4TRLA

Structure of ephrin type-a receptor 2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
277
structure length
268
Chain Sequence
QAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTEVPVAIKTLKGYTKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDPEATTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 2
publication title Structure of Ephrin type-A receptor 2
rcsb
source organism Homo sapiens
total genus 78
structure length 268
sequence length 277
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4trlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4trlA01
5LCKA 3E8NA 4O0XA 4PDPA 3G33A 3R7GA 5FRIA 2JFLA 4AACA 3D2KA 2R0UA 5AM6A 4YJUA 3F88A 5KHWA 2OIDA 3NUYA 2QLQA 3F2AA 4A9UA 4P4CA 5L2SA 4HGEA 2ITPA 3LCTA 4D58A 3Q4TA 4RWIA 2X9FA 4YBKA 4AP7A 4CKJA 3VBQA 4PTGA 3Q60A 2Y9QA 3NS9A 4JBQA 3ORZA 3MDYA 3F2RA 4U3YA 3GFEA 4NKSA 4BHNA 3C4FA 4QMZA 4X3FB 2I40A 4BDJA 2YZLA 5BYLA 2BAKA 2OF2A 2VTNA 3ANRA 2XVDA 3KRWA 3CPBA 2B7AA 2C3KA 5AM7A 4A06A 4A9SA 5CYIA 4CFNA 3NYOA 4XG4A 3Q04A 4TTHB 2O65A 4I6BA 3TI1A 2UW4A 3CTHA 3NW5A 4AN9A 4U3ZA 2W4JA 3EQRA 4FUXA 4P7EA 4TWOA 2WOUA 4XCUA 1KV2A 3TJCA 3F69A 4GT5A 3NUNA 4OTDA 4NFMA 5D7VA 2QNJA 2BRMA 3KRJA 2I1MA 3R30A 4DH8A 2R3RA 3PY0A 5CWZA 1JOWB 2WB8A 5AWMA 4MBIA 4YTHA 2OIBA 4FEQA 4G3GA 3WF8A 3FZTA 4TT7A 5CI7A 3UPZA 2HY0A 4S34A 4RLKA 2J0JA 4LQMA 2R0IA 5EHYA 4AN2A 4AFEA 2YCRA 4FODA 3E87A 2R9SA 5AIKA 3LVPA 3QYWA 2V22A 4HVHA 4FKUA 5A4EA 3D9VA 4K0YA 2WMAA 4L00A 3DJ5A 2I0EA 4QP1A 3QWJA 3GU8A 4R3RA 4U42A 4W8EA 3ZCLA 3P86A 3LFSA 5C4KA 3M11A 3PTGA 3ZTXA 3FV8A 1KUTA 3AQVA 3COIA 3OWPA 2PVRA 4F9BA 2PUUA 3OXTA 4KINA 4BI0A 4Y73A 4MBJA 5E8XA 3UQGA 4E20A 4ZSEA 4WUNA 4CTBA 4X7QA 4O7YA 5K0KA 4NM5A 3GQIA 4MD9E 4OBOA 4C33A 1UU8A 4IX6A 4IX4A 1M2PA 5DT3A 2BZKB 3TUBA 5TF9A 1M17A 2WD1A 4EQMA 4ANMA 4I4FA 1GOLA 2WEIA 3HMMA 2QO7A 4IDVA 4BYJA 1RE8A 2VNYA 2A27A 1LEZA 2YN8A 2OXXA 5HI2A 5AUXA 4BDBA 3LCKA 4J99A 5DA3A 3ZLSA 2VO7A 2YIYA 4I92A 2F57A 4WNKA 2QR8A 2RGPA 3C13A 3EN7A 5AR5A 4KIOA 4X3FC 3Q6WA 3GI3A 3F5XA 3MYGA 1BL7A 3OS3A 3Q4CA 3RHXA 4P90A 4PX6A 4RX8A 4EH9A 4IDTA 3E3PA 4XHKB 1CMKE 5LJJA 2P2HA 4O1OA 3RKBA 2WAJA 2PVYA 1CKPA 3MJ1A 4U41A 4V04A 1BX6A 1WMKA 5KKRB 4QTDA 1BL6A 3DA6A 3R8MA 2W1GA 4PPCA 4DCAA 4L68A 5BPYA 5JFWA 1RJBA 1YXUA 3OOGA 1Q8UA 2ZB0A 3OD6X 5AMNA 4FSQA 5DH3A 5E1SA 2WKMA 2PZPA 5J7BA 4YJTA 3CTJA 4FEVA 2BKKA 3FHRA 3LJ0A 3V5QA 2C5VA 2WQOA 2XB7A 2YAAA 5AA8A 2P2IA 4M97A 1M7NA 4RPVA 4WT6A 3UIBA 5CT7A 2C3JA 4FTJA 3D7TA 1OI9A 4U40A 3QQFA 5IUGA 1ZYLA 3KEXA 4EHZA 5HZNA 1JWHA 4J52A 4EHEA 5BVNA 2G01A 2WTVA 3DT1A 4KABA 4EK5A 3BHVA 2BDFA 4IM2A 2O5KA 2OZOA 5EHLA 3SRVB 3NUXA 4A7CA 3U6IA 4GFMA 3UNZA 4CLJA 3GC0A 4BZDA 4I5PA 5HBJA 3NZ0A 4KSQA 3ID6C 1FVRA 1GY3A 3ZHPC 2E9VA 2HZNA 3PVUA 4O2PA 3FYJX 4EKKA 3FQHA 5DFPA 2RKUA 3DBFA 4EOJA 3VUGA 4Q5EA 1NY3A 3UOJA 1Q4LA 2DYLA 1WZYA 3AC1A 2UZEA 3NMUF 2ZOQA 3KL8A 4UEUA 4FV8A 4HZRA 2VTQA 2R3MA 3QQLA 4FIFA 4HGSA 4Y95A 3ORPA 3OXIA 4YR8A 1MQ4A 3VJNA 4A4LA 2CKPA 5HEZA 1FOTA 2ZM3A 4GVJA 1PJKA 3VS5A 2XYUA 4H3QA 4DEIA 2YDIA 5DI1A 2F9GA 1X8BA 3ULIA 4A9RA 4FG8A 4NTTA 1CDKA 3IK3A 3GCQA 4L43A 1LPUA 3JVSA 4YJPA 5KMOA 3NDMA 3ORKA 2C3IB 3OBJA 5AP1A 1FMKA 2XH5A 4BBEA 5CAPA 4D2TA 4FTTA 5FEDA 2R3LA 1ZLTA 5CXHA 4NWMA 2HXQA 4FSUA 5ANEA 2C6OA 2JDOA 3BWJA 3BGPA 3HEGA 3Q9WA 4DA5A 4TYIA 2B4SB 3WE4A 3F5GA 4ORKA 2J0LA 4AS0A 5GNKA 4CT1A 3FYKX 4M3QA 2JDTA 2WTIA 3ORLA 3PPJA 3VS7A 3A7HA 5I0BA 4HYUA 3HA8A 2JAMA 4FVPA 4D9UA 3BYMA 2YCSA 3F3TA 5IQBA 2PK9A 3I6WA 3EKKA 3W2QA 3F3VA 4GW8A 4H1MA 4QYYA 4V05A 4UX9A 4QMVA 4RVTA 2UVYA 3GCUA 3WF7A 4EOOA 2G2FA 2HENA 2PYWA 4FKPA 2VX1A 2PVFA 4K33A 3UODA 4DG2E 4BZOA 3KULB 3RI1A 4XX9A 4FKSA 3ZDUA 2IO6A 4AZSA 3DZQA 3AD5A 3DXQA 3FI3A 2NP8A 5C01A 3R1NA 1E1XA 2FA2A 3QKKA 4FTNA 3D83A 5E8WA 3FLSA 4UALA 4O38A 4DBXA 3OC1A 4M12A 3GCSA 2Y4PA 2O8YA 2PU8A 3R21A 4ANLA 3TNWA 3QXOA 4QMPA 2ITOA 3EYGA 3AC4A 4FKRA 4UWYA 3I1AA 4PMSA 3H30A 4TRLA 3V6SA 1OITA 5IA3A 2WOTA 2XNMA 3PRFA 5IDNA 3P4KA 3WZEA 4EOQA 5HCYA 1IG1A 3CY3A 2W0JA 4U0IA 2NRUA 1YQJA 4BL1A 3PJ1A 4JI9A 4TYJA 3OY1A 4YLJA 3AG9A 1M52A 1H00A 1CTPE 3BRBA 3HDMA 4AW2A 3E62A 3W2SA 5I5ZA 4WNPA 1KE7A 1CKJA 3FHIA 4AGCA 4C62A 4IH8A 5H9BA 3QKMA 3Q96A 4ALUA 3SAYA 4E3CA 2GTNA 3HAMA 2GU8A 2ITTA 2WMQA 3HV6A 1WBWA 1GZKA 3ORMA 3HDNA 2DUVA 4OR5A 4ZOGA 2CLQA 4ZMEA 2GCDA 3A7JA 5FGKA 2BRGA 3UQCA 3RZBA 1Y57A 5E7RA 2UZUE 5IA2A 3LXLA 2R64A 3GGFA 5JGBA 4E26A 3LW0A 2CJMA 3EN9A 3NAXA 4KBKA 4BKJA 1AQ1A 3NUPA 2ZDTA 3K3JA 3NX8A 4EI4A 5M44A 1UU3A 3LFCA 2B52A 3MB6A 5AP6A 3VS0A 3QUEA 4G16A 3HAVA 2C6IA 3Q9XA 3KKVA 4RQKA 4AU8A 3MH1A 3MPTA 3ZU7A 3HVCA 3O7LD 5ANDA 4FV1A 4AN3A 4DH5A 4RX5A 4QQJA 4G34A 4NJDA 2YIQA 4H58A 3AOXA 1T45A 4TPTA 3DKCA 3RAHA 1G8SA 3WZKA 3A2CA 2G1TA 2R3FA 2H8HA 3IOKA 4FV9A 5EYKA 1NVSA 4ZTNA 3B8QA 3KCFA 4XRJA 4F70A 3OT8A 4D0WA 2X9EA 4ZLZA 3W32A 4I22A 5EKOA 5CU4A 2RFEA 3OW4A 3MH2A 3ZUUA 5C8KA 2YACA 3MFSA 1YHSA 3ORNA 1TQPA 1J91A 4NM3A 1OKZA 4AZWA 4XOYA 2R3NA 3EJ1A 4ZTQA 3MVLA 4C4JA 2WTDA 2XRUA 3I0QA 2J5EA 2PZ5A 3H0ZA 4LOOA 4MQ1A 2RIOA 4XG9A 5F94A 4DGNA 3KFAA 5HGIA 3A7FA 5J8IA 4LV5A 1U4DA 4UYAA 3FLQA 4Y8DA 2XNNA 2GS6A 4XRLA 3E8EA 1RW8A 3FSKA 2R3JA 3BGZA 3BBTB 3R02A 1YDSE 2FSOX 4HNIA 4AQCA 4X6QC 3FQEA 3G9NA 4BYIA 4FE2A 3HUCA 5EM6A 4CXAA 3FI8A 3Q32A 1E9HA 4YGAA 4F9YA 2W1IA 3LMHA 1H24A 5EI6A 2FSMX 4I20A 4WRGA 5J79A 4AZVA 4UY9A 3PG3A 3V5JA 5FM2A 4BGGA 4C4IA 4QPAA 4E4MA 2VTRA 3MS9A 3QF9A 5HBEA 4EBVA 4PY1A 1PKGA 5TR6A 4YZBA 3RK7A 4L46A 3VHKA 5DOSA 2IG7A 1NVQA 1YWVA 3Q5IA 2QKWB 3GBZA 1H1QA 2XNBA 3H9RA 3R9NA 4CMTA 3BYOA 5ANJA 3O2MA 1H1SA 4AXAA 4HPUE 2W9ZB 4F63A 4RZWA 1U54A 4KAOA 5IQFA 2HELA 5I4NA 3PSCA 2P3GX 5H8EA 4L3PA 2FSTX 3LCSA 4MNEA 4BHZA 3ODZX 3QZIA 4M68A 3W8LA 4GFOA 3U51A 2VTIA 2XKEA 4O0UA 2WMSA 4IFCA 2PUPA 3FSFA 2V55A 4ZK5A 4EUUA 2W96B 3PZHA 3HMPA 4YPSA 5KCVA 4TNBA 2J0MB 4ACHA 3MIYA 3NYNA 4F0GA 2O64A 5HCZA 3OTUA 5J1WA 4FEUA 4O84A 4WNOA 3V01A 4PP7A 2W1EA 5L8JA 2YIXA 2XIZA 4GKHA 1URCA 2BFXA 4LMUA 2RG5A 3EQFA 4IMYA 4NH1A 5M09A 1W8CA 4LFIA 4RIXA 1M7QA 4V0GA 2QOCA 1YKRA 4QP4A 4BFMA 5CVGA 1CKIA 5FLFA 2UW9A 2ETKA 5CU0A 3S2PA 3VS4A 2VTOA 3GC9A 4OTFA 2OKRA 3MPAA 5EG3A 3NYVA 4CFFA 3PXQA 3NNVA 5C1QB 3FZOA 3EN4A 3MJ2A 4CQEA 2XUUA 4LYNA 1YRPA 1MUOA 3KMWA 2NNWB 3DV3A 3R63A 4U80A 4GMYA 4WHZA 3LXKA 5IMEA 4O7WA 4PTCA 5DR9A 5J5TA 2OZAB 4PPBA 3HMIA 1PXJA 5HE1A 1JPAA 4FIGA 5DIAA 3ALOA 4C4HA 3FMLA 1FINA 4E4LA 3EH9A 3AMYA 5DEWA 3BU3A 1PXMA 4NEUA 4Z7GA 5AX9A 1ERKA 4EH5A 2BRHA 5A6OA 5HIBA 2JDVA 3NUUA 3OWJA 2J4ZA 2B9JA 3QWKA 5E4HA 1GNGA 4QNYA 4I0TA 5CSWA 3DCVA 2QCSA 5EKNA 4RIOA 1Z57A 3PIZA 4ASXA 2PMIA 5IU2A 4RBLA 4E5WA 2BDWA 2WXVA 1REKA 4FOCA 3G6GA 4DFNA 4IWDA 2PE1A 4E93A 3RPRA 3HV4A 4PWNA 2CNUA 1BI8A 3THBA 2X7GA 3DB8A 5A4CA 3PLAE 3PZEA 5J87A 3K3IA 4BDDA 5IUHA 4DFBA 3HRBA 4WBBB 5HICA 5CNOA 5DT0A 4ZAUA 3QCXA 2VWZA 1TQIA 4BIBA 4FSZA 3PJCA 5ACBC 3R9HA 2WQMA 4O7VA 4N0SA 4XMOA 5KX8A 2VX0A 5L4QA 3HV3A 2EXCX 3JUHA 1ZRZA 5AV4A 3HRCA 1U5QA 5KNJA 4PV0A 2HY81 4I23A 2XNPA 4USFA 3CD8A 3FKLA 4D5HA 4H05A 2QQ7A 5J9LA 4YPDA 2OJJA 3AC8A 3QRIA 1T46A 1W0XC 3RNYA 3QTQA 4IZYA 5GJGA 2IVUA 3EIDA 5AV3A 2PMNX 3RHKA 3CLYA 4FV7A 4JDJA 5CU2A 4ZJJA 3MESA 4FKVA 3VN9A 5J95A 1XH8A 3HV7A 4WNMA 4KIPA 4EOKA 5BMSA 2QD9A 4IZAA 4BBMA 4QNAA 4KKHA 3O17A 3SW4A 3HP2A 3R0TA 2X2LA 2W17A 3V8WA 1XBCA 3QRTA 1S9JA 1OIYA 2XIXA 4IAZA 1YXVA 2YDKA 3P79A 2IJMA 4F7SA 4Z55A 4F08A 3D14A 3RWQA 4FV4A 1QL6A 4JR7A 4GH2A 4ZTLA 4E6CA 4FKTA 1OUYA 3TEIA 3PVWA 2EB3A 2CCHA 4AA5A 2J5FA 5ANOA 4F6UA 3UIMA 3O8UA 2PZRA 3PG1A 4IACA 4IVAA 5AP5A 3ZH8A 5KBRA 1KE8A 4X2GA 5FWKK 5E8ZA 2BPMA 4ASDA 2J90A 2J6MA 1DAWA 1FGIA 4UYNA 5AP2A 5AUYA 4YJVA 4UMRA 1MQBA 4RWKA 2UW7A 3E5AA 4EK8A 5I9YA 3ATTA 3NW6A 4MXZA 4AA4A 3D7TB 1A48A 5TE0A 5ITAA 3LXPA 2GNJA 2Z8CA 2C1BA 2JLDA 4RIWA 3U55A 4FSYA 2UW6A 2PVLA 4FG7A 2WQBA 1IAJA 3WF6A 2GFSA 3GU4A 2Z7RA 4FTQA 3OCGA 5GZ9A 3RWPA 5JN2A 3ZC5A 3GC7A 3TCPA 4C34A 4HVSA 3MFTA 3O8TA 2C47A 1ZOHA 4GL9A 2V0DA 4EOPA 4L45A 2QONA 3S1HA 4E6QA 4FVRA 3QTZA 4YO6A 2E9PA 4RFZA 5AR8A 5ETIA 5D7AA 4CV9A 2UZTA 2Z02A 4O7ZA 3P1AA 2JITA 4C2VA 4BCMA 3MTLA 3LCOA 1VYZA 4C37A 3PA5A 3QA0A 3Q2MA 3A62A 3JR1A 2PVNA 3BV3A 4FV3A 3TG1A 4IIRA 5AUWA 3RJCA 2EWAA 4W9XA 1Q61A 1JNKA 2HCKA 4EC8A 4GUBA 3TIZA 4K11A 4NIFA 3T3UA 3UP2A 3HKOA 2W9FB 3UPXA 3TM0A 5AP3A 4JXFA 3ACJA 5JH6A 4R77A 3OBGA 5HE2A 5H2UA 2W4OA 2YDJA 3HMOA 4EZ7A 1P5EA 3KQ7A 3SGCA 2NO3A 4NYEA 4FNYA 4BDHA 4FSMA 3F3ZA 4WO5A 2Y8OA 2I0HA 4F1OA 1OECA 4RG0A 5A4TA 4YZDA 4BF2A 4J8MA 4EBWA 5K0XA 3R1QA 4FL1A 4QMTA 1KE6A 4PNKA 3C9WA 2FYSA 2C6KA 2VD5A 1PXLA 3AT3A 2Z7LA 3FLWA 3LOKA 1OKWA 4J97A 3VUIA 4IW0A 5LMBA 3CGOA 4FKOA 5BYZA 4DC2A 1M14A 4LL5A 4ARKA 5AX3A 5FTQA 4BIEA 2VTAA 3D5WA 4I41A 4CLIA 2XKCA 5KZIA 3T3VA 4RGJA 4YC6A 3U4WA 2VO3A 4USEA 4TYHA 3KC3A 3LM0A 2JAVA 3EFWA 3MGYA 4J96A 5CVHA 4FGRA 2Y6MA 2YZAA 4I93A 4AAAA 4ASEA 3CC6A 4JL9A 5J1VA 3N51A 4MCVA 5BNJA 2Y4IC 3MIAA 4Y83A 4D0XA 1FVVA 3SQQA 4R5SA 5EW9A 3T9IA 4YJQA 2FVDA 2WMRA 5CEOA 4PDSA 4FX3A 4RWJA 2GNIA 2P4IA 2XK4A 1OB3A 3UOLA 3V5PA 5AAGA 1G3NA 2WO6A 2ZJWA 4QP9A 4IFGA 1H01A 2JGZA 3W2RA 4YU2A 4CZTA 5GIPE 2WZJA 2IN6A 5E8UA 1BYGA 2PE2A 5K9IA 4AGDA 4XG3A 5IMXA 4Q9ZA 3SG9A 3IG7A 1MRVA 2XJ0A 4JOAA 4NW5A 5EM8A 3VUKA 5JFXA 3OG7A 3BV2A 5CQUA 2GTMA 3G9LX 2OH0E 3F2NA 4L9IA 3R7EA 3R8VA 1GAGA 2IVTA 4BKYA 4EHGA 5JGDA 4BCJA 4HVIA 3TNHA 4QMXA 2KULA 4XLVA 3IGOA 4UXLA 1J1BA 4M0YA 4N4SA 3FMMA 3S00A 1FGKA 3DBCA 2BIYA 5BVWA 3COMA 2G2HA 5IG1A 2W05A 3EL8A 4UWBA 3QUPA 4TNDA 4NSTA 4ZXTA 1UU7A 1J1CA 4J98A 4YNOA 4AT4A 3UZPA 2F2UA 1SVHA 4IWQA 4UMQA 2W4KA 4EOMA 2XM9A 5CF5A 3DTCA 4KIQA 4APPA 3I6UA 3IECA 4KIKA 3TDVA 1URWA 2O3PA 2EB2A 5FXRA 4PRJA 3BLHA 5CANA 1M2RA 3GFWA 3GOKA 1PMVA 2QU6A 3I79A 4IB0A 4BCGA 4IHPA 3PDTA 3Q5ZA 1W82A 2R3QA 2YISA 1WBVA 2VWXA 4WIHA 2JC6A 4ZZMA 3IPHA 4XG6A 3IW8A 5HG7A 3NVKI 3BE2A 2OIQA 2ZV2A 3GQLA 1BUHA 1WBOA 2I0VA 4R1VA 4U43A 2QU5A 1YW2A 3C0GA 4DINA 4BN1A 4ANNA 4K1BA 3NLBA 4OTWA 2YITA 2YM6A 3QLGA 4PTEA 3ENHA 4JRVA 2XKDA 2X4FA 1W84A 2VRXA 4RFYA 1XHAA 3IO7A 3KXNA 4GCJA 2V5QA 3RP9A 3C4CA 2C30A 1J7LA 2GQGA 3R1YA 5AR2A 3C5UA 3V3VA 4QMQA 2BTRA 1JSTA 2X8DA 1OL7A 1OM1A 3MA3A 3ZDIA 4C3PA 3BYSA 4B9DA 4RVKA 2X0GA 3NYXA 3DQWA 3EWHA 4C3FA 1HCLA 2PL0A 3Q9ZA 2RL5A 2Z7SA 4G5JA 4C8BA 5GIOE 4F0FA 3DXNA 1TKIA 2V7OA 3F82A 4KB8A 2YABA 4YBJA 4B8MA 3DJ7A 3BHUA 2X2KA 4MXXA 4YLLA 2EXMA 4ZLOA 1OL2A 3CTQA 4BICA 3DJ6A 2OFUA 5E9EA 2H34A 5IUIA 5L2QA 3EKNA 3FXXA 4FT7A 1ZYCA 3FLZA 3DNDA 1SM2A 5DPVA 4IB1A 4QP2A 3BPRA 4GU9A 5AFVA 4ONAA 3L9MA 2VTJA 2AUHA 2XP2A 3CEKA 3KB7A 4M84A 4WA9A 5AAEA 5LARA 3KXHA 2QHMA 3KMUA 3R7OA 3PIXA 4FKGA 4IWPA 3REPA 3KVWA 3QX2A 5C4LA 2H6DA 3WIGA 4BTKA 4XV1A 2WU7A 4FTUA 1Q8YA 3IW7A 4NKAA 4GU6A 3VF9A 2PSQA 4EYJA 4MH7A 2XEYA 4CKIA 2C0IA 3CD3A 4RRVA 4H36A 3U8WA 2YM7A 2WTWA 5J9ZA 4JT3A 4MX9A 5LVLA 3LXNA 5ANKA 4TL0A 1OPKA 1SMHA 3DKFA 4OTRA 5HLNA 3R7IA 4ZY4A 4M66A 2HIWA 4FSWA 3P7CA 1L8TA 3MV5A 3QAME 4ZJIA 1F0QA 2W1ZA 2YCQA 4FZ7A 4ALWA 1BKXA 1PXNA 4F99A 1WBTA 4O21A 3LE6A 2CNQA 2VTMA 4APCA 3DBEA 3IDPA 4AF3A 3ZS5A 1Y6BA 4H39A 4YO4A 3BYUA 3FXWA 3LIJA 2QO2A 3Q2JA 3ZSIA 3SW7A 1YXXA 3DAKA 3QZHA 3FKNA 4OBPA 4ID7A 2OH4A 4NJ3A 2E9NA 3RPOA 2NPQA 3TXOA 4LUEA 1W83A 5EYCA 5CALA 3UO5A 3TUCA 4YP8A 1ZMVA 4GG5A 4DTKA 5CAQA 2XJ2A 2J0IA 5EDPA 4PDOA 2QURA 3CQWA 3VVHA 2B9IA 3T9TA 4JNWA 4D4RA 3PVGA 3D15A 3OEFX 2JBPA 2Z2WA 3HV5A 4JDIA 3M2WA 4O0VA 5IH6A 5F4NA 4AGUA 4C61A 4CD0A 3EZVA 5HO8A 4AX8A 5GZ8A 4XBRA 2P55A 1JSVA 4FV5A 1SVGA 3I0OA 5FDPA 2FSLX 4IE9A 2VZ6A 4PMTA 3E64A 4PMMA 4KS7A 4GIIA 1XKKA 3T8OA 1XH4A 1YOLA 4D1SA 2HWPA 5DR6A 3RAIA 3RK9A 4C35A 2PTKA 2ITUA 3UOHA 1SNUA 1IRKA 1WVYA 5KE0A 4BGQA 4XNEA 4WG4A 4FL3A 5AUTA 4ITHA 5BX0A 4G1WA 5M51A 5JQ5A 2VNWA 3L9NA 4ZZOA 2I7QA 3VS6A 2BDJA 3ZZWA 4FTIA 1K3AA 5C03A 2PMLX 4BCNA 4DYMA 4B4LA 2ITQA 3BCEA 2X4ZA 2I6LA 3C4XA 4O0TA 3VNTA 1ZWSA 3C4ZA 1KSWA 3G2FA 1OUKA 4ZMFA 3QCQA 4E73A 3SDJA 3VRZA 2IW9A 4ZY5A 1ZZ2A 3LJ2A 4JIKA 3VWAA 3HX4A 5GJDA 4F65A 3DKGA 3UMWA 5M4UA 3WZJA 4I3ZA 3RK5A 2JIVA 4CFVA 5KKRC 3W2PA 4AOJA 5LQFA 3UYTA 4ACGA 2UZBA 3R01A 3R9DA 5CXZA 4LV8A 2HZ4A 3TZMA 4KBAA 4EOLA 5CI6A 5KMLA 1OBGA 4KWPA 3RVGA 4RJ3A 5AEPA 3C1XA 3KXMA 2BIKB 1Q24A 5D12A 4ACCA 3V5TA 4C36A 2OF4A 3K5VA 2ERZE 4IWOA 4L67A 4L7FA 5LWMA 2GNLA 4EWHA 3BHTA 1APME 1Q5KA 2OW3A 2P0CA 1IA8A 4JIAA 4QMSA 2YERA 3GUBA 1XR1A 2WIHA 3FL5A 3IW6A 2UZWE 2XIRA 4FZDB 3VBYA 1ZYDA 1S9IA 2ITZA 3E92A 5CEMA 5DT4A 3QA8A 5M07A 4JJRA 3P9JA 5CS6A 4M15A 1JBPE 5JKGA 5IKWA 3QTWA 3QU0A 4E5BA 3FKOA 4W9WA 3KRLA 3AMAA 5EDRA 4F09A 3ZO4A 3PXKA 1PMUA 3P7AA 3D5VA 5IDPA 3ATSA 3G15A 1PRYA 4FNXA 1P2AA 3WF5A 4CNHA 5JZNA 1ATPE 4FT5A 3KGAA 2Y0AA 3PWDA 3R22A 3FZPA 4X3JA 4ZS0A 1OKYA 4HW7A 5DHJA 3R7YA 4PL5A 2VU3A 1G8AA 3ALNA 2C5OA 1OIUA 2AC5A 4PPAA 3LAUA 2QI8A 4O22A 3PXRA 3QRKA 4FNZA 3F5PA 5JSMA 5D10A 4HCTA 4H3PA 2BCJA 3HP5A 4NFNA 4F0IA 3S4QA 3VC4A 4JG6A 2QOIA 4IVBA 4N6ZA 3R7VA 5IQIA 4FKWA 4RA5A 4TYEA 2ITNA 4A07A 5L6OA 2YWVA 1UWJA 1XH9A 3H10A 3DZOA 4N6YA 2W1DA 5HIEA 1V1KA 3UC4A 4L52A 3AXWA 5D1JA 4BTMA 2HZ0A 4EK4A 3Q4UA 4QMWA 3DNEA 3UC3A 3PXYA 2WQEA 3TKUA 5LMKC 5IF1A 2YLFA 1A06A 1UKIA 4GYIA 2WMUA 5CVFA 2PUIA 4FF8A 4O83A 4MQ2A 2GS2A 3N9XA 2J50A 2UVXA 4MWHA 3R73A 2QC6A 3QQJA 3TN8A 5IH4A 2X81A 5IQCA 1G5SA 4ASZA 4XJ0A 3V51A 1PMNA 3ZSGA 3FMDA 3JPVA 5D41A 3VQUA 3F6XA 2CLXA 4JAJA 4F6SA 2PY3A 4GEOA 5BVFA 4AZTA 4MXYA 3KVXA 1ZAOA 4YHFA 1OL5A 4QOXA 4F64A 3QCYA 1YDRE 4R78A 3P7BA 4LL0A 5I3RA 2PUNA 4U79A 4X3FA 2VWBA 4QP7A 5DNRA 4FK6A 3QHWA 4BDKA 3NNUA 4IVCA 1IA9A 2YCFA 3EQPA 3BIZA 4JAIA 4PF4A 2BHEA 1HOWA 4I0SA 3E8CA 4KKEA 5T3QA 2BR1A 4O81A 3P08A 1R0EA 3OMVA 3UO6A 1P4FA 5DRBA 3S3IA 2E2BA 4D4YA 1ZXEA 1XBBA 2O2UA 2OI4X 1VYWA 1NXKA 4IC8A 3BEGA 2WQNA 4FC0A 4DTAA 3OFMA 4MWIA 3RTPA 2JBOA 2CN8A 4DH7A 2YEXA 3LLTA 5FUTA 3QRJA 2ONLC 5FBOA 4AE9A 4C02A 5HNIX 4WKQA 3Q6UA 3TNIA 2ZV7A 4AOTA 2FB8A 4O91A 2IWIA 4D1XA 1WBNA 2VV9A 5CSPA 3LFQA 3K54A 3W2CA 5M4IA 4O0WA 2QKRA 3OW3A 5EQPA 4D2RA 5CLPA 3QBNA 3R2BA 3F7ZA 4RIYB 4AT5A 4CSVA 3LMGA 3OT3A 5HESA 5CEIA 3R7UA 4GS6A 4TYHB 3KRRA 1UNHA 4EH2A 3AGMA 3BEAA 4CT2A 3RAKA 5KMJA 2ITVA 4RZVA 5EYDA 3SHEA 4WUAA 2ACXA 5CZIA 4UXQA 4IXPA 1Q99A 1YI4A 1H26A 3HYHA 2ZDUA 2H9VA 4BRXA 3PLSA 3VS2A 3O7LB 5HTIA 3FLYA 1B38A 3MSSA 5FTGA 4MTAA 4CVAA 3D94A 4IZ5A 4D5KA 2VTPA 4FZ6A 4ANQA 4DEGA 4MKCA 3L8PA 3QUDA 4JX3A 4R3CA 1CSNA 4FIEA 4GJ2A 3P23A 4U81A 4PL4A 4BGHA 3K5UA 2WNTA 3F5UA 2W06A 4FICA 5DG5A 4WRSA 1AD5A 2XK8A 3WARA 4AW1A 2JKMA 3LHJA 1H1PA 3KRXA 4FKQA 4AOIA 5CEPA 4DAWA 4AA0A 2X2MA 4R5YA 5FEQA 4LGDA 3ORIA 2VGOA 1ZOEA 2X6EA 4EK6A 5HVKA 1MRUA 2B1PA 5LWNA 3R8PA 3TDWA 4FV2A 3ZSHA 5AR7A 2YM5A 3RCJA 3U9CA 5IPJA 1IAHA 4DGMA 3BGQA 2VX3A 2CGXA 4D28A 3EFJA 3M42A 1O9UA 3UVRA 3VW6A 3VBTA 4E5AX 4BCOA 2BAQA 5HNGA 4G5PA 4O6LA 3WOWA 2BRNA 5H8BA 1FVTA 2XK9A 4FVQA 1KE9A 2HWOA 2XK6A 3G0EA 1XO2B 5BUEA 3WE8A 5IISA 1H08A 2V7AA 3WF9A 3BELA 2GQRA 4DLJA 5B2LA 3FPMA 4X21A 5DYJA 3BE9A 5J9YA 5CF8A 3EMGA 3CQUA 3QD2B 3GCPA 3ZBFA 5JMSA 1V0PA 4OTIA 4QPMA 1WBSA 4XG7A 4HYHA 4EH8A 3ZM4A 2GNFA 2DS1A 4NL0A 4ANBA 2OG8A 2A2AA 3SRVA 4CFMA 4D2SA 4EH3A 3ZEWA 5K5NA 2LAVA 4C7TA 3KREA 4L8MA 3H9FA 4HPTE 3R8UA 3FMJA 3QTXA 4S30A 2JKQA 3FZRA 4XH6A 3UG1A 5CAOA 1FMOE 3C4EA 3ET7A 5J7HA 2VTTA 4M8TA 3F9NA 2QOQA 3AD4A 3Q4ZA 2QOBA 3FE3A 5CAVA 1UVRA 5L8KA 3F66A 5AP4A 3WZDA 3CSVA 1OPLA 3AD6A 3DKOA 4GV1A 5EQYA 2QHNA 3DAEA 3NPCA 5CU3A 4PNIA 4BCHA 5FTOA 3BKBA 5ETCA 4YUQA 5H3QA 4JBOA 2F7ZE 3UNJA 3TKIA 1JSUA 5AR3A 1KOBA 3KN5A 4NM7A 4CYIA 1F5QA 2ZVAA 1Q97A 1Q3DA 4ZSAA 4FEXA 4OTQA 4MD7E 5KMKA 2XA4A 3L8SA 4FBXA 4I6HA 1Q8WA 5EW3A 4YJOA 3G5DA 3RALA 4GKIA 4N57A 1BI7A 3E8DA 1VEBA 2EVAA 1WVWA 4WBOA 3ZLXA 2CDZA 4A9TA 5EOLA 4EKLA 3QC9A 4ERKA 4BY9E 4ZY6A 3CQEA 2GHGA 4X2NA 4BR3A 1J7IA 3N4VA 4II5A 1AGWA 4YJSA 3CPCA 5LMKA 4G6NA 2OFVA 1UNLA 4MF1A 2JIIA 3R1SA 4R8QA 1GJOA 3OROA 1TQMA 4RVMA 3PE2A 4UBAA 3UMXA 3OUNB 3JY9A 4XP0A 4IADA 2IZUA 4ITIA 5ETFA 2RFSA 3ITZA 3OCTA 3FPQA 3FC1X 3O51A 4I5HA 2B9HA 2BHHA 1BLXA 3MFUA 4EHVA 2W1FA 3U6JA 4YSMA 4QP3A 3GP0A 2WMWA 4YZNA 5L3AA 4HYSA 2R3KA 4W4XA 3H9OA 4O6EA 4W4YA 4YC8A 2JKKA 1FQ1B 2YLEA 3VRYA 3KULA 4XV9A 4P5ZA 3M1SA 4ANSA 3IONA 5I9UA 1PXPA 1OGUA 1QCFA 3OCBA 4HCVA 2YFXA 3AGLA 1LP4A 3Q52A 4BB4A 4KA3A 3HMNA 1QPJA 5D9HA 2VWUA 3DGKA 4FGBA 2BTSA 4NCTC 4DT8A 3FMHA 3CGFA 2WMXA 1Q62A 1ZMWA 3QX4A 4G6OA 4FTAA 4D2VA 4IQ6A 4UZDA 3POOA 2NRYA 4L01A 4U5JA 4IB3A 3IKAA 2XK7A 1K2PA 4M67A 3QL8A 5M08A 5CSVA 5B7VA 1GIIA 2BRBA 4A4XA 1SYKA 4IBMA 5K3YA 2B0QA 3IDBA 3EN6A 3RPVA 4MF0A 2PPQA 3LKMA 4LRKA 4DEEA 4YSJA 1H25A 5HD7A 2J51A 4RC4A 2C6EA 4FIHA 1XWSA 3RZFA 5FG8A 1ZARA 3A4OX 2UZVA 3I7CA 2C5YA 4B99A 4J71A 4M69A 2OSCA 3HGKA 3AT2A 3PJ3A 4IM3A 4D1ZA 4D4SA 3HL7A 4BCQA 2CGVA 4GK3A 3ZEPA 3FEGA 1WAKA 3GXLA 4H3BA 3COHA 2FUMA 3KN6A 3DAJA 4Q9SA 4OAVB 2ITYA 2SRCA 3QGWA 4S2ZA 3BYVA 1OZ1A 2HYYA 3RINA 4XBUA 1XBAA 3MFRA 5E8VA 1OIRA 1Y6AA 3R8LA 4GVAA 3FI2A 3QQUA 3NR9A 3SV0A 3TKHA 3RM7A 2Z7QA 3RNIA 4G17A 5L2TA 4RT7A 3C51A 4YTIA 3B2WA 4MYGA 4P2KA 2CCIA 3FMEA 4FTRA 5FP5A 5EK7A 2VO6A 3SKCA 4YHJA 4JG8A 5E91A 4ZIMA 5CENA 3LMIA 1IASA 4LG4A 5F95A 3TZ9A 2QO9A 5BYYA 5M56A 4BC6A 3JXWA 4BCPA 1R1WA 5H8GA 3Q53A 3O50A 4BI1A 4F1TA 2CN5A 1YI3A 3BHYA 4MAOA 2REIA 4JS8A 4R6VA 4R7BA 4RC3A 4FYNA 2X8IA 4ZJVA 3EFKA 4DGGA 4EEVA 3E7VA 4L6QA 1DM2A 2X1NA 4IANA 3BZ3A 5HO6A 5A14A 1I44A 2BMCA 4HNFA 2QOOA 4TW9A 2C5XA 4AFJA 3R6XA 4D4VA 2IVVA 5EH0A 3VULA 1F3MC 4C4EA 4DG3E 3ROCA 4EK3A 5EFQA 3PP0A 2B53A 3HUBA 3QRUA 3A8WA 4QQCA 5BVKA 3LQ8A 3N4TA 4F4PA 2EXEA 1KE5A 4U8ZA 4QPSA 1PKDA 3UO4A 4RMZA 3FQSA 3KK9A 4FI1A 4QMUA 1DI9A 3QLFA 3IGGA 5I3OA 2UW0A 4TKSA 4CGAA 3PVBA 2Y7JA 4CKRA 2HOGA 2PVJA 4B0GA 2OJIA 4DFXE 4S31A 5CT0A 2JKOA 3DQXA 3V6RA 4WSYA 4CFUA 5HKMA 2X7OA 5FXSA 4ITJA 5KUPA 4LOPA 4EONA 5ICPA 5CX9A 3COKA 3WI6A 5DRDA 2E9OA 4ZTMA 3DFCB 2OK1A 3A99A 2XNGA 4GT3A 4BTJA 1YOJA 3E63A 5E8TA 5LOHA 3P5KA 4YJNA 4O0SA 3CXWA 2C3LA 3R71A 3DTWA 2JEDA 3OEZA 3VF8A 1W98A 3TL8A 2YM4A 3F3WA 1YI6A 3VBXA 2GS7A 2PHKA 2JDRA 2WTCA 3LFDA 3OXZA 4TWNA 1OKVA 3A8XA 4I4EA 3UJGA 1O6YA 3KF4A 4OTGA 3UDBA 5EI8A 3WZUA 3ZO3A 2WMVA 4JBVA 3SC1A 3PRIA 3ROYA 5F9EA 4I21A 3A60A 4RQVA 4Y85A 4O7SA 4F9AA 4C4GA 3VJOA 3OOMA 4FT9A 4BDAA 4ZLYA 5KBQA 3VUMA 4KUJA 2QVSE 4O0RA 1U46A 3KU2A 2C0OA 3O23A 5DGZA 5EHOA 5E1EA 2WEVA 1JKLA 2XBAA 2VWVA 2X6DA 4ZTHA 3SLSA 4CZUA 4ACDA 4FSRA 4BIDA 3EFLA 5C27A 5LCJA 1U5RA 2GNGA 5GINE 4F9WA 4GK2A 4E8AA 2FO0A 4IB5A 4JDKA 2C6MA 3O96A 4RLLA 4MXOA 2OXYA 1E1VA 3QQGA 4TY1A 2WTJA 1WFCA 4CCUA 3LFBA 2W1CA 3U87A 3ULZA 3UNKA 1ZYSA 3TT0A 2OU7A 4W4VA 4K6ZA 4EZ5A 2R4BA 4JRNA 1OVEA 2WPAA 5JRSA 4RJ5A 3V5WA 3ZYAA 2QOKA 3JS2A 4J8NA 4X2KA 4Z16A 4CG9A 3HA6A 3AT4A 5EDQA 1ZY4A 4LI5A 3O71A 3B8RA 4FT3A 4U9AA 3FXZA 5DMZA 3ENMA 2J0KA 3RMFA 5HLWA 4EWQA 2C1AA 3KXGA 1L3RE 2JDSA 3QHRA 3FC2A 3DBQA 4FZFB 4Z9LA 1GIHA 3G90X 1SZMA 4U7ZA 3TNQB 3TNPC 4IAKA 5KO1A 2OZAA 3BU5A 4DH3A 4FA2A 2VO0A 1YDTE 3MH3A 3OZ6A 4M14A 3MN3A 5A9UA 4GRBA 1LEWA 5HE3A 3LZBA 2XM8A 3C0HA 3CJGA 1DI8A 3NWWA 5ETAA 3VS1A 5IH5A 4MVFA 2WU6A 1R78A 3ACKA 3V8SA 1UU9A 4PP9A 3QTSA 5BQ0A 4ZS4A 2IVSA 3NNXA 5GHVA 3C0IA 4FR4A 4ZTRA 4IX3A 4AWIA 1J7UA 2BZIB 2F2CB 3NCGA 2CKQA 4CEGA 3NIZA 5IQDA 5DVRA 3RPYA 2E9UA 4RX9A 2A0CX 3EQGA 4NCTA 4Y46A 1B6CB 2UW3A 3SA0A 4BDGA 4CMUA 5C8MA 3UG2A 1Q8TA 3ORTA 5JZJA 3SD0A 1OL1A 1SVEA 2VAGA 1YHVA 3D0EA 3PP1A 4FT0A 4I94A 2IZRA 5EW8A 4DN5A 3TTJA 5HTBA 3R9RA 2CPKE 2J9MA 2ZM1A 4D2PA 4LRMA 5CASA 3PUPA 2HW7A 3V04A 5AUVA 4DEHA 3ZM9A 2CGWA 3EQDA 4QRCA 4RC2A 5J5SA 4BDIA 3FJQE 4K2RA 3TV6A 3ZMMA 4XUFA 3H3CA 4G3CA 3SXRA 3UZTA 4WOVA 3NSZA 4C58A 3KA0A 3GU7A 3O8PA 3CBLA 3WYYA 1A9UA 1U54B 1YVJA 4ZSLA 1GZNA 1YWRA 4QYGA 4O7TA 4FNWA 4Y72A 2PWLA 4FKLA 4KRDA 4MNEB 1DAYA 5TO8A 3QZGA 5E8SA 4GYGA 3DXPA 3JYAA 3MY1A 1O6LA 4O1PA 1GZOA 4U97A 2QODA 2QG5A 4C38A 4FV0A 3QTIA 4G9RA 4L3LA 2IW6A 3POZA 5I9ZA 4MBLA 4UZHA 4TYGA 4XYFA 5DN3A 3R28A 4MD8E 3SOCA 3G51A 3PWYA 2XF0A 4UB7A 4DEDA 3RAWA 3LCDA 4AGWA 4QT1A 3FZSA 4AE6A 3ZBXA 1LR4A 3VQHA 4CMOA 4G2FA 1NT2A 3GT8A 2RFDA 4RIXB 4Q2AA 1STCE 4V0GB 1XJDA 2R3PA 4HYIA 3NUSA 3NNWA 3IOPA 4JG7A 5LVOA 3PE1A 4RWLA 4KRCA 3W33A 4DLIA 3OUKA 3RPSA 5FM3A 4KS8A 3ZFXA 4ERWA 5HORA 4NUSA 4N70A 4E4XA 4JBPA 2ZMDA 3MW1A 3PYYA 4L42A 5JGAA 1PXOA 2GFCA 4BCFA 3C4WA 4CV8A 3W55A 1O6KA 2R3IA 5CAUA 4IAFA 2QLUA 2WMBA 4RFMA 5FDXA 3TV4A 4BCKA 3LFFA 1NW1A 3NVMB 3P78A 1H4LA 4GK4A 2JFMA 1W7HA 3IW4A 4FL2A 1XH5A 4YZCA 5E90A 3EQCA 3HNGA 3GU5A 5TKDA 1JQHA 3VBVA 4D2WA 4YJRA 4DBNA 3UIUA 2BFYA 3MA6A 1REJA 5M53A 4G3EA 2VUWA 3ZONA 1Z9XA 3CCNA 4QQ5A 5JFVA 3DBDA 5AAFA 3ELJA 1ZMUA 1ZYJA 2ZYBA 1LUFA 4TWPA 4OW8A 4BVUA 3GB2A 4CQGA 4FKIA 4LUDA 1UKHA 1JKTA 5IA0A 4H1JA 2G2IA 3VHEA 4F7JA 5AP0A 4DCEA 3UVPA 4TN6A 4BWKA 3A7GA 2BILB 1YHWA 2KTYA 3EB0A 3PPZA 4XG8A 3RM6A 5BUJA 5IZFA 5ACKA 3NIEA 3QZFA 3L9LA 4JVGA 2ZV9A 5DLSA 4E7WA 2XS0A 4Y5HA 4UWCA 3ZO2A 4HGTA 5DE2A 4PUZA 1QPEA 2UVZA 3OWKA 3I81A 4R7IA 4D55A 1UWHA 3E93A 4C4FA 3ZFYA 2BUJA 2BZJA 4XEYA 3HRFA 5FEEA 3UYSA 3DPKA 4RX7A 2ESMA 3CR0A 2OLCA 5AV0A 3RGFA 4QD6A 4L7SA 3TTIA 4BDFA 4CFWA 4C59A 3KK8A 3A4PA 5AA9A 5M55A 4QO9A 2J7TA 4JQ8A 3LFAA 2GDOA 3N4UA 3DOGA 2ZM4A 2RF9A 1OIQA 3AC3A 4ALVA 3GOPA 3OY3A 3H4JA 1K9AA 2OWBA 4K77A 4BDCA 2ZMCA 3QD3A 3UTOA 3EL7A 1Q41A 3F61A 1PXIA 3IW5A 3R00A 3R2YA 4RSSA 4Y5QA 5AIRA 2CGUA 5BVEA 4E4NA 3WIKA 4OT6A 4AUAA 4O7LA 4L53A 5A54A 5HO7A 4C2WA 4G3FA 3KCKA 4DGLC 4WSQA 3ZOSA 5CNNA 5M4FA 4O7NA 4J53A 2AC3A 3PSBA 5CTPA 4IAAA 2C68A 2YM3A 2BZHB 4DFYA 2R3HA 5A6NA 2V62A 3EQHA 1Q8ZA 4I0RA 4A9YA 5JRQA 2G15A 2XBJA 2C6DA 4IAYA 5EM5A 1OPJA 3IDCA 4E6AA 5TT7A 1Y8GA 4IM0A 4MNFA 4RJ7A 5HE0A 5I9WA 2YIRA 2CSNA 3VAPA 4QYEA 4FTKA 4DEBA 2VTLA 3O0GA 5CZHA 4HVDA 5KMIA 2VTHA 2ETMA 5FQDC 3MVHA 4IJ9A 4O7RA 3CJFA 3FAAA 1NVRA 5IEYA 4GSBA 3UZRA 5K5XA 3QYZA 2XJ1A 2YA9A 3TZ8A 5CEQA 4CRSA 5HG8A 4EH4A 5BUIA 1Y91A 5IEVA 2XZSA 1ZZLA 2IZTA 2QOHA 3DLSA 3TZ7A 1HCKA 1QPCA 2C4GA 3I5NA 3WBLA 4BKZA 2B55A 4B6LA 5HX8A 4E1ZA 3ZXZA 1FPUA 3DU8A 5L8LA 1WCCA 3OHTA 1IR3A 4MEDA 4NM0A 3PXFA 3KXXA 4RIWB 5HVJA 3ZUVA 2PVKA 2XIYA 3DDQA 3GENA 4DT9A 5IQHA 5IQAA 3QD0A 1P4OA 4RA4A 3L8XA 1VZOA 3PJ2A 1H28A 5M57A 4OTHA 2UZLA 4WG3A 1U59A 4PQNA 2ZB1A 2XMYA 4M69B 4FYOA 4AZEA 5EOBA 5HQ0A 5IA4A 2GQSA 4DF3A 5DEYA 5HD4A 4FK3A 1YWNA 2OICA 3GCVA 5A4LA 3LM5A 3TACA 2GHLA 3D5XA 4EH7A 4JDHA 2XCHA 3R9OA 3ERKA 4Q5HA 3BWFA 2C6TA 2YM8A 4FTMA 1Z5MA 3I4BA 5HIDA 3ZRLA 2OJGA 4TWCA 4EL9A 2P33A 3IS5A 5DR2A 4F9CA 3BI6A 5GJFA 5IA1A 4O2ZA 2IPXA 2RG6A 4F7NA 5A3XA 5TOZA 5AV2A 2WHBA 4NIFB 4YZMA 5C26A 4TZRA 4CG8A 3FUPA 3PA3A 3SX9A 3W1FA 5CQWA 4DG0E 4YTCA 1KV1A 2PZIA 4CCBA 3GEQA 5HNBA 1PYXA 3JVRA 1H0WA 5LVNA 4JQEA 3U9NA 4AT3A 5HU3A 4EQUA 4TXCA 5I9VA 4NTSA 5CEKA 4DFLA 4IC7A 2UZNA 3CE3A 3NUAA 5DWRA 1H8FA 4KBCA 3MTFA 3WILA 5IQEA 2UZDA 5A46A 4UMUA 3DK7A 4AG8A 3KF7A 2VWIA 3EN5A 3MWUA 5L6WL 1UV5A 5HG5A 4QMYA 4CRLA 2CKEA 3QCSA 2R5TA 3EHAA 4K8AA 1MP8A 3ANQA 3QXPA 1H0VA 4ZTSA 5HOAA 3UP7A 4HOKA 1R0PA 2BAJA 2YWPA 5AP7A 2WFYA 5CY3A 4D9TA 2F4JA 4E6DA 2DWBA 5HLPA 2B9FA 5AR4A 4BI2A 2YIWA 4AW5A 4FTCA 4F1MA 3LJ1A 4XLIA 3TUDA 4UN0C 2ERKA 3MBLA 5LVMA 3LLAA 2OJ9A 2WIPA 2PVHA 4KNBA 3FBVA 5HTCA 3EYHA 4EH6A 4M0ZA 4FV6A 2VGPA 3FI4A 4QMOA 2XEZA 4QMNA 3ZRMA 3ZXTA 3FWQA 2BVAA 4F6WA 5C8NA 2PULA 3IQ7A 4DEAA 3DY7A 2GPHA 2QOLA 4IAIA 4FSNA 1WVXA 2JD5A 2OBJA 2H96A 2ZV8A 3U6HA 5EI2A 2ETRA 1ZOGA 3MVJA 5EQEA 5CF4A 3FMKA 3PSDA 4FTLA 4PMPA 4DGOA 3KMMA 5L2WA 1Y8YA 3FMNA 1ND4A 2VN9A 3E7OA 2VWWA 2HXLA 2FH9A 3ZLWA 4XV2A 5HX6A 5EYMA 4UMTA 4FOBA 3VUHA 4LGHA 4RVLA 3DDPA 4YURA 4JR3A 1TVOA 3W10A 3W8QA 3AC5A 3BHHA 4ACMA 3B2TA 4EOIA 4U45A 3TIYA 3NW7A 2PE0A 1VJYA 2OXDA 2QR7A 3OP5A 3CIKA 4P5QA 3Q9YA 4QP8A 4X0MA 4PDYA 3RBWA 4KIKB 2PZYA 2BALA 2ITXA 2RSVA 4DFUA 4FZAB 4O27B 3PY3A 3D4QA 4FKJA 4KKGA 4MHAA 4Z3VA 1B39A 3A61A 2BROA 1PY5A 1PHKA 3EQIA 3QALE 2EUFB 3PJ8A 3ORXA 1H1WA 2JIUA 5KZ0A 4LGGA 3L1SA 3BLQA 3I7BA 5JT2A 2UW5A 4M7IA 3ZRKA 2OO8X 3MI9A 4J95A 3QKLA 4C3RA 1CM8A 4FMQA 4KD1A 2XIKA 5HG9A 4G31A 5B2MA 2O63A 2HW6A 5K4IA 1OBDA 4A4OA 1XH6A 4GFGA 3LPBA 2ITWA 4R1YA 2Q0BA 3QD4A 5G1XA 5GZAA 3UQFA 4NK9A 4EOSA 4IVDA 2F49A 3BLRA 5LMAA 5D11A 5HBHA 1OL6A 2UW8A 2BKZA 3H0YA 3K2LA 4X2JA 4EJNA 4OTPA 4JX7A 1YXTA 1GIJA 4ZEGA 4AZFA 3F7WA 2OGVA 3QTRA 4U44A 4OT5A 1R3CA 3ODYX 1UNGA 1KOAA 3FY0A 4FG9A 2FGIA 3Q3BA 4J7BA 4BDEA 2F7XE 4BZNA 3W18A 2IW8A 4OUCA 3UVQA 3DK3A 3G6HA 1WBPA 4EQCA 3QTUA 3PY1A 5IEXA 4XS2A 5IQGA 4AW0A 2W7XA 3BQCA 3TWJA 2PVMA 4PL3A 1PYEA 3PPKA 5BMMA 2F7EE 4YMJA 4I5CA 4B8LA 3OVVA 5JK3A 4HCUA 3CKXA 4GUEA 3ZZEA 3HLLA 2XNOA 4ZP5A 4EJ7A 2GMXA 5T6KA 5FXQA 2GNHA 2WGJA 3A7IA 4UMPA 4GG7A 5ANGA 3D2IA 4I5MA 4L3JA 3C5IA 4C0TA 3L8VA 4BWXA 3OTVA 4Z7HA 5AUUA 3NRMA 3C50A 3QQHA 4DH1A 1JLUE 4QTEA 5M06A 3ZC6A 1QPDA 4I1ZA 2XYNA 4KSPA 5B2KA 3SOAA 4S33A 4EORA 5HHWA 4MXAA 3VW8A 1H1RA 4WD5A 2X7FA 4K18A 1QMZA 1IEPA 2EU9A 3AMBA 1V0BA 2UV2A 3P0MA 3D7ZA 4YHTA 3F3UA 1UA2A 3MB7A 5EM7A 2W99B 4QYFA 2J2IB 2B54A 4YC3A 5E8YA 2CMWA 4O96A 4YZ9A 2W5HA 4XOZA 4EUTA 4HZSA 5BVDA 3VIDA 1SNXA 3FL4A 3BBWA 3GC8A 4OGRA 4YLKA 1Q3WA 4G3DA 2VTSA 3UGCA 4FEWA 2ZAZA 1GZ8A 2R7IA 4G9CA 4O0YA 4QYHA 4X2FA 5AV1A 1RDQE 4HJOA 4QMLA 3SXSA 2W5BA 5CSXA 2CNVA 5AUZA 1JAMA 2Y6OA 1EH4A 3ZLYA 3LQ3A 4NZWB 3E88A 5F1ZA 2ONLA 3FZ1A 5C9CA 3LFEA 3CP9A 3NCZA 3II5A 3G0FA 4I6QA 4IJPA 4GT4A 4R7HA 3R83A 4DITA 3CS9A 4LOQA 3KY2A 4FIIA 5FBNC 4LRJA 5KHXA 5JEBA 3ETAA 1J3HA 1PXKA 2WTKB 4W4WA 2A4LA 4BBFA 1XQZA 1ZY5A 5HCXA 5K4JA 2CHLA 2XRWA 5G6VA 4DTBA 3R8ZA 1JKSA 3VUTA 3TV7A 2UUEA 3PFQA 4FSTA 3FLNC 3MVMA 3CKWA 2R3GA 2YAKA 3UIXA 4EYMA 5L6PA 3HZTA 4NW6A 3OF0A 1V0OA 3HECA 3QC4A 4M13A 2UZOA 4YNEA 4CZYB 4F7LA 5KMNA 3SG8A 2Y4IB 2X8EA 3SXFA 3W2OA 2CKOA 3U4UA 3AC2A 3EOCA 4CYJA 4O82A 2YJRA 2W5AA 4YTFA 4WG5A 1BMKA 3BU6A 3DK6A 4K9YA 4OBQA 5ANIA 5B0XA 4QQTA 2I0YA 2O0UA 3EQBA 3MPMA 2R2PA 4OAUC 1PMEA 1NA7A 4XP2A 4BTFA 4ZSGA 3PIYA 3NGAA 3W16A 5LXMA 3ZFMA 2R7BA 5FP6A 2AYPA 4IZ7A 2YHVA 4QTBA 3BQRA 2Q0NA 5F20A 4FTOA 3NAYA 3I60A 1H27A 2QOFA 2PMOX 4IEBA 2IZSA 4EC9A 5LVPA 2X39A 3MY0A 2RFNA 1R39A 4FUYA 5CSHA 2GSFA 3DS6A 3VS3A 3RCDA 3V5LA 3UE4A 2C6LA 4RJ6A 2HZIA 4XV3A 2C69A 5HVYA 2WELA 3OCSA 4MK0A 4DFZE 3VUDA 3JY0A 3FDNA 4RJ8A 3U54A 1XH7A 2XNEA 3FY2A 3L9PA 4JLCA 4I6FA 4EZ3A 5JFSA 4O86A 4LMNA 1KWPA 4ENXA 5A4QA 2LGCA 2Z60A 3VBWA 2C5NA 5CU6A 3QQKA 4ZSJA 1VR2A 3C7QA 4LM5A 3EZRA 4BWPA 4HVGA 4V01A 4W8DA 4C57A 3UBDA 3QFVA 4J1RA 4GJ3A 3V8TA 4QTCA 5FD2A 1PF8A 5M4CA 3D5UA 2XKFA 2OJFE 3KXZA 5KMMA 3VO3A 2Q83A 4ANOA 2YJSA 4NU1A 3SVVA 5CF6A 1M2QA 4IX5A 2A1AB 4UV0A 2HK5A 2WTKC 4FIJA 3R04A 5T68A 4RIYA 2HAKA 3ZO1A 4CFXA 4ZZNA 4DE4A 3OWLA 2XK3A 3MY5A 3DB6A 2A19B 3GNIB 1I09A 3LFNA 1PW2A 5DBXA 3GVUA 4U6RA 4L44A 3ZUTA 4JQ7A 2DQ7X 1YXSA 5AJQA 4B7TA 3I5ZA 4QMMA 1FBNA 1JVPP 1RQQA 4G6LA 2XCKA 3TJDA 3LQ5A 4USDA 3WYXA 1DS5A 4S32A 2R3OA 2W1HA 5IA5A 4QP6A 3GU6A 4X6RA 2G9XA 4MXCA 1JKKA 4DHFA 4HGLA 1MRYA 2C0TA 3QGYA 4I24A 1P14A 4CTCA 5JQ8A 3E3BX 3S95A 4XP3A 5BVOA 4GIHA 4ENYA 3S0OA 3BX5A 4QTAA 5AADA 5I9XA 3NEWA 3CY2A 3PA4A 5L2IA 4BCIA 1YOMA 2GHMA 3MH0A 4R3PA 5HU9A 2QG7A 1OMWA 4NT4A 1H07A 4RJ4A 2VWYA 5E92A 3DLZA 3DFAA 3UOKA 4XG2A 4OLIA 3PXZA 2WMTA
chains in the Genus database with same CATH superfamily
5LCKA 3E8NA 4O0XA 4PDPA 3G33A 3R7GA 5FRIA 2JFLA 4AACA 3D2KA 2R0UA 5AM6A 4YJUA 3F88A 5KHWA 2OIDA 3NUYA 2QLQA 3F2AA 4A9UA 4P4CA 5L2SA 3PFYA 4HGEA 2ITPA 3LCTA 4D58A 3Q4TA 4RWIA 2X9FA 4YBKA 4AP7A 4CKJA 3VBQA 4PTGA 3Q60A 2Y9QA 3NS9A 4JBQA 3ORZA 3MDYA 3F2RA 4U3YA 3GFEA 4NKSA 4BHNA 3C4FA 4QMZA 4X3FB 2I40A 4BDJA 2YZLA 5BYLA 2BAKA 2OF2A 2VTNA 3ANRA 2XVDA 3KRWA 3CPBA 2B7AA 2C3KA 5AM7A 4A06A 4A9SA 5CYIA 4CFNA 3NYOA 4XG4A 3Q04A 4TTHB 2O65A 2AQXA 4I6BA 3TI1A 2UW4A 3CTHA 3NW5A 4AN9A 4U3ZA 2W4JA 3EQRA 4FUXA 4P7EA 4TWOA 2WOUA 4XCUA 1KV2A 3TJCA 3F69A 4GT5A 3NUNA 4OTDA 4NFMA 5D7VA 2QNJA 2BRMA 3KRJA 2I1MA 3R30A 4DH8A 2R3RA 3PY0A 5CWZA 1JOWB 2WB8A 5AWMA 4MBIA 4YTHA 2OIBA 4FEQA 4G3GA 3WF8A 3FZTA 4TT7A 5CI7A 3UPZA 2HY0A 4S34A 4RLKA 2J0JA 4LQMA 2R0IA 5EHYA 4AN2A 2NYAA 4AFEA 2YCRA 4FODA 3E87A 2R9SA 5AIKA 3LVPA 3QYWA 2V22A 4HVHA 3KIOC 4FKUA 5A4EA 3D9VA 4K0YA 2WMAA 4L00A 3DJ5A 2I0EA 4QP1A 3QWJA 3GU8A 4R3RA 4U42A 4W8EA 3ZCLA 3P86A 3LFSA 5C4KA 3M11A 3PTGA 3ZTXA 3FV8A 1KUTA 3AQVA 3COIA 3OWPA 2PVRA 4F9BA 2PUUA 3OXTA 4KINA 4BI0A 4Y73A 4MBJA 5E8XA 3UQGA 4E20A 4ZSEA 4WUNA 4CTBA 4X7QA 4O7YA 5K0KA 4NM5A 3GQIA 4MD9E 4OBOA 4C33A 1UU8A 4IX6A 4IX4A 1M2PA 5DT3A 2BZKB 3TUBA 5TF9A 1M17A 2WD1A 4EQMA 4ANMA 4I4FA 1GOLA 2WEIA 3HMMA 2QO7A 4IDVA 4BYJA 4MUQA 1RE8A 2VNYA 2A27A 1LEZA 2YN8A 2OXXA 5HI2A 5AUXA 4BDBA 3LCKA 4J99A 5DA3A 3ZLSA 2VO7A 2YIYA 4I92A 2F57A 4WNKA 2QR8A 2RGPA 3C13A 3EN7A 5AR5A 4KIOA 4X3FC 3Q6WA 3GI3A 4LDTA 3F5XA 3MYGA 1BL7A 3OS3A 3Q4CA 3RHXA 4P90A 4PX6A 4RX8A 4EH9A 4IDTA 3E3PA 4XHKB 1CMKE 5LJJA 2P2HA 4O1OA 3RKBA 2WAJA 2PVYA 1CKPA 3MJ1A 4U41A 4V04A 1BX6A 1WMKA 5KKRB 4QTDA 1BL6A 3DA6A 3R8MA 2W1GA 4PPCA 4DCAA 4L68A 5BPYA 5JFWA 1RJBA 1YXUA 3OOGA 1Q8UA 2ZB0A 3OD6X 5AMNA 4FSQA 5DH3A 5E1SA 2WKMA 2PZPA 5J7BA 4YJTA 3CTJA 4FEVA 2BKKA 3FHRA 3LJ0A 3V5QA 2C5VA 2WQOA 2XB7A 2YAAA 5AA8A 2P2IA 4AAYA 4M97A 1M7NA 4RPVA 4WT6A 3UIBA 5CT7A 2C3JA 4FTJA 3D7TA 1OI9A 4O4DA 4U40A 3QQFA 5IUGA 1ZYLA 3KEXA 4EHZA 5HZNA 1JWHA 4J52A 4EHEA 5BVNA 2G01A 2WTVA 3DT1A 4KABA 4EK5A 3UDZA 3BHVA 2BDFA 4IM2A 2O5KA 2OZOA 5EHLA 3UDTA 3SRVB 3NUXA 4A7CA 3U6IA 4GFMA 3UNZA 4CLJA 3GC0A 4BZDA 4I5PA 5HBJA 3NZ0A 4KSQA 3ID6C 1FVRA 1GY3A 3ZHPC 2E9VA 2HZNA 3PVUA 4O2PA 3FYJX 4EKKA 3FQHA 5DFPA 2RKUA 3DBFA 4EOJA 3VUGA 4Q5EA 1NY3A 3UOJA 1Q4LA 2DYLA 1WZYA 3AC1A 2UZEA 1W2CA 2ZOQA 3KL8A 4UEUA 3NMUF 4FV8A 4HZRA 2VTQA 2R3MA 3QQLA 1G8KA 4FIFA 4HGSA 4Y95A 3ORPA 3OXIA 4YR8A 1MQ4A 3VJNA 4A4LA 2CKPA 5HEZA 1FOTA 2ZM3A 4GVJA 1PJKA 3VS5A 2XYUA 4H3QA 4DEIA 2YDIA 5DI1A 2F9GA 1X8BA 3ULIA 4A9RA 4FG8A 4NTTA 1CDKA 3IK3A 3GCQA 4L43A 1LPUA 3JVSA 4YJPA 5KMOA 3NDMA 3ORKA 2C3IB 3OBJA 5AP1A 1FMKA 2XH5A 4BBEA 5CAPA 4D2TA 4FTTA 5FEDA 2R3LA 3TYKA 1ZLTA 5CXHA 4NWMA 2HXQA 4AXDA 4FSUA 5ANEA 2C6OA 2JDOA 3BWJA 3BGPA 3HEGA 3Q9WA 4DA5A 4TYIA 2B4SB 3WE4A 3F5GA 4ORKA 2J0LA 4AS0A 5GNKA 4CT1A 3FYKX 4M3QA 2JDTA 2WTIA 3ORLA 3PPJA 3VS7A 3A7HA 5I0BA 4HYUA 3HA8A 2JAMA 4FVPA 4D9UA 3BYMA 2YCSA 3F3TA 5IQBA 2PK9A 3I6WA 3EKKA 3W2QA 3F3VA 4GW8A 4H1MA 4QYYA 4V05A 4UX9A 4QMVA 4RVTA 2UVYA 3GCUA 3WF7A 4EOOA 2G2FA 2HENA 2PYWA 4FKPA 2VX1A 2PVFA 4K33A 3UODA 4DG2E 4BZOA 3KULB 3RI1A 4XX9A 4FKSA 3ZDUA 2IO6A 4AZSA 3DZQA 3AD5A 3DXQA 3FI3A 2NP8A 5C01A 3R1NA 1E1XA 2FA2A 3QKKA 4FTNA 3D83A 5E8WA 3FLSA 4UALA 4O4CA 4O38A 4DBXA 3OC1A 4M12A 3GCSA 2Y4PA 2O8YA 2PU8A 3R21A 4ANLA 3TNWA 3QXOA 4QMPA 2ITOA 3EYGA 3AC4A 4FKRA 4UWYA 3I1AA 4PMSA 3H30A 4TRLA 3V6SA 1OITA 5IA3A 2WOTA 2XNMA 3PRFA 5IDNA 3P4KA 3WZEA 4EOQA 5HCYA 1IG1A 3CY3A 2W0JA 4U0IA 2NRUA 1YQJA 4BL1A 3PJ1A 4JI9A 4TYJA 3OY1A 4YLJA 3AG9A 1M52A 1H00A 1CTPE 3BRBA 3HDMA 4AW2A 3E62A 3W2SA 5I5ZA 4WNPA 1KE7A 1CKJA 3FHIA 4AGCA 4C62A 4IH8A 5H9BA 3QKMA 3Q96A 4ALUA 3SAYA 4E3CA 2GTNA 3HAMA 2GU8A 2ITTA 2WMQA 3HV6A 1WBWA 1GZKA 3ORMA 3HDNA 2DUVA 4OR5A 4ZOGA 2CLQA 4ZMEA 2GCDA 3A7JA 5FGKA 2BRGA 3UQCA 3RZBA 1Y57A 5E7RA 2UZUE 5IA2A 3LXLA 2R64A 3GGFA 5JGBA 4E26A 3LW0A 2CJMA 3EN9A 3NAXA 4KBKA 4BKJA 1AQ1A 3NUPA 2ZDTA 3K3JA 3NX8A 4EI4A 5M44A 1UU3A 3LFCA 2B52A 3MB6A 5AP6A 3VS0A 3QUEA 4G16A 3HAVA 2C6IA 3Q9XA 3BL9A 3KKVA 4RQKA 4AU8A 3MH1A 4DDGA 3MPTA 3ZU7A 3HVCA 3O7LD 5ANDA 4FV1A 4AN3A 4DH5A 4RX5A 4QQJA 4G34A 4NJDA 2YIQA 4H58A 3AOXA 1T45A 4TPTA 3DKCA 3RAHA 1G8SA 3W0MA 3WZKA 3A2CA 2G1TA 2R3FA 2H8HA 3IOKA 4FV9A 5EYKA 1NVSA 4ZTNA 3B8QA 3KCFA 4XRJA 4F70A 3OT8A 4D0WA 2X9EA 4ZLZA 3W32A 4I22A 5EKOA 5CU4A 2RFEA 3OW4A 3MH2A 3ZUUA 5C8KA 2YACA 3MFSA 1YHSA 3ORNA 1TQPA 1J91A 4NM3A 1OKZA 4AZWA 4XOYA 2R3NA 3EJ1A 4ZTQA 3MVLA 4C4JA 2WTDA 2XRUA 3I0QA 2J5EA 2PZ5A 3H0ZA 4LOOA 4MQ1A 2RIOA 4XG9A 5F94A 4DGNA 3KFAA 5HGIA 3A7FA 5J8IA 4LV5A 1U4DA 4UYAA 3FLQA 4Y8DA 2XNNA 2GS6A 4XRLA 3E8EA 3W0NA 1RW8A 3FSKA 2R3JA 3BGZA 3BBTB 3R02A 2X0OA 1YDSE 2FSOX 4HNIA 4FJVA 4AQCA 4X6QC 3FQEA 3G9NA 4BYIA 4FE2A 3HUCA 5EM6A 4CXAA 3FI8A 3Q32A 1E9HA 4YGAA 4F9YA 2W1IA 3LMHA 1H24A 5EI6A 2FSMX 4I20A 4WRGA 5J79A 4AZVA 4UY9A 3PG3A 3V5JA 5FM2A 4BGGA 4C4IA 4QPAA 4E4MA 2VTRA 3MS9A 3QF9A 5HBEA 4EBVA 4PY1A 1PKGA 5TR6A 4YZBA 3RK7A 4L46A 3VHKA 5DOSA 2IG7A 1NVQA 1YWVA 3Q5IA 2QKWB 3GBZA 1H1QA 2XNBA 3H9RA 3R9NA 4CMTA 3BYOA 5ANJA 3O2MA 1H1SA 4AXAA 4HPUE 2W9ZB 4F63A 4RZWA 1U54A 4KAOA 5IQFA 2HELA 5I4NA 3PSCA 2P3GX 5H8EA 4L3PA 2FSTX 3LCSA 4MNEA 4BHZA 3ODZX 3QZIA 4M68A 3W8LA 4GFOA 3U51A 2VTIA 2XKEA 2X0QA 4O0UA 2WMSA 4IFCA 2PUPA 3FSFA 2V55A 4ZK5A 4EUUA 2W96B 3PZHA 3HMPA 4YPSA 5KCVA 4TNBA 2J0MB 4ACHA 3MIYA 3NYNA 4F0GA 2O64A 5HCZA 3OTUA 4BJJB 5J1WA 4FEUA 4O84A 4WNOA 3V01A 4PP7A 2W1EA 5L8JA 2YIXA 2XIZA 4GKHA 1URCA 2BFXA 4LMUA 2RG5A 3EQFA 4IMYA 4NH1A 5M09A 1W8CA 4LFIA 4RIXA 1M7QA 4V0GA 2QOCA 1YKRA 4QP4A 4BFMA 5CVGA 1CKIA 5FLFA 2UW9A 2ETKA 5CU0A 3S2PA 3VS4A 2VTOA 3GC9A 4OTFA 2OKRA 3MPAA 5EG3A 3NYVA 4CFFA 3PXQA 3NNVA 5C1QB 3FZOA 3EN4A 3MJ2A 4CQEA 2XUUA 4LYNA 1YRPA 1MUOA 3KMWA 2NNWB 3DV3A 3R63A 4U80A 4GMYA 4WHZA 3LXKA 5IMEA 4O7WA 4PTCA 5DR9A 5J5TA 2OZAB 4PPBA 3HMIA 1PXJA 5HE1A 1JPAA 4FIGA 5DIAA 3ALOA 4C4HA 3FMLA 1FINA 4E4LA 3EH9A 3AMYA 5DEWA 3BU3A 1PXMA 4NEUA 4Z7GA 5AX9A 1ERKA 4EH5A 2BRHA 5A6OA 5HIBA 2JDVA 3NUUA 3OWJA 2J4ZA 2B9JA 3QWKA 5E4HA 1GNGA 4QNYA 4I0TA 5CSWA 3DCVA 2QCSA 5EKNA 4RIOA 1Z57A 3PIZA 4ASXA 2PMIA 5IU2A 4RBLA 4E5WA 2BDWA 2WXVA 1REKA 4FOCA 3G6GA 4DFNA 4IWDA 2PE1A 4E93A 3RPRA 3HV4A 4PWNA 2CNUA 1BI8A 3THBA 2X7GA 3DB8A 5A4CA 3PLAE 3PZEA 5J87A 3K3IA 4BDDA 5IUHA 4DFBA 3HRBA 4WBBB 5HICA 5CNOA 5DT0A 4ZAUA 3QCXA 2VWZA 1TQIA 4BIBA 4FSZA 3PJCA 5ACBC 3R9HA 2WQMA 4O7VA 4N0SA 4XMOA 5KX8A 2VX0A 5L4QA 3HV3A 2EXCX 3JUHA 1ZRZA 5AV4A 3HRCA 1U5QA 5KNJA 4PV0A 2HY81 4I23A 2XNPA 4USFA 3CD8A 3FKLA 4D5HA 4H05A 2QQ7A 5J9LA 4YPDA 2OJJA 3AC8A 3QRIA 1T46A 1W0XC 3RNYA 3QTQA 4IZYA 5GJGA 2IVUA 3EIDA 5AV3A 2PMNX 3RHKA 3CLYA 4FV7A 4JDJA 5CU2A 4ZJJA 3MESA 4FKVA 3VN9A 5J95A 1XH8A 3HV7A 4WNMA 4KIPA 4EOKA 5BMSA 2QD9A 4IZAA 4AXFA 4BBMA 4QNAA 4KKHA 3O17A 3SW4A 3HP2A 3R0TA 2X2LA 2W17A 3V8WA 1XBCA 3QRTA 1S9JA 1OIYA 2XIXA 4IAZA 1YXVA 2YDKA 3P79A 2IJMA 4F7SA 4Z55A 4F08A 3D14A 3RWQA 4FV4A 1QL6A 4JR7A 4GH2A 4ZTLA 4E6CA 4FKTA 1OUYA 3TEIA 3PVWA 2EB3A 2CCHA 4AA5A 2J5FA 5ANOA 4F6UA 3UIMA 3O8UA 2PZRA 3PG1A 4IACA 4IVAA 5AP5A 3ZH8A 5KBRA 1KE8A 4X2GA 5FWKK 5E8ZA 2BPMA 4ASDA 2J90A 2J6MA 1DAWA 1FGIA 4UYNA 5AP2A 5AUYA 4YJVA 4UMRA 1MQBA 4RWKA 2UW7A 3E5AA 4EK8A 5I9YA 3ATTA 3NW6A 4MXZA 4AA4A 3D7TB 1A48A 5TE0A 5ITAA 3LXPA 2GNJA 2Z8CA 2C1BA 2JLDA 4RIWA 3U55A 4FSYA 2UW6A 2AEGA 2PVLA 4FG7A 2WQBA 1IAJA 3WF6A 2GFSA 3GU4A 2Z7RA 4FTQA 3OCGA 5GZ9A 3RWPA 5JN2A 3ZC5A 3GC7A 3TCPA 4C34A 4HVSA 3MFTA 3O8TA 2C47A 1ZOHA 4GL9A 2V0DA 4EOPA 4L45A 2QONA 3S1HA 4E6QA 4FVRA 3QTZA 4YO6A 2E9PA 4RFZA 5AR8A 5ETIA 5D7AA 4CV9A 2UZTA 2Z02A 4O7ZA 3P1AA 2JITA 4C2VA 4BCMA 3MTLA 3LCOA 1VYZA 4C37A 3PA5A 3QA0A 3Q2MA 3A62A 3JR1A 2PVNA 3BV3A 4FV3A 3TG1A 4IIRA 5AUWA 3RJCA 2EWAA 4W9XA 1Q61A 1JNKA 2HCKA 4EC8A 4GUBA 3TIZA 4K11A 4NIFA 3T3UA 3UP2A 3HKOA 2W9FB 3UPXA 3TM0A 5AP3A 4JXFA 3ACJA 5JH6A 4R77A 3OBGA 5HE2A 5H2UA 2W4OA 2YDJA 3HMOA 4EZ7A 1P5EA 3KQ7A 3SGCA 2NO3A 4NYEA 4FNYA 4BDHA 4FSMA 3F3ZA 4WO5A 2Y8OA 2I0HA 4F1OA 1OECA 4RG0A 5A4TA 4YZDA 4BF2A 4J8MA 4EBWA 5K0XA 3R1QA 4FL1A 4QMTA 1KE6A 4PNKA 3C9WA 2FYSA 2C6KA 2VD5A 1PXLA 3AT3A 2Z7LA 3FLWA 3LOKA 1OKWA 4J97A 3VUIA 4IW0A 5LMBA 3CGOA 4FKOA 5BYZA 4DC2A 1M14A 4LL5A 4ARKA 5AX3A 5FTQA 4BIEA 2VTAA 3D5WA 4I41A 4CLIA 2XKCA 5KZIA 3T3VA 4RGJA 4YC6A 3U4WA 5BV3A 2VO3A 4USEA 4TYHA 3KC3A 3LM0A 2JAVA 3EFWA 3MGYA 4J96A 5CVHA 4FGRA 2Y6MA 2YZAA 4I93A 4AAAA 4ASEA 3CC6A 4JL9A 5J1VA 3N51A 4MCVA 5BNJA 2Y4IC 3MIAA 4Y83A 4D0XA 1FVVA 3SQQA 4R5SA 5EW9A 3T9IA 4YJQA 2FVDA 2WMRA 5CEOA 4PDSA 4FX3A 4RWJA 2GNIA 2P4IA 2XK4A 1OB3A 3UOLA 3V5PA 5AAGA 1G3NA 2WO6A 2ZJWA 4QP9A 4IFGA 1H01A 2JGZA 3W2RA 4YU2A 4CZTA 5GIPE 2WZJA 2IN6A 5E8UA 1BYGA 2PE2A 5K9IA 4AGDA 4XG3A 5IMXA 4Q9ZA 3SG9A 3IG7A 1MRVA 2XJ0A 4JOAA 4NW5A 5EM8A 3VUKA 5JFXA 3OG7A 3BV2A 5CQUA 2GTMA 3G9LX 2OH0E 3F2NA 4L9IA 3R7EA 3R8VA 1GAGA 2IVTA 4BKYA 4EHGA 5JGDA 4BCJA 3ML1A 4HVIA 3TNHA 4QMXA 2KULA 4XLVA 3IGOA 4UXLA 1J1BA 4M0YA 4N4SA 3FMMA 3S00A 1FGKA 3DBCA 2BIYA 5BVWA 3COMA 2G2HA 5IG1A 2W05A 3EL8A 4UWBA 3QUPA 4TNDA 4NSTA 4ZXTA 1UU7A 1J1CA 4J98A 4YNOA 4AT4A 3UZPA 2F2UA 1SVHA 4IWQA 4UMQA 2W4KA 4EOMA 2XM9A 5CF5A 3DTCA 4KIQA 4APPA 3I6UA 3IECA 4KIKA 3TDVA 1URWA 2O3PA 2EB2A 5FXRA 4PRJA 3BLHA 5CANA 1M2RA 3GFWA 3GOKA 1PMVA 2QU6A 3I79A 4IB0A 4BCGA 4IHPA 3PDTA 3Q5ZA 1W82A 2R3QA 2YISA 1WBVA 2VWXA 4WIHA 2JC6A 4ZZMA 3IPHA 4XG6A 3IW8A 5HG7A 3NVKI 3BE2A 2OIQA 2ZV2A 3GQLA 1BUHA 1TZDA 1WBOA 2I0VA 4R1VA 4U43A 2QU5A 1YW2A 3C0GA 4DINA 4BN1A 4ANNA 4K1BA 3NLBA 4OTWA 2YITA 2YM6A 3QLGA 4PTEA 3ENHA 4JRVA 2XKDA 2X4FA 1W84A 2VRXA 4RFYA 1XHAA 3IO7A 3KXNA 4GCJA 2V5QA 3RP9A 3C4CA 2C30A 1J7LA 2GQGA 3R1YA 5AR2A 3C5UA 3V3VA 4QMQA 2BTRA 1JSTA 2X8DA 1OL7A 1OM1A 3MA3A 3ZDIA 4C3PA 3BYSA 4B9DA 4RVKA 2X0GA 3NYXA 3DQWA 3EWHA 4C3FA 1HCLA 2PL0A 3Q9ZA 2RL5A 2Z7SA 4G5JA 4C8BA 5GIOE 4F0FA 3DXNA 1TKIA 2V7OA 3F82A 4KB8A 2YABA 4YBJA 4B8MA 3DJ7A 3BHUA 2X2KA 4MXXA 4YLLA 2EXMA 4ZLOA 1OL2A 3CTQA 4BICA 3DJ6A 2OFUA 5E9EA 2H34A 5IUIA 5L2QA 3EKNA 3FXXA 4FT7A 1ZYCA 3FLZA 3DNDA 1SM2A 5DPVA 4IB1A 1W2FA 4QP2A 3BPRA 4GU9A 5AFVA 4ONAA 3L9MA 2VTJA 2AUHA 2XP2A 3CEKA 3KB7A 4M84A 4WA9A 5AAEA 5LARA 3KXHA 2QHMA 3KMUA 3R7OA 3PIXA 4FKGA 4IWPA 3REPA 3KVWA 3QX2A 5C4LA 2H6DA 3WIGA 4BTKA 4XV1A 2WU7A 4FTUA 1Q8YA 3IW7A 4NKAA 4GU6A 3VF9A 2PSQA 4EYJA 4MH7A 2XEYA 4CKIA 2C0IA 3CD3A 4RRVA 4H36A 3U8WA 2YM7A 2WTWA 5J9ZA 4JT3A 4MX9A 5LVLA 3LXNA 5ANKA 4TL0A 1OPKA 1SMHA 3DKFA 4OTRA 5HLNA 3R7IA 4ZY4A 4M66A 2HIWA 4FSWA 3P7CA 1L8TA 3MV5A 3QAME 4ZJIA 1F0QA 2W1ZA 2YCQA 4FZ7A 4ALWA 1BKXA 1PXNA 4F99A 1WBTA 4O21A 3LE6A 2CNQA 2VTMA 4APCA 3DBEA 3IDPA 4AF3A 3ZS5A 1Y6BA 4H39A 4YO4A 3BYUA 3FXWA 3LIJA 2QO2A 3Q2JA 3ZSIA 3SW7A 1YXXA 3DAKA 3QZHA 3FKNA 4OBPA 4ID7A 2OH4A 4NJ3A 2E9NA 3RPOA 2NPQA 3TXOA 4LUEA 1W83A 5EYCA 5CALA 3UO5A 3TUCA 4YP8A 1ZMVA 4GG5A 4DTKA 5CAQA 2XJ2A 2J0IA 5EDPA 4PDOA 2QURA 3CQWA 3VVHA 2B9IA 3T9TA 4JNWA 4D4RA 3PVGA 3D15A 3OEFX 2JBPA 2Z2WA 3HV5A 4JDIA 3M2WA 4DHIB 4O0VA 5IH6A 5F4NA 4AGUA 4C61A 3O5AA 4CD0A 2XAOA 3EZVA 5HO8A 4AX8A 5GZ8A 3W0SA 4XBRA 2P55A 1JSVA 4FV5A 1SVGA 3I0OA 5FDPA 2FSLX 4IE9A 2VZ6A 4PMTA 3E64A 4PMMA 4KS7A 4GIIA 1XKKA 3T8OA 1XH4A 1YOLA 4D1SA 2HWPA 5DR6A 3RAIA 3RK9A 4C35A 2PTKA 2ITUA 3UOHA 1SNUA 1IRKA 1WVYA 5KE0A 4BGQA 4XNEA 4WG4A 4FL3A 5AUTA 1W2DA 4ITHA 5BX0A 4G1WA 5M51A 5JQ5A 2VNWA 3L9NA 4ZZOA 2I7QA 3VS6A 2BDJA 3ZZWA 4FTIA 1K3AA 5C03A 2PMLX 4BCNA 4DYMA 4B4LA 2ITQA 3BCEA 2X4ZA 2I6LA 3C4XA 4O0TA 3VNTA 1ZWSA 3C4ZA 1KSWA 3G2FA 1OUKA 4ZMFA 3QCQA 4E73A 3SDJA 3VRZA 2IW9A 4ZY5A 1ZZ2A 3LJ2A 4JIKA 3VWAA 3HX4A 5GJDA 4F65A 3DKGA 3UMWA 5M4UA 3WZJA 4I3ZA 3RK5A 2JIVA 4CFVA 5KKRC 3W2PA 4AOJA 5LQFA 3UYTA 4ACGA 2UZBA 3R01A 3R9DA 5CXZA 4LV8A 2HZ4A 3TZMA 4KBAA 4EOLA 5CI6A 5KMLA 1OBGA 4KWPA 3RVGA 4RJ3A 5AEPA 3C1XA 3KXMA 2BIKB 1Q24A 5D12A 4ACCA 3V5TA 4C36A 2OF4A 3K5VA 2ERZE 4IWOA 4L67A 4L7FA 5LWMA 2GNLA 4EWHA 3BHTA 1APME 1Q5KA 2OW3A 2P0CA 1IA8A 4JIAA 4QMSA 2YERA 3GUBA 1XR1A 2WIHA 3FL5A 3IW6A 2UZWE 2XIRA 4FZDB 3VBYA 1ZYDA 1S9IA 2ITZA 3E92A 5CEMA 5DT4A 3QA8A 5M07A 4JJRA 3P9JA 5CS6A 4M15A 1JBPE 5JKGA 5IKWA 3QTWA 3QU0A 4E5BA 3FKOA 4W9WA 3KRLA 3AMAA 5EDRA 4F09A 3ZO4A 3PXKA 1PMUA 3P7AA 3D5VA 5IDPA 3ATSA 3G15A 4QDVA 1PRYA 4FNXA 1P2AA 3WF5A 4CNHA 5JZNA 1ATPE 4FT5A 3KGAA 2Y0AA 3PWDA 3R22A 3FZPA 4X3JA 4ZS0A 1OKYA 3PUFC 4HW7A 5DHJA 3R7YA 4PL5A 2VU3A 1G8AA 3ALNA 2C5OA 1OIUA 2AC5A 4PPAA 3LAUA 2QI8A 4O22A 3PXRA 3QRKA 4FNZA 3F5PA 5JSMA 5D10A 4HCTA 4H3PA 2BCJA 3HP5A 3W0QA 4NFNA 2X0PA 4F0IA 3S4QA 3VC4A 4JG6A 2QOIA 4IVBA 4N6ZA 3R7VA 5IQIA 4FKWA 4RA5A 4TYEA 2ITNA 4A07A 5L6OA 2YWVA 1UWJA 1XH9A 3H10A 3DZOA 4N6YA 2W1DA 5HIEA 1V1KA 3UC4A 4L52A 2XARA 3AXWA 5D1JA 4BTMA 2HZ0A 4EK4A 3Q4UA 4QMWA 3DNEA 3UC3A 3PXYA 2WQEA 3TKUA 5LMKC 5IF1A 2YLFA 1A06A 1UKIA 4GYIA 2WMUA 5CVFA 2PUIA 4FF8A 4O83A 4MQ2A 2GS2A 3N9XA 2J50A 2UVXA 4MWHA 3R73A 2QC6A 3QQJA 3TN8A 5IH4A 2X81A 5IQCA 1G5SA 4ASZA 4XJ0A 3V51A 1PMNA 3ZSGA 3FMDA 3JPVA 5D41A 3VQUA 3F6XA 2CLXA 4JAJA 4F6SA 2PY3A 4GEOA 5BVFA 4AZTA 4MXYA 3KVXA 1ZAOA 4YHFA 1OL5A 4QOXA 4F64A 3QCYA 1YDRE 4R78A 3P7BA 4LL0A 5I3RA 2PUNA 4U79A 4X3FA 2VWBA 4QP7A 5DNRA 4FK6A 3QHWA 4BDKA 3NNUA 4IVCA 1IA9A 2YCFA 3EQPA 3BIZA 4JAIA 4PF4A 2BHEA 1HOWA 4I0SA 3E8CA 4KKEA 5T3QA 2BR1A 4O81A 3P08A 1R0EA 3OMVA 3UO6A 1P4FA 5DRBA 3S3IA 2E2BA 4D4YA 1ZXEA 1XBBA 2O2UA 2OI4X 1VYWA 1NXKA 4IC8A 3BEGA 2WQNA 4FC0A 4DTAA 3OFMA 4MWIA 3RTPA 2JBOA 2CN8A 4DH7A 2YEXA 3LLTA 5FUTA 3QRJA 2ONLC 5FBOA 4AE9A 4C02A 5HNIX 4WKQA 3Q6UA 3TNIA 2ZV7A 4AOTA 2FB8A 4O91A 2IWIA 4D1XA 1WBNA 2VV9A 5CSPA 3LFQA 3K54A 3W2CA 5M4IA 4O0WA 2QKRA 3OW3A 5EQPA 4D2RA 5CLPA 3QBNA 3R2BA 3F7ZA 4RIYB 4AT5A 4CSVA 3LMGA 3OT3A 5HESA 5CEIA 3R7UA 4GS6A 4TYHB 3KRRA 1UNHA 4EH2A 3AGMA 3BEAA 4CT2A 3RAKA 5KMJA 2ITVA 4RZVA 5EYDA 3SHEA 4QDEA 4WUAA 2ACXA 5CZIA 4UXQA 4IXPA 1Q99A 1YI4A 1H26A 3HYHA 2ZDUA 2H9VA