4TRLA

Structure of ephrin type-a receptor 2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
277
structure length
268
Chain Sequence
QAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTEVPVAIKTLKGYTKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDPEATTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Ephrin type-A receptor 2
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-A receptor 2
total genus 78
structure length 268
sequence length 277
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4trlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4trlA01
4ZSLA 4E5WA 2H9VA 1XH7A 3OY3A 3OCSA 3WIGA 1U54B 5EOBA 3ZLWA 2W17A 3L9PA 3QYZA 3G9LX 4K9YA 2C1AA 2WMSA 2XK3A 3BU5A 2O3PA 4C4HA 4QMLA 3NYOA 2OJIA 3MV5A 2OLCA 2P2IA 1H00A 1Z5MA 3VUDA 3NWWA 3H10A 3LFDA 4FTUA 4WNMA 4OTRA 2R3QA 5B2LA 2A0CX 4IX3A 3OW4A 3R1QA 4M8TA 4MBJA 4O27B 4IZ7A 3TUBA 4FL2A 5ETAA 2Y8OA 4IANA 5CAVA 2C30A 3GENA 2Q0BA 3FZSA 2W1ZA 4WG4A 4XP0A 3RKBA 3JS2A 2OJ9A 3QL8A 1WBSA 4NSTA 3FEGA 2XK8A 2ZM3A 3LFEA 1MRUA 2Y7JA 3NUNA 4N6ZA 3I79A 1AD5A 4CZUA 3QQKA 4FTJA 4BTFA 4RJ3A 4QP1A 4RIXA 5JQ5A 4J96A 4BCIA 5KX8A 3L9MA 4CMUA 2YCSA 5T3QA 1JKSA 1ZYJA 5EM5A 2V7OA 4Y83A 4IAYA 5HBJA 3ZZEA 2PVLA 3UVQA 5DT4A 5HESA 3VQUA 4DEGA 4DGLC 2EXCX 2X1NA 3PIXA 3T9IA 3LFAA 4YJTA 5F9EA 2C0TA 4A9RA 4OAUC 3ODYX 5L2IA 4UY9A 4EK6A 4RFYA 1X8BA 5IU2A 3TZ8A 2YM6A 3QD0A 5DNRA 4XCUA 3Q3BA 4BYIA 2IO6A 2IVVA 2O2UA 4KB8A 5C8KA 2GQRA 4JNWA 1APME 4UALA 5FP5A 4NYEA 2GS7A 4AX8A 1JNKA 5KMIA 4M3QA 5LMBA 3RNYA 4BDFA 3A2CA 3NDMA 3EFWA 4TT7A 4XMOA 4FV2A 4U0IA 2ITOA 5E8TA 4RC3A 3TCPA 1PMVA 4WA9A 2VN9A 4DBXA 1ZMWA 3TV6A 4LOOA 5TF9A 2QI8A 4XEYA 5IZFA 3A62A 3KQ7A 4PNKA 3SD0A 4I0TA 3POZA 5JRSA 4AZTA 2PYWA 2B52A 3FZRA 3BYSA 4JBVA 1J7LA 2YERA 4B9DA 4Q9SA 4I0SA 1MQ4A 1Q97A 3AC2A 4RQKA 2BRGA 4ANSA 4IM3A 4C4JA 4L00A 4FKOA 4TYGA 4LV5A 5G6VA 4ALWA 4ACDA 3PPZA 1OKWA 3P1AA 3IS5A 3JVRA 1Q41A 2X7GA 3NS9A 3PY1A 1W8CA 4TNBA 5L2QA 4EOPA 4UN0C 3GC9A 3P4KA 2C6KA 5IISA 3HDNA 4TKSA 2RIOA 3D15A 5IQCA 3OTVA 4YJPA 4D0XA 4W4XA 1L3RE 1ZLTA 3W33A 4FVPA 3KC3A 2B53A 1Q3WA 5CU2A 3DQWA 3EL8A 4LGGA 4O7LA 4BFMA 2W5HA 5M07A 4BR3A 3SKCA 2JGZA 2WTVA 5IQEA 2W1IA 3AC4A 3W2PA 4IC8A 2YCQA 3CJGA 3COKA 3MVJA 4B7TA 4FKGA 5BUEA 3RAWA 2PVYA 3MH3A 2PTKA 2R5TA 4QYEA 4WRGA 5GJGA 4EWQA 1Y8YA 3PY3A 5CT7A 4MXAA 5AR8A 5DVRA 2ZV2A 2WQEA 3PXFA 4AA5A 3E8NA 3MA6A 2X2KA 5JGDA 2I0YA 3BHHA 3D7TB 5AV3A 1J1BA 3UJGA 4GFGA 2PUPA 2RSVA 3QZFA 1ND4A 3NW5A 4GMYA 5KKRB 4MBLA 5M53A 5KMOA 3C4CA 1CKPA 4XG7A 5LVLA 4BTKA 2R0IA 4S2ZA 3CC6A 5HKMA 2XH5A 4AQCA 2JITA 4D2VA 2SRCA 5IUIA 2UW9A 4FEWA 4F70A 4QYHA 4O2ZA 4MXOA 4ASZA 4BCMA 2KULA 1BUHA 2W05A 4IX5A 3E8DA 3NIZA 3W2OA 4KSPA 2OIDA 4HPUE 4AOIA 1XH9A 3AOXA 4D28A 4WG5A 1OBDA 3KL8A 4CRSA 1L8TA 2G01A 4ZP5A 3VAPA 1BI7A 4ZZNA 4YLKA 1V0PA 3COMA 4PPCA 1XWSA 1K2PA 4JIAA 4XYFA 3MYGA 3RWPA 3VUGA 4QMNA 4YZBA 2QKWB 4FEQA 3AT2A 2G15A 3OF0A 4GSBA 3OMVA 4FSNA 1H1WA 2BHHA 2WTJA 4KRCA 2VO6A 4BI2A 3AMBA 1G8SA 4NKAA 4ENYA 4EOOA 3FUPA 3RPYA 4AS0A 5BVWA 4FTRA 4RIWA 5K3YA 3NGAA 4XBUA 2P55A 2EUFB 3DKGA 5M55A 5H2UA 4U8ZA 3VW8A 5IMEA 4CV9A 4EBVA 2YDJA 4ZXTA 4CSVA 4E4LA 2C6DA 3HEGA 3NYXA 4QYFA 2QVSE 3C4XA 5EQPA 4X6RA 5CXZA 2CGWA 4DAWA 4XLIA 3D83A 2BTRA 4BDJA 3C0GA 3Q9XA 4HYHA 3MFTA 2C5NA 4BIBA 1B38A 4O2PA 5DH3A 3VULA 3P7BA 5CQWA 2XKDA 3BGQA 2ITWA 4D58A 5KMLA 4YZDA 3ZC6A 4QP6A 4DE4A 1KE7A 2WKMA 3R01A 4RJ7A 3UIUA 3H9OA 3PJ3A 3R2BA 4FVQA 4JOAA 4KWPA 3R7IA 1OL1A 4LMUA 2R0UA 3MSSA 2QG5A 3DK7A 1GZOA 2JDOA 4F63A 5FG8A 1YDRE 2OICA 4PL3A 4JDIA 5GJDA 2OFUA 5D1JA 1OB3A 3A7JA 4PMSA 4F7NA 3K54A 4GIHA 3E87A 3UYTA 1H0WA 2V0DA 3PPKA 3FZPA 3VUHA 3QTZA 1NA7A 4CVAA 3G15A 5BNJA 3F88A 4QMUA 3Q6UA 4MWIA 4PPAA 2BFXA 3ORZA 4MH7A 3C13A 2BZHB 4G3EA 3ZBXA 4IJ9A 2OGVA 3UOJA 3PVBA 3LFSA 3DAKA 3DJ6A 4NU1A 5HU9A 2WOUA 1HOWA 2O65A 3Q9ZA 2Y6MA 3BYOA 3QGYA 5HIEA 1G8AA 3TACA 5AV0A 2R7IA 4B8LA 1ZAOA 1GIIA 3ZCLA 4CCBA 3V8WA 5ACBC 5HE1A 4M66A 2BAKA 5TKDA 3UP7A 3R8UA 5CF6A 4RA5A 2J0JA 2W4OA 2YM8A 4XRJA 3FMHA 2HZNA 3ZU7A 1R39A 2B4SB 4WD5A 4EJ7A 3ZM4A 2FH9A 2GU8A 3O8UA 3KEXA 4PX6A 3LLAA 3ANRA 2JFMA 4WNOA 1E1VA 4AOJA 2RFNA 4I4FA 4MQ1A 5LARA 4H3QA 1YI3A 4WNPA 3VS7A 3W2QA 5HD7A 3LKMA 3QD4A 5I5ZA 4CRLA 1TQIA 5I0BA 3MY0A 1ZZLA 4TTHB 3OXIA 5A9UA 4JBQA 4IWOA 3R28A 3C4FA 4D5KA 4C3RA 4AN3A 5IQIA 4FTQA 1U4DA 1YRPA 2BDJA 4ITIA 4YBJA 1KV1A 3BV3A 2IJMA 4IB3A 3QZIA 2REIA 5JK3A 4PRJA 3NNXA 3QTQA 1Y8GA 2BIYA 5AV1A 1SM2A 3MH2A 1H27A 3SAYA 1REKA 5M4CA 3MB6A 3VC4A 4GV1A 3FKOA 2QR8A 4UX9A 3KCKA 2UW8A 2YJSA 2X8IA 2Z02A 1ZY5A 4ZSEA 3OS3A 4EEVA 1XO2B 5EM7A 2VTMA 2CHLA 3LHJA 3MIAA 3SXSA 5GZ8A 2VTLA 5AX9A 3TIZA 4RSSA 4AW0A 3HUBA 4FOBA 3AC3A 4RJ6A 5CT0A 5HBEA 5KHWA 4EH5A 3HUCA 3FBVA 5K5NA 1RQQA 5AP0A 1Q8TA 4M97A 1R0EA 3AD4A 3IK3A 1PKDA 4LRJA 5CXHA 4DYMA 2WELA 3K3JA 3OCBA 4FOCA 4U97A 4C2WA 5CY3A 3MTFA 5D12A 4JDHA 3HMNA 4QD6A 5LWNA 4IIRA 2FO0A 3CY2A 4PV0A 1VR2A 2B54A 2XK7A 4FGBA 4Z9LA 4KINA 4FT7A 3U8WA 2PMLX 1SNXA 4G5PA 5CWZA 3BCEA 5A6OA 4AZWA 5AM6A 3GCSA 3GU5A 3FPMA 4BYJA 5DLSA 5IUHA 3WARA 4BRXA 2XIZA 5L8LA 3VWAA 2UZBA 4G31A 1P4OA 3LAUA 4U45A 1M17A 5CSWA 1M2PA 5IF1A 1ZYCA 4FT0A 3NVKI 4LGDA 5KMKA 5J1WA 1FPUA 3KK9A 2JIUA 5I9WA 3EZRA 3KB7A 4FTKA 3FLYA 2ERKA 4D1SA 3DT1A 3FLWA 2FSMX 1OZ1A 1TQPA 3R30A 4F6UA 1A9UA 3LM0A 4JBPA 2IZUA 2C6EA 2WD1A 5K4JA 4PMTA 4WSQA 3NIEA 3Q5IA 3OP5A 4QNAA 3NUUA 3ROYA 4TWNA 4J95A 3PXYA 4AGUA 4E6CA 3NYNA 3Q5ZA 4NW5A 1NVRA 5JGAA 4MXYA 4N0SA 3WYYA 4R78A 3R7UA 4QTAA 4A9YA 4YZNA 4EQCA 3SG8A 2CKEA 3EMGA 3UO4A 3ZH8A 3BV2A 4CZYB 2Z60A 4YU2A 4H36A 4UMTA 3R9RA 3ACKA 4RFMA 3QWJA 3HZTA 3ZEWA 3A7IA 3V8SA 4MF0A 4HYIA 4FV4A 4FIIA 3LJ0A 2WMRA 3FL4A 1IAHA 1PF8A 1U5QA 3PWDA 2NNWB 3PIYA 3KMUA 5I3OA 3FSFA 5DN3A 2W0JA 1XKKA 1OPJA 3MH1A 5E8UA 4BKJA 4QTCA 4W8DA 4M69B 2PWLA 1XHAA 5TE0A 1WBTA 4EK8A 5T68A 4XG4A 4YTIA 2B9IA 3R63A 5BYZA 2ZB1A 3E88A 3ZHPC 2BR1A 2PE2A 2XNPA 3FLQA 3KVWA 4RX9A 3VUKA 4EC8A 5HTIA 2YWVA 4MEDA 4XHKB 3KCFA 4UWBA 3ZLSA 4ZTMA 4IVBA 3R1YA 4MHAA 1JKLA 3WILA 3ZDIA 3QLFA 3I7CA 4MK0A 2XK6A 2OKRA 1OIRA 3AMYA 3DNEA 3HKOA 2CLXA 1ZRZA 3I6UA 1Q99A 1YHVA 4J8NA 4GG7A 4PMPA 4QMSA 2VTAA 2ZJWA 1TQMA 2WMAA 3FC1X 3LXPA 4QP7A 1MUOA 4ZSAA 2PUIA 1Y91A 1AGWA 3OZ6A 3G33A 4FC0A 3ZOSA 4USDA 3UQCA 2H96A 4PMMA 4H39A 1YHSA 3PYYA 4M0ZA 2Y4IB 2OJJA 4H05A 2ZV7A 4NKSA 3TZMA 4A9SA 4HNFA 2BZJA 4YTCA 4X7QA 3HYHA 3WE8A 3RHKA 4ANBA 1Q4LA 4NZWB 2WQBA 3G51A 5A4LA 1KUTA 4HYUA 4U6RA 1G5SA 5A54A 3AT3A 4K0YA 3KULB 4CMOA 3ZFXA 2CKQA 2V7AA 5HG9A 1SVGA 1XR1A 2IPXA 1XH4A 4FA2A 2E9UA 2OG8A 3FYJX 4C34A 1ZZ2A 4KKEA 5TO8A 1WZYA 3A8XA 1JKTA 2GHMA 2R3PA 4YSJA 5J9LA 5HU3A 1RDQE 2Y4PA 1VYWA 4OTWA 4I21A 5ANJA 4KKHA 4DF3A 1J1CA 2FA2A 2XUUA 3Q52A 5CANA 4F1MA 3I4BA 5IQGA 2ETRA 3QUEA 5EYKA 3ZSHA 3HMPA 4IM2A 5JZJA 3PXRA 3HMMA 2W1HA 3R8MA 3BPRA 2JDVA 3RP9A 5FDPA 3OWPA 3LZBA 4TPTA 4EHZA 4FSUA 5AA8A 5M06A 2C47A 3E62A 4Y73A 5EM6A 5CEMA 5CF8A 3F5GA 4GYGA 4LL5A 3F9NA 3I0QA 2QCSA 3PLSA 3ZBFA 5EKNA 2BDWA 3HP5A 4S30A 4XP3A 4A4XA 4DH8A 4XLVA 2E9OA 3A61A 3H0YA 2IWIA 5FXRA 3DAJA 3D94A 2UW3A 1YXXA 2QKRA 3TV4A 2DQ7X 1UU3A 2VTSA 3DDPA 3F7ZA 4MVFA 4FIEA 4FNXA 2LAVA 3ZLXA 1H28A 4EH6A 3NLBA 5FLFA 4XRLA 3S3IA 3QD2B 4TYIA 3I5ZA 2QOCA 4FKQA 4YZ9A 5M51A 3LFFA 1GZNA 3BE2A 5L4QA 3PPJA 4UV0A 3E3PA 4JDJA 5EKOA 3QD3A 5KHXA 3TDWA 2QURA 2JIVA 4W9XA 4HVDA 5AUTA 3QX2A 4XG6A 4IX6A 3CE3A 1UU8A 4TWOA 1XH6A 2C6IA 3H3CA 1K9AA 4O21A 5DI1A 5ACKA 3RAIA 5FP6A 3KN5A 3P9JA 3UZTA 1Q24A 2CKPA 4GKHA 3FQHA 4FZ7A 3D7ZA 4CTBA 5EDRA 2YDKA 5C27A 4D5HA 3SG9A 4IB0A 3DS6A 2GNHA 3MY5A 5BX0A 3EB0A 3EN5A 3KULA 5FXSA 3R6XA 3LQ5A 3P7CA 2VNYA 4OAVB 4AT4A 5M4IA 4AFJA 2VX3A 3P23A 2BKKA 4ZS4A 3T3UA 1WMKA 3V5JA 3IDBA 3PP0A 4QO9A 3AC5A 3UG1A 1JSTA 4K33A 1W7HA 3CCNA 3NMUF 4EBWA 1YQJA 2I0HA 3R73A 4RIOA 4JRNA 3I1AA 3GBZA 3IQ7A 3QFVA 4I4EA 4IHPA 3QQLA 5H3QA 2E9PA 3VO3A 1FINA 1DAYA 1Q62A 1H01A 5CNOA 5EYMA 3QCXA 1STCE 4FKWA 2QU6A 4GFOA 3QX4A 3ZXTA 5HIDA 4P90A 5J9ZA 2X2LA 4A7CA 3S0OA 2EVAA 4E5AX 2YIYA 2OH4A 4ANQA 3GC8A 3QF9A 1OL7A 3U55A 4U81A 3OBJA 3MFRA 3D4QA 5I9VA 5ETIA 3QBNA 3LCDA 1UNHA 1FVRA 2I40A 1H08A 4PL5A 4R5YA 4U79A 5M57A 2CPKE 1T45A 3GQLA 4DGOA 4FX3A 5IA2A 4GKIA 4M15A 3DB6A 1WAKA 4RWJA 3JR1A 5F1ZA 4JG6A 2E9NA 5DMZA 2WZJA 3UNZA 5C1QB 4L45A 4KBKA 2YJRA 2CGXA 4LV8A 1UKHA 3RPVA 4EC9A 2HW7A 5CU6A 4FTAA 3BLHA 1OKZA 3ENMA 3OROA 3OXTA 4FL3A 4G17A 3ZRLA 4E73A 4UMPA 1V1KA 3MVMA 4J1RA 3FY2A 4AE6A 4D1ZA 4F99A 4AW1A 1YDTE 2XNBA 4RX8A 5CAOA 3D5XA 2YACA 3BBTB 4FF8A 4WUNA 3CGFA 4AXAA 3V01A 1QCFA 1NY3A 2J7TA 3NAYA 4LFIA 1UNLA 4E20A 2R3HA 5AP5A 1YXSA 4I3ZA 5D7AA 3MA3A 3LM5A 3UZPA 4DITA 5LCJA 3IGOA 4I5MA 2WTCA 2C3KA 3LPBA 5J87A 5JGBA 4F0FA 2BHEA 1HCLA 3F82A 4FZFB 3R8LA 4K18A 5KO1A 4BY9E 1Q8ZA 3UOKA 5DRBA 5AR3A 3UQGA 3KREA 3KFAA 2YEXA 3QWKA 3W1FA 4DCAA 3MTLA 3KMWA 3EQIA 4RIYA 2PMIA 5L2TA 4MAOA 3VBQA 5E1SA 2VO0A 4F7LA 5CEQA 3PVUA 3NUSA 1PMUA 4QP9A 3C5IA 1TVOA 4M69A 3BGZA 4Y95A 3GUBA 5AAEA 1F0QA 2VAGA 4TYEA 3RVGA 4TY1A 3UC4A 4C0TA 4ZY4A 3UPZA 1IEPA 2UZOA 3O0GA 3M1SA 3ORIA 5E8XA 5ETFA 4W9WA 4MTAA 2OXDA 3KA0A 4QTDA 4ZTHA 3RK7A 5E8YA 3TNQB 3VUIA 4LGHA 4BDHA 5HE3A 3OT8A 4ID7A 5IQDA 1H1RA 3OBGA 3FLNC 3QC4A 2BKZA 3EQGA 3QUPA 4IZYA 4G3CA 4GK4A 4UEUA 4AZEA 2B9JA 4G6LA 4JDKA 2OZAA 3SDJA 4DLJA 3CPBA 3T9TA 4DEBA 3SA0A 3ID6C 5H8BA 3EQBA 3Q53A 5DPVA 3WF8A 5AR7A 5HNIX 1PXMA 4PPBA 4FKVA 2WGJA 5A46A 4O22A 5L6PA 3OUNB 3UP2A 2GHGA 4XH6A 3UMWA 2X81A 1OKVA 3GXLA 2XK4A 3FKLA 4ONAA 5EDPA 3LQ3A 3TNPC 5EI8A 3V5QA 4MX9A 4O1PA 1CM8A 3SOCA 3AG9A 4L52A 4V05A 1ZYDA 3VS0A 5HD4A 1O6LA 2EB3A 2WB8A 5LVNA 3S00A 3GVUA 3K5VA 4AW2A 4JG8A 3QKKA 2WHBA 4MNFA 3GU7A 3ULIA 4GEOA 4X2FA 2P33A 4YTHA 4O0VA 5FM2A 3FPQA 3LCKA 4GJ2A 4FSTA 4DEEA 1R0PA 2PZPA 4FSWA 2GTNA 3VJNA 5BVKA 5A4EA 2F9GA 4BDDA 3F69A 4ASEA 5CZIA 1ATPE 3GEQA 4UMRA 3KRWA 4EOSA 2YAKA 2JBPA 3E93A 3CD3A 4HCTA 1U46A 3ZMMA 4R3RA 2RGPA 3FMEA 3EN4A 3GOPA 4L46A 4WIHA 3F66A 2IZRA 2XIKA 2WMQA 2VNWA 4S34A 3NVMB 4JQEA 4ALVA 4FSQA 1PKGA 4CFWA 5CI7A 4WT6A 4C33A 4BCKA 3SVVA 1LUFA 3R7OA 2OXYA 2IVUA 2GS6A 4BZDA 4O82A 4FG9A 4U7ZA 1ZOHA 3OVVA 4DFNA 5C4KA 4L6QA 3LCOA 3MPAA 2P3GX 3RTPA 3PIZA 4OBQA 3TJCA 4DFXE 4XBRA 4FUXA 1H24A 4O7YA 2J0MB 2XB7A 3QRJA 4NH1A 4F65A 3E7VA 3U4UA 4G6NA 4ZJVA 4CFNA 2JKKA 2G9XA 1FGIA 3BHTA 2VUWA 3JUHA 4OGRA 2AUHA 2J5EA 3QTIA 2I1MA 1QL6A 1OL5A 4NJDA 5HBHA 3KGAA 4BL1A 4G6OA 4AAAA 3CSVA 5EYDA 4UWCA 3FAAA 3EN6A 4TW9A 1JKKA 3BIZA 3IGGA 5DEWA 2UZNA 2NRUA 3S95A 4HYSA 4IBMA 4CCUA 2CNQA 2W7XA 3PWYA 4YLJA 2WNTA 2W9FB 3AD6A 1JSVA 3DZOA 3MN3A 2VO3A 4RJ5A 2BIKB 3AC1A 3QKLA 4ZTQA 5J95A 4BKYA 3PA5A 2CNUA 4Z7HA 2R7BA 4I22A 1YWVA 4JS8A 2PHKA 4RT7A 4HGSA 1W82A 3BRBA 1KOBA 4ARKA 2J5FA 3TTJA 4C4GA 3JVSA 4EOQA 3BZ3A 4IZAA 4CFFA 3FLSA 4L53A 5M56A 3DFCB 2XMYA 4CYIA 2C0OA 1I44A 4AFEA 3F6XA 5I9ZA 4RIYB 4LOPA 4O91A 5BVDA 1OBGA 4PTEA 2RL5A 4L01A 4EWHA 1RJBA 2AYPA 1PYEA 3L9LA 3D5UA 3FZTA 2Y0AA 3CEKA 2GPHA 4IVDA 3I5NA 3FMNA 2QOLA 5CEOA 4XUFA 4WHZA 4TYHB 4ZLZA 4FICA 2GNLA 3QQHA 3VBXA 4JT3A 4W4YA 4QP2A 4NTSA 4RBLA 5CU0A 2YZAA 3P86A 5EG3A 5H9BA 1JPAA 3S1HA 2P0CA 4MF1A 3PE1A 3WF9A 3Q4TA 4DG2E 2JDSA 2FGIA 3Q9YA 4XV2A 5GHVA 2XKEA 4MWHA 5EI2A 4O7VA 2PULA 4F9YA 3DXQA 2AC5A 4GRBA 4I0RA 4V01A 3RAKA 3ZS5A 5CU4A 3FI8A 4R77A 5CENA 4GCJA 4DH7A 4TYHA 2QG7A 1FOTA 3OEFX 3O8PA 4GK2A 4C58A 3Q4CA 4FZAB 2ITNA 4A07A 4USEA 4QPAA 2J50A 2UZUE 3FQSA 1PXPA 3H9FA 3R21A 4R1VA 4BIDA 5JSMA 2RFSA 4I1ZA 4HNIA 1OKYA 2W06A 2WMBA 3PZEA 4CKIA 2XM9A 1OL2A 3TKHA 3VBWA 5ICPA 3U54A 3KXMA 2HK5A 2JC6A 2W4KA 5HIBA 1ERKA 3EQHA 4N6YA 4X3FC 5AP7A 4L9IA 3LXLA 5AR5A 3ZSIA 4XS2A 2XYNA 3KF7A 4L3LA 5FWKK 4XNEA 5KE0A 2C5XA 4YJQA 3GCUA 5HICA 3D5VA 5ANDA 3V5PA 2VTRA 4QYGA 3GQIA 5FM3A 4IWPA 3ZZWA 2OFVA 3CD8A 4H58A 2UZTA 1JWHA 2C3LA 1LP4A 3VN9A 4BF2A 3MVLA 3ZYAA 1PYXA 2O64A 3C7QA 4O84A 2Y9QA 4YZMA 3MJ2A 2QODA 5E9EA 1PXNA 3RPSA 1CMKE 4IFCA 3GP0A 1OGUA 5CX9A 4FIGA 1SVEA 3QXOA 4JR7A 4PDPA 4W4VA 4C59A 4CEGA 5JFWA 4O81A 4EKLA 5DWRA 1JAMA 3TJDA 4I6HA 1CKIA 2BAJA 2XZSA 3FMLA 5K0XA 3ZUUA 4L7FA 4XV1A 4O38A 3E63A 4U41A 3UTOA 3ZO2A 2HY0A 3DBDA 2GNFA 1DM2A 5DIAA 5K0KA 5JFVA 3NX8A 4NTTA 2X7FA 1WFCA 2QR7A 4J98A 4C61A 5CQUA 4PL4A 4RQVA 2OXXA 4XOZA 1NXKA 4LMNA 5KZIA 2GNIA 3D9VA 1XBAA 4E6QA 5CF5A 4DA5A 1JLUE 3WYXA 4D2TA 3R00A 5L6OA 1BMKA 3E92A 2A2AA 1GOLA 4RC4A 5E91A 5EW3A 4O6EA 2XJ2A 1W84A 2HXLA 4C02A 3D2IA 4NL0A 4JQ8A 5JFXA 2Z2WA 4LUEA 3AMAA 1URWA 3R7VA 2VWWA 3ORXA 3EQFA 4IVCA 4UXQA 5IKWA 5IEVA 4BDEA 3D7TA 3FKNA 4RVMA 3QKMA 3NRMA 4IE9A 4O6LA 5AJQA 5J8IA 5L2WA 2UZLA 3MH0A 2AC3A 2IW8A 4F4PA 4C4IA 3K2LA 3V5TA 4CFXA 3HNGA 4XV9A 3FWQA 1Q5KA 3M2WA 4JJRA 4AUAA 2BAQA 3BU3A 3GOKA 3RMFA 2PUNA 3REPA 3Q6WA 4AT3A 4BCPA 4CXAA 3DJ7A 2YAAA 2ACXA 4Q2AA 3DBEA 3DNDA 2ZAZA 2QOKA 4IVAA 4F1OA 3LMIA 1KWPA 3S4QA 3VUTA 5ANIA 3ZFMA 5D41A 4IZ5A 4C3PA 2W1CA 2CN8A 3SXFA 3JY9A 3CP9A 3U6IA 1PRYA 1OECA 4D4SA 4N4SA 5HCXA 4D55A 4P4CA 1WBPA 2XNEA 4U43A 4PDSA 2J0LA 2UW4A 2BUJA 2J90A 4AP7A 2OIBA 4S32A 1I09A 2C69A 1Q8WA 2VWYA 3EN9A 4FV1A 3PRFA 4RC2A 5L2SA 4FYOA 2WMWA 3BWFA 4FYNA 4IEBA 3EQDA 3P78A 2JEDA 3NR9A 1LEZA 3ET7A 1UA2A 3DLZA 4Y8DA 3UBDA 4QMXA 2PUUA 3VBTA 4I5CA 3TT0A 4R3PA 2HWOA 2OWBA 3VBVA 3OOGA 2BRNA 4CT1A 2PVKA 4F0GA 4MCVA 5HLWA 5HO7A 3EHAA 3A99A 3N51A 1YKRA 3O51A 2XNOA 2HAKA 4MXCA 4G34A 2OI4X 3VQHA 3ZM9A 5HNBA 4IMYA 5DFPA 2QQ7A 4FIHA 4A9TA 3UZRA 2H8HA 3LFCA 2OJFE 4BCJA 4CG9A 4DEAA 5BQ0A 2ITTA 5ANGA 3QGWA 5TR6A 4RJ4A 4AGWA 1OIQA 3IDCA 4EHEA 4RJ8A 4EOMA 2VX1A 2P2HA 5FDXA 1JOWB 2HW6A 2X7OA 2VX0A 2C3IB 5M08A 3WF7A 4ANMA 4C36A 3VF9A 3II5A 5CNNA 2XIXA 3EOCA 4ERWA 2OSCA 1H1SA 5FRIA 3TI1A 2UUEA 4HGLA 4AF3A 2X39A 4CFUA 4CYJA 3LCTA 3ORLA 4EI4A 4QQ5A 5LWMA 5AWMA 5BUIA 2PVHA 3F2AA 4BGHA 4TYJA 3FYKX 4USFA 3PJ1A 3D14A 3SC1A 4ZLOA 2VWVA 4IAZA 4D9UA 2PVJA 4EONA 4KRDA 4LI5A 4YZCA 3H0ZA 3FLZA 2Z7SA 3WZUA 3ZLYA 5J79A 4HCVA 4ACGA 4XJ0A 5ANOA 4II5A 4LYNA 3DK3A 3TM0A 3IOKA 4QPMA 2O5KA 4OR5A 4QP3A 3IECA 2W1DA 3OEZA 5K9IA 4ERKA 3GC7A 5I3RA 2JKMA 4FT3A 1LEWA 4R6VA 4TWCA 4C2VA 4FE2A 3CGOA 2PZYA 5A6NA 2IW9A 4F9BA 4WUAA 1KOAA 4E5BA 4JAJA 4C38A 2YLFA 3TNIA 2E9VA 2B55A 3ZO1A 5EHLA 3TXOA 4EHVA 3ZO3A 3IW4A 3TNHA 1U54A 4BDIA 3TWJA 4EHGA 4W8EA 5GZ9A 4J7BA 3P79A 5LMAA 5IMXA 5HG5A 2WMXA 1NW1A 3V5LA 3FHIA 3FXXA 3CKWA 3QZGA 4ACHA 3ODZX 3JYAA 4RZVA 2XS0A 3OCTA 2P4IA 4QMZA 3QQJA 2NP8A 3OT3A 4RWKA 5IH4A 1YOMA 2B9HA 3LW0A 4AG8A 4U44A 3E8CA 3ENHA 3W16A 4DEIA 5CAPA 5DYJA 1YXVA 4DFBA 4BZNA 4YUQA 4OTPA 2PK9A 4AOTA 5JEBA 1P4FA 2R3MA 3KF4A 4F7SA 4FUYA 2NPQA 4UYAA 4QMTA 3L9NA 2X6EA 4IXPA 5E8VA 3PVGA 5I4NA 4NCTC 1OIUA 1WBOA 1UVRA 3NNWA 1DI9A 4H1JA 4TXCA 2RFDA 3KMMA 3RM6A 3DKFA 1UV5A 2XIRA 3CLYA 4ANNA 1MQBA 4EOJA 3R1SA 4FV8A 2WQOA 4KIKA 3RZBA 2CNVA 2W1GA 4M84A 3UC3A 3BYMA 2Z7QA 4LUDA 3SXRA 1JBPE 5CAUA 1VZOA 1SNUA 2YCRA 4FG7A 4H3BA 4OBOA 5AP6A 1A48A 4FL1A 3C9WA 1YI4A 4QQCA 3ALNA 2R4BA 1PMNA 2XCKA 2PZRA 2CMWA 3QRUA 2VGPA 4P2KA 4FT9A 1OIYA 2WMUA 4LRKA 4XV3A 4I6BA 4TN6A 5CVGA 2VTNA 3GFEA 3C51A 3UO6A 5EFQA 4BWPA 2BZKB 4KIQA 2GTMA 4FTNA 5HNGA 3RCDA 2IW6A 3C4WA 4DFYA 4DH5A 2GHLA 2J9MA 2UW6A 4GH2A 4YR8A 2CKOA 2NO3A 1MRYA 4FBXA 3ROCA 1H1PA 5TOZA 2DYLA 5AIRA 2YISA 5JT2A 1BL6A 1UWJA 1WVWA 3P08A 3VS1A 3K3IA 3A4PA 2I7QA 4YJVA 5M09A 4D0WA 4BCQA 2XBAA 4QT1A 5ANKA 2C5OA 3EQPA 2EXEA 3C1XA 4FSZA 4IH8A 4MQ2A 4BC6A 3TUCA 5AR4A 2J51A 3W10A 5LOHA 1T46A 4ZJJA 3QC9A 4JLCA 5CI6A 5IA0A 1E9HA 3DCVA 4FI1A 4G2FA 4WOVA 4QMPA 4RA4A 4EUUA 1YDSE 4FTMA 3BX5A 4QP8A 5C01A 3ZDUA 3NCZA 3ZUTA 4QTEA 3DJ5A 4JXFA 5CLPA 2QC6A 1DS5A 4WG3A 3BELA 5CSVA 3LVPA 5EM8A 4RX7A 4DFUA 3BLQA 2C5YA 3PFQA 5CSPA 3R8VA 4C35A 3LXKA 1EH4A 1H8FA 2QOFA 2UVZA 4AW5A 5A4TA 4UMUA 2XNNA 3RGFA 2QHMA 4FKSA 5DGZA 1KSWA 4FTIA 2W4JA 4YC6A 2X6DA 2CGUA 5KBRA 3NNUA 4FV5A 4NCTA 3SQQA 5BYYA 3LQ8A 5EH0A 3R9HA 4X2KA 3PZHA 5EHOA 4EJNA 4IQ6A 4JVGA 4R3CA 3O8TA 2WFYA 5B0XA 4HPTE 2VWBA 3HA6A 4MKCA 2XKFA 4OTGA 5EHYA 2QO2A 5GJFA 1JSUA 2BILB 3HX4A 3MB7A 4BDKA 3FMJA 3GB2A 2VWZA 4RZWA 3PLAE 5HTCA 4O7ZA 4KIKB 3NUXA 2XM8A 3HV4A 3GCPA 1YWNA 3SW4A 4GFMA 4BB4A 3VBYA 3G5DA 3QXPA 3Q60A 4ZMEA 5HOAA 2GNJA 2V55A 4LL0A 3ORPA 4QMYA 3KRXA 4JX3A 1PXKA 4C4FA 5LQFA 2IVTA 1Y57A 2VTPA 3EZVA 2ZV8A 3RJCA 5DRDA 4KBCA 4XG8A 2PY3A 5IQHA 3CXWA 4P5ZA 2R3KA 2WTIA 4PTGA 4RRVA 3ORMA 3PA4A 3RALA 3Q2JA 2VRXA 4F09A 4O7WA 3Q4UA 2JLDA 2HZIA 4FV9A 4KA3A 3SX9A 4ACMA 4CMTA 4DTAA 1FVTA 3IW7A 3RI1A 5A14A 4IC7A 3L8XA 4H3PA 3OUKA 2FYSA 5HQ0A 3JXWA 5HCYA 3R8PA 2V62A 4DH3A 2R3LA 4NEUA 4ZTSA 4EH3A 3V04A 4FKLA 4UBAA 4O0UA 4MXXA 1O9UA 4WSYA 1SMHA 4EK5A 1UNGA 2VGOA 1U59A 2R3NA 3LFNA 3PE2A 4G9CA 4ENXA 1IG1A 2HIWA 4HOKA 4QNYA 2XKCA 5HO6A 1REJA 3B2WA 4CT2A 3FI2A 4I6QA 2C4GA 3BEGA 3Q04A 4L44A 3DV3A 4I41A 5FTOA 4R5SA 3F5XA 4QMMA 2JIIA 3OWKA 2HYYA 4QMWA 5HI2A 5CASA 4J71A 4RGJA 5I9XA 3DPKA 3TZ9A 4I20A 1FMOE 2JDTA 4AGCA 3POOA 3WIKA 1M52A 3TEIA 3HECA 5AUWA 3BQCA 3ZRKA 2X9FA 4EYMA 5KMNA 3GI3A 3F7WA 2QOBA 4FODA 2YABA 3UE4A 3UOLA 2EU9A 5AUXA 4GG5A 4O0RA 5E8WA 3Q9WA 3TUDA 3RBWA 3ELJA 1URCA 1GIHA 4NUSA 4BICA 4FGRA 4IWDA 4UXLA 2XYUA 4ZK5A 4IAKA 3RWQA 1XBCA 2B7AA 1JVPP 3DQXA 3CTHA 3H9RA 3OY1A 4GL9A 3VF8A 3ZRMA 2GDOA 2YM3A 3GU4A 3EL7A 4JX7A 5DBXA 4LRMA 4EZ7A 3U6JA 3L8VA 4M12A 4YNEA 4A06A 1FBNA 2YM7A 3AC8A 5DT0A 5AR2A 2UZDA 4U42A 5J1VA 4FEUA 4YBKA 3A60A 2ITUA 3E5AA 3F5PA 4EYJA 1Y6BA 3ATSA 4O83A 4ZTNA 4EUTA 1ZYLA 3PG1A 3EQRA 4L3PA 3R71A 4M14A 5HO8A 3ULZA 2OF2A 4BN1A 3AT4A 1W98A 4Y72A 3QTRA 3SRVA 1DAWA 2YN8A 1P5EA 4FEXA 2IZTA 4ITJA 1UU9A 5LVPA 3EJ1A 3N4UA 1IASA 1KE6A 3N4TA 3G6HA 4GW8A 3FHRA 4NIFA 3M11A 4D2SA 3DBFA 3DU8A 5LMKA 2GMXA 4Y85A 3S2PA 1QPCA 3RM7A 4BCNA 4L8MA 2I6LA 4O1OA 1CSNA 1ZY4A 2C6OA 3M42A 3BKBA 4AZVA 1P14A 2QOHA 2CLQA 3EIDA 1ZYSA 3I7BA 4NFMA 3W2RA 3R8ZA 3DB8A 3ETAA 3IW8A 4C8BA 2WIPA 2WPAA 5CSHA 4FSRA 3OCGA 3LCSA 4G1WA 4E4XA 4EH7A 3GCVA 3R0TA 2CDZA 3UDBA 2YZLA 5GINE 4AWIA 1A06A 2A4LA 4FV0A 2UZWE 4IDVA 2UZVA 4O96A 4KIPA 4AZSA 3KKVA 3BBWA 3KRJA 3MW1A 4DC2A 3BHYA 4IAIA 4E4NA 4MNEB 5L6WL 4BBFA 4K6ZA 4LQMA 4FKIA 4K77A 3V8TA 4I92A 5IA4A 5EQEA 3VRZA 3D2KA 3F3VA 2HY81 3DGKA 3WI6A 3HMOA 4LOQA 3RINA 4BHZA 4BIEA 4D4YA 2QLQA 3OTUA 4FSYA 3GGFA 4CZTA 2WQNA 3MDYA 5DR2A 4AACA 3FZ1A 3PJCA 3KRRA 5G1XA 2X8EA 2CSNA 4KSQA 1H4LA 3C0IA 3UOHA 5AX3A 4E26A 1YVJA 4ACCA 5AP1A 5LCKA 2NRYA 2ONLC 4I5PA 2BRMA 2YDIA 4ZJIA 4O0XA 2OF4A 4YTFA 3IW6A 5FUTA 2J0IA 4X2NA 3O17A 5FXQA 3TZ7A 2IZSA 2GCDA 3CJFA 5CU3A 4AZFA 4ZIMA 4OT6A 1YI6A 2LGCA 1H1QA 3VS6A 3HDMA 3VS2A 1PXIA 2YA9A 2DWBA 3MPMA 3FXWA 5HGIA 2Z8CA 3SRVB 2ZYBA 3P5KA 2QLUA 4ALUA 3NNVA 3IOPA 1K3AA 3G0FA 4KS7A 2HZ4A 4MD8E 3MS9A 4B8MA 4DTKA 5IH6A 5EDQA 5HG7A 2FUMA 4DN5A 5AUUA 2R3JA 5LMKC 1ZARA 1J7IA 2C6TA 3C4ZA 3QRTA 5JZNA 3A7GA 4FNYA 3R7EA 5FEQA 4BBMA 2EB2A 3GFWA 3TV7A 3WZDA 4N70A 4NK9A 4DGNA 5DA3A 3W18A 4E7WA 3MGYA 3G2FA 3NPCA 3GU8A 4ITHA 4TWPA 4ZTLA 2HOGA 3K5UA 3TKIA 2W1EA 5J5SA 5KMMA 4J52A 3UYSA 4BCGA 5BPYA 2V22A 3B8QA 3QTXA 4D9TA 5DHJA 1QPJA 3FMDA 4MXZA 4EL9A 5M4FA 4I24A 2Q0NA 4FR4A 4L43A 1Q8UA 4FZDB 2JD5A 3EYHA 2F4JA 3FY0A 1HCKA 4WBBB 5HG8A 5J9YA 3EQCA 4QRCA 4JRVA 5H8EA 3F3ZA 2VTIA 3WF6A 4D2RA 5C4LA 5HX6A 3WOWA 1V0BA 2DUVA 5C8MA 2WOTA 4M67A 4PQNA 4DGMA 2UZEA 2R3RA 2Z7RA 4YHJA 2W5BA 3Q4ZA 2C6LA 3WBLA 3FMMA 5A4CA 5HORA 5CF4A 2F2UA 2CCIA 3PG3A 1WBWA 4ZEGA 4APPA 5IDPA 2ZDTA 3KK8A 5HE2A 4BHNA 3MFUA 1LR4A 2ZV9A 3CTQA 4ZY6A 2PPQA 3FSKA 4R7HA 4O7RA 4I5HA 3HLLA 3ZONA 5FD2A 2Q83A 1F3MC 3BWJA 2PZ5A 3F3UA 4FVRA 4M7IA 4ASDA 3C50A 5GZAA 3GNIB 3KRLA 4IDTA 3QALE 4OTIA 4DG0E 4JIKA 3LLTA 3SV0A 4F6WA 2VWUA 3HVCA 5EOLA 4BDBA 3SW7A 5IQBA 4EQUA 3ANQA 2PVRA 1BI8A 4G3DA 1XBBA 4EH9A 4Q9ZA 3F2RA 3RNIA 1JQHA 2EXMA 3UMXA 2I0EA 5HHWA 3F61A 2QOQA 3A4OX 4X2JA 3TDVA 4F1TA 2XJ0A 2PMNX 4R7IA 3P0MA 4O86A 3PUPA 3VIDA 1DI8A 5FBNC 3D0EA 3HV3A 2HZ0A 4FZ6A 3RCJA 3P7AA 5JKGA 5DEYA 5AIKA 3VVHA 4WO5A 3F2NA 3OHTA 1PW2A 5E8ZA 4JQ7A 4GK3A 4ANOA 3OFMA 3WE4A 4V0GB 5D10A 4PWNA 2YFXA 1BYGA 1PJKA 3AGMA 4FMQA 2YM5A 3NW7A 3V5WA 2ITPA 1SVHA 3E64A 2WEIA 2R3OA 4CLIA 4GUEA 4DT8A 5AUYA 2W99B 2OU7A 2CGVA 2XNMA 3C4EA 4YJRA 2XF0A 3DFAA 4K11A 3SLSA 4F08A 3R04A 4TRLA 3BE9A 4IB5A 4TNDA 3R22A 3MWUA 5HVKA 4QP4A 3EFLA 5M44A 4O0YA 4OTFA 2WAJA 3R02A 3BEAA 4MD9E 3TTIA 5I9UA 4C62A 4IACA 3SOAA 4PF4A 3DY7A 1ZWSA 3NUAA 4JL9A 5DR6A 5DE2A 3B2TA 5L8KA 2QO9A 3W32A 2FVDA 5FGKA 5D11A 5IDNA 2C1BA 2YITA 5FQDC 5HVYA 4FIJA 1XH5A 3VW6A 2JKOA 4FKPA 4D2WA 2X9EA 2XA4A 4BVUA 4EKKA 2YHVA 5HE0A 4OUCA 4X3JA 1R78A 2X2MA 5F94A 3ATTA 1Z57A 5L3AA 3SHEA 1OUKA 2BMCA 3HV6A 3CR0A 2O0UA 2XRUA 2ETMA 2C68A 5KNJA 2QONA 3WZKA 2UV2A 2PZIA 2G1TA 4YSMA 4ZSJA 3ZTXA 2H6DA 4L67A 3R83A 1BLXA 2VU3A 3WF5A 4A4OA 5HX8A 4L68A 4E6DA 3IKAA 4GT3A 5KMJA 2X4FA 4MYGA 4HZSA 4OTDA 4F9CA 3PDTA 2GFCA 1YW2A 5CVHA 3O2MA 2BALA 3NAXA 4S31A 3TN8A 3UNJA 2KTYA 3QZHA 4D4RA 2F7XE 2OO8X 2RG5A 4KD1A 3DTWA 3N4VA 1PXOA 3BQRA 3PSDA 1G3NA 1QPEA 3V6RA 4ZTRA 4DFLA 2UW7A 1M14A 4DCEA 2PSQA 1OL6A 3T8OA 4YPSA 5AV2A 5B7VA 3NW6A 4GVJA 3ZO4A 5KCVA 3DAEA 3KY2A 3EWHA 1W83A 3B8RA 3G90X 3RHXA 1QPDA 3FC2A 3GC0A 4D2PA 3UPXA 5BVFA 5AFVA 2QO7A 3I0OA 3DKCA 5E4HA 2OBJA 4I93A 2PMOX 4HZRA 4HCUA 2B9FA 4AA4A 5F20A 3MIYA 5F4NA 1OITA 4FEVA 2Y4IC 4KAOA 1YOLA 3L8SA 3O7LD 5AUVA 4YJSA 4BGQA 5C26A 2A1AB 4G3FA 5HCZA 2R3FA 1S9JA 1GNGA 3C0HA 4EQMA 4AE9A 2UVYA 4QMOA 4QOXA 4NWMA 2VWXA 4P7EA 3W8QA 1PXJA 3NYVA 3PXZA 5AMNA 3F5UA 4UWYA 2GNGA 3BLRA 4HVHA 4ORKA 3HAVA 2R64A 3DXNA 4BTMA 4ZLYA 1ZOEA 4EORA 4FNZA 1GZKA 5HLPA 4BI1A 3WZJA 1R1WA 3BHVA 1MRVA 4OW8A 4AN9A 5HZNA 2OK1A 3R9DA 3QCSA 5IUGA 3QQUA 3R7YA 3UVPA 5E90A 4HVGA 3MI9A 3R1NA 4CLJA 2C6MA 4E4MA 3BU6A 3OG7A 5CALA 4E6AA 2R2PA 3I60A 4D4VA 4IAAA 4K8AA 4FTTA 5CZHA 2ONLA 4E1ZA 2A19B 4L7SA 3ORTA 3SGCA 3PA3A 5IH5A 3N9XA 3VHEA 5EQYA 3DK6A 2WEVA 2PL0A 4ZSGA 2R3IA 3COHA 3O7LB 4WNKA 3DTCA 2C5VA 3DZQA 4AT5A 2HENA 5AAGA 1NVSA 3QAME 4RVTA 1ZOGA 3DOGA 4GUBA 4UZHA 2YWPA 3RZFA 3VRYA 1F5QA 2J2IB 4FKJA 5CS6A 2BFYA 5HTBA 2XVDA 4X0MA 3KXZA 3E8EA 5FEDA 4R7BA 4JR3A 3LIJA 4KS8A 1J91A 1Q61A 1VEBA 1VJYA 2QHNA 3KU2A 3FZOA 4Q5HA 2XNGA 4Q5EA 3VUMA 3PXQA 3KN6A 4NT4A 2VO7A 3HL7A 3OOMA 4M13A 2F57A 2YIWA 4J97A 4KKGA 4NFNA 5LXMA 4V0GA 1M7NA 3R9NA 4FIFA 5CEKA 2CCHA 4U3ZA 4DGGA 5CTPA 3HGKA 3O50A 1BX6A 3ZXZA 4F0IA 4HGEA 4BDGA 3DKOA 2YLEA 4XG2A 5EW9A 2XP2A 4M68A 2VTTA 3UNKA 3EN7A 3QUDA 3RAHA 3AQVA 3W55A 5ITAA 3UO5A 1UWHA 4DINA 1SYKA 3W8LA 5J7BA 4RWLA 1XJDA 3QA8A 4Z7GA 4RLLA 1WBVA 1OPLA 3HRCA 4G5JA 2XCHA 2RF9A 3GCQA 4GT4A 4PY1A 5E8SA 4QMQA 3A8WA 3QLGA 4CTCA 4G9RA 4WBOA 4UYNA 1M2RA 1U5RA 2VV9A 3NUPA 4X6QC 3ZC5A 2J6MA 1M2QA 3E7OA 3FMKA 5IA1A 4NM7A 1XH8A 4C37A 4YP8A 4F9AA 5HEZA 2EWAA 4FKUA 5FTGA 4BWKA 4TL0A 5A3XA 2OZOA 3Q32A 3A7FA 4TZRA 4GU6A 5CYIA 4L42A 4A9UA 4X3FA 4IB1A 4FT5A 4F6SA 3H30A 3IDPA 1AQ1A 5DOSA 5BYLA 4EH2A 2GQGA 3NCGA 2ITQA 3LXNA 3HV5A 1PY5A 4OLIA 5E1EA 3U87A 4WKQA 5HLNA 4UZDA 2FSOX 4DEHA 5CVFA 4FKRA 2XEZA 2G2HA 4YGAA 3E3BX 2ETKA 5HVJA 3T3VA 3FI4A 5DG5A 5BVEA 4YPDA 4X2GA 4YNOA 3COIA 3CS9A 4Z3VA 3RK5A 1RE8A 1XQZA 4V04A 4APCA 5DT3A 3IPHA 4NM3A 5AM7A 4F9WA 4K2RA 3PRIA 5L8JA 3R7GA 5KBQA 1FVVA 5KUPA 2BVAA 4DLIA 3CQWA 4BKZA 2JBOA 4CQGA 1UKIA 3G0EA 3NZ0A 1OMWA 3CPCA 2WXVA 5BVOA 3LJ2A 3AD5A 3HRBA 5C8NA 3OWLA 4CFMA 1H07A 4DFZE 4N57A 1OPKA 1ZMVA 4MNEA 4YMJA 1WVYA 4OTQA 5TT7A 3V51A 2WTKC 5D7VA 3QHRA 4D1XA 1PMEA 4NJ3A 3V6SA 2F49A 5KZ0A 2HELA 4CG8A 4R1YA 2PVNA 5BVNA 3QA0A 3L1SA 4CKRA 4JI9A 3OWJA 4QQTA 1Q8YA 4O7SA 1IR3A 2BCJA 4O0TA 4OTHA 5AAFA 2XIYA 3CQUA 3ORNA 2OIQA 5B2KA 2WMTA 4IM0A 2QOOA 3RPRA 1J3HA 4QMVA 2JFLA 3CQEA 5DR9A 1H0VA 3HA8A 4CD0A 4E8AA 1GY3A 5ANEA 4I94A 2XK9A 2WQMA 5H8GA 5IA5A 2BROA 2PVMA 4PNIA 3W2SA 4NIFB 1OVEA 2VTOA 5IEYA 1R3CA 3MPTA 2VZ6A 1QMZA 3FI3A 4B6LA 4BI0A 4DBNA 3DDQA 2CN5A 1NVQA 3QCQA 4FV6A 4U3YA 2HXQA 4RVKA 3DBQA 1CTPE 3VNTA 3BHUA 4CGAA 3EFKA 3QU0A 2VWIA 3BI6A 3HP2A 2ITXA 3R9OA 4YC3A 2XJ1A 3QRKA 1IA8A 3U9CA 3A7HA 3EKNA 1BL7A 4FKTA 4KBAA 4ZY5A 3QHWA 3NEWA 4ZMFA 5GIPE 1BKXA 1Q3DA 4EZ5A 3Q2MA 2QD9A 3QTUA 3MESA 4RWIA 4GU9A 4XX9A 3MFSA 3PVWA 5EYCA 5J7HA 3LMHA 4FV7A 4F64A 5CAQA 2X4ZA 3IONA 2OJGA 4BCOA 1H26A 3VS4A 2YIRA 3D5WA 2BPMA 2XBJA 3HV7A 3FXZA 2ZM1A 2ESMA 5AP4A 5AUZA 3EKKA 1O6KA 4YURA 5EK7A 3VS3A 5D9HA 3HRFA 2GSFA 2X0GA 1YOJA 1ZMUA 4R8QA 2GQSA 1WVXA 4A4LA 4DG3E 4QPSA 4ZOGA 2FSTX 2C3JA 2F7EE 4F7JA 4ANLA 3HAMA 4CKJA 3U6HA 2PU8A 5GNKA 2JKQA 2FB8A 2IN6A 3ALOA 1CDKA 1OM1A 3L8PA 2ZB0A 1OI9A 3MBLA 4QTBA 4DEDA 4YJNA 2O63A 4C3FA 1S9IA 3MJ1A 3I81A 4YO6A 4XP2A 1WCCA 3AXWA 2PVFA 4IFGA 5E7RA 5CEIA 3QYWA 3PSBA 5A4QA 4RMZA 4HW7A 4LM5A 4YHTA 2F7ZE 3C5UA 4FV3A 1B6CB 4H1MA 3DLSA 3BGPA 3JPVA 4EOLA 4HVIA 5E92A 2VD5A 4JBOA 4ZS0A 1YXTA 4CNHA 3CKXA 4KIOA 4FSMA 5JN2A 3Q96A 1RW8A 4EZ3A 4PDOA 2BDFA 4PUZA 4BZOA 5GIOE 2WU7A 4BGGA 2UVXA 4CQEA 2WTDA 4FG8A 3KVXA 2A27A 3JY0A 3ZSGA 3F3WA 4FTOA 3LOKA 4U5JA 3UG2A 5JFSA 1CKJA 5M4UA 3MVHA 4LG4A 3ZUVA 3OXZA 1H25A 2WO6A 2X8DA 5C03A 5EW8A 4EK3A 1KE8A 2BRBA 5IA3A 1SZMA 5IQFA 5FTQA 3V3VA 4GS6A 1YXUA 3AGLA 4AA0A 4G16A 4KABA 2ERZE 2VTQA 2W1FA 3EH9A 3KXXA 4IADA 2PE1A 4IW0A 4S33A 4Z16A 3O96A 4GYIA 4J8MA 4PTCA 3PTGA 4RG0A 2O8YA 2BTSA 2WMVA 2OW3A 5KKRC 4HJOA 4MBIA 4IAFA 2YIQA 4XG9A 3KXHA 2WTKB 4EH8A 1J7UA 4RPVA 2FSLX 3LFQA 3OW3A 3ITZA 3PXKA 3R2YA 2WIHA 4Y5HA 1GAGA 3WZEA 2W9ZB 3IO7A 1KV2A 1NT2A 5I9YA 3ACJA 4DTBA 5AEPA 3LFBA 4FNWA 1IRKA 3W2CA 1GZ8A 1PHKA 4FK3A 1Z9XA 3TIYA 4QYYA 3DXPA 3UODA 2QNJA 3UIXA 2Z7LA 4RX5A 2GFSA 2H34A 4GJ3A 2BRHA 4ZZOA 4RIWB 2JDRA 2JAVA 5JQ8A 4BWXA 5BMSA 5EI6A 4FK6A 2R3GA 5LVMA 4U9AA 1IA9A 3I6WA 3PJ8A 1P2AA 2CJMA 2ZOQA 1VYZA 2WU6A 3EFJA 3PJ2A 4EH4A 4EK4A 1O6YA 5CEPA 5K4IA 1MP8A 3CTJA 4IJPA 3ZEPA 3THBA 4KUJA 4DT9A 3H4JA 2ZMCA 3UGCA 4UMQA 3GU6A 5J5TA 1GIJA 3VHKA 3QQGA 4EOIA 2WTWA 4I6FA 2J4ZA 2UW0A 4YJOA 4O0WA 4Z55A 4P5QA 3RPOA 3U9NA 3PSCA 4QQJA 5AV4A 3FDNA 2ITZA 2ITVA 2VTHA 4L3JA 4JG7A 3U51A 1Y6AA 5IQAA 2W96B 3EYGA 4XG3A 4C4EA 4BDCA 5JRQA 3TG1A 1KE5A 3QTSA 5IG1A 2G2IA 2BZIB 2QU5A 2RG6A 4BTJA 3UQFA 4U80A 5K5XA 3BYUA 5CSXA 3RK9A 3OC1A 4E93A 1GJOA 3FJQE 4YC8A 4YO4A 1YHWA 3UIBA 3DBCA 4BDAA 3KXGA 3G9NA 3QTWA 1IAJA 5LJJA 2J0KA 4RFZA 3TKUA 5AADA 4O7NA 4ZAUA 3O23A 3QQFA 1FQ1B 1WBNA 3FV8A 3FL5A 4AGDA 3CIKA 3ORKA 2XRWA 5FEEA 3LE6A 2W5AA 1B39A 3PP1A 3GT8A 2ZDUA 4YLLA 3U4WA 1UU7A 2B1PA 4BCHA 4NW6A 4PP9A 4C7TA 3UVRA 3DA6A 5AP2A 4ASXA 4EOKA 4ZZMA 2F2CB 1FGKA 1ZXEA 4HGTA 4I23A 3QCYA 3IW5A 2ITYA 3O71A 3LMGA 2RKUA 4JAIA 4Y5QA 5BUJA 4U40A 4B0GA 3LJ1A 2ZVAA 4GVAA 1V0OA 2E2BA 4B99A 4X21A 4BCFA 1PXLA 4AN2A 5AA9A 4CFVA 4J53A 2B0QA 2IVSA 4HVSA 4FTLA 4XOYA 4M0YA 4G3GA 4GT5A 4IWQA 4NM0A 3TNWA 3HMIA 3NSZA 2G2FA 5C9CA 2RFEA 3CBLA 3ERKA 2Y6OA 3ZFYA 4C57A 4YHFA 4IX4A 5JMSA 5IEXA 2DS1A 2IG7A 2VTJA 3MY1A 4YJUA 3TL8A 2XEYA 3FQEA 4OBPA 5ETCA 2YIXA 1TKIA 5JH6A 3CY3A 5IPJA 4E3CA 1E1XA 2ZMDA 2OH0E 4O0SA 4Y46A 1M7QA 2YM4A 4PDYA 2ZM4A 3UIMA 2V5QA 3VJOA 5FBOA 4J99A 1LPUA 1OUYA 3FE3A 2JAMA 2C0IA 2I0VA 2YCFA 3IG7A 3QRIA 2GS2A 1KE9A 4RVLA 3G6GA 2UW5A 5B2MA 3NUYA 5F95A 4O7TA 4OT5A 2PE0A 4NM5A 4UB7A 4K1BA 4X3FB 2QOIA 5LVOA 3F3TA 1W0XC 5AP3A 4CV8A 2HWPA 4FTCA 4MD7E 4B4LA 2HCKA 4BBEA 3KXNA 2OZAB 4RLKA 1FMKA 2R9SA 4DHFA 5T6KA 4DH1A 4AU8A 3OD6X 4KNBA 4GIIA 1YWRA 5BMMA 4WRSA 3VS5A 4PP7A 4RIXB 4W4WA 3BYVA 3PY0A
chains in the Genus database with same CATH superfamily
4ZSLA 4E5WA 2H9VA 1XH7A 3OY3A 3OCSA 3WIGA 1U54B 5EOBA 3ZLWA 2W17A 3L9PA 3QYZA 3G9LX 4K9YA 2C1AA 2WMSA 2XK3A 3BU5A 2O3PA 4C4HA 4QMLA 3NYOA 2OJIA 3MV5A 2OLCA 2P2IA 1H00A 1Z5MA 3VUDA 3NWWA 3H10A 3LFDA 4FTUA 4WNMA 4OTRA 2R3QA 5B2LA 2A0CX 4IX3A 3OW4A 3R1QA 4M8TA 4MBJA 4O27B 4IZ7A 3TUBA 4FL2A 5ETAA 2Y8OA 4IANA 5CAVA 2C30A 3GENA 2Q0BA 3FZSA 2W1ZA 4WG4A 4XP0A 3RKBA 3JS2A 2OJ9A 3QL8A 1WBSA 4NSTA 3FEGA 2XK8A 2ZM3A 3LFEA 1MRUA 2Y7JA 3NUNA 4N6ZA 3I79A 1AD5A 4CZUA 3QQKA 4FTJA 4BTFA 4RJ3A 4QP1A 4RIXA 5JQ5A 4J96A 4BCIA 5KX8A 3L9MA 4CMUA 2YCSA 5T3QA 1JKSA 1ZYJA 5EM5A 2V7OA 4Y83A 4IAYA 5HBJA 3ZZEA 2PVLA 3UVQA 5DT4A 5HESA 3VQUA 4DEGA 4DGLC 2EXCX 2X1NA 3PIXA 3T9IA 3LFAA 4YJTA 5F9EA 2C0TA 4A9RA 4OAUC 3ODYX 5L2IA 4UY9A 4EK6A 4RFYA 1X8BA 5IU2A 3TZ8A 2YM6A 3QD0A 5DNRA 4XCUA 3Q3BA 4BYIA 2IO6A 2IVVA 2O2UA 4KB8A 5C8KA 2GQRA 4JNWA 1APME 4UALA 5FP5A 4NYEA 2GS7A 4AX8A 1JNKA 5KMIA 4M3QA 5LMBA 3RNYA 4BDFA 3A2CA 3NDMA 3EFWA 4TT7A 4XMOA 4FV2A 4U0IA 2ITOA 5E8TA 4RC3A 3TCPA 1PMVA 4WA9A 2VN9A 4DBXA 1ZMWA 3TV6A 4LOOA 5TF9A 2NYAA 2QI8A 4XEYA 5IZFA 3A62A 3KQ7A 4PNKA 3SD0A 4I0TA 3POZA 5JRSA 4AZTA 2PYWA 2B52A 3FZRA 3BYSA 4JBVA 1J7LA 2YERA 4B9DA 4Q9SA 4I0SA 1MQ4A 1Q97A 3AC2A 4RQKA 2BRGA 4ANSA 4IM3A 4C4JA 4L00A 4FKOA 4TYGA 4LV5A 5G6VA 4ALWA 4LDTA 4ACDA 3PPZA 1OKWA 3P1AA 3IS5A 3JVRA 1Q41A 2X7GA 3NS9A 3PY1A 1W8CA 4TNBA 5L2QA 4EOPA 4UN0C 3GC9A 3P4KA 2C6KA 5IISA 3HDNA 4TKSA 2RIOA 3D15A 5IQCA 3OTVA 4YJPA 4D0XA 4W4XA 1L3RE 1ZLTA 3W33A 4FVPA 3KC3A 2B53A 1Q3WA 5CU2A 3DQWA 3EL8A 4LGGA 4O7LA 4BFMA 2W5HA 5M07A 4BR3A 3SKCA 2JGZA 2WTVA 5IQEA 2W1IA 3AC4A 3W2PA 4IC8A 2YCQA 3CJGA 3COKA 3MVJA 4B7TA 4FKGA 5BUEA 3RAWA 2PVYA 3MH3A 2PTKA 2R5TA 4QYEA 4WRGA 5GJGA 4EWQA 1Y8YA 3PY3A 5CT7A 4MXAA 5AR8A 5DVRA 2ZV2A 2WQEA 3PXFA 4AA5A 3E8NA 3MA6A 2X2KA 4AAYA 5JGDA 2I0YA 3BHHA 4DHZA 3D7TB 5AV3A 1J1BA 3UJGA 4GFGA 2PUPA 2RSVA 3QZFA 1ND4A 3NW5A 4GMYA 5KKRB 4MBLA 5M53A 5KMOA 3C4CA 1CKPA 4XG7A 5LVLA 4BTKA 2R0IA 4S2ZA 3CC6A 5HKMA 2XH5A 4AQCA 2JITA 4D2VA 2SRCA 5IUIA 2UW9A 4FEWA 4F70A 4QYHA 4O2ZA 4MXOA 4ASZA 4BCMA 2KULA 1BUHA 2W05A 4IX5A 3E8DA 3NIZA 3W2OA 4KSPA 2OIDA 1VLRA 4HPUE 4AOIA 1XH9A 3AOXA 4D28A 4WG5A 1OBDA 3KL8A 4CRSA 1L8TA 4FJVA 2G01A 4ZP5A 3VAPA 1BI7A 4ZZNA 4YLKA 1V0PA 3COMA 4PPCA 1XWSA 1K2PA 4JIAA 4XYFA 3MYGA 3RWPA 3VUGA 4QMNA 4YZBA 2QKWB 4FEQA 3AT2A 2G15A 3OF0A 4GSBA 3OMVA 4FSNA 1H1WA 2BHHA 2WTJA 4KRCA 2VO6A 4BI2A 3AMBA 1G8SA 3AKLA 4NKAA 4ENYA 4EOOA 3FUPA 3RPYA 4JMQA 4AS0A 5BVWA 4FTRA 4RIWA 5K3YA 3NGAA 4XBUA 2P55A 2EUFB 3DKGA 5M55A 5H2UA 4U8ZA 3VW8A 5IMEA 4CV9A 4EBVA 2YDJA 4ZXTA 4CSVA 4E4LA 4DDGA 2C6DA 3HEGA 3NYXA 4QYFA 2QVSE 3C4XA 5EQPA 4X6RA 5CXZA 2CGWA 4DAWA 4XLIA 3D83A 2BTRA 4BDJA 3C0GA 3Q9XA 4HYHA 3MFTA 2C5NA 4BIBA 1B38A 4O2PA 5DH3A 3VULA 3P7BA 5CQWA 2XKDA 3BGQA 2ITWA 4D58A 5KMLA 4YZDA 3ZC6A 4QP6A 4DE4A 1KE7A 2WKMA 3R01A 4RJ7A 3UIUA 3H9OA 3PJ3A 3R2BA 4FVQA 4JOAA 4KWPA 3R7IA 1OL1A 4LMUA 2R0UA 3MSSA 2QG5A 4DDIA 3DK7A 1GZOA 2JDOA 4F63A 5FG8A 1YDRE 2OICA 4PL3A 4JDIA 5GJDA 2OFUA 5D1JA 1OB3A 3A7JA 4PMSA 4F7NA 3K54A 4GIHA 3E87A 3UYTA 1H0WA 2V0DA 3PPKA 2A98A 3FZPA 3VUHA 3QTZA 1NA7A 4CVAA 3G15A 5BNJA 3F88A 4QMUA 3Q6UA 4MWIA 4PPAA 2BFXA 3ORZA 4MH7A 3C13A 2BZHB 4G3EA 3ZBXA 4IJ9A 2OGVA 3UOJA 3PVBA 3LFSA 3DAKA 3DJ6A 4NU1A 5HU9A 2WOUA 1XMMA 1HOWA 2O65A 3Q9ZA 2Y6MA 3BYOA 3QGYA 5HIEA 1G8AA 3TACA 5AV0A 2R7IA 4B8LA 1ZAOA 1GIIA 3ZCLA 4CCBA 3V8WA 5ACBC 5HE1A 4M66A 2BAKA 5TKDA 3UP7A 3R8UA 5CF6A 4RA5A 2J0JA 2W4OA 2YM8A 4XRJA 3FMHA 2HZNA 3ZU7A 1R39A 2B4SB 4WD5A 4EJ7A 3ZM4A 2FH9A 2GU8A 3O8UA 3KEXA 4PX6A 3LLAA 3ANRA 2JFMA 4WNOA 1E1VA 4AOJA 2RFNA 4I4FA 4MQ1A 5LARA 4H3QA 1YI3A 4WNPA 3VS7A 3W2QA 5HD7A 3LKMA 3QD4A 5I5ZA 4CRLA 1TQIA 5I0BA 3MY0A 1ZZLA 4TTHB 3OXIA 5A9UA 4JBQA 4IWOA 3R28A 3C4FA 4D5KA 4C3RA 4AN3A 5IQIA 4FTQA 1U4DA 1YRPA 2BDJA 4ITIA 4YBJA 1KV1A 3BV3A 2IJMA 4IB3A 3QZIA 2REIA 5JK3A 4PRJA 3NNXA 3QTQA 1Y8GA 2BIYA 1TZDA 5AV1A 1SM2A 3MH2A 1H27A 3SAYA 1REKA 5M4CA 3MB6A 3VC4A 4GV1A 3FKOA 2QR8A 4UX9A 3KCKA 2UW8A 2YJSA 2X8IA 2Z02A 1ZY5A 4ZSEA 3OS3A 4EEVA 1XO2B 5EM7A 2XAMA 2VTMA 2CHLA 3LHJA 3MIAA 3SXSA 5GZ8A 2VTLA 5AX9A 3TIZA 4RSSA 4AW0A 3HUBA 4FOBA 3AC3A 4RJ6A 5CT0A 5HBEA 5KHWA 4EH5A 3HUCA 3FBVA 5K5NA 1RQQA 5AP0A 1Q8TA 4M97A 1R0EA 3AD4A 3IK3A 1PKDA 4LRJA 5CXHA 4DYMA 2WELA 3K3JA 3OCBA 4FOCA 4U97A 4C2WA 5CY3A 3MTFA 5D12A 4JDHA 3HMNA 4QD6A 5LWNA 4IIRA 2FO0A 3CY2A 4PV0A 1VR2A 2B54A 2XK7A 4FGBA 4Z9LA 4KINA 4FT7A 3U8WA 2PMLX 1SNXA 4G5PA 5CWZA 3BCEA 5A6OA 4AZWA 5AM6A 3GCSA 3GU5A 3FPMA 4BYJA 5DLSA 5IUHA 3WARA 4BRXA 2XIZA 5L8LA 3VWAA 2UZBA 4G31A 1P4OA 3LAUA 4U45A 1M17A 5CSWA 1M2PA 5IF1A 1ZYCA 4FT0A 3NVKI 4LGDA 5KMKA 5J1WA 1FPUA 3KK9A 2JIUA 5I9WA 3EZRA 3KB7A 4FTKA 3FLYA 2ERKA 4D1SA 3DT1A 3FLWA 2FSMX 1OZ1A 1TQPA 3R30A 4F6UA 1A9UA 3LM0A 4JBPA 2IZUA 2C6EA 2WD1A 5K4JA 4PMTA 4WSQA 3NIEA 3Q5IA 3OP5A 4QNAA 3NUUA 3ROYA 4TWNA 4J95A 3PXYA 4AGUA 4E6CA 3NYNA 3Q5ZA 4NW5A 1NVRA 5JGAA 4MXYA 4N0SA 3WYYA 4R78A 3R7UA 4QTAA 4A9YA 4YZNA 4EQCA 3SG8A 2CKEA 3EMGA 3UO4A 3ZH8A 3BV2A 4CZYB 2Z60A 4YU2A 4H36A 4UMTA 3R9RA 3ACKA 4RFMA 3QWJA 3HZTA 3ZEWA 3A7IA 3V8SA 4MF0A 4HYIA 4FV4A 4FIIA 3LJ0A 2WMRA 3FL4A 1IAHA 1PF8A 1U5QA 3PWDA 2NNWB 3PIYA 3KMUA 5I3OA 3FSFA 5DN3A 2W0JA 1XKKA 1OPJA 3MH1A 5E8UA 4BKJA 4QTCA 4W8DA 4M69B 2PWLA 1XHAA 5TE0A 1WBTA 4EK8A 5T68A 4XG4A 4YTIA 2B9IA 3R63A 5BYZA 2ZB1A 3E88A 3ZHPC 2BR1A 2PE2A 2XNPA 3FLQA 3KVWA 4RX9A 3VUKA 4EC8A 5HTIA 2YWVA 4MEDA 4XHKB 3KCFA 4UWBA 3ZLSA 4BJJA 4ZTMA 4IVBA 3R1YA 4MHAA 1JKLA 3WILA 3ZDIA 3QLFA 3I7CA 4MK0A 2XK6A 2OKRA 1OIRA 3AMYA 3DNEA 3HKOA 2CLXA 1ZRZA 3I6UA 1Q99A 1YHVA 4J8NA 4GG7A 4PMPA 4QMSA 2VTAA 2ZJWA 1TQMA 2WMAA 3FC1X 3LXPA 4QP7A 1MUOA 4ZSAA 2PUIA 1Y91A 1AGWA 3OZ6A 3G33A 4FC0A 3ZOSA 4USDA 3UQCA 4LV7A 2H96A 4PMMA 4H39A 1YHSA 3PYYA 4M0ZA 2Y4IB 2OJJA 4H05A 2ZV7A 4NKSA 3TZMA 4A9SA 4HNFA 2BZJA 4YTCA 4X7QA 3HYHA 3WE8A 3RHKA 4ANBA 1Q4LA 4NZWB 2WQBA 3W0SA 3G51A 5A4LA 1KUTA 4HYUA 4U6RA 1G5SA 5A54A 3AT3A 4K0YA 3KULB 4CMOA 3ZFXA 2CKQA 2V7AA 5HG9A 1SVGA 1XR1A 2IPXA 1XH4A 4FA2A 2E9UA 2OG8A 3FYJX 4C34A 1ZZ2A 4KKEA 5TO8A 1WZYA 3A8XA 1JKTA 2GHMA 2R3PA 4YSJA 5J9LA 5HU3A 1RDQE 2Y4PA 1VYWA 4OTWA 4I21A 5ANJA 4KKHA 4DF3A 1J1CA 2FA2A 2XUUA 3Q52A 5CANA 4F1MA 3I4BA 5IQGA 2ETRA 3QUEA 5EYKA 3ZSHA 3HMPA 4IM2A 5JZJA 3PXRA 3HMMA 2W1HA 3R8MA 3BPRA 2JDVA 3RP9A 5FDPA 3OWPA 3LZBA 4TPTA 4EHZA 4FSUA 5AA8A 5M06A 2C47A 3E62A 4Y73A 5EM6A 5CEMA 5CF8A 3F5GA 4GYGA 4LL5A 3F9NA 3I0QA 2QCSA 3PLSA 3ZBFA 5EKNA 2BDWA 3HP5A 4S30A 4XP3A 4A4XA 4DH8A 4XLVA 2E9OA 3A61A 3H0YA 2IWIA 5FXRA 3DAJA 3D94A 2UW3A 1YXXA 2QKRA 3TV4A 2DQ7X 1UU3A 2VTSA 2XAOA 3DDPA 3F7ZA 4MVFA 4FIEA 4FNXA 2LAVA 3ZLXA 1H28A 4EH6A 3NLBA 5FLFA 4XRLA 3S3IA 3QD2B 4TYIA 3I5ZA 2QOCA 4FKQA 4YZ9A 5M51A 3LFFA 1GZNA 3BE2A 5L4QA 3PPJA 4UV0A 3E3PA 4JDJA 5EKOA 3QD3A 5KHXA 3TDWA 2QURA 2JIVA 4W9XA 4HVDA 5AUTA 3QX2A 4XG6A 4IX6A 3CE3A 1UU8A 4TWOA 1XH6A 2C6IA 3H3CA 1K9AA 4O21A 5DI1A 5ACKA 3RAIA 5FP6A 3KN5A 3P9JA 3UZTA 1Q24A 2CKPA 3PFYA 4GKHA 3FQHA 4FZ7A 3D7ZA 4CTBA 5EDRA 2YDKA 5C27A 4D5HA 3SG9A 3W0PA 3PUFC 4IB0A 3DS6A 2GNHA 3MY5A 5BX0A 3EB0A 3EN5A 3KULA 5FXSA 3R6XA 3LQ5A 3P7CA 2VNYA 4OAVB 4DHJA 4AT4A 5M4IA 4AFJA 2VX3A 3P23A 2BKKA 4ZS4A 3T3UA 1WMKA 3V5JA 3IDBA 3PP0A 4QO9A 3AC5A 3UG1A 1JSTA 4K33A 1W7HA 3CCNA 3NMUF 4EBWA 1YQJA 2I0HA 3R73A 4RIOA 4JRNA 3I1AA 3GBZA 3IQ7A 3QFVA 4I4EA 4IHPA 3QQLA 5H3QA 2E9PA 3VO3A 1FINA 1DAYA 1Q62A 1H01A 5CNOA 5EYMA 3QCXA 1STCE 4FKWA 2QU6A 4GFOA 3QX4A 3ZXTA 5HIDA 4P90A 5J9ZA 2X2LA 4A7CA 3S0OA 2EVAA 4E5AX 2YIYA 2OH4A 4ANQA 3GC8A 3QF9A 1OL7A 3U55A 4U81A 3OBJA 3MFRA 3D4QA 5I9VA 5ETIA 3QBNA 3LCDA 1UNHA 1FVRA 2I40A 1H08A 4PL5A 4R5YA 4U79A 5M57A 2CPKE 1T45A 3GQLA 4DGOA 4FX3A 5IA2A 3NFGB 4GKIA 4M15A 3DB6A 1WAKA 4RWJA 3JR1A 5F1ZA 4JG6A 2E9NA 5DMZA 2WZJA 3UNZA 5C1QB 4L45A 4KBKA 2YJRA 2CGXA 4LV8A 1UKHA 3RPVA 4EC9A 2HW7A 5CU6A 4FTAA 3BLHA 1OKZA 3ENMA 3OROA 3OXTA 4FL3A 4G17A 3ZRLA 4E73A 4UMPA 1V1KA 3MVMA 4J1RA 3FY2A 4AE6A 4D1ZA 4F99A 3KIOC 4AW1A 1YDTE 2XNBA 4RX8A 5CAOA 3D5XA 2YACA 3BBTB 4FF8A 4WUNA 3CGFA 4AXAA 3V01A 1QCFA 1NY3A 2J7TA 3NAYA 4LFIA 1UNLA 4E20A 2R3HA 5AP5A 1YXSA 4I3ZA 5D7AA 3MA3A 3LM5A 3UZPA 4DITA 5LCJA 3IGOA 1XMLA 4I5MA 2WTCA 2C3KA 3LPBA 5J87A 5JGBA 4F0FA 2BHEA 1HCLA 3F82A 4FZFB 3R8LA 4K18A 5KO1A 4BY9E 1Q8ZA 3UOKA 5DRBA 5AR3A 3UQGA 3KREA 3KFAA 2YEXA 3QWKA 3W1FA 4DCAA 3MTLA 3KMWA 3EQIA 4RIYA 2PMIA 5L2TA 4MAOA 3VBQA 5E1SA 2VO0A 4F7LA 5CEQA 3PVUA 3NUSA 1PMUA 4QP9A 3C5IA 1TVOA 4M69A 3BGZA 4Y95A 3GUBA 5AAEA 1F0QA 2VAGA 4TYEA 3RVGA 4TY1A 3UC4A 4C0TA 4ZY4A 3UPZA 1IEPA 2UZOA 3O0GA 3M1SA 3ORIA 5E8XA 5ETFA 4W9WA 4MTAA 2OXDA 3KA0A 4QTDA 4ZTHA 3RK7A 5E8YA 3TNQB 3VUIA 4LGHA 4BDHA 5HE3A 3OT8A 4ID7A 5IQDA 1H1RA 3OBGA 3FLNC 3QC4A 2BKZA 3EQGA 3QUPA 4IZYA 4G3CA 4GK4A 4UEUA 4AZEA 2B9JA 4G6LA 4JDKA 2OZAA 3SDJA 4DLJA 3CPBA 3T9TA 4DEBA 3SA0A 3ID6C 5H8BA 3EQBA 3Q53A 5DPVA 3WF8A 5AR7A 5HNIX 1PXMA 4PPBA 4FKVA 2WGJA 5A46A 4O22A 5L6PA 3OUNB 3UP2A 2GHGA 4XH6A 3UMWA 2X81A 1OKVA 3GXLA 2XK4A 3FKLA 4ONAA 5EDPA 3LQ3A 3TNPC 5EI8A 3V5QA 4MX9A 4O1PA 1CM8A 3SOCA 3AG9A 4L52A 4V05A 1ZYDA 3VS0A 5HD4A 1O6LA 2EB3A 2WB8A 5LVNA 3S00A 3GVUA 3K5VA 4AW2A 4JG8A 3QKKA 2WHBA 4MNFA 3GU7A 3ULIA 4GEOA 4X2FA 2P33A 4YTHA 4O0VA 5FM2A 3FPQA 3LCKA 4GJ2A 4FSTA 4DEEA 1R0PA 2PZPA 4FSWA 2GTNA 3VJNA 5BVKA 5A4EA 2F9GA 4BDDA 3F69A 4ASEA 5CZIA 1ATPE 3GEQA 3ML1A 4UMRA 3KRWA 4EOSA 2YAKA 2JBPA 3E93A 3CD3A 4HCTA 1U46A 4O4CA 4R3RA 2RGPA 3FMEA 3EN4A 3GOPA 4L46A 4WIHA 3F66A 3ZMMA 2IZRA 2XIKA 2WMQA 2VNWA 4S34A 3NVMB 4JQEA 4ALVA 4FSQA 1PKGA 4CFWA 5CI7A 4WT6A 4C33A 4BCKA 3SVVA 1LUFA 3R7OA 2OXYA 2IVUA 2GS6A 4BZDA 4O82A 4FG9A 4U7ZA 1ZOHA 3OVVA 4DFNA 5C4KA 4L6QA 3LCOA 3MPAA 2P3GX 3RTPA 3PIZA 4OBQA 3TJCA 4DFXE 4XBRA 4FUXA 1H24A 4O7YA 2J0MB 2XB7A 3QRJA 4NH1A 4F65A 3E7VA 3U4UA 4G6NA 4ZJVA 4CFNA 2JKKA 2G9XA 1FGIA 3BHTA 2VUWA 3JUHA 4OGRA 2AUHA 2J5EA 3QTIA 2I1MA 1QL6A 1OL5A 4NJDA 5HBHA 3KGAA 4BL1A 4G6OA 4AAAA 3CSVA 5EYDA 4UWCA 3FAAA 3EN6A 4TW9A 1JKKA 3BIZA 3IGGA 5DEWA 2UZNA 2NRUA 3S95A 4HYSA 4IBMA 4CCUA 2CNQA 2W7XA 3PWYA 4YLJA 2WNTA 2W9FB 3AD6A 1JSVA 3DZOA 3MN3A 2VO3A 4RJ5A 2BIKB 3AC1A 3QKLA 4ZTQA 5J95A 4BKYA 3PA5A 2CNUA 4Z7HA 2R7BA 4I22A 1YWVA 4JS8A 4O4FA 2PHKA 4RT7A 4HGSA 1W82A 4I6LA 3BRBA 1KOBA 4ARKA 2J5FA 3TTJA 4C4GA 3JVSA 4EOQA 3BZ3A 4IZAA 4CFFA 3FLSA 4L53A 5M56A 3DFCB 2XMYA 4CYIA 2C0OA 1I44A 4AFEA 3F6XA 5I9ZA 4RIYB 4LOPA 4O91A 5BVDA 1OBGA 4PTEA 2RL5A 4L01A 4EWHA 1RJBA 2AYPA 1PYEA 3L9LA 3D5UA 3FZTA 2Y0AA 3CEKA 2GPHA 4IVDA 3I5NA 3FMNA 2QOLA 5CEOA 4XUFA 4WHZA 4TYHB 4ZLZA 4FICA 2GNLA 3QQHA 3VBXA 4JT3A 4W4YA 4QP2A 4NTSA 4RBLA 5CU0A 2YZAA 3P86A 5EG3A 5H9BA 1JPAA 3S1HA 2P0CA 4MF1A 3PE1A 3WF9A 3Q4TA 4DG2E 2JDSA 2FGIA 3Q9YA 4XV2A 5GHVA 2XKEA 4MWHA 5EI2A 4O7VA 2PULA 4F9YA 3DXQA 2AC5A 4GRBA 4I0RA 4V01A 3RAKA 3ZS5A 5CU4A 3FI8A 4R77A 5CENA 4GCJA 4DH7A 4TYHA 2QG7A 1FOTA 3OEFX 3O8PA 4GK2A 4C58A 3Q4CA 4FZAB 2ITNA 4A07A 4USEA 4QPAA 2J50A 2UZUE 3FQSA 1PXPA 3H9FA 3R21A 4R1VA 4BIDA 5JSMA 2RFSA 4I1ZA 4HNIA 1OKYA 2W06A 2WMBA 3PZEA 4CKIA 2XM9A 1OL2A 3TKHA 3VBWA 5ICPA 3U54A 3KXMA 2HK5A 2JC6A 2W4KA 5HIBA 1ERKA 3EQHA 4N6YA 4X3FC 5AP7A 4L9IA 3LXLA 5AR5A 3ZSIA 4XS2A 2XYNA 3KF7A 4L3LA 5FWKK 4XNEA 5KE0A 2C5XA 4YJQA 3GCUA 5HICA 3D5VA 5ANDA 3V5PA 2VTRA 4QYGA 3GQIA 5FM3A 4IWPA 3ZZWA 2OFVA 3CD8A 4H58A 2UZTA 1JWHA 2C3LA 1LP4A 3VN9A 4BF2A 3MVLA 3ZYAA 1PYXA 2O64A 3C7QA 4O84A 2Y9QA 4YZMA 3MJ2A 2QODA 5E9EA 1PXNA 3RPSA 1CMKE 4IFCA 3GP0A 1OGUA 5CX9A 4FIGA 1SVEA 3QXOA 4JR7A 4PDPA 4W4VA 4C59A 4CEGA 5JFWA 4O81A 4EKLA 5DWRA 1JAMA 3TJDA 4I6HA 1CKIA 2BAJA 3UDSA 2XZSA 3FMLA 5K0XA 3ZUUA 4L7FA 3P5JC 4XV1A 4O38A 3E63A 4U41A 3UTOA 3ZO2A 2HY0A 3DBDA 2GNFA 1DM2A 5DIAA 5K0KA 5JFVA 3NX8A 4NTTA 2X7FA 1WFCA 2QR7A 4J98A 4C61A 5CQUA 4PL4A 4RQVA 2OXXA 4XOZA 1NXKA 4LMNA 5KZIA 2GNIA 3D9VA 1XBAA 4E6QA 5CF5A 4DA5A 1JLUE 3WYXA 4D2TA 3R00A 5L6OA 1BMKA 3E92A 2A2AA 1GOLA 4RC4A 5E91A 5EW3A 4O6EA 2XJ2A 1W84A 2HXLA 4C02A 3D2IA 4NL0A 4JQ8A 5JFXA 2Z2WA 4LUEA 3AMAA 1URWA 3R7VA 2VWWA 3ORXA 3EQFA 4IVCA 4UXQA 5IKWA 5IEVA 4BDEA 3D7TA 3FKNA 4RVMA 3QKMA 3NRMA 4IE9A 4O6LA 5AJQA 5J8IA 5L2WA 2UZLA 3MH0A 2AC3A 2IW8A 4F4PA 2IF8A 4C4IA 3K2LA 1G8JA 3V5TA 4CFXA 3HNGA 4XV9A 3FWQA 1Q5KA 3M2WA 4JJRA 4AUAA 2BAQA 3BU3A 3GOKA 3RMFA 2PUNA 3REPA 3Q6WA 4AT3A 4BCPA 4CXAA 3DJ7A 2YAAA 2ACXA 4Q2AA 3DBEA 3DNDA 2ZAZA 2QOKA 4IVAA 4F1OA 3LMIA 1KWPA 3S4QA 3VUTA 5ANIA 3ZFMA 5D41A 4IZ5A 4C3PA 2W1CA 2CN8A 3SXFA 3JY9A 3CP9A 3U6IA 1PRYA 1OECA 4D4SA 4N4SA 2XANA 5HCXA 4D55A 4P4CA 1WBPA 2XNEA 4U43A 4PDSA 2J0LA 2UW4A 2BUJA 2J90A 4AP7A 2OIBA 4S32A 1I09A 2C69A 1Q8WA 2VWYA 3EN9A 4FV1A 3PRFA 4RC2A 5L2SA 4FYOA 2WMWA 3BWFA 4FYNA 4IEBA 3EQDA 3P78A 2JEDA 3NR9A 1LEZA 3ET7A 1UA2A 3DLZA 4Y8DA 4QEBA 3UBDA 4QMXA 2PUUA 3VBTA 4I5CA 3TT0A 4R3PA 2HWOA 2OWBA 3VBVA 3OOGA 2BRNA 4CT1A 3NFFB 2PVKA 4F0GA 4MCVA 5HLWA 5HO7A 3EHAA 3A99A 3N51A 1YKRA 2X0OA 3O51A 2XNOA 2HAKA 4MXCA 4G34A 2OI4X 3VQHA 3ZM9A 5HNBA 4IMYA 5DFPA 2QQ7A 4FIHA 4A9TA 3UZRA 2H8HA 3LFCA 2OJFE 4BCJA 4CG9A 4DEAA 5BQ0A 2ITTA 5ANGA 3QGWA 5TR6A 4RJ4A 4AGWA 1OIQA 3IDCA 4EHEA 4RJ8A 4EOMA 2VX1A 2P2HA 5FDXA 1JOWB 2HW6A 2X7OA 2VX0A 2C3IB 5M08A 3WF7A 4ANMA 4C36A 3VF9A 3II5A 5CNNA 2XIXA 3EOCA 4ERWA 2OSCA 1H1SA 5FRIA 3TI1A 2UUEA 4HGLA 4AF3A 2X39A 4CFUA 4CYJA 3LCTA 3ORLA 4EI4A 4QQ5A 5LWMA 5AWMA 5BUIA 2PVHA 3F2AA 4BGHA 4TYJA 3FYKX 4USFA 3PJ1A 3D14A 3SC1A 4ZLOA 2VWVA 4IAZA 4D9UA 2PVJA 4EONA 4KRDA 4LI5A 4YZCA 4AQKA 3H0ZA 3FLZA 2Z7SA 3WZUA 3ZLYA 5J79A 4HCVA 4ACGA 3AKKA 4XJ0A 5ANOA 4II5A 4LYNA 3DK3A 3TM0A 3IOKA 4QPMA 2O5KA 4OR5A 4QP3A 3IECA 2W1DA 3OEZA 5K9IA 4ERKA 3GC7A 5I3RA 2JKMA 4FT3A 1LEWA 4R6VA 4TWCA 4C2VA 4FE2A 3CGOA 2PZYA 5A6NA 2IW9A 4F9BA 4WUAA 1KOAA 4E5BA 4JAJA 4C38A 2YLFA 3TNIA 2E9VA 2B55A 3ZO1A 5EHLA 3TXOA 4EHVA 3ZO3A 3IW4A 3TNHA 1U54A 4BDIA 3TWJA 4EHGA 4W8EA 5GZ9A 4J7BA 3P79A 5LMAA 5IMXA 5HG5A 2WMXA 1NW1A 3V5LA 3FHIA</