AV3A 5HBEA 4DEHA 1H27A 3BYUA 3WZUA 3A7JA 3VJNA 5CANA 5A6OA 5DR9A 3OT3A 3A7FA 5JGBA 3K5VA 3FI4A 2V5QA 4D5KA 4EQMA 4U43A 1VZOA 3O0GA 3RAIA 5CU0A 5HI2A 3Q4ZA 4FV3A 3FZSA 1MRUA 2NRYA 2AYPA 3UPXA 3UZTA 2R3QA 4F1OA 1HOWA 1W98A 3AMBA 2GQRA 2XK4A 4PDOA 5HICA 4P2KA 4NTSA 1XH9A 4GW8A 2C5XA 3GU8A 3HA8A 3FL5A 2OZAA 3SVVA 3BYOA 2BAJA 2VTPA 5HU3A 4F7LA 1JSTA 1P4FA 5IQHA 4DLIA 4GKHA 2VNWA 4QQ5A 5E9EA 3OXTA 1H25A 4KIPA 4TZRA 2XNMA 1OVEA 3ORZA 5HX8A 4IAYA 3DXQA 2ZJWA 4R3RA 3FV8A 4BYJA 3UDTA 2PVFA 5AUXA 3OHTA 1VEBA 2BAQA 4EZ7A 2GMXA 4WSQA 3A60A 4IACA 3EQDA 5HO6A 4H05A 1K9AA 3EFLA 3CPBA 4LOPA 3RJCA 1PF8A 3LJ1A 1W82A 3LJ0A 4EK8A 3HV4A 3NNVA 1DI9A 3MA3A 2JITA 2UW0A 4AA0A 4GFOA 5EQEA 1Q8YA 3ATTA 4P4CA 3RTPA 3GU7A 5DRBA 4O1OA 4JX3A 4U79A 4D2TA 4DEGA 3I1AA 4O2ZA 5LVPA 3PPJA 2GNFA 2R3PA 4TRLA 5ACBC 3NUXA 4QP3A 5AP3A 5AX9A 3N4UA 3DY7A 3U4WA 5CENA 4ENYA 3G0FA 3NUSA 3OP5A 3RWPA 4M13A 4MXOA 1Q8WA 5IH6A 5IU2A 4XOZA 2QO9A 3E3PA 4FTUA 4BIDA 3E8DA 4KKHA 3TNPC 4WUAA 2EU9A 4H1MA 3RHKA 3QQJA 4O0XA 2F57A 2XF0A 1YI4A 3OOGA 4JAIA 3QWJA 1ST4A 5GINE 3L9MA 3K3JA 5M4UA 2JLDA 3PUFC 3TKIA 4IB1A 1CSNA 3PJ1A 3BPRA 4DH7A 4JQEA 5HIDA 3TJDA 4TXCA 2C5NA 2XJ1A 3JXWA 1SMHA 4HCTA 5FM2A 3O8PA 4L68A 5AM6A 3ORKA 1QPJA 1NY3A 2GCDA 3ITZA 2VV9A 5EYCA 5IA0A 2SRCA 4LMUA 4ZLYA 4ASDA 5EFQA 3P0MA 2C5VA 2GNHA 3VUTA 4ZOGA 2O2UA 2VX0A 4HOKA 3KXNA 3ZXZA 2XCHA 3HUBA 4ITIA 4DGGA 3LXLA 4HGEA 4MYGA 3R7UA 4GH2A 3TKHA 3LMHA 3D7TB 4IB0A 4IJPA 4YO6A 2DUVA 4C38A 3QKMA 4M66A 4YJUA 4TTHB 2HYYA 3KL8A 3WOWA 4BZNA 3HAMA 2GNLA 3RNYA 3WE4A 4ASZA 4LM5A 3NS9A 4I4FA 4J53A 1VLRA 4L53A 5D7VA 1H1SA 3NEWA 4IX5A 4C3RA 3N9XA 4WNPA 3DLZA 3Q9ZA 4O21A 5L6WL 1AGWA 2PMLX 4R3PA 5JKGA 1BKXA 4M67A 4G3CA 4EC9A 2XANA 3C1XA 3VW8A 4UWYA 3DB8A 2WMQA 2BILB 4MTAA 3R8PA 2BKZA 1ZRZA 3GCSA 3HZTA 5AR3A 4B8LA 3DZOA 3AKLA 1W2DA 4K6ZA 1K2PA 4IX6A 4I5MA 3KC3A 4RFMA 3M42A 4RA5A 4CQEA 3QTRA 2CGUA 3TZMA 3UPZA 3N51A 2C30A 1WBSA 4HPTE 2Z7QA 1RJBA 1SNXA 3BX5A 2HK5A 2XNGA 3D83A 5DN3A 5HCYA 5HG9A 4BCHA 4CKIA 4EWHA 3NIEA 4L01A 2J0LA 3EQRA 3QRUA 4KWPA 4QQCA 3MVHA 2C0IA 3WBLA 4EL9A 2GHLA 3I7BA 3TACA 4Q5HA 4ASXA 1J7IA 1YHVA 4J98A 4MXZA 3UNKA 3I0QA 3LM0A 5C01A 2BFYA 4GT3A 5M4FA 2B9FA 4XBUA 1PKDA 3DPKA 4MXCA 2O0UA 2CPKE 4XCUA 4D2RA 3JR1A 5KMJA 2XKEA 4X3FC 5CEPA 3QQFA 2WOTA 5DBXA 4E73A 1ZY4A 2F7XE 4X3FB 4X7QA 3MI9A 3BI6A 3CSVA 4ZLOA 5L3AA 1YI3A 4FTAA 5IF1A 3C4ZA 3ZLXA 2WEVA 4E7WA 4QMPA 3R9HA 3AC2A 2FSOX 5IH4A 3R00A 2HWPA 3PWYA 1GIHA 2FYSA 4MD8E 3VBXA 3GCPA 3S95A 3OXZA 3P7CA 4CTBA 4DT8A 5A54A 2NRUA 4FSYA 3T3VA 4CTCA 3H9RA 3K3IA 3C50A 3UNZA 4JRNA 4DTBA 1XKKA 3BHVA 4FGBA 3ML1A 2IW9A 3NDMA 2F2UA 2E9OA 3FBVA 1NVRA 2KTYA 4RC4A 5CXZA 3FL4A 2CGVA 3FQEA 3IW6A 3MPTA 3KY2A 3QCSA 4FVRA 1LP4A 4R1YA 5A4TA 3SHEA 3G15A 3RMFA 2C6TA 4O0RA 4OR5A 2H9VA 3R6XA 4M3QA 4XRJA 3ZRMA 5IQDA 5HTCA 2G1TA 5ANEA 4AG8A 4XYFA 4X2GA 3IOKA 3FMEA 5J8IA 2VX3A 2YLFA 3RGFA 2XP2A 5KMLA 3HECA 3UDBA 3KRLA 3F3UA 2R3IA 5T68A 3HEGA 4I0TA 3OUKA 1JAMA 2YIQA 3NRMA 4QQTA 1PW2A 1UU7A 4WRSA 5C4LA 2C6IA 5IG1A 4UWBA 2XEZA 4YHTA 5H2UA 4DITA 3FPQA 4K9YA 3ZMMA 2GHMA 4BBFA 3D7TA 3OY1A 5IQEA 4B99A 3GUBA 3P7BA 2OLCA 2C0OA 3D4QA 3F88A 2YISA 3D15A 4EHEA 3PUPA 1U46A 3A7GA 1BI7A 3DJ5A 4HCUA 4C35A 1XMMA 2BDFA 2J6MA 2JKMA 3FKOA 4FV4A 4S31A 4A9RA 5AUTA 4BY9E 4XP2A 2XRUA 3ZC6A 4TYGA 1S9JA 4Q9SA 2OSCA 4TWNA 3F5UA 3QYZA 3BL9A 4DFBA 5AR5A 1SVEA 3FY0A 3Q6WA 4H3PA 2ZB0A 2Q83A 4JJRA 4X2FA 5AAGA 4FA2A 3PIYA 4FTRA 2XBJA 4MVFA 4EBWA 4FK3A 2X81A 3WI6A 4QMNA 3TM0A 1A48A 2B55A 2WTCA 2VO0A 3UJGA 2PY3A 3N4VA 3EQGA 3V5JA 4GYIA 4QMQA 5M51A 3A7HA 1YDSE 2ACXA 3QTQA 3QHWA 3G33A 5H9BA 3GNIB 4BKYA 3UO4A 4D5HA 5CSXA 5AEPA 4I22A 3ID6C 2XB7A 3FYKX 4JBVA 2JC6A 1GZ8A 2XIKA 3QTXA 4TYHB 2BMCA 3AT4A 4LGDA 5E1SA 1P4OA 4QTBA 3V6RA 5JFSA 5CI7A 4BJJA 4YLKA 4KBAA 4PWNA 3ZFYA 2HENA 5AP5A 4FKSA 4X3FA 4YZCA 1YXVA 4XUFA 4GT5A 1OIRA 3ORPA 2O5KA 3Q9WA 3RPVA 1HCLA 2YDJA 1BYGA 2YJSA 4UEUA 4YR8A 4AGUA 5FLFA 3QTWA 2QCSA 3HAVA 2WTIA 1ZY5A 1CTPE 4TWOA 2J0JA 1TQPA 3IW8A 3QTUA 2XIRA 3PDTA 4MXAA 4AW1A 4CV8A 4F7NA 5HIEA 3CGOA 5HE1A 2VRXA 1QPCA 4NM0A 4AGWA 5IPJA 4DA5A 4K33A 1FOTA 2HW6A 4L46A 3PPKA 2IZSA 2IW6A 5EI2A 5GIPE 5IA3A 4HYIA 3COHA 4W9WA 5JZNA 2B9HA 4OBPA 2C5OA 2G15A 3W8QA 5AP0A 1J7UA 1YW2A 2B4SB 2ZM3A 4WBOA 3UMWA 4FI1A 3JY9A 3QC9A 4RX9A 1NVSA 3FMHA 3PXKA 5CU3A 3W55A 3ORTA 3HUCA 2IWIA 1BUHA 4W4YA 4FTTA 1PRYA 4BIBA 1BX6A 1XH4A 1YRPA 3R73A 2VTHA 3QCYA 4HZRA 4M69B 1E9HA 4FT9A 4MD7E 4DAWA 3FLYA 3HKOA 4TYJA 3DK7A 3F7ZA 5JMSA 3GC9A 3OEZA 4GS6A 2ZB1A 5FM3A 3ZO4A 3FI3A 2NNWB 2C1AA 4FTMA 4DHFA 4FKOA 3TL8A 5AUZA 4YUQA 3GQLA 3R7YA 2ESMA 4UALA 4XOYA 4PDYA 5E91A 1FMKA 2B0QA 5AR2A 2CN5A 3SKCA 4JT3A 3ATSA 2WMBA 3M1SA 4QPMA 4HVGA 4ZSAA 3KRRA 4C8BA 4AN2A 3LCKA 3C5UA 3REPA 5HE3A 4J8NA 4AOTA 1W8CA 2Y6OA 4AT5A 3CQUA 1OECA 3HNGA 5EM6A 3VS0A 3PRFA 4X2NA 3TNQB 3V8TA 4ZLZA 5HNIX 2QOQA 4BCGA 5IEYA 1PMVA 5L8JA 4BWKA 3FLZA 2DWBA 4BCIA 4PX6A 2I0EA 3SDJA 2GPHA 4HYSA 2YM6A 2YWPA 3I60A 4GJ3A 4H39A 4QTDA 1V1KA 4HNFA 5J5SA 3MVJA 4FSTA 3E8NA 2IW8A 1Q99A 3TWJA 3UVRA 2CKQA 1ZOHA 2CNUA 3RBWA 2X9EA 3OS3A 4OGRA 4PTEA 4RBLA 3FXZA 3UYTA 4BDEA 4C2WA 4D4VA 2QO2A 4I6QA 1H1QA 1OPKA 3HMNA 4FL1A 3VJOA 1G5SA 2RFEA 3SOCA 5KHXA 4ACCA 1PKGA 4L7FA 3GBZA 3VVHA 4U5JA 3LFNA 4G31A 3WZDA 2EWAA 2X8IA 3BYSA 3LFFA 4TYHA 4WUNA 4HW7A 5JN2A 4OW8A 4CFUA 5KMIA 3BZ3A 5AV0A 3UIMA 3VRZA 4KIOA 4O4CA 2XNNA 4FKJA 1XBBA 3G2FA 4O84A 2HIWA 2XNOA 3R8ZA 3R1QA 3UQFA 2UW9A 1W7HA 2UW5A 4FKRA 2QR7A 3Q9XA 4NT4A 4FOBA 4Z7GA 3K54A 1XO2B 2HW7A 5EHYA 4AE9A 4BTJA 1PY5A 3Q5ZA 5CXHA 4XLIA 3NFGB 1Q3DA 3E5AA 4FKTA 2PHKA 3HMOA 4BN1A 4Y83A 3IPHA 2CLQA 4PRJA 3VBVA 5IISA 3F66A 3NCZA 4JDHA 4II5A 5ANDA 5FXQA 1UNGA 3BHTA 2IZUA 2VWUA 4QMUA 3FUPA 4AGDA 3QL8A 5BVWA 4AX8A 4U45A 3KULB 4DFYA 4QPAA 4HGLA 1JWHA 5EM7A 2YWVA 5E8YA 4I3ZA 3C4FA 1OB3A 4FF8A 3BBWA 3G9NA 3PRIA 3PP0A 3QA0A 2W5HA 3BLRA 3QXPA 4LUEA 3TDVA 2PZYA 3ANRA 5H8EA 1KE5A 3KK9A 4L3PA 3GU5A 5IA5A 3UE4A 2EXEA 2VTMA 1MRVA 2VAGA 4DFLA 2CGXA 5I0BA 4ZSEA 3R7EA 1ZOGA 3JVSA 4MNEB 3U9CA 1XH8A 4CYJA 1JQHA 1IG1A 3MH0A 4PPAA 4RLLA 2GHGA 3QQHA 3WF5A 2BDJA 3LFBA 2UZNA 4LV5A 2W1ZA 3TMOA 3W0RA 3KVXA 2GNJA 2ITVA 4E5WA 4WD5A 3BU6A 4QYGA 3EZRA 4GMYA 3R21A 4DH8A 4O0VA 4XP3A 3IO7A 2I0HA 5IEXA 1KE9A 2WHBA 3SA0A 4QP2A 4U41A 5FTQA 5J1WA 4BGGA 4O7SA 3UBDA 2X0PA 1R0PA 4IAZA 4S32A 5IMXA 3FHRA 3ZUUA 4G5PA 4V0GB 3VUMA 4IVBA 1EH4A 2YFXA 4PUZA 4OTQA 5B2KA 4LFIA 4YLJA 4JX7A 2W4JA 4DEBA 5I9YA 3EB0A 4LOQA 1DS5A 5F95A 4RA4A 3KEXA 4S30A 1YDRE 5G1XA 4U7ZA 3FE3A 4FK6A 4HCVA 3W2QA 4FSMA 3ODZX 3OW3A 4LYNA 3FJQE 2R3RA 4M15A 4RJ5A 4I41A 5BMSA 4FGRA 4PF4A 5DEYA 5AJQA 2OBJA 3UO6A 5DEWA 2XM9A 2PUUA 1O6YA 2R9SA 3EN9A 3LFAA 4X3JA 2R2PA 3SGCA 5CNNA 4PMSA 4O86A 4O6EA 3HRFA 5DFPA 3EFJA 3IDCA 4XH6A 5HNBA 3P23A 4NW6A 4ZP5A 1Q41A 4DE4A 1FVRA 2WU6A 1PXPA 4DINA 2OFUA 3NNXA 4D9TA 4ZY4A 3I5NA 3LFEA 2OKRA 4OTFA 4C59A 5L6PA 5TKDA 2HOGA 4WKQA 3C5IA 2BALA 4G34A 4FRFA 3N4TA 4RGJA 4MHAA 3R01A 4FX3A 3PYYA 5ETAA 5GHVA 3LKMA 3TG1A 3R22A 4JI9A 4IZAA 3U55A 2RL5A 4ANSA 5HCXA 4AXEA 4FTLA 1JBPE 4OTGA 5TT7A 5HU9A 3QXOA 3F5GA 4E6QA 5M08A 3GOKA 3W0NA 4PDSA 3WYYA 5JEBA 1OZ1A 3HMIA 4H58A 3Q4TA 2BIYA 3UQCA 4LDTA 3TN8A 1YXTA 3KULA 2HZ0A 4FKLA 3TTIA 3DBDA 3VUHA 2J0IA 3PSBA 2C47A 4AZWA 2R3NA 2WMUA 2ERZE 3KXHA 3TZ8A 1KWPA 2W17A 2VWYA 2W0JA 1OPLA 3QGYA 4DH5A 4CD0A 4CMOA 3FMNA 4WIHA 4G3EA 3TJCA 1OIYA 4BDKA 3DFAA 5EYKA 4F9AA 2QI8A 2PVYA 2RFSA 3F69A 4L44A 4XEYA 4DH1A 4RWLA 2G2FA 4MNEA 4O91A 2A2AA 5GZAA 5IMEA 3D5UA 2CGWA 2PVKA 3HV6A 3KMWA 4RIOA 1SZMA 4ITHA 4A9YA 1ZMUA 3PJCA 1H1RA 3IKAA 5DGZA 2RFDA 3RZFA 5CT0A 4I21A 2RIOA 4ALUA 4G3GA 2E9UA 2PE0A 2H34A 3F61A 1M7NA 5LVNA 1MUOA 3F3ZA 3QC4A 4D2WA 4ZEGA 1U54A 3MTLA 1J1BA 1ZYCA 2WQOA 4C4GA 2VTNA 1BI8A 4BDAA 1H0WA 1OMWA 1ZAOA 3VS3A 4I0SA 2Y9QA 2XIYA 3OOMA 4FTQA 2QOFA 2ZVAA 1FMOE 4GT4A 4A7CA 4ZJJA 2F4JA 4A9SA 5H8BA 3UODA 2QO7A 5HQ0A 4FT3A 3KN5A 1R78A 3G9LX 3CD3A 3IECA 2YM7A 2X8DA 3LPBA 4IXPA 2WQEA 4DH3A 4M0ZA 5HOAA 2QLQA 1PXNA 4K1BA 2XAOA 2QR8A 5ICPA 4YP8A 1MRYA 3G6GA 3SX9A 3C4WA 4R7BA 2UW6A 5IQIA 5EYDA 3C4EA 3H0YA 2WQBA 4BZDA 3ALNA 2HXLA 2B7AA 3V5QA 4FUXA 4F1TA 2C6EA 4HVSA 1NT2A 2CCIA 3MBLA 4L45A 4UMPA 3QCQA 4KIKB 2XBAA 3QRJA 4QDEA 2R3JA 2W4KA 4IWOA 1O6KA 3C0IA 3DBCA 2OU7A 3ZFXA 4AE6A 3C0GA 1Q8TA 4AT3A 2J50A 4ZJIA 4AXFA 4RX7A 4AQKA 4B6LA 3RI1A 2IPXA 4OTDA 1IAHA 2C3KA 4QYEA 1L3RE 3W0MA 2ZYBA 4WG3A 5CLPA 2V62A 4EOOA 2AC3A 1YWVA 3KMMA 2HWOA 3ACJA 3CQWA 3B2TA 4QMZA 2B9JA 4ZTQA 2P55A 5LXMA 3DNDA 4IDTA 3ZO2A 2RKUA 3OWPA 4J96A 4RC3A 5DHJA 3ZCLA 2VO3A 3GCUA 4QNYA 3WF9A 4EORA 3NUUA 4JBOA 5HG7A 5A4QA 1G3NA 4I93A 4O6LA 3R30A 4M68A 2PVNA 4U6RA 5CX9A 5BVNA 4DBNA 3FZ1A 4QT1A 4W4WA 4GIHA 3QQGA 1GY3A 2YEXA 2A27A 5C03A 3QTZA 4Q2AA 4DG0E 4ANMA 3IONA 1PXOA 5FWKK 2A1AB 2ITPA 4EH4A 4DEEA 3MWUA 1H26A 2PL0A 4ZY6A 2VTIA 5M06A 5A4LA 4GK2A 3ZM4A 4C4IA 3CEKA 3ZBFA 3TI1A 4IB3A 5HCZA 5DRDA 3PTGA 4I6LA 5DR6A 3ZUVA 3QAME 2X7GA 3Q4UA 4RJ7A 5FXRA 4EK6A 3BHHA 3FXWA 1ST0A 2JAVA 3EQPA 1R3CA 4FOCA 4BTFA 1QCFA 4FNYA 3E88A 4YHJA 2WNTA 3KU2A 4IFCA 3LQ5A 4F64A 4NL0A 5K5NA 4IM3A 4BZOA 2ITZA 5CSVA 4W8DA 5EDPA 1OIUA 4EOPA 4G9RA 4GKIA 2ZV8A 3MFSA 3LAUA 4DGNA 3P79A 4G1WA 3TNHA 3EYGA 4KKGA 3QZGA 4QPSA 3ERKA 2C3IB 1J3HA 2PSQA 5CY3A 3MH3A 3VHKA 1Q24A 3HRCA 3A2CA 3A8XA 4IFGA 3QTSA 3BELA 3FLQA 5E90A 4H3BA 4EOLA 3ORIA 4RRVA 3ZC5A 1ZYDA 3HL7A 1OKVA 2WTKB 3AG9A 1PXJA 5FTOA 2WU7A 2IO6A 2QNJA 1P14A 3NUPA 2XK9A 3Q60A 4IBMA 3FMDA 1WBNA 3KXZA 5AMNA 5F1ZA 3T8OA 4YURA 2AUHA 3A99A 3FQHA 4JOAA 3W16A 4IEBA 5HTIA 5KMMA 4UMRA 4FNWA 2XRWA 2W9ZB 3R04A 3DXPA 2PVRA 4ANQA 4NM5A 4RZWA 2PZRA 1J91A 1VR2A 4IWQA 3EYHA 4R6VA 4ACMA 4ANNA 4BCNA 4BFMA 3W8LA 1ZYJA 3SW4A 4X6RA 4BBEA 1I44A 4DHIB 4PDPA 3S4QA 3TKUA 3K2LA 3I4BA 1A9UA 4O22A 5F4NA 4AWIA 3VQHA 5EKOA 3PPZA 2EUFB