4TRLA

Structure of ephrin type-a receptor 2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
277
structure length
268
Chain Sequence
QAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTEVPVAIKTLKGYTKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDPEATTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 2
publication title Structure of Ephrin type-A receptor 2
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 268
sequence length 277
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4trlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4trlA01
4EOPA 2VX1A 3GC0A 3MDYA 4KAOA 4AN3A 1XWSA 3TZMA 3UNZA 5IEXA 3JR1A 2W5HA 4OTQA 1JNKA 4JI9A 4S33A 3QCSA 4U42A 3F5XA 4BDEA 2PVMA 3BWJA 3OXIA 2UZLA 2WTDA 4FV7A 4F1TA 3LKMA 3EQIA 3FBVA 4EK6A 3NVMB 2WTVA 4LGGA 4MKCA 3MVJA 5FUTA 4IB3A 4DTBA 3OTUA 2YEXA 3PVBA 3FMEA 4AW2A 5IZFA 1Q3WA 1GY3A 4U81A 3LMGA 1REJA 4O2ZA 1B38A 3ZO2A 4CKRA 3GI3A 4IAZA 3ET7A 4FNYA 1R1WA 5DE2A 4C57A 2R3GA 3CR0A 4O91A 2WEVA 2CN8A 5FEQA 3GOPA 3A61A 3DJ5A 4BDJA 5E4HA 2QVSE 3CJGA 2W5BA 5FXQA 4FEWA 1UNHA 4XG6A 3A4OX 1XH6A 1YXXA 1FMOE 3F5GA 2AUHA 3POOA 4PMSA 2QOLA 5HO8A 4BI1A 3IK3A 3CEKA 4DCEA 4JLCA 2XA4A 4I6HA 4OUCA 2P3GX 1J1BA 5J95A 4RC4A 5KZIA 1M14A 4ZTHA 4IJ9A 3GFWA 3PPZA 4BKJA 3E93A 5AAEA 4G3GA 4IAFA 3EL7A 3IOKA 3ZMMA 4ASDA 3OY3A 5M06A 3V6SA 2O3PA 3LLTA 3PYYA 3VW6A 4L6QA 4QNAA 2YAKA 4UV0A 2X7GA 2V55A 3WZDA 1DS5A 4ITJA 3FKLA 2RIOA 3JVSA 2XNMA 2OXDA 3NNVA 1FQ1B 3UGCA 3WF8A 3NX8A 3FXXA 3MH1A 4CZUA 5JRSA 3REPA 1JSTA 1RQQA 4W8EA 5ANGA 3HRFA 3OS3A 4C59A 5M09A 4EYJA 3JXWA 5HGIA 4BFMA 4DH5A 2XNOA 3EKNA 2ZM3A 3CQEA 4I92A 5HIBA 4LGDA 3ZU7A 4AAAA 4EH7A 4IAKA 5DT3A 5FEEA 3ZONA 2YABA 2IJMA 4V0GB 3G90X 1G5SA 4MYGA 4NM0A 3QX4A 4QMMA 5FBOA 3DBDA 3GVUA 4ZIMA 4FGBA 3QCXA 4FICA 1V0BA 4GS6A 2WMQA 4EOMA 2W0JA 3R8MA 5EM8A 4IMYA 4DH8A 2VWVA 1OPLA 3FC1X 5HKMA 5K0XA 3O23A 4EJ7A 4FTCA 4RWKA 4BCKA 2JIUA 3MGYA 1ERKA 4FK3A 4YHTA 4CNHA 3MY5A 4EZ7A 2PULA 4CZYB 1YHVA 1PYEA 4RWLA 3DBQA 4D9UA 3TV4A 2WAJA 3BGPA 3ZLYA 3G6GA 2IW6A 2BDFA 4OBQA 2QI8A 3KY2A 3C0GA 5CALA 1ZLTA 2VV9A 3E5AA 3PVUA 4G9CA 2XNEA 5A4CA 2HY81 4GW8A 4I5HA 2FH9A 2W17A 3KMMA 4UXQA 4ZLZA 5D11A 5ACKA 2WEIA 3BHYA 3ERKA 5FQDC 5EM6A 1F3MC 3VBYA 5HORA 4RC3A 1G3NA 2B1PA 3ZOSA 2W05A 4YZBA 5G1XA 1BX6A 2XJ0A 3G5DA 2R4BA 4S30A 4D2TA 1AD5A 5L6PA 2H9VA 4AT3A 5A3XA 4CTCA 3GXLA 2OJ9A 4FKQA 4J95A 3VUIA 5IEYA 2VWIA 2ZMDA 3LFAA 3TZ9A 4ANMA 4F9YA 4NL0A 4RX5A 4LFIA 4CTBA 4PNKA 5ETFA 4IVCA 4O7NA 2RL5A 5JQ5A 4CFFA 1PMVA 4ZJVA 3EQGA 2C6OA 4AGUA 5KHWA 4A4XA 2I0YA 5B2KA 5FTGA 3NS9A 4DEBA 5K9IA 2QR7A 2W7XA 3V5TA 4EOSA 4YJNA 4IX4A 3AGLA 2PL0A 3V8TA 4FVQA 4I94A 4ZLYA 4NU1A 4R8QA 2YM5A 4XS2A 2IZUA 3EQBA 4QMUA 2IO6A 3G6HA 3MH3A 4NFMA 1RJBA 3L9PA 1BI8A 3Q4TA 3RAIA 4ZS0A 4GUEA 3QHWA 4IZ5A 4QPMA 3PRFA 2JBOA 3HDMA 4DA5A 5K4IA 1JAMA 1VYWA 2XRWA 1OUKA 2JDTA 3F7ZA 4MXCA 4FKTA 1ZMVA 3ALOA 3WARA 4DITA 2F57A 3KXXA 4LRMA 4TKSA 3W2RA 1M17A 3HECA 4WIHA 5JZNA 4KIQA 4C33A 2X8EA 4CLIA 3EH9A 4K77A 5HNIX 3MV5A 2PYWA 4RRVA 3VULA 4XEYA 1ND4A 2YIYA 4FVRA 5D12A 2UZTA 2SRCA 5M56A 4F0GA 4CG8A 3JUHA 1BKXA 2HCKA 1HCKA 3HRCA 3QTXA 4DGMA 4FKVA 4AG8A 1H27A 2Z60A 2JAVA 4EOOA 3V8WA 3RAHA 3ZO4A 3R1SA 1Q41A 2PWLA 1S9IA 3EQHA 3DK7A 2YERA 4UB7A 1NA7A 3F2NA 4XG3A 5DI1A 5T6KA 3ZTXA 4FIHA 4C3RA 5IMXA 3RAWA 4N57A 5CVGA 4OBOA 4AZFA 2WTJA 3DT1A 2W4KA 4G17A 4NIFB 1M7NA 4GVAA 3GU4A 3DK6A 4AZTA 2BZHB 1UWHA 4FTIA 4QP3A 5IKWA 3TNWA 3LCOA 2IZSA 3QLGA 2VTIA 3IPHA 4FBXA 4YZMA 3RAKA 3HUBA 5CASA 2VTJA 2WTCA 2WQBA 5E8TA 4ZJIA 2B54A 3LM5A 2GTNA 3H9FA 1OBDA 2DWBA 5CSHA 3T3VA 5F20A 4AE9A 3ENMA 1YKRA 1IRKA 4FG7A 3KGAA 3BCEA 3GBZA 4HYIA 1G8AA 2O5KA 1JSUA 3OWPA 4JAJA 4ZMEA 4I41A 1IR3A 2VZ6A 4RX8A 4AN9A 3VUHA 4S2ZA 2VTNA 2YIQA 3LXNA 3BHUA 2XBAA 2YWPA 4FZAB 4JXFA 4K8AA 4M14A 4M66A 3A99A 2A0CX 1O6YA 2H8HA 2C3LA 4EQUA 3LHJA 4WHZA 5LVNA 4FTQA 1KE9A 1WMKA 4G5PA 3TJCA 3DB8A 4ZSJA 4E1ZA 1Y6BA 2WQOA 5HTCA 2B0QA 5A4EA 1H1SA 4IAIA 5IQIA 4L45A 5HG9A 1ZARA 3C1XA 4ASXA 4NM7A 3MI9A 3ZSGA 5AV3A 4X3FA 4EBWA 1OVEA 4AOTA 4M15A 3C4ZA 3PXRA 5AUYA 3BU3A 3KXMA 2PE2A 3ACJA 1SVHA 5C1QB 2OXXA 3JPVA 5DEYA 4EK8A 3OHTA 2JITA 2GNLA 2JAMA 1GOLA 2ZAZA 3AMBA 1A9UA 4OBPA 5AX3A 3PSCA 4BCIA 3G9NA 5BUJA 4O7SA 2J2IB 4YBKA 5DT4A 4IAYA 3CC6A 4C4IA 4FV4A 3W2OA 4M3QA 4Y8DA 3POZA 3QBNA 3H3CA 3RMFA 4EOJA 3CBLA 5AIKA 4D4YA 3GNIB 3QKKA 1VR2A 4D2VA 3AG9A 3QWJA 3TCPA 4BIDA 5BVKA 4RFMA 4O0VA 5EI8A 2I0VA 4YHFA 3SG8A 3QC4A 3R73A 3NW7A 2VTQA 5A4TA 3PXKA 3OEFX 3OP5A 4OLIA 3WZJA 4IDTA 1FVTA 3R6XA 4O6LA 4AFJA 4HCVA 4QP2A 2OJGA 3DBFA 1H07A 3OOMA 2XKDA 1TQPA 4YZDA 5E8SA 5JGBA 4O96A 2XK6A 4E6QA 4GFMA 4RBLA 2PVNA 5AM7A 3B2TA 4K11A 2IWIA 2YDIA 3DBCA 4BDAA 1PYXA 3P1AA 3GB2A 4MH7A 4YTIA 4BZDA 4KWPA 2YACA 2X9FA 3PJCA 4D5HA 2OXYA 4QMWA 3RHXA 4OAVB 4GRBA 4FG8A 4P2KA 4ZTQA 2WNTA 1Q24A 1J91A 4XX9A 4U5JA 5AR2A 3W16A 4ZTLA 4YLJA 2UVZA 2C6DA 3SXFA 2XB7A 2OIDA 4CD0A 4QYGA 3MJ2A 3SG9A 5KMNA 3PSBA 4IX6A 4XV9A 3R00A 1MQ4A 4L67A 3UJGA 3G0EA 5A54A 3K5VA 1XKKA 4ITIA 1JOWB 4O0UA 3LFFA 1JKLA 4NJ3A 4O7WA 4QYFA 1PXMA 3GCQA 5IQCA 5DFPA 2JGZA 5IQHA 3TT0A 4DGOA 3ORTA 2UZOA 3T9TA 3BYMA 1XBCA 2OKRA 3PA4A 4BWPA 1T46A 3R7UA 4Y85A 4EH2A 2C0OA 4FMQA 2BRMA 4IFCA 3U8WA 5J9YA 4R1YA 3TG1A 5M07A 4GK3A 4I0SA 1R0EA 4ACGA 4WSQA 3VBXA 4F7JA 1F0QA 2ITVA 2HZ0A 1YXUA 2OZAA 2NNWB 4Y46A 3RHKA 4CZTA 4RLLA 2VGPA 4GJ2A 4HZSA 2Z02A 4EWHA 4LRKA 3DDPA 1WCCA 5DH3A 3ALNA 4HCUA 4DG3E 3AC1A 1OITA 3R01A 3UPXA 2F9GA 4FOCA 2ZV7A 2EUFB 3L9MA 4NZWB 3ZZEA 2PUUA 3QF9A 5IQAA 2IPXA 4D1SA 4I5PA 3C4EA 2QG5A 1GIIA 2QR8A 4DGNA 1PXIA 2WTKC 1K3AA 4LUDA 3KCKA 3PXZA 3RJCA 3THBA 3WYYA 2BVAA 1J7IA 3E7VA 3FI8A 5EI6A 1UWJA 3EB0A 2W1DA 4L3PA 2GCDA 2Y8OA 4QTBA 3AC4A 3U87A 5M53A 2WIPA 2QO7A 3CY3A 3DK3A 4HGLA 4K2RA 4XRJA 4GU6A 4ANLA 3NIZA 4LMUA 5AX9A 1GZOA 4BCNA 3BLRA 1GZKA 3FSKA 3NNXA 5BVEA 1WBNA 2XJ2A 4ACCA 4QMLA 5HG7A 4M13A 4MD7E 2R64A 3EQCA 4WBBB 1YI6A 2R7IA 4BYJA 1CDKA 4AQCA 1NXKA 1JLUE 3LFSA 5HOAA 2RFEA 3SHEA 3EIDA 4OTHA 4PP7A 3ZUVA 2VRXA 3FQEA 5CEIA 5AJQA 5BUIA 2BRGA 5CAOA 3NVKI 3ATSA 5KE0A 1BI7A 4ZAUA 5KBRA 3TKUA 5LOHA 4PDYA 3DZQA 1ZYLA 4IC7A 3ZDUA 5D1JA 4RC2A 4GYIA 3FY0A 2FSTX 1UKHA 3FZRA 2HZIA 2XYUA 4QPAA 3VS6A 4CV8A 4Y72A 4BCJA 2ITQA 4EONA 5C27A 4QTCA 4YZ9A 2BILB 4FV5A 4ZMFA 4XLIA 3KB7A 5B7VA 4XP0A 3TWJA 2ITWA 4ACDA 3C4CA 4B0GA 5JGDA 4PQNA 4E6CA 5IA1A 3AT3A 2UZUE 3R7YA 4F7NA 3VUGA 3MPAA 4EZ3A 1KE5A 2WIHA 2VTOA 3PXQA 4IZYA 5CSWA 4F6SA 3R02A 2UW9A 3DKFA 2X8DA 3F88A 3LJ1A 4NM3A 3PE1A 4TZRA 2UW0A 5FWKK 4EKKA 1LEWA 1MRYA 2PUNA 4IZAA 4PPCA 3FLZA 2C30A 3H9OA 2UZWE 3EFKA 3P9JA 2H96A 3ZC5A 3HMPA 5H3QA 1OPKA 3NUXA 3ZEWA 4CMUA 2AC5A 4J71A 3UVPA 4AP7A 2YLEA 3LXLA 3U6IA 4KRCA 4FTNA 4MVFA 3IECA 4MWIA 4O7TA 2PHKA 2OFUA 3QQUA 3MFRA 5ACBC 4DFUA 5EW9A 3LJ2A 4ZSGA 2XK7A 4FKRA 1PMNA 3DXPA 3U55A 5EDRA 1Q3DA 3TM0A 2VWZA 2GS6A 1OL7A 3QGWA 3WE8A 2I40A 3TKIA 3PY0A 3C9WA 3SRVA 5CAQA 3L8PA 4Z55A 4XRLA 3C7QA 4GKHA 4RPVA 4KS7A 4PX6A 2ACXA 3VS4A 1QPJA 4KUJA 3F3ZA 3DQXA 3VVHA 3OROA 5E8XA 4BDIA 2XKFA 3B2WA 2BFYA 4C37A 3AD6A 2GNFA 5EFQA 5L6WL 2B9FA 2RG5A 4D2PA 4J97A 1AQ1A 3OC1A 4IE9A 4NEUA 5H8GA 4CT1A 5DMZA 3EZVA 1APME 2HZNA 4UWBA 5J5SA 4C35A 3VS2A 5EKNA 3BRBA 2QNJA 3NSZA 4KABA 2AC3A 3SLSA 4B8LA 4P4CA 4UWCA 5BUEA 2ZMCA 5KMMA 5T3QA 3T3UA 1W8CA 4DHFA 3Q52A 4KKEA 4NM5A 1UU3A 4WG4A 1XHAA 4H36A 4D0WA 3NUSA 2UZBA 2P0CA 5TT7A 3W32A 4FIFA 4F7SA 3LM0A 3BIZA 3BGQA 4WT6A 5E92A 1QPDA 3FMMA 3K5UA 4DLIA 4MD8E 4TYEA 3QRJA 4BDCA 3R7OA 2BRHA 3DTCA 1H1PA 2C3JA 2XNBA 3DLSA 4MNFA 4E4NA 2GNGA 4FUXA 1FMKA 4JBVA 1J7LA 1PY5A 1RE8A 2BRBA 4MXAA 4C0TA 2BAKA 4C8BA 4EK4A 3EL8A 5HO7A 3RVGA 2E9UA 3ZYAA 2W1ZA 3DQWA 2UZNA 5DNRA 3W2QA 4BHZA 3HGKA 2WMSA 3VS7A 4DEGA 4YURA 4AX8A 2PTKA 3PE2A 5LVLA 3V6RA 5JEBA 3QWKA 4LOPA 4O22A 4BKYA 5IPJA 5JT2A 3EQPA 2LGCA 4JVGA 3HA6A 3K3IA 2CPKE 4BTFA 1E1XA 2ITPA 2XNNA 1Q4LA 3D5XA 2WPAA 3OF0A 5EYMA 1RW8A 4BC6A 5L8LA 2YWVA 4O83A 2YJRA 1TQMA 4RT7A 4BDFA 4X3FB 4D4SA 3DFCB 2B9IA 3PVGA 5M55A 2XIRA 3IW8A 4D0XA 2PMLX 2Q0NA 4XP2A 4CMTA 1WBWA 4C2WA 4QMNA 1YWVA 3HV6A 4U43A 5CU2A 2G2HA 2XBJA 2PZPA 1JPAA 3MTFA 3VHKA 3QU0A 1ZYDA 4O7RA 4PUZA 1M52A 3ZXZA 4MXOA 4HVSA 4QRCA 3TEIA 3ZM4A 1Y91A 5JH6A 5FRIA 2FVDA 3VW8A 4RQVA 5DRDA 5J9ZA 3P5KA 2QOBA 4GFGA 2VD5A 3LZBA 3EYGA 3A2CA 4OT6A 2OK1A 2XJ1A 3LFDA 3EWHA 4YNOA 5IUHA 4QMXA 2YDKA 5L8JA 3RNIA 2GU8A 3IS5A 3BX5A 2VX0A 4IANA 1WZYA 3U6JA 4TTHB 2OSCA 4OW8A 2X81A 2W1EA 4RVTA 2HK5A 3V04A 2F7ZE 4MX9A 3SX9A 4BYIA 4TNDA 4QP4A 4H1MA 3HLLA 4JT3A 4P5ZA 1FOTA 4IQ6A 3N51A 4ZTSA 4F1MA 5KKRB 4JR3A 3P08A 3F69A 1U46A 3ORXA 3Q5IA 4EWQA 1A06A 4HW7A 3S2PA 4JG7A 3I7BA 4IB0A 3A7FA 5M57A 2W4OA 4RX7A 2P33A 2PZIA 2OH0E 4IWOA 2BALA 4WNPA 2GQGA 1JKSA 4EH6A 4G3EA 1U4DA 2X4ZA 4EI4A 3LFBA 2ZB1A 3BHTA 4OTIA 4KIKA 4QMYA 3E64A 3A8WA 1B6CB 3IDBA 2G2FA 4DH3A 3HP2A 4Y95A 2XUUA 5J7HA 3R7IA 2I1MA 4IXPA 4RJ4A 5D7AA 3DKGA 2BHEA 3ZBXA 4ZEGA 2C3KA 4KINA 1P4FA 4FK6A 1LP4A 2ZV8A 4TYHA 4MTAA 4BTMA 4GK4A 5DBXA 2A2AA 1IA9A 2OICA 4L44A 4FV6A 5EHYA 2B9JA 2VX3A 3H9RA 3DAKA 4A06A 1KE7A 2WKMA 2GNHA 4K33A 3MFTA 2RG6A 3R9OA 3D83A 5HLWA 3Q4ZA 3K2LA 4M68A 2OJJA 5CLPA 4CQEA 3BV2A 4N6YA 2ETKA 2XMYA 4PPBA 1ATPE 4L8MA 4AA5A 3JS2A 1YW2A 1V1KA 4I23A 4EK5A 2HIWA 4TT7A 5JKGA 1ZAOA 3RKBA 5J9LA 2WB8A 3TIYA 4YJQA 3LFEA 2PVRA 4RIYA 4EH8A 4H05A 3BGZA 2W5AA 3C4FA 3UP7A 1OKVA 3PXYA 3QAME 4X7QA 3VUTA 4B8MA 4I3ZA 1OBGA 4H1JA 4N70A 4JIAA 1ZOEA 3MS9A 3Q9ZA 4U9AA 4FKSA 3KREA 3C50A 5AP0A 4FF8A 5BVWA 3HEGA 2W4JA 5FLFA 1NT2A 4I1ZA 2PK9A 2C5YA 2BZIB 4E5AX 5IMEA 3W18A 4EOQA 4YJUA 3COMA 4I24A 4GH2A 4IM2A 3VAPA 3BI6A 4O0YA 1AGWA 4QMQA 4ZTMA 5HTIA 2PMOX 3KXNA 2YIWA 4BDDA 3BEAA 3LQ8A 2QQ7A 1STCE 3HA8A 3KRWA 4CEGA 3P4KA 4HOKA 5J5TA 4FE2A 4FSYA 4FIEA 3OWKA 2EB3A 4C61A 5HE2A 1XH4A 2Z2WA 2NPQA 5FP5A 3R63A 1GAGA 3E88A 3OXTA 4TYGA 4AF3A 4FV2A 2YCQA 5EDPA 3FL5A 3QRTA 3FY2A 5A9UA 3BYUA 3MIYA 4GG7A 4R6VA 2JLDA 2VWBA 3FHIA 5HBEA 3RK9A 4EOIA 3MH0A 4BGHA 4YPSA 2YCSA 3UMXA 3HUCA 3UG2A 3ZHPC 3A8XA 4XG7A 1K2PA 3OTVA 5CF4A 3LAUA 2EB2A 4JX7A 5HI2A 4ZK5A 4RJ6A 4XH6A 4Z7HA 4LUEA 3D94A 2UW3A 4E3CA 4IM3A 4JBPA 2PZ5A 4LL5A 2QOIA 4WRGA 4F99A 2C5XA 3LIJA 4B6LA 5AV2A 4D58A 3E8DA 1SVEA 1W7HA 4LRJA 5IISA 3PJ3A 4GIIA 5JK3A 4U3YA 3AMAA 3G9LX 4MNEA 3ZC6A 2X9EA 2BFXA 3NUYA 2R3QA 3EQFA 1NVRA 4TXCA 2Z8CA 3DLZA 4EHVA 3MFSA 3COHA 3V5PA 2QODA 2R3KA 2NP8A 2WD1A 1XO2B 1SVGA 1JKTA 4S31A 4E5BA 4WKQA 4KKHA 2ZM4A 4JG6A 2QONA 3V01A 2XF0A 3FMDA 3UODA 4EK3A 4O38A 3KN5A 3LW0A 5KKRC 3P86A 3R30A 4UBAA 5HTBA 4I5MA 4QYHA 4YMJA 4USDA 3RWPA 4C34A 5DOSA 2VNWA 2YCRA 3LXKA 1OKZA 4FL1A 5HIEA 1R0PA 1Q8UA 5LVMA 3RTPA 2QLUA 4QP1A 3GC9A 5C8KA 5A4QA 2PVJA 4QQTA 3LMIA 1DI8A 2JKQA 3OFMA 4W9WA 2JKKA 2XYNA 2PZYA 3GCSA 4HCTA 1PXLA 3FMLA 1XH5A 2BZJA 3KC3A 5E1EA 3VIDA 4HGEA 1KV1A 4YBJA 2G2IA 3BV3A 3R8PA 3CJFA 3RK7A 4RX9A 3D14A 4DN5A 3HX4A 4RMZA 3V3VA 2O8YA 3CIKA 4O2PA 4FUYA 4O0TA 4BCMA 2BDWA 4MQ1A 4O21A 4QMVA 3U4WA 3MA6A 4CFMA 4DFNA 4E4XA 5LMBA 4F6UA 4KIPA 5D10A 4DC2A 1UU7A 5BVDA 2JDSA 1H25A 1YHSA 4U97A 3TI1A 1YRPA 2O0UA 5JN2A 3CPBA 4QP7A 1YXSA 1OPJA 5L8KA 4XCUA 3F7WA 3R1QA 2QOFA 4NCTA 4ZZMA 1O6KA 2BZKB 5LQFA 1Q5KA 4FZ7A 2C5OA 3RZFA 3W33A 4DFXE 4L7SA 4E7WA 5JSMA 4WRSA 5HE0A 3W8LA 4I0RA 3FKOA 1MP8A 3PPJA 1M2RA 4RIWA 2C0IA 4BCGA 4RJ5A 2C0TA 5LARA 4AW1A 4C4JA 2QCSA 5LMKA 2WMTA 5HCXA 4MBJA 4HGSA 4I93A 5IH5A 3SGCA 4BY9E 4MXXA 3HAMA 1WBTA 2VWYA 5HD4A 3OUKA 4YLKA 5CXHA 4G3CA 4OTFA 5EQEA 3RCJA 4DCAA 4EC9A 3ZS5A 1H00A 5TKDA 5EQYA 2CCIA 3UVQA 3F3WA 3OVVA 3MB7A 3RZBA 2W9FB 2VTLA 1DI9A 4OAUC 4XBUA 3I6WA 5CVFA 2ITUA 3O71A 5CZIA 1OZ1A 3MY0A 1H8FA 2C47A 3UZPA 5B0XA 3ZZWA 3Q2JA 3U9NA 1HOWA 3C4XA 2WQEA 3WE4A 3F66A 3ATTA 4MD9E 4JS8A 2XIZA 3UDBA 3WZKA 4PDSA 4A07A 4DEHA 2Y4PA 2X2MA 4F9AA 4UX9A 3AC5A 3GU5A 4X0MA 3PG3A 3QUDA 2VTSA 3SA0A 5HQ0A 4G6OA 5C8MA 3FPMA 1ZZLA 4BL1A 3Q60A 3JY9A 4FC0A 3QUEA 5DR2A 3UO5A 4G5JA 3OCGA 4HVGA 4YO4A 3ZUUA 4LOQA 2XS0A 3CTQA 2Q0BA 3UIBA 4R7BA 4D2RA 3AOXA 5IQDA 3PSDA 3AMYA 4L00A 2IVVA 3ODZX 3DJ7A 4CXAA 4D1ZA 3VUKA 3AGMA 1KUTA 1OIYA 4RG0A 4U6RA 3HMNA 4BI2A 3IGGA 3DU8A 3R9NA 1UA2A 3TACA 3FZPA 4NK9A 4GKIA 2B55A 4AA4A 4BF2A 4K18A 5DVRA 2WMRA 5GJDA 4ANNA 3GUBA 2FSOX 1H4LA 4X3JA 3N4VA 3PG1A 2J5FA 3II5A 3KK8A 4Y73A 2OBJA 2XNGA 4RJ7A 3KN6A 4ZTRA 5AUZA 1PXOA 4HYSA 4EHZA 3ZO1A 5CF8A 2G15A 4UMQA 4O7VA 1Z5MA 3MIAA 3TNQB 4ANSA 4MXYA 2FSMX 3NLBA 1YOMA 3D5UA 4RFZA 3CE3A 3CGFA 4CSVA 1MRUA 3O2MA 1VJYA 5JFWA 4FT9A 2Y4IB 4OTPA 3I7CA 3SKCA 2HW7A 3OCTA 4ZY6A 2B9HA 2YZAA 2QU6A 4PP9A 3MTLA 3S95A 3VS5A 4I6QA 2Z7LA 3SOCA 3GP0A 4KIKB 3T8OA 3S0OA 3UVRA 4OTGA 4IWPA 5K0KA 2BAQA 5HCZA 3FMNA 3UIMA 3KRJA 4WG3A 2ZJWA 4BIBA 4BBMA 2GNIA 5L2IA 4XOZA 5J87A 4C02A 1JWHA 2HAKA 2RGPA 4FT7A 4DH7A 4PPAA 3RM6A 3U51A 4TYHB 4J8MA 5M08A 5CANA 3SXRA 2HW6A 3DKCA 4XG4A 4CLJA 2WO6A 3WF7A 2CMWA 2GS7A 1LR4A 4F9BA 2YZLA 4V01A 1ZYSA 4CRLA 4FEVA 3E7OA 3AT2A 3BU5A 2BPMA 3R21A 1IAHA 3AC2A 4HVHA 3UO6A 2GPHA 1YWNA 4M12A 3FLSA 3GU7A 2ZM1A 3F5PA 4C4FA 4YR8A 4RIYB 1XBAA 3TNPC 4XOYA 5KX8A 3V8SA 2CJMA 3ZFYA 4Q5EA 3D15A 5EW8A 3VQHA 5IA0A 2PU8A 5HU9A 3G0FA 5I3OA 1PJKA 3ENHA 3LJ0A 2Z7QA 2RKUA 1GZNA 1Q8YA 3TUCA 3UIXA 3LCSA 2C6TA 1Q8WA 2X6EA 4ID7A 3RPVA 1Q8TA 4IM0A 5K3YA 2XK4A 3CTHA 4EOKA 3TTIA 3D5WA 2PMIA 3KVXA 3LCKA 3BPRA 5FBNC 5IA2A 5KMIA 5JMSA 5E8VA 4D1XA 3FZ1A 5F4NA 2R3NA 5AMNA 4L53A 2Q83A 1BMKA 4O0XA 5T68A 3IDPA 1ZY4A 2HENA 5B2LA 4DT8A 3QD3A 4FI1A 2A19B 2C4GA 2WMUA 5AP7A 3QTQA 2QURA 4FR4A 3I0OA 2HWOA 3DCVA 4M67A 1GJOA 1YDSE 4E93A 4DT9A 3G33A 2HXQA 1RDQE 2GSFA 4YJVA 5HE1A 5BYZA 3ZFMA 3P0MA 4IHPA 4FKOA 1IAJA 3O7LD 3UYSA 3PUPA 2JKOA 5HNGA 4AGCA 1XH8A 4J52A 3ZCLA 3O8PA 5BVOA 4GK2A 3QRKA 1PXJA 3GFEA 2UZVA 5HVJA 3SXSA 2VTTA 4W4XA 4RZVA 4ZP5A 4C62A 4QP8A 4GU9A 2GQRA 3FLNC 2OWBA 4WG5A 4WA9A 2UV2A 3COKA 3Q53A 4YLLA 5JGAA 4ZY4A 2E9NA 3MY1A 4OTWA 4D9TA 3RALA 5CQWA 1CKJA 2VUWA 2JBPA 4HYUA 4PL3A 5A6OA 3GENA 4FVPA 3FEGA 2E9OA 5CQUA 3SDJA 3UOLA 4Y5QA 4CYJA 1Y8GA 4G1WA 2PUIA 4FYOA 3NYOA 4GMYA 1GIJA 4RFYA 5E91A 2OG8A 3QC9A 3ZRKA 4A9SA 2E9VA 3QL8A 4WNMA 5FXSA 2OIBA 3K54A 5AUUA 3C13A 5AUWA 3HMIA 2KTYA 4L9IA 4FKUA 2IVUA 2B53A 5I4NA 4MNEB 4U41A 3NNWA 3PJ2A 4BDBA 4F08A 3FI2A 3FJQE 5HLNA 3KMWA 3EQDA 5BPYA 3FZSA 1R39A 3A60A 4QD6A 4TWCA 4CFVA 1CTPE 3BYVA 3F5UA 3I5ZA 5AFVA 2C1AA 4WO5A 1ZMUA 5AV1A 3NYNA 2IW9A 2YA9A 3UNKA 3GCVA 1W84A 2J50A 3I79A 4Y83A 4ALWA 3QYZA 5HX6A 5K4JA 2EXEA 4LG4A 1QL6A 5IF1A 3KCFA 4BI0A 2OZOA 4YPDA 5IA5A 4F70A 2IG7A 4AGDA 2ZYBA 2R0UA 3NW6A 3FPQA 2BROA 4PY1A 5I3RA 3KMUA 2VTHA 3LXPA 2WGJA 2Y4IC 1JSVA 1H26A 3EOCA 4FTJA 4I22A 4OGRA 5I9UA 2C69A 2X6DA 3W10A 2QKWB 5EW3A 3KXZA 4ZZOA 4PDPA 5J1VA 3TZ8A 4YHJA 5E9EA 3VUMA 5BVFA 4DF3A 4FTOA 4QQ5A 5I9VA 4BCHA 3IDCA 4J98A 3RPYA 2CKOA 4C58A 5DIAA 5CX9A 3PJ1A 2BAJA 3Q5ZA 4S32A 2B7AA 3D4QA 3H30A 3PWYA 5CNOA 5AUXA 5AIRA 2WMWA 2W1GA 2VAGA 5HD7A 4LI5A 4QNYA 1OIRA 1H01A 2XIKA 3QLFA 4M8TA 3ANQA 4HPUE 2C6MA 1IASA 4GV1A 3QTSA 3ZLSA 4Z9LA 3WIKA 1PMUA 4EH9A 5GIPE 1XBBA 1Z57A 5K5XA 3WF9A 4U79A 5LXMA 3HKOA 2C68A 2PVYA 3KQ7A 3RNYA 1TVOA 1F5QA 2JFMA 4FTLA 4V05A 5IQBA 4O1OA 1PHKA 4BWKA 2ITYA 4K1BA 3U4UA 1JBPE 2J0JA 2YM4A 5HG5A 3FXZA 4ONAA 5ICPA 1OL5A 2XK3A 4C3PA 4O81A 4BICA 4IVBA 2WU7A 4OTRA 3UMWA 3LCTA 3OG7A 4DBXA 1T45A 2R3PA 4CKIA 3OT3A 2CNVA 1P4OA 4MQ2A 1Q8ZA 3NPCA 2OFVA 2R3HA 3FV8A 4EEVA 5A46A 3QYWA 4RIWB 3S4QA 1PKGA 4MWHA 4DGGA 4HZRA 2EU9A 5E7RA 4L46A 3W2PA 1R3CA 1CKPA 3O8UA 3F82A 2BKKA 4UWYA 3ZLXA 2EWAA 3KU2A 4FSMA 1U5QA 3A4PA 2QD9A 4EJNA 4EYMA 2ZDTA 5AEPA 3I5NA 4KKGA 3P23A 4QTAA 3HDNA 3TKHA 3VUDA 3R04A 1I09A 3VF9A 2C5VA 1SMHA 2WMAA 2I0EA 4I6FA 3MN3A 3WZEA 5E8ZA 4CVAA 4E20A 3PLAE 4YNEA 4DINA 4G6LA 4X2NA 4YZCA 1YI4A 1FVVA 2J6MA 2RSVA 3D7ZA 4W9XA 3ZLWA 4APCA 3E87A 3PP0A 4ITHA 4FZDB 4RJ3A 1MUOA 4UEUA 1ZYCA 2IVTA 3ZO3A 4IH8A 4QQJA 2YITA 2F49A 3IW7A 3ZDIA 1SNXA 2UZDA 2JFLA 2JIVA 3BBTB 3G51A 4IADA 5FD2A 5GZ8A 3LQ3A 4FTMA 4QP6A 2W96B 4G2FA 3UQGA 5IQGA 1IEPA 3DPKA 3OT8A 3PPKA 5LJJA 3O96A 5CEOA 4KA3A 5HU3A 4AA0A 3E62A 4H39A 4C7TA 3R83A 2R3RA 5I9YA 5TF9A 5KMLA 5FEDA 3W2CA 4UMTA 4FTAA 1JQHA 4XYFA 5HBHA 4D4RA 4DYMA 3FDNA 3I4BA 4FZFB 4UALA 3BWFA 2FSLX 4EL9A 3WILA 3R9DA 4JJRA 2ONLA 1W98A 3MVMA 3QALE 1WVXA 3RINA 5JZJA 2YM3A 3AD4A 5M4IA 3BLQA 2R3IA 3DXNA 2OF2A 3KF4A 5AWMA 4PF4A 2FB8A 4QMSA 3PZHA 2C6IA 2ITNA 2Z7SA 1PXNA 3Q6UA 3LLAA 3P7AA 4CT2A 3CQUA 4F0IA 1YWRA 4BCOA 2CKEA 2Y7JA 4TWPA 3QX2A 3QTUA 4KBCA 3PA5A 3KA0A 4K9YA 4X2GA 4BGGA 3QQJA 4FTRA 4PWNA 2UW7A 4ANQA 3L9NA 4AUAA 3UQCA 3QQFA 3FLQA 4CFUA 4M97A 1J7UA 3PFQA 2RFNA 3R71A 4NUSA 4BVUA 4FV0A 4GJ3A 4F9WA 3HV4A 5E8YA 2R3FA 4F9CA 4BRXA 2O2UA 2FA2A 2ZVAA 3NMUF 2GHMA 4PNIA 3U6HA 2OH4A 4IEBA 3LFCA 2PVLA 4GYGA 2FGIA 1PXPA 5AP4A 5EI2A 4ANBA 4CMOA 3N4UA 4NW6A 4JBOA 3VS0A 4DH1A 1ZMWA 1H1WA 3IQ7A 4WSYA 1OKWA 2V5QA 2R2PA 3TN8A 3RBWA 2CNUA 4FSZA 4R3CA 1DM2A 1TQIA 4ORKA 1NVSA 5AA9A 4A7CA 2XIXA 4EH4A 2J90A 4FKIA 4FV1A 4LL0A 5EH0A 3UC3A 3BYSA 5C4KA 5ANKA 3NYVA 4BWXA 1DAYA 3OBGA 4JDIA 3FQHA 3WF6A 4KNBA 4OT5A 4EC8A 2QKRA 3QQGA 4X6RA 2VO6A 3PY1A 3FYJX 4ZJJA 5HBJA 4E73A 4M7IA 2YDJA 2YM8A 4G9RA 3MYGA 4U40A 1KOBA 2BIYA 5M4FA 2BTRA 2V7OA 3LVPA 5KO1A 3D2IA 4N6ZA 3EN6A 3L9LA 3MJ1A 2XM9A 1R78A 3GOKA 4J8NA 5I0BA 4HJOA 1OL2A 4W8DA 4D2SA 3G15A 4H58A 4CG9A 2PVKA 4MAOA 3A62A 2XK9A 2E9PA 3PY3A 5TO8A 1NW1A 3VHEA 2ETRA 4TWNA 4BZNA 2CDZA 4O82A 2C6LA 4FSNA 5HO6A 4X6QC 1ZOGA 3DNEA 1CSNA 3SVVA 4J99A 3QQHA 3ORNA 3TV6A 2ZB0A 3NUPA 1XJDA 2YAAA 1Q62A 5AADA 2BCJA 3HNGA 5AP1A 5EOLA 5HCYA 4UMUA 3SD0A 5M51A 1SYKA 4BKZA 4N4SA 1S9JA 3DNDA 3RPSA 3Q6WA 3O0GA 5IDPA 2OW3A 3KFAA 5CEKA 2XVDA 3VC4A 3EFWA 4NTTA 4R7IA 4GIHA 3QCYA 4H3PA 5E8WA 3I1AA 1YHWA 3CS9A 2F7XE 3CPCA 3UNJA 5IA4A 4ZLOA 3FLYA 3D7TA 4NYEA 2R3OA 1REKA 5DRBA 4HGTA 3R1YA 4N0SA 3R8VA 3QRUA 4C36A 3BYOA 4DFBA 4IW0A 2QHMA 3QQLA 3AT4A 2UVYA 2HOGA 3NW5A 2UW6A 4FT5A 1H1RA 5BYYA 1KSWA 1OIQA 2WFYA 4AWIA 2F7EE 3MESA 5H8EA 2OZAB 5F95A 3VWAA 4UMPA 2R5TA 2DS1A 4C4HA 1VYZA 3ZM9A 4GUBA 4JX3A 1DAWA 4QTEA 2CLXA 1UU9A 2PZRA 4GG5A 4DEEA 1Q61A 2YM6A 4QMZA 5AR7A 4DEAA 4UMRA 3NCGA 1EH4A 4EZ5A 4F4PA 4KD1A 5HICA 3P7BA 4L01A 3V51A 4EBVA 3HMMA 5H9BA 3N4TA 5HNBA 2DYLA 4CGAA 2J0IA 2QOHA 3I81A 4FTKA 4AZWA 3QXOA 4WD5A 4I5CA 4IB5A 3E8NA 3P79A 4YC8A 5CF6A 1SM2A 2IN6A 4IDVA 3GU6A 1V0PA 2WOTA 3EHAA 2XK8A 5DA3A 5AAGA 2R3JA 3FI3A 5BNJA 2CGVA 2OJIA 4LGHA 5A4LA 4G16A 4A4OA 2VTMA 1H28A 3FKNA 4QO9A 3PJ8A 2VWXA 4FEQA 5CNNA 4ALUA 2UW8A 2VGOA 5ETAA 2GHGA 3UIUA 1WBVA 4IWDA 5EM7A 3AQVA 4BDHA 2R0IA 1QMZA 2WQNA 4WOVA 5EYDA 5GNKA 2DUVA 5IH6A 3DS6A 2GQSA 2ERZE 2BKZA 4R3PA 4AOJA 4AACA 2PMNX 2YJSA 2ESMA 2WMBA 3H4JA 3DAJA 2CGUA 4U44A 2KULA 2O63A 4TYIA 3WF5A 4BIEA 1UKIA 4XLVA 2H34A 5AP2A 3WZUA 4XG8A 2XEYA 4JDKA 5J8IA 5CEPA 3DFAA 4TYJA 2ITZA 1SZMA 3NCZA 4TN6A 3OMVA 3ORIA 5EHLA 2QLQA 3QZIA 4YSJA 1W0XC 4O0WA 4FT3A 3V5QA 4Y5HA 5HG8A 4X3FC 4FSUA 4XHKB 4DAWA 4AW5A 1YOJA 3QQKA 3UOJA 3NIEA 5LWMA 3M1SA 4O6EA 5F1ZA 3QD4A 2W06A 2HY0A 3MH2A 4W4YA 5C4LA 1MQBA 3CSVA 3KULA 3Q04A 5CI7A 2NO3A 3IOPA 3EN4A 3MSSA 4BN1A 2XM8A 3QA8A 3GQIA 4KRDA 4UY9A 3FMJA 2CKPA 3ORKA 4GL9A 5DEWA 5DHJA 4V04A 3S00A 4XMOA 5EHOA 2QOKA 2V7AA 2GFSA 2A27A 3EN7A 3GT8A 3P7CA 3FAAA 2HXLA 3ORPA 1H08A 2CGWA 3BKBA 3JYAA 2YHVA 4O86A 4YZNA 4LV5A 4L43A 3B8RA 1OL1A 2HYYA 2XNPA 3Q3BA 4NH1A 4B4LA 2VN9A 3PIZA 5KMKA 5LCJA 4AT4A 4OR5A 1W83A 3VS3A 4FTTA 4NJDA 2BRNA 3G2FA 4Q9ZA 2BIKB 3DJ6A 5CTPA 4UZDA 4XP3A 1UNGA 4UZHA 5AV0A 3N9XA 4PMTA 3Q2MA 2A1AB 3TUBA 3BQRA 3COIA 5IUIA 2RF9A 1O6LA 5HVKA 2W1FA 4AGWA 1L3RE 4F0FA 3FMKA 4IWQA 5ANJA 2C3IB 4U3ZA 4IB1A 5CAVA 3S1HA 2XH5A 3UPZA 3SRVB 4S34A 3HVCA 5J7BA 4ACMA 1KE6A 3CGOA 3R28A 1OECA 2FO0A 3TL8A 4FGRA 1KE8A 5DPVA 4YSMA 3NAXA 5E1SA 2B52A 4E4LA 3ID6C 1FPUA 1Q99A 4RJ8A 2G9XA 4U7ZA 3FC2A 4G34A 4P5QA 2XRUA 3DY7A 4BB4A 2RFDA 2JIIA 3A7JA 3NUUA 4FIJA 4X21A 5FG8A 4FNXA 4BBFA 3DB6A 4TWOA 3R7VA 3RI1A 5CY3A 4EHGA 3OW4A 5AP3A 4F65A 5I9XA 2BDJA 2OO8X 2YIRA 2CKQA 4DG2E 4WBOA 3B8QA 3SW4A 5IUGA 5GHVA 2CNQA 4D2WA 4YO6A 2CLQA 3DV3A 1YI3A 2VTRA 4PL5A 3UBDA 2V22A 3NAYA 5GJFA 4MCVA 1URWA 3WBLA 1Y6AA 5J1WA 1YDTE 2VNYA 3LMHA 3CQWA 5AR8A 3QTRA 4YUQA 3IKAA 1UVRA 4BCPA 4PTCA 5E90A 3UTOA 2PE1A 4A4LA 5HVYA 3UE4A 4X2JA 4FNZA 1OKYA 1UV5A 3BELA 3QZGA 4YTCA 5FDPA 5I5ZA 4O0RA 1ZYJA 3UC4A 2UZEA 3F3VA 2E2BA 4KSPA 3RPRA 3AXWA 5KNJA 5L4QA 3H0YA 5AUTA 1LPUA 2NRYA 4WNKA 2YISA 1MRVA 2VWUA 5FM2A 2JC6A 4R7HA 2XKEA 3MA3A 5L2SA 5EOBA 5TOZA 4O7LA 4FSTA 4ZS4A 2P2HA 2WU6A 3GCUA 5CEMA 2IVSA 5EG3A 5TR6A 3WI6A 4ZOGA 2J0KA 5AR5A 3HYHA 5HHWA 4O0SA 4A9UA 4RWIA 4ENXA 5F94A 3UZRA 3NRMA 4ASZA 4XG2A 2VO3A 3OBJA 4QT1A 4E6DA 4ZTNA 5ETCA 4NFNA 3QFVA 4D55A 4PRJA 3DTWA 4M0ZA 3VBWA 4FL2A 4RA5A 2OJFE 1CM8A 3A7GA 5C26A 4I4EA 5CSXA 4YJPA 3PIYA 4QYYA 2CCHA 3M11A 2F2CB 3ZH8A 4FG9A 4ZSEA 4E4MA 4AZEA 4UN0C 4LV8A 2IZRA 2C5NA 4LM5A 3DKOA 3CD3A 3HV5A 4R77A 4IVDA 2F4JA 3ANRA 3GGFA 4RWJA 1U54A 2XZSA 5I9WA 3PXFA 4XNEA 3JY0A 2OLCA 3C5IA 2ETMA 3OZ6A 4HYHA 5EYKA 1OL6A 2UUEA 4B7TA 2O64A 5EK7A 3K3JA 2P4IA 4FEUA 3ACKA 2X2LA 2OU7A 4I0TA 1P2AA 3NUNA 4GT4A 4HPTE 3O51A 2PSQA 3JVRA 2YIXA 3CXWA 4J96A 4BDGA 3L1SA 1ZY5A 3R7GA 2GS2A 4TRLA 2XP2A 1QPCA 3QTWA 3RCDA 2WOUA 3FYKX 3CY2A 3LOKA 4GVJA 5E8UA 1YOLA 2VU3A 4KS8A 5C01A 3U54A 5HE3A 2QO2A 4YJOA 4IFGA 3I0QA 1NY3A 2LAVA 5LVOA 1A48A 4G3FA 3FUPA 1H0VA 3KK9A 4NKSA 5DLSA 4C3FA 1PKDA 2V62A 4R5SA 2WTKB 3MFUA 2QOCA 3OXZA 4D4VA 2QG7A 4FV8A 2HWPA 1BL6A 1P14A 2PVFA 1KV2A 4I21A 4XJ0A 5ETIA 3NDMA 4JDJA 4O7YA 5LCKA 3SOAA 3ROCA 1U5RA 3AC8A 4FV3A 5CT7A 5HLPA 3HZTA 4O1PA 5KUPA 2PY3A 4F63A 5ITAA 3W1FA 3Q4UA 3ZSIA 4LMNA 2JKMA 5JRQA 5CU0A 3L8XA 3O17A 3D7TB 4ERWA 4TW9A 1CKIA 3NR9A 4EQMA 3F9NA 3MBLA 4IVAA 4QOXA 4GSBA 5IH4A 2C1BA 3KL8A 2B4SB 3L8SA 3IW4A 5CXZA 5KHXA 2W1CA 3V5LA 4J53A 3GCPA 2GHLA 3O7LB 3QTZA 4FT0A 3UYTA 1XH9A 1OI9A 4R3RA 4PDOA 1YXVA 3PDTA 4O27B 5FP6A 4ANOA 3IW6A 5GZ9A 4DGLC 4LQMA 4RIOA 1VEBA 4JIKA 4CV9A 4JL9A 3W8QA 3CTJA 5BQ0A 3BQCA 4DFYA 4YGAA 4ACHA 1KOAA 5EQPA 3QD0A 4G31A 2W99B 5L2TA 1LUFA 1PXKA 2ITOA 5HESA 4L3LA 3EFJA 3EYHA 2QOOA 3ZSHA 4W4VA 1G8SA 4EKLA 4L42A 4O84A 5BVNA 3NEWA 2PPQA 4E26A 5IA3A 3E92A 3TTJA 3QGYA 2ONLC 3BU6A 4QPSA 1ZWSA 4M69A 2P2IA 4R5YA 3R7EA 4FIIA 4GCJA 1LEZA 1M7QA 4X2FA 5L2WA 4O7ZA 3FL4A 3CLYA 3TDWA 5CWZA 5FGKA 2YN8A 3V5WA 3GU8A 3KVWA 2Y6MA 2EVAA 3NYXA 4DFZE 5LWNA 4GEOA 1Q97A 3S3IA 4B9DA 2UW5A 5BX0A 1YDRE 3R8ZA 1J3HA 4DEIA 1PMEA 4USFA 3P78A 2QO9A 4TY1A 2XKCA 3D9VA 3DGKA 2ZDUA 3EKKA 3UOHA 4QMTA 3KF7A 5KMJA 3LE6A 4FOBA 4Z3VA 3OCBA 4HVDA 4DTKA 5KBQA 2IZTA 3LFNA 3SQQA 3O50A 1BYGA 3TV7A 4NSTA 4AW0A 2R3LA 1ZRZA 3R2BA 4J7BA 2WTWA 4U45A 4LOOA 4PV0A 5HIDA 5IQFA 1P5EA 3ODYX 5EKOA 4X2KA 5GIOE 3ULIA 5TE0A 5CU4A 3NWWA 1UNLA 1CMKE 3KEXA 4J1RA 4NTSA 5CYIA 4FIGA 3FZTA 5AAFA 2Y6OA 5K5NA 4KSQA 3RWQA 4MK0A 1GIHA 1XR1A 2VWWA 3ZRLA 5GINE 3NUAA 3FZOA 3M2WA 4RVLA 4EUTA 4YTFA 2I6LA 5AM6A 3KXGA 3KULB 2DQ7X 4RIXA 1XH7A 3Q4CA 4MF0A 4FKJA 4APPA 4GT3A 1V0OA 4CCUA 4YC3A 5HX8A 1HCLA 2PVHA 2I7QA 4JG8A 4ZZNA 4E5WA 1OGUA 3T9IA 3H0ZA 1BLXA 3TNHA 3UZTA 4BDKA 3LCDA 5M4CA 3FXWA 4BZOA 3HL7A 3M42A 5AR4A 5BMMA 3CP9A 5DYJA 5G6VA 2XEZA 5DT0A 2FYSA 3QHRA 4KBKA 3SV0A 3ZUTA 2XCKA 3BE2A 3ITZA 4MF1A 4Q5HA 3GC8A 4FYNA 3DDQA 2W9ZB 2X0GA 4IBMA 5D7VA 3TXOA 4BCQA 3EFLA 4G6NA 2CGXA 4JR7A 4YJSA 5HZNA 5BYLA 4HNFA 5JQ8A 5FM3A 3L8VA 5CENA 4ZY5A 4BR3A 2OF4A 1PF8A 3C51A 3RM7A 3R2YA 4JBQA 2XCHA 4CFNA 2J0MB 5CT0A 1E9HA 1IA8A 3VJOA 4XV2A 4D28A 5DG5A 2JDOA 3ORMA 3UQFA 2EXCX 1WVYA 3LFQA 3HV7A 4FODA 3BBWA 3IONA 4BGQA 5LMAA 3Q32A 3SAYA 4Q2AA 1OMWA 5ANEA 2H6DA 2GNJA 5HEZA 4AT5A 3R22A 5M44A 2O65A 4ASEA 3ELJA 4DG0E 4MHAA 4CYIA 3DZOA 4IX3A 5A6NA 5ANOA 2VO0A 4D5KA 2J5EA 3IG7A 3MPTA 5DWRA 2QC6A 4PTEA 2YM7A 5FDXA 2GDOA 4YP8A 3LQ5A 5H2UA 3GQLA 4U80A 3R8LA 3CKXA 1FGIA 3IO7A 2VTAA 4QQCA 5CU3A 2X7OA 4NKAA 5CU6A 4FKLA 3VBQA 4F09A 5C8NA 2J4ZA 2Z7RA 4FKGA 4W4WA 5DGZA 4YTHA 1WBOA 4FV9A 3RGFA 2HZ4A 5BMSA 3FSFA 4WUNA 1U59A 2C6EA 4A9RA 5L6OA 2X39A 2VTPA 4C4EA 4EOLA 4I6BA 4AXAA 3Q9YA 1M2PA 1OUYA 3FLWA 3I60A 4P90A 1GZ8A 5AUVA 3QTIA 4H3BA 3VF8A 4MXZA 3O8TA 3UO4A 5ANDA 2R3MA 3EMGA 3EN9A 4EQCA 1O9UA 2ZV2A 3KKVA 2WTIA 5LVPA 3SW7A 1Y57A 2QOQA 3AC3A 3BE9A 4MBIA 4TNBA 5CZHA 3VRZA 4CKJA 1OM1A 4G3DA 2ITXA 3VO3A 2GMXA 4QYEA 3UP2A 1BL7A 4UXLA 3ZXTA 4YU2A 2WMVA 4DTAA 3E63A 2BMCA 4IJPA 3OUNB 2A4LA 3Q9WA 3D5VA 5KCVA 2WXVA 3MWUA 2GTMA 2UW4A 3FI4A 2FUMA 4KIOA 4V0GA 4A9TA 4TL0A 3HMOA 1PW2A 1WBSA 3BLHA 4L68A 5CF5A 2PE0A 3AD5A 5CAUA 2WELA 5JFXA 1L8TA 3CCNA 3TZ7A 4FKPA 1TKIA 4FEXA 5EYCA 5DR9A 4R78A 4IAAA 4DE4A 1FVRA 4FZ6A 5FTOA 3W55A 2G01A 4WNOA 3SC1A 3VNTA 4CRSA 3DBEA 3H10A 1Y8YA 4IC8A 5FTQA 3WOWA 4HNIA 1SNUA 1U54B 2UVXA 5I9ZA 3EN5A 4XG9A 1H1QA 5IEVA 3TJDA 3VBVA 4WUAA 3R1NA 4IX5A 4YJRA 4JNWA 4DBNA 4JAIA 1WBPA 4FL3A 4RVKA 3E3BX 2JD5A 1UU8A 2ZV9A 3EJ1A 3KRRA 3MB6A 3ORLA 3WIGA 3TDVA 4Z16A 3FHRA 3F3UA 4MEDA 2JEDA 2C6KA 4F64A 4C4GA 1XQZA 1YVJA 4RGJA 2R7BA 4RQKA 2X1NA 2XIYA 2PUPA 5KZ0A 3VRYA 3ZFXA 5AR3A 5GZAA 3RP9A 5KMOA 2QU5A 4I4FA 1WFCA 4R1VA 3OCSA 4C2VA 4FSRA 4ERKA 2JDVA 2YCFA 5CAPA 1JKKA 2BUJA 2CHLA 1FBNA 3A7HA 4USEA 2Y9QA 4PMPA 5DR6A 5C9CA 3KRXA 4B99A 1I44A 3PIXA 4DFLA 2BR1A 4KBAA 2ZOQA 3OY1A 3W2SA 3E3PA 1WAKA 2OGVA 2R9SA 2ERKA 4MBLA 1WVWA 3R9HA 3HP5A 3MVHA 3UG1A 4BHNA 4E6AA 3PA3A 4FA2A 1QCFA 4A9YA 2X4FA 3BEGA 4BTJA 3E8CA 1PRYA 3IGOA 4ENYA 4EHEA 4PL4A 1J1CA 3ZBFA 2J0LA 2BTSA 4TPTA 5L2QA 2WZJA 2I0HA 3QRIA 4L3JA 4Q9SA 3ULZA 5J79A 4BBEA 3R9RA 4JRNA 5FXRA 1ZOHA 3VBTA 2REIA 2G1TA 3NZ0A 3C0HA 3UOKA 4ZSAA 5AA8A 3GEQA 4II5A 5M4UA 3U9CA 3R0TA 1YXTA 4Z7GA 2AYPA 4JQEA 4QMPA 5CVHA 4AZSA 4E8AA 3OOGA 3QCQA 3V5JA 4P7EA 3DXQA 5CI6A 5JFSA 5IU2A 1OIUA 3FMHA 4L52A 2P55A 4UYNA 1H24A 4U0IA 3GC7A 4RVMA 3ROYA 3QZHA 5L3AA 3BHHA 4LYNA 3OD6X 4IZ7A 2W1IA 5IQEA 2QHNA 4XUFA 5JFVA 4OTDA 3QXPA 3MW1A 3OEZA 3OWLA 4JQ7A 4RLKA 2IW8A 3R8UA 3TIZA 4F6WA 3QKMA 4FNWA 4DLJA 4FSQA 4AOIA 4M69B 3OWJA 4AE6A 3MVLA 4ZSLA 4H3QA 3ETAA 3F2AA 3VQUA 4ZXTA 4NCTC 5IG1A 4RZWA 3QA0A 2W1HA 5F9EA 4NIFA 4EORA 4ALVA 2F2UA 5CSVA 1VZOA 3QKLA 3WYXA 4FSWA 4AU8A 3BZ3A 1FGKA 2OI4X 3D0EA 1B39A 4FX3A 3DA6A 2YLFA 4EH3A 2WHBA 2OIQA 4RA4A 4EH5A 5LMKC 5AP5A 5CEQA 4K6ZA 4EUUA 3LPBA 3HAVA 2CN5A 5DN3A 4GFOA 3RK5A 3HV3A 3PWDA 3A7IA 4JQ8A 4CQGA 2VO7A 3FQSA 3KRLA 4BCFA 5CS6A 4FKWA 3FE3A 5EM5A 5B2MA 3PTGA 2WMXA 4HVIA 4NW5A 2X7FA 3PLSA 3QUPA 4NT4A 3F2RA 1GNGA 2CSNA 2X2KA 4GT5A 1M2QA 4UYAA 4F1OA 1IG1A 2WQMA 3C5UA 4RSSA 4CCBA 5A14A 1JVPP 4JOAA 3C4WA 3VS1A 4ARKA 5AV4A 1Z9XA 3F61A 3TUDA 2NRUA 3CKWA 3E8EA 3EQRA 3F6XA 4U8ZA 5EDQA 2YFXA 3DAEA 3FWQA 1E1VA 3HRBA 3KXHA 3Q9XA 3IW5A 1URCA 3NGAA 3PZEA 4KB8A 4XV3A 4RIXB 3PRIA 4M0YA 3CD8A 2JDRA 3ZRMA 4XBRA 3DOGA 5D41A 4XV1A 2Y0AA 2BHHA 2J9MA 4JRVA 4I20A 3QZFA 4FTUA 2J51A 1FINA 4PMMA 4DEDA 2HELA 1H0WA 2EXMA 2RFSA 4IACA 4K0YA 3I6UA 4F7LA 4IIRA 1KWPA 3VJNA 3ZEPA 5C03A 4BTKA 1BUHA 3Q96A 3PP1A 1ZXEA 3MPMA 5CSPA 5D9HA 1QPEA 2GFCA 1K9AA 5GJGA 5H8BA 4AFEA 4AZVA 4CFWA 1NVQA 4AN2A 2J7TA 4QMOA 3BHVA 3TNIA 4NWMA 2V0DA 3C0IA 1ZZ2A 3F3TA 3QD2B 1OB3A 4L7FA 5IDNA 3EZRA 4CFXA 4AS0A 4JDHA 3ORZA 3VN9A 4C38A 1W82A 4QTDA 5AP6A 1YQJA 2X8IA 3D2KA 4QP9A 5ANIA 4PTGA 3RPOA 3OW3A 3PVWA 4YJTA 4YC6A 4M84A 2ITTA 3NNUA 1X8BA
chains in the Genus database with same CATH superfamily
4EOPA 2VX1A 3GC0A 3MDYA 4KAOA 4AN3A 1XWSA 3TZMA 3UNZA 5IEXA 3JR1A 2W5HA 4OTQA 1JNKA 4JI9A 4S33A 3QCSA 4U42A 3F5XA 4BDEA 2PVMA 3BWJA 3OXIA 2UZLA 2WTDA 4FV7A 4F1TA 3LKMA 3EQIA 3FBVA 4EK6A 3NVMB 2WTVA 4LGGA 4MKCA 3MVJA 5FUTA 4IB3A 4DTBA 3OTUA 2YEXA 3PVBA 3FMEA 4AW2A 5IZFA 1Q3WA 1GY3A 4U81A 3LMGA 1REJA 4O2ZA 1B38A 3ZO2A 4CKRA 3GI3A 4IAZA 3ET7A 4FNYA 1R1WA 5DE2A 4C57A 2R3GA 3CR0A 4O91A 2WEVA 2CN8A 5FEQA 3GOPA 3A61A 3DJ5A 4BDJA 5E4HA 2QVSE 3CJGA 2W5BA 5FXQA 4FEWA 1UNHA 4XG6A 3A4OX 1XH6A 1YXXA 1FMOE 3F5GA 2AUHA 3POOA 4PMSA 2QOLA 5HO8A 4BI1A 3IK3A 3CEKA 4DCEA 4JLCA 2XA4A 4I6HA 4OUCA 2P3GX 1J1BA 5J95A 4RC4A 5KZIA 1M14A 4ZTHA 4IJ9A 3GFWA 3PPZA 4BKJA 3E93A 5AAEA 2IF8A 4G3GA 4IAFA 3EL7A 3IOKA 3ZMMA 4ASDA 3OY3A 5M06A 3V6SA 2O3PA 3LLTA 3PYYA 3VW6A 4L6QA 4QNAA 2YAKA 4UV0A 2X7GA 2V55A 3WZDA 1DS5A 4ITJA 3FKLA 2RIOA 3JVSA 2XNMA 2OXDA 3NNVA 1FQ1B 3UGCA 3WF8A 1XMMA 3NX8A 3FXXA 3MH1A 4CZUA 5JRSA 3REPA 1JSTA 1RQQA 4W8EA 5ANGA 3HRFA 3OS3A 4C59A 5M09A 4EYJA 3JXWA 5HGIA 4BFMA 4DH5A 2XNOA 3EKNA 2ZM3A 3CQEA 4I92A 5HIBA 4LGDA 3ZU7A 4AAAA 4EH7A 4IAKA 5DT3A 5FEEA 3ZONA 2A98A 2YABA 2IJMA 4V0GB 3G90X 1G5SA 4MYGA 4NM0A 3QX4A 4QMMA 5FBOA 3DBDA 3GVUA 4ZIMA 4FGBA 3QCXA 4FICA 1V0BA 4GS6A 2WMQA 4EOMA 2W0JA 3R8MA 5EM8A 4IMYA 4FRFA 4DH8A 2VWVA 1OPLA 3FC1X 5HKMA 5K0XA 3O23A 4EJ7A 4FTCA 4RWKA 4BCKA 2JIUA 3MGYA 1ERKA 4FK3A 4YHTA 4CNHA 3MY5A 4EZ7A 2PULA 4CZYB 1YHVA 1PYEA 4RWLA 3DBQA 4D9UA 3TV4A 2WAJA 3BGPA 3ZLYA 3G6GA 2IW6A 2BDFA 4OBQA 2QI8A 3KY2A 3C0GA 5CALA 1ZLTA 2VV9A 3E5AA 3PVUA 4G9CA 2XNEA 5A4CA 2HY81 4GW8A 4I5HA 2FH9A 2W17A 3KMMA 4UXQA 4ZLZA 5D11A 5ACKA 2WEIA 3BHYA 3ERKA 5FQDC 5EM6A 1F3MC 3VBYA 5HORA 4RC3A 1G3NA 2B1PA 3ZOSA 2W05A 4YZBA 5G1XA 1BX6A 2XJ0A 3G5DA 2R4BA 4S30A 4D2TA 1AD5A 5L6PA 2H9VA 4AT3A 5A3XA 4CTCA 3GXLA 2OJ9A 4FKQA 4J95A 3VUIA 5IEYA 2VWIA 2ZMDA 3LFAA 3TZ9A 4ANMA 4F9YA 4NL0A 4RX5A 4LFIA 4CTBA 4PNKA 5ETFA 4IVCA 4O7NA 2RL5A 5JQ5A 4CFFA 1PMVA 4ZJVA 3EQGA 2C6OA 4AGUA 5KHWA 4A4XA 2I0YA 5B2KA 5FTGA 3NS9A 4DEBA 5K9IA 2QR7A 2W7XA 3V5TA 4EOSA 4YJNA 4IX4A 3AGLA 2PL0A 3V8TA 4FVQA 4I94A 4ZLYA 4NU1A 4R8QA 2YM5A 4XS2A 2IZUA 3EQBA 4QMUA 2IO6A 3G6HA 3MH3A 4NFMA 1RJBA 3L9PA 1BI8A 3Q4TA 3RAIA 4ZS0A 4GUEA 3QHWA 4IZ5A 4QPMA 3PRFA 2JBOA 3HDMA 4DA5A 5K4IA 1JAMA 1VYWA 2XRWA 1OUKA 2JDTA 3F7ZA 4MXCA 4FKTA 1ZMVA 3ALOA 3WARA 4DITA 2F57A 3KXXA 4LRMA 4TKSA 3W2RA 1M17A 3HECA 4WIHA 5JZNA 4KIQA 4C33A 2X8EA 4CLIA 3EH9A 4K77A 5HNIX 3MV5A 2PYWA 4RRVA 3VULA 4XEYA 1ND4A 2YIYA 4FVRA 5D12A 3W0OA 2UZTA 2SRCA 5M56A 4F0GA 4CG8A 3JUHA 1BKXA 2HCKA 1HCKA 3HRCA 3QTXA 4DGMA 4FKVA 4AG8A 1H27A 2Z60A 2JAVA 2X0QA 4EOOA 3V8WA 3RAHA 3ZO4A 3R1SA 1Q41A 2PWLA 1S9IA 3EQHA 3DK7A 2YERA 4UB7A 1NA7A 3F2NA 4XG3A 5DI1A 5T6KA 3ZTXA 4FIHA 4C3RA 5IMXA 3RAWA 4N57A 5CVGA 4OBOA 4AZFA 2WTJA 3DT1A 2W4KA 4G17A 4NIFB 1M7NA 4GVAA 3GU4A 3DK6A 4AZTA 2BZHB 1UWHA 4FTIA 4QP3A 5IKWA 3TNWA 3LCOA 2IZSA 3QLGA 2VTIA 3IPHA 4FBXA 4YZMA 3RAKA 3HUBA 5CASA 2VTJA 2WTCA 2WQBA 5E8TA 4ZJIA 3BL7A 2B54A 3LM5A 2GTNA 3H9FA 1OBDA 2DWBA 5CSHA 3T3VA 5F20A 4AE9A 3ENMA 1YKRA 1IRKA 4FG7A 3KGAA 3BCEA 3GBZA 4HYIA 1G8AA 2O5KA 1JSUA 3OWPA 4JAJA 4ZMEA 4I41A 1IR3A 2VZ6A 4RX8A 4AN9A 3VUHA 4S2ZA 2VTNA 2YIQA 3LXNA 3BHUA 2XBAA 2YWPA 4FZAB 4JXFA 4K8AA 4M14A 4M66A 3A99A 2A0CX 1O6YA 2H8HA 2C3LA 4EQUA 3LHJA 4WHZA 5LVNA 4FTQA 1KE9A 1WMKA 4G5PA 3TJCA 3DB8A 4ZSJA 4E1ZA 1Y6BA 3NFGB 2WQOA 5HTCA 2B0QA 5A4EA 1H1SA 4IAIA 5IQIA 4L45A 5HG9A 1ZARA 3C1XA 4ASXA 4NM7A 3MI9A 3ZSGA 5AV3A 4X3FA 4EBWA 1OVEA 4AOTA 4M15A 3C4ZA 3PXRA 5AUYA 3BU3A 3KXMA 2PE2A 3ACJA 1SVHA 5C1QB 2OXXA 3JPVA 5DEYA 4EK8A 3OHTA 2JITA 2GNLA 2JAMA 1GOLA 2ZAZA 3AMBA 1A9UA 4OBPA 5AX3A 3PSCA 4BCIA 3G9NA 5BUJA 4O7SA 2J2IB 4YBKA 3W0MA 5DT4A 4IAYA 3CC6A 4C4IA 4FV4A 3W2OA 4M3QA 4Y8DA 3POZA 3QBNA 3H3CA 3RMFA 4EOJA 3CBLA 5AIKA 4D4YA 3GNIB 3QKKA 1VR2A 4D2VA 3AG9A 3QWJA 3TCPA 4BIDA 5BVKA 4RFMA 4O0VA 5EI8A 2I0VA 4YHFA 3SG8A 3QC4A 3R73A 3NW7A 2VTQA 5A4TA 3PXKA 3OEFX 3OP5A 4OLIA 3WZJA 4IDTA 1FVTA 3R6XA 4O6LA 4AFJA 4HCVA 4QP2A 2OJGA 3DBFA 1H07A 3OOMA 2XKDA 1TQPA 4YZDA 5E8SA 5JGBA 4O96A 2XK6A 4E6QA 4GFMA 4RBLA 2PVNA 5AM7A 3B2TA 4K11A 2IWIA 2YDIA 3DBCA 4BDAA 1PYXA 3P1AA 3GB2A 4MH7A 4YTIA 4BZDA 4KWPA 2YACA 2X9FA 3PJCA 4D5HA 2OXYA 4QMWA 3RHXA 4OAVB 4GRBA 4FG8A 4P2KA 4ZTQA 2WNTA 1Q24A 5BV3A 1J91A 4XX9A 4U5JA 5AR2A 3W16A 4ZTLA 4YLJA 2UVZA 4BJJA 2C6DA 3SXFA 2XB7A 2OIDA 4CD0A 4QYGA 3MJ2A 3SG9A 5KMNA 1W2CA 3PSBA 4IX6A 4XV9A 3R00A 1MQ4A 4L67A 3UJGA 3G0EA 5A54A 3K5VA 1XKKA 4ITIA 1JOWB 4O0UA 3LFFA 1JKLA 4NJ3A 4O7WA 4QYFA 4O4CA 1PXMA 3GCQA 5IQCA 5DFPA 2JGZA 5IQHA 3TT0A 4DGOA 3ORTA 2UZOA 3T9TA 3BYMA 1XBCA 2OKRA 3PA4A 4BWPA 1T46A 3R7UA 4Y85A 4EH2A 2C0OA 4FMQA 2BRMA 4IFCA 3U8WA 5J9YA 4R1YA 3TG1A 5M07A 4GK3A 4I0SA 1R0EA 4ACGA 4WSQA 3VBXA 4F7JA 1F0QA 2ITVA 2HZ0A 1YXUA 2OZAA 2NNWB 4Y46A 3RHKA 4CZTA 4RLLA 2VGPA 4GJ2A 4HZSA 2Z02A 4EWHA 4LRKA 3DDPA 1WCCA 5DH3A 3KIOC 3ALNA 4HCUA 4DG3E 3AC1A 1OITA 3R01A 3UPXA 2F9GA 4FOCA 2ZV7A 2EUFB 3L9MA 4NZWB 3ZZEA 2PUUA 3QF9A 5IQAA 2IPXA 4D1SA 4I5PA 3C4EA 2QG5A 1GIIA 2QR8A 4DGNA 1PXIA 2WTKC 1K3AA 4LUDA 3KCKA 3PXZA 3RJCA 3THBA 3WYYA 3TMOA 2BVAA 1J7IA 3E7VA 3FI8A 5EI6A 1UWJA 3EB0A 2W1DA 4L3PA 2GCDA 2Y8OA 4QTBA 3AC4A 3U87A 5M53A 2WIPA 2QO7A 3CY3A 3DK3A 4HGLA 4K2RA 4XRJA 4GU6A 4ANLA 3NIZA 4LMUA 5AX9A 1GZOA 4BCNA 3BLRA 1GZKA 3FSKA 3NNXA 5BVEA 1WBNA 2XJ2A 4ACCA 4QMLA 5HG7A 4M13A 4MD7E 2R64A 3EQCA 4WBBB 1YI6A 2R7IA 4BYJA 1CDKA 4AQCA 1NXKA 1JLUE 3LFSA 5HOAA 2RFEA 3SHEA 3EIDA 4OTHA 4PP7A 3ZUVA 2VRXA 3FQEA 5CEIA 5AJQA 5BUIA 2BRGA 5CAOA 3NVKI 3ATSA 5KE0A 1BI7A 4ZAUA 5KBRA 3TKUA 5LOHA 4PDYA 3DZQA 1ZYLA 4IC7A 3ZDUA 5D1JA 4RC2A 4GYIA 3FY0A 2FSTX 1UKHA 3FZRA 4DDGA 2HZIA 2XYUA 4QPAA 3VS6A 4CV8A 4Y72A 4BCJA 2ITQA 4EONA 5C27A 4QTCA 4YZ9A 2BILB 4FV5A 4ZMFA 4XLIA 3KB7A 5B7VA 4XP0A 3TWJA 2ITWA 4ACDA 3C4CA 4B0GA 5JGDA 4PQNA 4E6CA 5IA1A 3AT3A 2UZUE 3R7YA 4F7NA 3VUGA 3MPAA 4EZ3A 1KE5A 2WIHA 2VTOA 3PXQA 4IZYA 5CSWA 4F6SA 3R02A 2UW9A 3DKFA 2X8DA 3F88A 3LJ1A 4NM3A 3PE1A 4TZRA 2UW0A 5FWKK 4EKKA 1LEWA 1MRYA 2PUNA 4IZAA 4PPCA 4I6LA 3FLZA 2C30A 3H9OA 2UZWE 3EFKA 3P9JA 2H96A 3ZC5A 3HMPA 5H3QA 1OPKA 3NUXA 3ZEWA 4CMUA 2AC5A 4J71A 3UVPA 4AP7A 2YLEA 3LXLA 3U6IA 4KRCA 4FTNA 4MVFA 3IECA 4MWIA 4AXCA 4O7TA 2PHKA 2OFUA 3QQUA 3MFRA 5ACBC 4DFUA 5EW9A 3LJ2A 4ZSGA 2XK7A 4FKRA 1PMNA 3DXPA 3U55A 5EDRA 1Q3DA 3TM0A 2VWZA 2GS6A 1OL7A 3QGWA 3WE8A 2I40A 3TKIA 3PY0A 3C9WA 3SRVA 5CAQA 3L8PA 4Z55A 4XRLA 3C7QA 4GKHA 4RPVA 4KS7A 4PX6A 2ACXA 3VS4A 1QPJA 4KUJA 3F3ZA 3DQXA 4DDIA 3VVHA 3OROA 5E8XA 4BDIA 2XKFA 3B2WA 2BFYA 4C37A 3AD6A 2GNFA 5EFQA 5L6WL 2B9FA 2RG5A 4D2PA 4J97A 1AQ1A 3OC1A 4IE9A 4NEUA 5H8GA 4CT1A 5DMZA 3EZVA 1APME 2HZNA 4UWBA 5J5SA 4C35A 3VS2A 5EKNA 3BRBA 2QNJA 3NSZA 4KABA 2AC3A 3SLSA 4B8LA 4P4CA 4UWCA 5BUEA 2ZMCA 5KMMA 5T3QA 3T3UA 1W8CA 4DHFA 3Q52A 4KKEA 4NM5A 1UU3A 4WG4A 1XHAA 4H36A 4D0WA 3NUSA 4FJVA 2UZBA 2P0CA 5TT7A 3W32A 4FIFA 3UDTA 4F7SA 3LM0A 3BIZA 3BGQA 4WT6A 5E92A 1QPDA 3FMMA 3K5UA 4DLIA 4MD8E 4TYEA 3QRJA 4BDCA 3R7OA 2BRHA 3DTCA 1H1PA 2C3JA 2XNBA 3DLSA 4MNFA 4E4NA 2GNGA 4FUXA 1FMKA 4JBVA 1J7LA 1PY5A 1RE8A 2BRBA 4MXAA 4C0TA 2BAKA 4C8BA 4EK4A 3EL8A 5HO7A 3RVGA 2E9UA 3ZYAA 2W1ZA 3DQWA 2UZNA 5DNRA 3W2QA 4BHZA 3HGKA 2WMSA 4AQKA 3VS7A 4DEGA 4YURA 4AX8A 2PTKA 3PE2A 5LVLA 3V6RA 5JEBA 3QWKA 4LOPA 4O22A 4BKYA 5IPJA 5JT2A 3EQPA 2LGCA 4JVGA 3HA6A 3K3IA 2CPKE 4BTFA 1E1XA 2ITPA 2XNNA 1Q4LA 3D5XA 2WPAA 3OF0A 5EYMA 1RW8A 4BC6A 5L8LA 2YWVA 4O83A 2YJRA 1TQMA 4RT7A 4BDFA 4X3FB 4D4SA 3DFCB 3W0RA 2B9IA 3PVGA 5M55A 2XIRA 3IW8A 4D0XA 2PMLX 2Q0NA 4XP2A 4CMTA 1WBWA 4C2WA 4QMNA 1YWVA 3HV6A 4U43A 5CU2A 2G2HA 2XBJA 2PZPA 1JPAA 3MTFA 3VHKA 3QU0A 1ZYDA 4O7RA 4PUZA 1M52A 3ZXZA 4MXOA 4HVSA 4QRCA 3TEIA 3ZM4A 1Y91A 5JH6A 5FRIA 2FVDA 3VW8A 4RQVA 5DRDA 5J9ZA 4DHIB 3P5KA 2QOBA 4GFGA 2VD5A 3LZBA 3EYGA 3A2CA 4OT6A 2OK1A 2XJ1A 3LFDA 3EWHA 4YNOA 5IUHA 4QMXA 2YDKA 5L8JA 3RNIA 2GU8A 3IS5A 3BX5A 2VX0A 4IANA 1WZYA 3U6JA 4TTHB 2OSCA 4OW8A 2X81A 2W1EA 4RVTA 2HK5A 3V04A 2F7ZE 4MX9A 3SX9A 4BYIA 4TNDA 4QP4A 4H1MA 3HLLA 4JT3A 4P5ZA 1FOTA 4IQ6A 3N51A 4ZTSA 4F1MA 5KKRB 4JR3A 3P08A 3F69A 1U46A 3ORXA 3Q5IA 4EWQA 1A06A 4HW7A 3S2PA 4JG7A 3I7BA 4IB0A 3A7FA 5M57A 2W4OA 4RX7A 2P33A 2PZIA 2OH0E 4IWOA 2BALA 4WNPA 2GQGA 1JKSA 4EH6A 1OGYA 4G3EA 1U4DA 2X4ZA 4EI4A 3LFBA 2ZB1A 3BHTA 4OTIA 4KIKA 4QMYA 3E64A 3A8WA 4BJJB 1B6CB 3IDBA 2G2FA 4DH3A 3HP2A 4Y95A 2XUUA 5J7HA 3R7IA 2I1MA 4IXPA 4RJ4A 5D7AA 3DKGA 2BHEA 3ZBXA 4ZEGA 2C3KA 4KINA 1P4FA 4FK6A 1LP4A 2ZV8A 4TYHA 4MTAA 4BTMA 4GK4A 5DBXA 2A2AA 1IA9A 2OICA 4L44A 4FV6A 5EHYA 2B9JA 2VX3A 3H9RA 3DAKA 4A06A 1KE7A 2WKMA 2GNHA 4K33A 3AKKA 3MFTA 2RG6A 3R9OA 3D83A 5HLWA 3Q4ZA 3K2LA 4M68A 2OJJA 5CLPA 4CQEA 3BV2A 4N6YA 2ETKA 2XMYA 4PPBA 1ATPE 4L8MA 4AA5A 3JS2A 1YW2A 1V1KA 4I23A 4EK5A 2HIWA 4TT7A 5JKGA 1ZAOA 3RKBA 5J9LA 2WB8A 3TIYA 4YJQA 3LFEA 2PVRA 4RIYA 4EH8A 4H05A 3BGZA 2W5AA 3C4FA 3UP7A 1OKVA 3PXYA 3QAME 4X7QA 3VUTA 4B8MA 4I3ZA 1OBGA 4H1JA 4N70A 4JIAA 2XARA 1ZOEA 3MS9A 3Q9ZA 4U9AA 4FKSA 3KREA 3C50A 5AP0A 4FF8A 5BVWA 3HEGA 2W4JA 5FLFA 1NT2A 4MUQA 4I1ZA 2NYAA 3NFFB 2PK9A 2C5YA 2BZIB 4E5AX 5IMEA 3W18A 4EOQA 4YJUA 3COMA 4I24A 4GH2A 4IM2A 3VAPA 3BI6A 4O0YA 1AGWA 4QMQA 4ZTMA 5HTIA 2PMOX 3KXNA 2YIWA 4BDDA 4JMQA 3BEAA 3LQ8A 2QQ7A 1STCE 3HA8A 3KRWA 4CEGA 3P4KA 4HOKA 5J5TA 4FE2A 4FSYA 4FIEA 3OWKA 2EB3A 4C61A 5HE2A 1XH4A 2Z2WA 2NPQA 5FP5A 3R63A 1GAGA 3E88A 3OXTA 4TYGA 4AF3A 4FV2A 2YCQA 5EDPA 3FL5A 3QRTA 3FY2A 5A9UA 3BYUA 3MIYA 4GG7A 4R6VA 2JLDA 2VWBA 3FHIA 5HBEA 3RK9A 4EOIA 3MH0A 4BGHA 4YPSA 2YCSA 3UMXA 3HUCA 3UG2A 3ZHPC 2ZFYA 3A8XA 4XG7A 4O4FA 1K2PA 3OTVA 5CF4A 3LAUA 2EB2A 4LV7A 4JX7A 5HI2A 4ZK5A 4RJ6A 4XH6A 4Z7HA 4LUEA 3D94A 2UW3A 4E3CA 4IM3A 4JBPA 2PZ5A 4LL5A 2QOIA 4WRGA 4F99A 2C5XA 3LIJA 4B6LA 5AV2A 4D58A 3E8DA 1SVEA 1W7HA 4LRJA 5IISA 3PJ3A 4GIIA 5JK3A 4U3YA 3AMAA 3G9LX 4MNEA 3ZC6A 2X9EA 2BFXA 3NUYA 2R3QA 3EQFA 1NVRA 4TXCA 2Z8CA 3DLZA 4EHVA 3MFSA 3COHA 3V5PA 2QODA 3AKJA 2R3KA 2NP8A 2WD1A 1XO2B 2AQXA 1SVGA 1JKTA 4S31A 4E5BA 4WKQA 4KKHA 4DHJA 2ZM4A 4JG6A 2QONA 3V01A 2XF0A 3FMDA 3UODA 4EK3A 4O38A 3KN5A 3LW0A 5KKRC 3P86A 3R30A 4UBAA 5HTBA 4I5MA 4QYHA 4YMJA 4USDA 3RWPA 4C34A 5DOSA 2VNWA 2YCRA 3LXKA 1OKZA 4FL1A 5HIEA 1R0PA 1Q8UA 5LVMA 3RTPA 2QLUA 4QP1A 3GC9A 5C8KA 5A4QA 2PVJA 4QQTA 3LMIA 1DI8A 2JKQA 3OFMA 4W9WA 2JKKA 2XYNA 2PZYA 3GCSA 4HCTA 1PXLA 3FMLA 1XH5A 2BZJA 3KC3A 5E1EA 3VIDA 4HGEA 1KV1A 4YBJA 2G2IA 3BV3A 3R8PA 4F78A 3CJFA 3RK7A 4RX9A 3D14A 4DN5A 3HX4A 4RMZA 3V3VA 2O8YA 3CIKA 4O2PA 4FUYA 4O0TA 4BCMA 2BDWA 4MQ1A 4O21A 4QMVA 3U4WA 3MA6A 4CFMA 4DFNA 4E4XA 5LMBA 4F6UA 4KIPA 5D10A 4DC2A 1UU7A 5BVDA 2JDSA 1H25A 1YHSA 4U97A 3TI1A 1YRPA 2O0UA 5JN2A 3CPBA 4QP7A 1YXSA 1OPJA 5L8KA 4XCUA 3F7WA 3R1QA 2QOFA 4NCTA 4ZZMA 1O6KA 2BZKB 5LQFA 1Q5KA 4FZ7A 2C5OA 3RZFA 3W33A 4DFXE 4L7SA 4E7WA 5JSMA 4WRSA 5HE0A 3W8LA 4I0RA 3FKOA 1MP8A 3PPJA 1M2RA 4RIWA 2C0IA 4BCGA 4RJ5A 2C0TA 5LARA 4AW1A 4C4JA 2QCSA 5LMKA 2WMTA 5HCXA 4MBJA 4HGSA 4I93A 5IH5A 3SGCA 4BY9E 4MXXA 3HAMA 1WBTA 2VWYA 5HD4A 3OUKA 4YLKA 5CXHA 4G3CA 4OTFA 5EQEA 3RCJA 4DCAA 4EC9A 3ZS5A 1H00A 5TKDA 5EQYA 2CCIA 3UVQA 3F3WA 3OVVA 3MB7A 3RZBA 2W9FB 2VTLA 1DI9A 4OAUC 4XBUA 3I6WA 5CVFA 2ITUA 3O71A 5CZIA 1OZ1A 3MY0A 1H8FA 2C47A 3UZPA 5B0XA 3ZZWA 3Q2JA 3U9NA 1HOWA 2XALA 3C4XA 2WQEA 3WE4A 3F66A 3ATTA 4MD9E 4JS8A 2XIZA 3UDBA 3WZKA 4PDSA 4A07A 4DEHA 2Y4PA 2X2MA 4F9AA 4UX9A 3AC5A 3GU5A 4X0MA 3PG3A 3QUDA 2VTSA 3SA0A 5HQ0A 4G6OA 5C8MA 3FPMA 1ZZLA 4BL1A 3Q60A 3JY9A 4FC0A 3QUEA 5DR2A 3UO5A 4G5JA 3OCGA 4HVGA 4YO4A 3ZUUA 4LOQA 2XS0A 3CTQA 2Q0BA 3UIBA 4R7BA 4D2RA 3AOXA 5IQDA 3PSDA 3AMYA 4L00A 2IVVA 3ODZX 3DJ7A 4CXAA 4D1ZA 1W2DA 3VUKA 3AGMA 1KUTA 1OIYA 4RG0A 4U6RA 3HMNA 4BI2A 3IGGA 3DU8A 3R9NA 1UA2A 3TACA 3FZPA 4NK9A 4GKIA 2B55A 4AA4A 4BF2A 4K18A 5DVRA 2WMRA 5GJDA 4ANNA 3GUBA 2FSOX 1H4LA 4X3JA 3N4VA 3PG1A 2J5FA 3II5A 3KK8A 4O4BB 2OBJA 2XNGA 4RJ7A 3KN6A 4Y73A 5AUZA 1PXOA 4HYSA 4EHZA 3ZO1A 5CF8A 2G15A 4UMQA 4O7VA 1Z5MA 3MIAA 3TNQB 4ANSA 4MXYA 2FSMX 3NLBA 1YOMA 3D5UA 4RFZA 3CE3A 3CGFA 4CSVA 1MRUA 1ST0A 3O2MA 1VJYA 5JFWA 4FT9A 2Y4IB 4OTPA 3I7CA 3SKCA 2HW7A 3OCTA 4ZY6A 2B9HA 2YZAA 2QU6A 4PP9A 3MTLA 3S95A 3VS5A 4I6QA 2Z7LA 3SOCA 3GP0A 4KIKB 3T8OA 3S0OA 3UVRA 4OTGA 4IWPA 5K0KA 2BAQA 5HCZA 3FMNA 3UIMA 3KRJA 4WG3A 2ZJWA 4BIBA 4BBMA 2GNIA 5L2IA 4XOZA 5J87A 4C02A 1JWHA 2HAKA 2RGPA 4FT7A 4DH7A 4PPAA 3RM6A 3U51A 4TYHB 4J8MA 5M08A 5CANA 3SXRA 2HW6A 3DKCA 4XG4A 3VONA 4CLJA 2WO6A 3WF7A 2X0OA 2CMWA 2GS7A 1LR4A 4F9BA 2YZLA 4V01A 1ZYSA 4CRLA 4FEVA 3E7OA 3AT2A 3BU5A 2BPMA 3R21A 1IAHA 3AC2A 4HVHA 3UO6A 2GPHA 1YWNA 4M12A 3FLSA 3GU7A 2ZM1A 3F5PA 4C4FA 4YR8A 4RIYB 1XBAA 3TNPC 4QEBA 4XOYA 5KX8A 3V8SA 2CJMA 3ZFYA 4Q5EA 3D15A 5EW8A 3VQHA 5IA0A 2PU8A 5HU9A 3G0FA 5I3OA 1PJKA 3ENHA 3LJ0A 2Z7QA 2RKUA 1GZNA 1Q8YA 3TUCA 3UIXA 3LCSA 2C6TA 1Q8WA 2X6EA 4ID7A 3RPVA 1Q8TA 4IM0A 5K3YA 2XK4A 3CTHA 4EOKA 3TTIA 3D5WA 2PMIA 3KVXA 3LCKA 3BPRA 5FBNC 5IA2A 5KMIA 5JMSA 5E8VA 4D1XA 3FZ1A 5F4NA 2R3NA 5AMNA 4L53A 2Q83A 1BMKA 4O0XA 5T68A 3IDPA 1ZY4A 2HENA 5B2LA 4DT8A 3QD3A 4FI1A 2A19B 2C4GA 1TZDA 2WMUA 5AP7A 3QTQA 2QURA 4FR4A 3I0OA 2HWOA 3DCVA 4M67A 1GJOA 1YDSE 4E93A 4DT9A 3G33A 2HXQA 1RDQE 2GSFA 4YJVA 5HE1A 5BYZA 3ZFMA 3P0MA 4IHPA 4FKOA 2XAOA 1IAJA 3O7LD 3UYSA 3PUPA 2JKOA 5HNGA 4AGCA 1XH8A 4J52A 3ZCLA 3O8PA 5BVOA 4GK2A 3QRKA 1PXJA 3GFEA 2UZVA 5HVJA 3SXSA 2VTTA 4W4XA 4RZVA 4ZP5A 4C62A 4QP8A 4GU9A 2GQRA 3FLNC 2OWBA 4WG5A 4WA9A 2UV2A 3COKA 3Q53A 4YLLA 5JGAA 4ZY4A 2E9NA 3MY1A 4OTWA 4D9TA 3RALA 5CQWA 1CKJA 2VUWA 2JBPA 4HYUA 4PL3A 5A6OA 3W0PA 3GENA 4FVPA 3FEGA 2E9OA 5CQUA 3SDJA 3UOLA 4Y5QA 4CYJA 1Y8GA 4G1WA 2PUIA 4FYOA 3NYOA 4GMYA 1GIJA 4RFYA 5E91A 2OG8A 3QC9A 3ZRKA 4A9SA 2E9VA 3QL8A 4WNMA 5FXSA 2OIBA 3K54A 5AUUA 3C13A 5AUWA 3HMIA 2KTYA 4L9IA 4FKUA 2IVUA 2B53A 5I4NA 4MNEB 4U41A 3NNWA 3PJ2A 4BDBA 4F08A 3FI2A