3TN8A

Cdk9/cyclin t in complex with can508
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
318
structure length
304
Chain Sequence
b'VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 9
publication title The CDK9 C-helix Exhibits Conformational Plasticity That May Explain the Selectivity of CAN508.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 89
structure length 304
sequence length 318
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tn8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tn8A01
4PDSA 3T9IA 4UMUA 4Y5HA 4U3ZA 5CYIA 2QO7A 3NAXA 4A07A 4DAWA 4BI1A 2XIRA 3TUCA 2FO0A 3BHHA 5CEQA 5KX8A 2HOGA 2I1MA 5ANIA 4YO6A 4EOIA 5JGDA 3OCTA 3HMPA 5ACBC 4EKKA 2VU3A 4HGEA 5M53A 4ZMFA 3FZ1A 1OUYA 4QP6A 4AT4A 3OROA 1IA9A 4JI9A 4NM7A 4DFNA 4GFMA 2GNFA 2XNBA 1GZ8A 3VULA 3CTHA 4RWLA 3EZVA 4QYYA 2ZDUA 3FXZA 1CTPE 4EI4A 4Z7HA 4I92A 4XG4A 3DXPA 1FVTA 5EM5A 4FVPA 3ZSIA 3BLHA 3LHJA 1WBOA 3PA4A 4PPCA 3DS6A 2VO6A 2WPAA 5K4IA 3FMNA 2ZYBA 3CQEA 3MFSA 2VTIA 3AXWA 3FYJX 4U81A 4TTHB 5A4CA 2OIDA 3V8TA 3FKLA 3II5A 4GRBA 3EFLA 2CMWA 3O71A 3UGCA 3C5IA 3AMBA 2W0JA 4QMZA 4S33A 2J0MB 5ANKA 4IB3A 1H1WA 3D4QA 3SX9A 3BYMA 5F1ZA 4AWIA 4BB4A 4ZJVA 2QKWB 3DXQA 2R3HA 3FZTA 4Y73A 3OTUA 1J7LA 1G8AA 5ETIA 3NSZA 4FEQA 4X7QA 2BIYA 5A6NA 2ITOA 5ANJA 5A4EA 1XWSA 4JR3A 3ANRA 3U51A 4GIIA 4XYFA 5AIKA 5BVOA 5GJDA 4UB7A 5E1EA 3DKCA 5L2TA 4NJ3A 3PY0A 4NTSA 2OJIA 3G33A 3UE4A 2YFXA 2ITQA 3R00A 1UWJA 2C6TA 2UUEA 1V0OA 5AAEA 2X2MA 4D1SA 4TYJA 2QCSA 3RZBA 4CZYB 1LUFA 3HZTA 4TNBA 2VWIA 2XNNA 4DEIA 3LCSA 4FSMA 4PQNA 5IEYA 4GS6A 4AN9A 3DPKA 1YW2A 3NNVA 3ZFYA 3ZEWA 4OAVB 4I93A 4UXQA 2IG7A 2IN6A 5HD7A 3VS1A 1OKWA 3G0FA 4FZFB 4IHPA 1W83A 4LOPA 5FGKA 5EQPA 5HU3A 3QXPA 1OITA 3OHTA 1YHWA 1OBDA 3HKOA 2OK1A 4BGQA 4V04A 3NUSA 4CYIA 3EKKA 2CN8A 2F2CB 3HV4A 5H8GA 3EQRA 4ZTNA 2JIIA 2VO0A 1LEWA 2BAJA 2FSMX 4XG6A 3PVBA 4KSQA 3UVRA 5C1QB 4BZDA 2PVMA 4DLJA 4FTIA 4B4LA 5JKGA 4NZWB 1J1CA 4QP3A 4RIYB 3I6WA 2HZIA 3FI8A 2DS1A 1KSWA 3NUPA 5ANEA 5CAVA 4X2KA 3S0OA 2VRXA 1MRUA 3MH0A 4W8DA 4CTBA 5IF1A 4BY9E 3QQUA 4NEUA 2PZIA 4U45A 2PL0A 3NNXA 4XG9A 4XBRA 4EZ3A 3OS3A 4ZY4A 4C4IA 1TQPA 4D2RA 4BGGA 4AE9A 2CPKE 1W7HA 4DGMA 3C51A 4F08A 2IJMA 3ODYX 3AD4A 1XH5A 4CYJA 3BE9A 5LJJA 5HG8A 2P55A 2F57A 3OY1A 5I5ZA 2C68A 4XJ0A 2PZRA 4IZYA 5DN3A 2VTJA 4HGSA 1IRKA 4OGRA 4YJQA 5L3AA 3M42A 5C8MA 2J2IB 4ERKA 3CD8A 2CSNA 3PJ1A 3QXOA 2ITWA 4JBVA 4IWDA 2JKMA 5FLFA 2QOOA 2YABA 3TNQB 4DH5A 5HVYA 2WMQA 4WHZA 1R78A 4QD6A 3VN9A 4E6CA 2UZBA 4CQGA 1OM1A 4JT3A 4EUUA 2CDZA 5ITAA 1TVOA 3RNYA 4FVRA 4ASXA 3CXWA 4XS2A 5B2LA 3QCYA 4GH2A 2PPQA 4EH7A 5C03A 4BDAA 3FEGA 5HLWA 4DEGA 2GU8A 3QCXA 2NRYA 2R3LA 5CU3A 5TOZA 4C4EA 4MBIA 2G9XA 4BBMA 3S95A 3KRRA 3R28A 4WBOA 4EYJA 3MI9A 4L3PA 1PKGA 4FKLA 4BCHA 2V22A 3P5KA 3P0MA 3Q60A 3R7YA 4DG3E 4O2ZA 4F99A 4O81A 4QMLA 5HTBA 4AW2A 2W1EA 1Q24A 2WB8A 4NSTA 3OG7A 3LCKA 4H3BA 3Q53A 3MWUA 4YZBA 3R9OA 4ZMEA 1IG1A 1F3MC 3KXGA 4FZAB 2HXLA 2VZ6A 3BV2A 3K3IA 4FODA 3CP9A 5BUEA 1UVRA 2RGPA 2QR8A 3DFCB 3ODZX 3P79A 4C2VA 2YM4A 2Z7LA 4UYNA 4EQCA 3G5DA 2G01A 5D41A 3F61A 2EB2A 4ASDA 4C7TA 4FSZA 4Y8DA 3VUHA 5DEYA 3TDWA 2O63A 2Y4IB 3BBTB 3OOMA 3LLAA 3QYWA 4OTRA 5J8IA 4AAAA 4O7TA 4IX4A 4KIOA 4DCAA 3TCPA 4QPMA 4ZAUA 4WKQA 3LE6A 4ALWA 2A4LA 4A9YA 4QYEA 4QT1A 4BKJA 1PF8A 3I4BA 2XYUA 3KMUA 4OT6A 4RPVA 4ALUA 2QLUA 1IEPA 3NW6A 3RCDA 3RINA 2BRNA 3BQCA 4MQ2A 3TKUA 1RW8A 4QTEA 4YLJA 5A4QA 4YJNA 1XKKA 4X3FC 4AU8A 3ATTA 2XYNA 4EL9A 3NVMB 2VX0A 2FA2A 1WFCA 1YI3A 5BYZA 3L9MA 5HG7A 1ERKA 3ZRKA 2W4KA 1H01A 2W9ZB 3O2MA 5CU4A 4EQUA 3RM7A 4DEBA 3Q5ZA 2OICA 2YM5A 3HGKA 4QMWA 3F66A 3WI6A 4BDDA 5HHWA 4AQCA 2Y7JA 3D9VA 3ZUUA 2YCRA 1Q41A 3QTZA 4E6DA 3KA0A 5EYDA 4YU2A 4XMOA 2Q0BA 2R3KA 4O82A 4PDYA 3ORTA 2HZ0A 3EQDA 3WBLA 1UU7A 3FSFA 5A4LA 2I0EA 4D9UA 3MESA 4PWNA 3F2NA 5AMNA 4M97A 4BICA 1T45A 4UWBA 4U44A 3ZTXA 4DLIA 3TUDA 4MWHA 4OAUC 4R3RA 2YCQA 2RF9A 3IOPA 4ACGA 3P7CA 1YI4A 4E20A 3QTWA 3RPVA 4OBQA 4EHVA 1BL7A 1MQBA 3M1SA 2PVFA 1YOLA 4CCUA 4S34A 4X21A 4E26A 2YHVA 3MJ1A 1GJOA 2XK4A 3CY2A 1H08A 4LM5A 3S2PA 3G6HA 3ZUTA 3FMKA 3FLYA 4AGDA 4CT1A 3PXYA 5B2MA 5LMAA 3DJ5A 2G2IA 3TV7A 4BDBA 4CFFA 3UQCA 3DK3A 3F5GA 3LZBA 4QP2A 2BZKB 5CSVA 3ZBFA 4K11A 1XH4A 5ANOA 3UIMA 2WTCA 4BC6A 3F69A 4M68A 2B52A 4FSQA 4HPUE 3R7VA 3WF5A 3PTGA 4BDEA 4ZSAA 3OXIA 3O50A 5HBEA 5AV3A 2P3GX 2QO2A 3IGOA 4IFCA 3QQHA 2R9SA 1RE8A 5A46A 3PFQA 4HVHA 4O83A 4GSBA 4D2WA 5A3XA 3VQUA 1WVWA 3PSCA 1WBNA 4C36A 3EQBA 3WZUA 1T46A 4WUAA 4HYHA 3UBDA 1SVHA 4IEBA 1GIJA 3L1SA 2EWAA 2IWIA 5DT4A 4MNFA 4DEEA 4GYIA 3IK3A 3PE1A 3TNIA 5KMOA 4OLIA 3SV0A 3SAYA 1L3RE 4C8BA 1M2PA 2GHLA 2RSVA 2ITUA 1YKRA 5EK7A 4I22A 2ONLA 4S32A 2VAGA 2ZV8A 4JOAA 2VUWA 3LFDA 5AADA 2ZOQA 5H8BA 4ZXTA 3EQCA 5CEMA 3D7TB 4QP8A 4F9WA 2WTIA 3ZEPA 5JGAA 1H8FA 2GNLA 3NEWA 2R3JA 3DKOA 3IDBA 3NVKI 3KREA 2ZMCA 3Q9WA 3HMMA 3R83A 5FTGA 4U43A 4HZRA 4XOZA 5DT3A 5CNOA 4YSMA 2XIXA 4QP7A 4FC0A 3MVHA 4GT4A 4BDFA 1YWNA 2UW3A 2XNMA 4JQ8A 5TT7A 2W1CA 4BCNA 3FC1X 1NY3A 4ASZA 4O7YA 2V5QA 3ZXTA 3W8LA 1YDTE 5FDXA 1YOJA 3GEQA 3DZQA 3DK6A 4R1YA 4F4PA 5EKNA 2VTHA 4ERWA 5AR2A 4NH1A 4JBPA 3W1FA 3L9PA 4BIDA 1ZXEA 1APME 3LOKA 2XNEA 3ORNA 3G15A 2JIUA 3IW6A 3PDTA 4YJOA 5AUVA 4DT8A 3EHAA 2C5XA 4I6HA 4P5QA 3TZ8A 4L68A 4IX5A 2X6DA 4FZ7A 4JRVA 4QYHA 2F49A 2P2IA 5AR8A 2OJGA 2XRUA 3QUEA 1J3HA 2B9HA 3GCQA 3EN7A 4FK3A 5AEPA 3U54A 2YERA 4WD5A 5FDPA 3ROYA 5JT2A 1PKDA 3Q9YA 2BDFA 5CWZA 4OTDA 4IIRA 4QNAA 4FTLA 5J9YA 2QU6A 2OF2A 3HL7A 5D11A 1UU9A 5IKWA 4O6EA 3KXZA 3A8WA 2XNOA 3QX4A 5AA8A 1CM8A 1ZOEA 2WMTA 2W1HA 3BYUA 3R8PA 2XJ0A 4DITA 1NA7A 1CKJA 3LFBA 3SA0A 1J1BA 2V0DA 4CSVA 2W1ZA 2WQEA 3PWYA 1P4OA 4NK9A 4WNPA 4WO5A 5EDRA 5BVWA 4KUJA 4FT9A 1CSNA 3DDQA 3ENHA 2WOTA 3B2TA 3KXNA 4IWPA 4XV9A 4YC6A 4GK3A 3ZFMA 4CKJA 2PVYA 3VS3A 4D55A 1HCLA 5GZ8A 4QQ5A 3EL7A 5EW3A 3QTXA 3S4QA 4EEVA 4FKTA 1H07A 1KV2A 1RJBA 2FSLX 3R6XA 3QCQA 4RA4A 4M14A 5EI2A 5HNGA 5IG1A 3L8SA 4W4YA 3FBVA 2ITXA 2PE1A 4BTMA 4R6VA 5HZNA 4M67A 2X81A 4PPBA 4F7SA 4FTTA 4G9RA 5KCVA 2H34A 3COHA 3SOCA 2JEDA 4YC8A 3QLFA 4K0YA 5IQCA 3NZ0A 1YI6A 2UZWE 4GMYA 2XMYA 4IE9A 5IU2A 3F5PA 1Z9XA 4GKIA 4ZSJA 1GIIA 5IH4A 3BYVA 4AZEA 3FZOA 4D0XA 2Y9QA 1YXVA 4FL1A 5KE0A 3GVUA 4JDIA 4WA9A 3ZM9A 4J7BA 3ORXA 1OL5A 3A7JA 4NTTA 4TYGA 3UC4A 1ZRZA 3E8DA 4NKAA 4BWXA 4FV7A 4E4NA 2XNPA 3MY5A 2UW0A 4FKUA 3GFWA 2WHBA 4FV8A 3RPOA 5E8SA 3OCGA 4I23A 5T68A 4EHEA 1FGIA 2UZEA 2R3GA 3FL5A 3I7CA 3DBEA 3P86A 4LG4A 2HENA 4OTIA 3ZO2A 1IASA 3OXZA 1REKA 4ZZMA 2UZDA 4TPTA 3JY0A 4L44A 3K54A 4FSWA 1ZYLA 4DH7A 2X8IA 5BMMA 3T8OA 4J97A 3UTOA 4YZ9A 2C6IA 3P4KA 1H0VA 2ITZA 2NPQA 2WEVA 3Q9ZA 1BLXA 4IWOA 4JIKA 4QYFA 5HNBA 3FHRA 2R0UA 4V01A 5L8KA 3AT3A 4RWKA 2B9FA 4BYIA 4ALVA 2QOHA 3N4UA 3CPBA 2XB7A 5A4TA 4FL2A 4EOQA 2A0CX 4YHJA 2E9NA 3E8EA 4B7TA 3MFTA 2VN9A 4A7CA 3OUKA 5KNJA 3DQWA 2DQ7X 5KUPA 2XCKA 3HECA 4HCVA 3HUCA 2ZDTA 4KBAA 4A9RA 2EU9A 3LXPA 4FV5A 4AA0A 2ZB0A 3CEKA 3F5XA 4TT7A 4EZ7A 5IQFA 4O7WA 4FV3A 2ZM1A 3MIYA 4AG8A 4GG5A 3E8NA 2C6OA 5CF4A 2J51A 2R7IA 3GT8A 3RP9A 4AGUA 4C35A 3EKNA 1W8CA 2OIQA 3BGQA 3ZO3A 3MH1A 3MY1A 4C4HA 3KK8A 4NFMA 4A4OA 1LR4A 1QPDA 3NUXA 5HE2A 2VTTA 4QQTA 3AOXA 5FWKK 1BKXA 1FQ1B 1B39A 4J8NA 2HWPA 3GFEA 4MF0A 1KV1A 2YACA 4AS0A 5LCJA 2ITVA 5HX6A 5M44A 3LLTA 4HYIA 5EOLA 2ZV2A 2WTJA 4YPDA 5AP6A 1BX6A 4RC4A 5C9CA 3Q6UA 5IA2A 4IWQA 4XG7A 4LFIA 5EYCA 1OIYA 5H8EA 3MPMA 3QD0A 4ZY6A 5K9IA 4YZNA 5AUUA 5L6OA 4BDKA 3HP2A 5DR2A 4J71A 2BZHB 5E9EA 4RJ5A 5FEDA 3Q2MA 3U6JA 4L7SA 1GOLA 4A06A 2UZLA 3DLZA 3DKGA 3NYOA 3I1AA 4UEUA 2QG5A 3ERKA 3MA3A 3BHTA 3D5XA 3R1NA 4YC3A 3SLSA 3FDNA 4XLVA 3DQXA 1FVVA 2RL5A 1OL1A 2XRWA 3MPAA 3R1YA 1Z57A 3AC2A 4O86A 3V5PA 4FYNA 3QC4A 4LGDA 4EOKA 5JFWA 4CLIA 3MFUA 4O0WA 1KOAA 2XIZA 3FLSA 3QZHA 3VS2A 4FNWA 5F20A 4CTCA 5HNIX 3W2SA 4RFMA 4I24A 1SYKA 4UXLA 4U5JA 4UZHA 4DC2A 5BNJA 3CD3A 3AC5A 2A1AB 5AP1A 4FVQA 3WARA 5EQYA 4Q2AA 3FPMA 3U9CA 3LKMA 5DRDA 4QTDA 3RK9A 2YWPA 4I6BA 1F5QA 3UMXA 3HV6A 3PJ8A 4XRLA 2XIKA 3W10A 2XM8A 5EQEA 1VJYA 4YR8A 4J1RA 4OUCA 5J87A 5IA4A 3FLNC 3HA8A 3EH9A 2HELA 3FZRA 3FLQA 5BUJA 3IW4A 1U59A 3C4EA 1BYGA 3GU7A 3PLAE 2YAAA 1FVRA 4FKRA 4HGTA 1JKLA 4MNEB 3BHVA 3MB7A 5JQ8A 2WFYA 5L8JA 3A7HA 3NUNA 3R2BA 2BALA 2HWOA 2R64A 3C50A 3CJGA 1ATPE 2IVTA 4ZS0A 4MTAA 2NP8A 3HRCA 2VWBA 2X2LA 3QL8A 4FG7A 3R8LA 4O27B 3Q52A 2WZJA 5DEWA 3LPBA 3GOPA 4C4GA 4ZIMA 4H3PA 1KE6A 2YZLA 3R02A 4ARKA 4RIOA 1OIRA 3G51A 3MH2A 3P78A 4KIPA 4G1WA 4QQJA 3FPQA 5L2WA 2C1AA 3PE2A 4BI0A 1ZARA 5IZFA 4RWIA 3EJ1A 4CD0A 2WMXA 3ALOA 3O8TA 1E9HA 4FV0A 3TEIA 1JPAA 2WMWA 2B0QA 4IAFA 3AD5A 4GFOA 4EH8A 3IW5A 3QHWA 5AR5A 2V55A 3VUTA 4EOPA 2A19B 2C4GA 2OW3A 1PMVA 4IDVA 4QMOA 3EYHA 1CKIA 4FTOA 3U6HA 2YISA 3KMWA 2SRCA 3F88A 4AZWA 1Y6AA 4GG7A 2XKDA 3JY9A 4K6ZA 4YMJA 3HYHA 3BU6A 4BRXA 1FPUA 4FKPA 3DNEA 4F9AA 1DS5A 1UNGA 4DGOA 3ZDUA 3QUPA 1M7NA 3OEZA 2J6MA 1YHSA 5HU9A 4BCJA 4EH2A 4HYSA 4GKHA 2XK6A 4FICA 1YWRA 5E8TA 1UNLA 2C0OA 2VGPA 4GVAA 3FUPA 1XQZA 4L42A 4A4LA 2GQSA 4BCPA 1RQQA 2FH9A 1KWPA 4YO4A 4DH8A 3FMLA 2Z02A 2WO6A 4W4VA 4C62A 4BDCA 4I94A 4DEDA 4F7NA 5HTIA 3FY0A 4K77A 2UV2A 2R3PA 2PU8A 1WCCA 2QO9A 1P4FA 3R1SA 1B6CB 4LRKA 4QP9A 4O7RA 2V7OA 5IH6A 3LQ8A 1H1RA 3NCGA 4JG6A 3WOWA 5BVNA 5EM8A 2OH0E 2VWUA 2HAKA 3AC1A 4HGLA 4IBMA 2OG8A 3V3VA 3MN3A 4UMPA 5HORA 2IW8A 5LWNA 4M15A 1BI8A 3V5TA 5AM6A 3VBXA 4GEOA 4G3DA 4KIKA 1OPLA 2I6LA 4GFGA 5B0XA 4UZDA 3V5JA 5HTCA 3C4XA 3NAYA 4GK4A 2HZNA 5GZAA 2P4IA 2R3OA 3FI3A 4WUNA 3D5WA 4O91A 3OC1A 4D2VA 3OCBA 1TQIA 5IUGA 2OJJA 1JSUA 2E9VA 2WQOA 4NW5A 4RIYA 2WD1A 1GZNA 1UU8A 4OTGA 2WMUA 2JDSA 4MX9A 3TZMA 3O51A 3FWQA 3PIXA 3W8QA 5BVDA 2XEYA 3TN8A 5GIOE 4P7EA 4P90A 2BKKA 2P33A 5I4NA 2W17A 2YEXA 2W5BA 4JNWA 3WILA 5C4KA 1Y57A 2H9VA 2VWYA 4E73A 2EVAA 3HAVA 4BCFA 1OI9A 4MAOA 3ORKA 3I60A 4WOVA 5HVJA 3EFWA 1U46A 4QMYA 2C5YA 3OD6X 4F1TA 3K2LA 4IW0A 3BLRA 1J91A 2ZM4A 3MYGA 5AP7A 4F6SA 3CE3A 3HV5A 5KHXA 2UZTA 1W98A 4LMNA 2OJ9A 4PTCA 5AP5A 4AFEA 4BDGA 1CKPA 3F3TA 4IM3A 4P2KA 3TJDA 3SXFA 1O6YA 4KKHA 2I0VA 4EC9A 4MXAA 4RJ7A 4PMMA 5KHWA 3R9DA 3B8QA 4XP0A 1ZOHA 5DLSA 3DBQA 4I5PA 4IC7A 5M56A 4UALA 5LVLA 2BROA 4W9XA 3LMGA 2PYWA 3ANQA 4PL5A 3EB0A 4DCEA 1WBWA 2HY81 3VO3A 4A9UA 3FV8A 3SHEA 3NW7A 3PA5A 3WZKA 3RTPA 2R5TA 4TL0A 5FBOA 3PZEA 3EN4A 2LAVA 4FSYA 4ZTSA 4CMTA 2JKQA 3VBVA 3QRJA 4ZLYA 4FIFA 4O21A 4DINA 4QO9A 3N4VA 1ZYJA 3SD0A 4D28A 3DBDA 4LOQA 4KD1A 3MY0A 3TNPC 5IPJA 4MF1A 1M2QA 4PMPA 4KIKB 5CSHA 4F9BA 4X2FA 1MP8A 1JKSA 2ZVAA 5FEQA 4R5SA 3HUBA 2JDVA 2JC6A 2JBPA 2VWZA 4K9YA 4OTPA 4R3PA 4MVFA 3EN5A 2YLEA 4E5BA 1P14A 2ZV9A 3ZOSA 3QBNA 3KF7A 4FZ6A 4ZTRA 3ZO1A 4HVGA 1XH9A 3PG3A 1JBPE 3D94A 3JS2A 3FZPA 5IISA 2OI4X 5HCZA 5JN2A 4GK2A 1LP4A 3RGFA 5LVNA 3FL4A 2OH4A 3KXMA 4YUQA 4R5YA 4F63A 5AR4A 3BKBA 4EQMA 3COKA 4RVTA 3UIUA 1FMKA 2FUMA 2QOIA 2XKCA 4FKGA 3THBA 3WIGA 3QZIA 2OZOA 3AMAA 3UVPA 1E1XA 3TI1A 2R0IA 2R3NA 3NCZA 4I5MA 4JG8A 4IAKA 5FP6A 4AZVA 3Q9XA 4H39A 3VJOA 5K0KA 1KUTA 4MXZA 4U80A 4M3QA 5KO1A 4ACCA 4C57A 1M14A 3C4CA 4GCJA 5ANDA 3EOCA 2ITPA 2B55A 3R0TA 5AUZA 5HO7A 5DFPA 1J7IA 5HX8A 2VTNA 5J9ZA 2GQRA 3KN5A 4LRMA 4TWNA 5CZIA 3VUGA 3E93A 4E6QA 3VS7A 4AFJA 5HE0A 3ZO4A 3Q5IA 5H9BA 2YM3A 1MUOA 1W0XC 3PJCA 5J5TA 5KMJA 4TYEA 4D4YA 3NR9A 4O22A 2NO3A 2RG5A 1PXPA 4J8MA 3CSVA 2IZUA 4U97A 2B1PA 4MD7E 1U54B 3SQQA 5E8YA 3MW1A 4NJDA 4Z55A 3A8XA 5I9ZA 4ANMA 3FMEA 2OLCA 3RALA 4TY1A 4DT9A 1NXKA 4CFNA 1OGUA 4YJTA 4N6ZA 2BFXA 3VBTA 4ZJJA 5BQ0A 2DUVA 3D0EA 3FMJA 3HLLA 3CY3A 4DGLC 1Y6BA 3RHKA 2JLDA 4FYOA 4XV3A 1ZZ2A 2O2UA 3UP7A 1SZMA 4JIAA 4KRDA 4S31A 4IM2A 4M66A 4X3FA 5AUXA 4AT5A 4ZS4A 3RVGA 3GU8A 5EFQA 1BMKA 3BIZA 3FE3A 2VGOA 2C5VA 3PWDA 4HZSA 5AUTA 4DFBA 2G1TA 1ZZLA 1W82A 3FSKA 4O0YA 1K3AA 4HVIA 3LM0A 2ERKA 1U5QA 5TR6A 1UA2A 3A7IA 3BI6A 3O0GA 5KKRC 1QL6A 3QX2A 1ZWSA 3GC8A 4Y72A 2PUNA 3UIBA 2XJ1A 3PXFA 2F2UA 5IA5A 5DGZA 4K8AA 5DH3A 3EWHA 3JXWA 5CEPA 1Q8ZA 4WRSA 2V7AA 5CTPA 5HOAA 4JXFA 5CF5A 2W06A 5M08A 2W4JA 1R1WA 4HCTA 4D1XA 2YM8A 3E5AA 4WRGA 4XP3A 4ASEA 1FGKA 4A9SA 1M7QA 1Q8TA 3CIKA 3P1AA 3QQJA 4WNMA 1AQ1A 3R8VA 4DFZE 3RCJA 2YN8A 4BCIA 4PUZA 4A4XA 3SRVA 3IECA 3QRKA 3R01A 4FEVA 4WSYA 2YIWA 4AT3A 3VHEA 3FHIA 4IVCA 2X7OA 4G3CA 3FYKX 1KOBA 2VV9A 5CASA 1PHKA 3QF9A 5K5XA 3ALNA 4QYGA 4XH6A 2JIVA 2W7XA 3Q4ZA 1ZMVA 2GTNA 5CNNA 5JH6A 4NL0A 3IKAA 2W1DA 4QNYA 3TNWA 4C3RA 4D2SA 1K9AA 2QOKA 4NIFA 5LOHA 2XVDA 4RZVA 2C6KA 3F6XA 4FSTA 4JAJA 5HO6A 1YXTA 1LEZA 4USEA 5HIBA 4PL4A 5ETAA 4X3FB 2ITNA 5EM7A 1KE5A 4L53A 1JKKA 5J1VA 5KMLA 2OXXA 4NW6A 2C6LA 3ZONA 4AX8A 3FMDA 5DT0A 1M52A 1M17A 2VTLA 5ETCA 4Y5QA 5A54A 1IAJA 5HG9A 4IADA 2ZM3A 3D7TA 3C9WA 4MXCA 3D15A 2X8EA 2R7BA 3NPCA 5ETFA 4LYNA 4QPAA 4RJ4A 4OBPA 3R7OA 3T3UA 2YWVA 2Z7QA 5M09A 2WTKC 3ETAA 4W8EA 4TZRA 4L6QA 3GCUA 3ZHPC 3VF8A 1H00A 4JQEA 2VD5A 5LVOA 2B9JA 3N51A 4C38A 5E8WA 4CVAA 3VW8A 1H27A 3ITZA 5C4LA 3WZEA 2ESMA 5KMKA 2W5HA 2XA4A 4I6FA 5HO8A 5CAUA 3F9NA 4F09A 4RX9A 4CFWA 1Q8YA 3A61A 2YA9A 4UYAA 4FEWA 3LM5A 4GU6A 3G90X 4IVDA 3SRVB 2ETRA 1H1QA 1GAGA 4F1OA 3KVWA 5HD4A 3LIJA 4LGHA 1JLUE 3FZSA 4UMQA 2QI8A 2WMAA 5EOBA 5FM2A 4IZAA 5HI2A 4JDKA 2WTKB 1Q62A 3C4ZA 2RFEA 4J95A 1NT2A 3VIDA 4F1MA 3G9NA 1A48A 4DA5A 2W96B 4FIHA 4ITIA 4EOJA 5GIPE 3NYVA 5C8NA 3DAEA 5GZ9A 5DMZA 4R77A 2GTMA 2BVAA 2FGIA 2GS6A 3GCVA 4LGGA 5BVKA 2F7XE 4NIFB 5AAFA 3JVRA 2ZV7A 3AQVA 4IAZA 2B54A 4FT0A 1B38A 4EONA 3HEGA 4E4MA 3POOA 2CKQA 2CGXA 3K5VA 2C47A 4PY1A 2HXQA 3QYZA 5FBNC 1DI8A 3RK5A 4FV1A 2CNQA 3ORZA 4CZTA 3G0EA 2QQ7A 3KXHA 4FTJA 5B7VA 3GBZA 1OB3A 3DY7A 2QODA 3H9FA 3PSDA 2UW8A 3U8WA 2JDTA 5AR3A 4FA2A 2BILB 3BHUA 5CY3A 2ZJWA 4DBXA 3UDBA 3QWJA 2J50A 5LARA 2XM9A 4QRCA 4ZTLA 3QQKA 3M2WA 3VS6A 4AF3A 3TTIA 3HP5A 4M12A 4XNEA 5CAQA 4QPSA 3RAKA 3OW4A 4DG2E 2BPMA 5D7VA 4RLKA 4F70A 2QOQA 2RIOA 3I5NA 4FX3A 4EH4A 4L46A 4R78A 2QU5A 3KMMA 5IQHA 2CHLA 4WIHA 4EZ5A 2VTAA 2CLQA 4ZZNA 1MRYA 3ZRLA 4UV0A 2JD5A 4NCTC 2WQNA 2J0LA 4DBNA 4MWIA 3F3VA 1YRPA 5D12A 1FMOE 1S9JA 4TNDA 5KBRA 2WMRA 3EQPA 4FIIA 3SGCA 3LCDA 5HBHA 2YDIA 3ZYAA 4KS8A 4ZLOA 1ZAOA 4KKGA 2Z7RA 3NS9A 5K0XA 4BCKA 4G6OA 2HW6A 5E4HA 1OKZA 3LW0A 1BUHA 4ZJIA 2C69A 5L8LA 4RFZA 3KL8A 1UU3A 3LJ0A 3HNGA 3UPXA 1UWHA 4FIGA 3WZJA 5KMIA 1ZYSA 3CS9A 2BZIB 5JQ5A 3QZFA 1SNXA 3TKHA 4F7LA 3ZS5A 2OFVA 3MTLA 3MJ2A 4FOBA 4EK4A 4EK5A 3TNHA 4AACA 5FQDC 1JSTA 3E3PA 5H2UA 1LPUA 4E8AA 3WIKA 5D10A 2FB8A 4YBKA 4EH3A 1RDQE 2X4ZA 5KBQA 5BVEA 3PA3A 1JQHA 3E87A 1ZYCA 1PXOA 4LQMA 2EB3A 4RC3A 4C02A 5CU0A 1H24A 4GUBA 4LUEA 2IW9A 3CC6A 5HCYA 2C0TA 3GNIB 4RJ8A 4BIBA 2EXCX 4ENYA 3EYGA 4XG3A 3C0GA 4MBLA 2BIKB 5D7AA 3OBJA 2VTOA 4YJSA 2BAQA 3H30A 3L8PA 3U87A 5J7BA 4O0VA 4AN2A 4F6WA 1H1SA 5D9HA 2R3QA 3NX8A 3P9JA 4JRNA 2XNGA 3MVLA 3OZ6A 3HV3A 3KXXA 3MDYA 3NNWA 3U9NA 4YZMA 3PVWA 3WE4A 4E6AA 2FSOX 5G1XA 5I9YA 1JNKA 1JVPP 2GNHA 2JKOA 4G5JA 1PXMA 5CENA 4FTAA 4IVAA 1YWVA 4ZSLA 2W9FB 3RNIA 5LMKC 4ITJA 4L8MA 5CI6A 4QMNA 1PXJA 4XG2A 3DBFA 3NUUA 5CVGA 2KTYA 4QMXA 5IA0A 3FQEA 3E63A 1PRYA 3Q6WA 4I1ZA 4Y46A 3SW7A 5LVMA 3CTQA 4YTIA 4FUXA 1O6LA 4MD8E 4MXXA 2XF0A 4FTUA 5FG8A 3DT1A 5LXMA 2BMCA 4L52A 4C34A 3UNKA 3UOKA 3DJ7A 3E8CA 3SXRA 3Q4UA 4NM5A 1VR2A 2HCKA 2OO8X 4WNOA 3MFRA 4BWKA 4PMTA 3R73A 2VTQA 3E92A 5E1SA 3UNZA 5IQEA 4FF8A 2W1IA 4WNKA 2W99B 3KRJA 2GDOA 3VUDA 3QKKA 4S30A 3C13A 3PG1A 3GC7A 2E2BA 4J96A 4E5WA 4EC8A 3WYYA 5JFXA 4G16A 1O9UA 2XH5A 3GP0A 3Q4TA 5BYYA 3FC2A 1Q97A 4ZEGA 3T3VA 5EG3A 4F65A 4YSJA 4BBEA 1GY3A 1QMZA 5BUIA 4ZY5A 4UY9A 1PXNA 3QHRA 4J52A 4NM0A 4I41A 4IFGA 3PYYA 4RZWA 2PZPA 4CMOA 2CLXA 3KRLA 5FTOA 5IA1A 3OOGA 4EJ7A 3KQ7A 3R8ZA 3PPKA 1G3NA 5DPVA 5IDPA 3F3WA 3I7BA 3KF4A 4AW5A 3U55A 5FRIA 1NVRA 3C4FA 5C26A 3AT4A 3C7QA 4FV2A 4UWCA 4QOXA 3DFAA 3AGLA 4FNYA 4AGWA 4CV8A 5C8KA 2XK8A 4YP8A 2R3RA 3TIZA 2CGWA 2YIQA 3QC9A 4J53A 1XO2B 2QKRA 5CU2A 4O7NA 2O0UA 1EH4A 1O6KA 4L7FA 2PULA 4E7WA 3DJ6A 3QD4A 5JZJA 4DF3A 2OIBA 3A4OX 1K2PA 3LQ3A 3MIAA 4M0ZA 4QQCA 3PVGA 4FTQA 4B99A 4DFUA 5DIAA 4FEXA 3QTSA 3OWKA 3FMMA 4KRCA 2AYPA 2BRHA 1GZKA 5EW8A 2PMLX 4I20A 1A9UA 4BVUA 2IZRA 3A4PA 1JKTA 3QD2B 4O7LA 3OEFX 2VTRA 3CQUA 3IOKA 4UN0C 1YHVA 4X6RA 4FBXA 4EBVA 1YDRE 3GXLA 4AA4A 3DB8A 3QCSA 3EL8A 4GJ3A 4L45A 4YGAA 4Z16A 3PJ3A 2PSQA 3AC8A 3EFJA 4ANBA 3VVHA 4ONAA 1VYZA 3LCTA 3PVUA 1U5RA 3UYTA 4AOTA 2VWXA 2O5KA 2E9UA 3GU6A 2XJ2A 4RT7A 4B9DA 4O1PA 4PP9A 3F82A 4IVBA 2LGCA 1XBBA 4TWCA 3LFEA 1SM2A 3IONA 4MNEA 4FTMA 3IW8A 3A7FA 1WAKA 1DI9A 1YVJA 5AV2A 2PVRA 1DAYA 2YM7A 2PZYA 3QKMA 5AV0A 4H36A 4F0IA 4FUYA 4BDIA 4RX5A 3GCSA 5CS6A 5I9VA 4ACHA 4FTCA 2HY0A 3BGPA 3QTRA 4MHAA 4MXOA 4BGHA 4G6LA 4GT3A 3W2OA 4O84A 2XIYA 4QTCA 2BCJA 3ULIA 1QPCA 1TQMA 3IG7A 3V5LA 2B53A 3ORIA 4F0GA 4O6LA 3KCFA 4G3GA 4USDA 3W18A 2BRGA 4OT5A 5FM3A 4EH5A 3V5WA 3MS9A 3WYXA 2C5NA 1SMHA 4U40A 3V8WA 3D5UA 1OKYA 3QQFA 2X1NA 3COMA 3FJQE 2P2HA 3PJ2A 3E3BX 4EUTA 3ORMA 4FOCA 2W4OA 5FD2A 3HDNA 3PP0A 4MCVA 5TKDA 3TV6A 5I0BA 4D2TA 3V6RA 5HBJA 5CT7A 4ITHA 4XEYA 4DFXE 3BV3A 4IB0A 3LVPA 1Q4LA 3PIYA 3JUHA 4FKIA 4NWMA 2EUFB 5DR9A 2BZJA 2G2FA 2PK9A 4LUDA 4EOLA 5ICPA 2PUPA 3MSSA 3F2RA 1JWHA 3OF0A 3Q32A 4ID7A 4YTCA 1XH6A 2YJRA 3DTCA 5AX9A 1DM2A 2PMOX 3CKWA 3QRIA 4U7ZA 4IZ7A 3ZCLA 1J7UA 4CG8A 4BN1A 2B7AA 3LJ2A 4G5PA 3LQ5A 4YLLA 1OKVA 3NIEA 5M4FA 3FKNA 4DEAA 3G2FA 3TUBA 4RBLA 4RVMA 5J7HA 1QPEA 3SKCA 1FINA 1OMWA 4I0SA 1NVQA 3QALE 2BRBA 4PNIA 4X3JA 1U4DA 4E4XA 3R9HA 3U6IA 1GZOA 2UVZA 3HA6A 3MV5A 5F9EA 3A2CA 3QUDA 5CLPA 3OFMA 2QHNA 4H3QA 3UO4A 2GS2A 4EHZA 2PWLA 4U8ZA 4FSUA 1NVSA 4HNFA 4XRJA 3RM6A 4TXCA 4PMSA 3N9XA 4DGGA 4MD9E 4I6QA 5LWMA 3BHYA 3FMHA 4YURA 2ETKA 5FXQA 4G2FA 4Y85A 4E3CA 2OGVA 2JDRA 4D4VA 2F7EE 2X2KA 5HKMA 4KAOA 3UODA 3WF9A 4W4WA 4EOSA 3FKOA 4RJ3A 4JQ7A 3QWKA 4UX9A 1XBAA 3MGYA 4IC8A 2CJMA 3KVXA 2W1FA 3QQLA 2FYSA 3QTIA 4RFYA 4B8MA 4E93A 4EOMA 1JSVA 2WTWA 2OZAA 3QZGA 4G31A 1CMKE 3AMYA 3KU2A 4I5CA 4FT3A 3E88A 3ZDIA 4CRLA 4QMPA 4BCMA 4CQEA 2X7GA 5AX3A 1S9IA 3NLBA 1PMEA 2PVLA 5FEEA 3VQHA 5CVHA 3BBWA 3MPTA 3OW3A 4FK6A 4IACA 4JLCA 4R7IA 4ZTHA 4F9CA 3DXNA 3ZSHA 3IQ7A 3CGFA 4O0UA 4FL3A 4TRLA 5CQUA 3RMFA 4ANOA 5T6KA 5J79A 5LQFA 3SOAA 1G5SA 2Y6MA 3EQGA 3NNUA 1SVEA 5AR7A 4DHFA 2QHMA 3VS0A 2HW7A 2QLQA 2VNYA 4APCA 3FAAA 3KULA 4NKSA 4H1MA 4DE4A 3QRTA 3H4JA 2VTPA 4FMQA 3EZRA 5EI8A 3VS4A 5CAPA 4FSRA 1URWA 4ZOGA 5E91A 2H6DA 2WU6A 3DK7A 2PZ5A 5KZIA 3A99A 5EDQA 4O0TA 3DAKA 3HAMA 1OL7A 3MA6A 2WELA 4JDJA 2UZVA 3VWAA 5DRBA 5HG5A 5K3YA 5JGBA 3ID6C 3OWPA 2WGJA 2CGUA 3WF6A 4CV9A 4IZ5A 4Q5HA 3JR1A 2R3FA 3TWJA 1ZYDA 2RFDA 4RX7A 4XP2A 2IVSA 4DFYA 4OR5A 3KKVA 4C37A 2PMIA 2BUJA 2P0CA 1IA8A 3H9RA 4YNEA 4FKJA 3QA8A 2Z7SA 2OJFE 3GB2A 4FKOA 2VX1A 1OPJA 2YDJA 4MBJA 4JBOA 2H8HA 2OZAB 3R7IA 3R9RA 3DOGA 1XH7A 5LMBA 4KABA 4YJRA 2XS0A 2UW5A 1XHAA 4IDTA 4NUSA 4BZOA 5J9LA 4KKEA 3COIA 2WKMA 3GUBA 4AZSA 4ZK5A 1IAHA 4XG8A 4TKSA 4D4SA 3LFSA 4JAIA 3ZC5A 4E1ZA 3CPCA 1YDSE 3I0OA 3KRWA 3PY3A 3QD3A 4K18A 2DYLA 3W2QA 2WTVA 4IJ9A 3OT8A 3I81A 3KCKA 5C27A 3AT2A 1JAMA 1UV5A 1WMKA 1ZLTA 2GCDA 5E7RA 5HLPA 3Q04A 5AUYA 4FKSA 1AD5A 4PTEA 4WG5A 2F9GA 5F4NA 4OTWA 4FT7A 3KULB 4QMVA 5D1JA 3W16A 1ZMUA 2WOUA 4X0MA 2BAKA 3ELJA 1YXSA 3VF9A 3VRYA 5EHOA 5BX0A 4ANNA 1TKIA 4EH6A 5ACKA 3UOHA 4BDHA 4I0RA 4KS7A 4C59A 5JFVA 5K4JA 2XCHA 3D14A 4TW9A 4WG3A 3UZRA 5M06A 2BTSA 4YPSA 3PZHA 3QQGA 5EH0A 5I3RA 3MH3A 5DHJA 1BI7A 1R39A 2J7TA 4FKVA 4AGCA 3GC9A 3UG1A 3BGZA 5JZNA 4O96A 3UQFA 4MEDA 4BYJA 5H3QA 1U54A 3PXRA 2VNWA 4U42A 3ZXZA 2QG7A 5E90A 4BHNA 2X9EA 2WNTA 3LXNA 4MH7A 1Q5KA 2BTRA 4CEGA 2IO6A 3L9LA 4QMTA 3TKIA 4CT2A 3HMIA 1PMUA 3ZZWA 5IQAA 5JMSA 4NFNA 1A06A 1ZOGA 4JJRA 5B2KA 3K5UA 4EYMA 3O23A 3ROCA 4EHGA 2VTMA 5CANA 4N57A 3DA6A 4G3FA 2X8DA 3A62A 2GFCA 2OWBA 2CN5A 3UJGA 1P5EA 4KA3A 4YHTA 3DCVA 4IANA 2UW7A 3R22A 4OTFA 4XX9A 5CEIA 2YM6A 4HVSA 2ZAZA 4B8LA 5L2IA 4EJNA 1V1KA 1GNGA 2Y8OA 2WQBA 2C30A 4KNBA 4QMUA 3DTWA 4I21A 3BEAA 4LV8A 2V62A 2CGVA 3ACJA 3VJNA 3H9OA 4I4EA 4O0XA 4RGJA 2OKRA 3WF7A 4XV1A 5AM7A 3FLWA 4QP4A 3RKBA 3FI2A 5CF6A 1CDKA 5IA3A 4Z9LA 4KWPA 1HOWA 3GU4A 3DV3A 4P4CA 4U3YA 5I9UA 5A9UA 5HCXA 3P08A 4GL9A 1FBNA 3DGKA 2OU7A 2XK9A 2W1GA 3RAWA 4IX6A 2QR7A 4PDPA 5DWRA 2BFYA 3UYSA 2C5OA 4RQKA 3HRBA 2C6MA 3TTJA 1I44A 4FI1A 4JG7A 1OIQA 3W2RA 5DYJA 4U6RA 4RVKA 3V01A 3IO7A 5TF9A 3E7OA 2JITA 3DKFA 3EQHA 2GMXA 3IGGA 4MKCA 4QMQA 4I5HA 5AV4A 4ORKA 5FXRA 4FTNA 4O0SA 4ZZOA 2YAKA 4DFLA 1M2RA 4CGAA 2WQMA 4ZTQA 2OBJA 3UZPA 4RVLA 5DR6A 3OWJA 3W33A 4CCBA 2A2AA 3SC1A 2GNIA 3UNJA 5E92A 3HDMA 3DBCA 2UW6A 1MQ4A 4FIEA 5DG5A 3ZLXA 5HICA 4RWJA 5AP4A 4FIJA 3ZSGA 3CJFA 4FNZA 4IH8A 2PVNA 2I0HA 4MK0A 1PYEA 3R30A 3QTQA 3MVJA 3R04A 4A9TA 4YNOA 4C4FA 3LJ1A 2QOLA 2YIYA 3NRMA 2BRMA 4TYIA 3OCSA 4NT4A 1Y91A 2XP2A 4DTBA 3F3ZA 1XH8A 1YOMA 4IB1A 2Y4IC 2WIPA 3W32A 5AAGA 4WG4A 3LAUA 4U79A 5GJGA 4Q9ZA 1Q8WA 2BHHA 3H0YA 3U4UA 2CNVA 5AV1A 2XZSA 1H0WA 2Z60A 3DNDA 4EWHA 2ITTA 3HMOA 5BPYA 2PMNX 2BDJA 3NYXA 3Q4CA 2FSTX 4MQ1A 4L3JA 4XV2A 5AIRA 5GJFA 4FGRA 3GC0A 3L8XA 4D5KA 4M0YA 3VAPA 5EHYA 5J5SA 4RSSA 5L4QA 4UMRA 4FV6A 5M4UA 2WMBA 2Q0NA 3GGFA 4XLIA 3C0HA 4OTQA 4L00A 3UQGA 4EK8A 2J4ZA 4MXYA 5EYMA 2WIHA 3HV7A 4GVJA 2RFNA 4EK6A 2JAVA 3ENMA 3IW7A 3M11A 3EMGA 3AC4A 4FKQA 5KKRB 3FXWA 3T9TA 5IQBA 3QGYA 2I7QA 3VBYA 2EXMA 3W55A 3TG1A 2PE0A 2DWBA 4IQ6A 2REIA 2X6EA 4KBCA 3L8VA 4O2PA 4QTAA 4O7SA 3OTVA 1PJKA 3HX4A 2XUUA 4CFVA 4PL3A 5L6WL 2RG6A 4FTRA 5M4IA 4ZTMA 4RIXA 3IPHA 5I9WA 4JR7A 4KIQA 4R8QA 3ZFXA 1Y8GA 2GHMA 3E7VA 3RZFA 3SDJA 4ANLA 3UC3A 4RIWA 3PLSA 2CCHA 2IZTA 1H4LA 3PRFA 5A14A 2Y4PA 4CKIA 3QRUA 5L2QA 2IVUA 4CFXA 3R2YA 2HYYA 2E9OA 4B6LA 3GQLA 4AXAA 4JBQA 4MYGA 3HRFA 3IS5A 4D0WA 3PIZA 5AWMA 3SW4A 5M51A 1XBCA 2J0JA 3F7ZA 3K3JA 2W05A 4OTHA 4TWOA 4DTAA 3S1HA 3W2PA 3EIDA 4CFUA 3KGAA 5IEXA 4B0GA 4G34A 4EORA 5HLNA 3UO6A 4Y83A 3TACA 4FSNA 3EFKA 2WAJA 5IMEA 2C3JA 2QC6A 4BCQA 3DDPA 2EXEA 2JBOA 2ZB1A 2OFUA 3NWWA 2O3PA 5CZHA 3RK7A 3ZLSA 4AW0A 4C2WA 4CZUA 5AP2A 1WBTA 2VTSA 5E8VA 2J0KA 1X8BA 2JDOA 1R3CA 4PRJA 3Q96A 5CT0A 3UMWA 3UOLA 5BYLA 2VWWA 4GJ2A 4IAAA 1ZMWA 4Z3VA 3OBGA 5G6VA 4G6NA 3KEXA 3HVCA 2Z2WA 1Q99A 2WMSA 4IX3A 3QKLA 4RIXB 5DI1A 4D2PA 4F9YA 3CCNA 1Q3DA 2VO7A 2X7FA 4NCTA 2X4FA 3R7UA 3TXOA 5M4CA 4DH1A 2GQGA 1XR1A 5CQWA 3NW5A 1OBGA 4RIWB 1L8TA 2J9MA 3TT0A 4BR3A 4LL0A 2Y6OA 4ZP5A 4C4JA 5F95A 5TE0A 2YIRA 5BVFA 4L3LA 4BCOA 4NU1A 2NRUA 5DA3A 5GNKA 3N4TA 3KB7A 4GW8A 3AD6A 4CRSA 3VBQA 4EWQA 1R0EA 2VO3A 3R1QA 1WVXA 4R7HA 5HQ0A 4O38A 3UOJA 2JGZA 2E9PA 2F7ZE 3BE2A 3EQIA 3O8PA 5IUHA 3ATSA 3TL8A 2UZUE 1PXKA 5M07A 4AZFA 5C01A 4EKLA 4GIHA 5DVRA 4XOYA 3UIXA 2C3LA 3BCEA 4AP7A 5CSXA 4BKYA 5LCKA 5J95A 5JK3A 4KB8A 4LOOA 5EKOA 4CNHA 4LI5A 1NW1A 5FUTA 2CNUA 3P7BA 1KE7A 5DBXA 2JFMA 4UMTA 4X2NA 1SNUA 2IW6A 2J5FA 4BIEA 4C0TA 3PSBA 4EOOA 5T3QA 3LFNA 4DG0E 3NIZA 3WZDA 3HMNA 2X39A 5EI6A 2GSFA 2QURA 1H28A 2Y0AA 3BU3A 5EDPA 5JRQA 2PVHA 4S2ZA 4W9WA 3TJCA 5DNRA 3MB6A 4F0FA 4LRJA 3LFCA 2YCFA 3PRIA 2WTDA 3AGMA 3GENA 4F6UA 4K2RA 5L2SA 3O8UA 4AZTA 4X6QC 3VRZA 3UO5A 4JDHA 3A7GA 3LFAA 5L6PA 5IMXA 5BMSA 4M8TA 4FG9A 3PPZA 4M69A 5FXSA 4H1JA 4O7VA 4AW1A 3CQWA 4WT6A 2QOCA 5FTQA 1MRVA 4DGNA 5IDNA 4N4SA 4RJ6A 4EBWA 3DU8A 3R8UA 2RKUA 4DYMA 5LMKA 3TZ9A 2W5AA 3QA0A 3O7LB 5AJQA 2ONLC 4YZDA 3H0ZA 4C33A 3BWFA 5CXHA 4AOJA 1WBPA 3F7WA 3ZH8A 3NDMA 4HNIA 4H05A 1PXIA 3IDPA 3U4WA 3H10A 3OMVA 3QAME 4FT5A 4C3FA 4BHZA 3R7GA 3UG2A 4FZDB 5EYKA 1Q61A 3DZOA 2I40A 2BR1A 2UW9A 4RQVA 3RJCA 2F4JA 4K33A 4XBUA 3E62A 2XBJA 3ZLWA 1G8SA 2ZMDA 3CBLA 3QFVA 4FTKA 4M7IA 4YBJA 3OP5A 5CALA 4F64A 3C5UA 1WZYA 4PF4A 4GYGA 2ACXA 3BELA 3UP2A 3RI1A 1Y8YA 3BEGA 2UVXA 2YIXA 3V5QA 3VUIA 5JEBA 4HCUA 1IR3A 3ZZEA 5CXZA 2YLFA 3GU5A 3JYAA 2ETMA 2OXDA 4JX7A 1WVYA 1OZ1A 3C0IA 5CSWA 3BU5A 2C0IA 2UW4A 5AP3A 4V0GA 1PY5A 2C3IB 4E5AX 2CKOA 3ZC6A 5EW9A 3RPSA 3ORLA 4PTGA 4BFMA 3Q2JA 1OVEA 4G17A 1OUKA 2C6EA 2GPHA 4O0RA 3EQFA 4CMUA 2QD9A 3S3IA 3BQRA 1YXXA 3NGAA 3C4WA 5DOSA 3W2CA 3ET7A 5DE2A 2UZNA 4R1VA 2XKEA 5HIEA 5FP5A 3UVQA 4BKZA 3KRXA 4QMSA 3WF8A 4N6YA 4RLLA 4IAYA 5LVPA 3PXKA 1ZY5A 2J0IA 4M69B 5IEVA 3CTJA 3DAJA 4CXAA 5CEOA 2ITYA 5AP0A 1PW2A 3C1XA 3QU0A 2B9IA 2HZ4A 2XK3A 4QMMA 5E8ZA 3BYSA 3V51A 4BCGA 5AFVA 1H25A 3TZ7A 2PY3A 4AOIA 3PP1A 1OL6A 3CR0A 4PNKA 4D5HA 4X2GA 4ACMA 2G2HA 4JX3A 4HPTE 4FG8A 4GU9A 2AUHA 1OIUA 2C3KA 3BWJA 3NUYA 2XEZA 4OBOA 1Z5MA 2CCIA 1STCE 5KZ0A 4DTKA 2O65A 4O1OA 3FI4A 1FOTA 1UKHA 5CVFA 3UPZA 3VUKA 4I3ZA 3P23A 4V05A 3O17A 4YJVA 5JFSA 1DAWA 3PXZA 5EM6A 3AG9A 5EHLA 2X9FA 4LL5A 3EN6A 4TYHA 3SXSA 3R71A 1F0QA 4PP7A 3SVVA 1SVGA 2PVJA 4RG0A 5GHVA 3FQHA 3R8MA 3ZBXA 4N0SA 3VS5A 5CF8A 4BF2A 3SG9A 3KK9A 3KN6A 1QCFA 4IAIA 4ZLZA 3Q3BA 4OW8A 3VBWA 4JVGA 4PDOA 4V0GB 4NYEA 1Q3WA 4IM0A 5IUIA 4BI2A 3I6UA 3IDCA 5J1WA 3VUMA 4BTKA 2QOFA 4HVDA 4R3CA 3I0QA 3I5ZA 5CAOA 5JRSA 3RBWA 1JOWB 2BHEA 4K1BA 1ND4A 3MBLA 2C1BA 3MTFA 5I9XA 1QPJA 4L67A 4XCUA 4F7JA 3SG8A 4BWPA 1V0BA 4HJOA 2IPXA 4RX8A 2PHKA 1OPKA 3OWLA 4APPA 4YTFA 4AA5A 4R7BA 4M84A 2IVVA 1XJDA 2OSCA 4GT5A 5HE3A 4Q9SA 4H58A 3RAHA 3ZU7A 2CKPA 3RPRA 4GV1A 2O8YA 1H1PA 3VHKA 2JKKA 2QONA 2PUIA 3MVMA 4HW7A 1WBSA 3ACKA 3O7LD 4DN5A 1PYXA 2XK7A 1REJA 3JPVA 3KY2A 4ZSGA 1UKIA 4BTJA 1VZOA 4QTBA 4CLJA 3LMHA 2JAMA 4ANQA 1VEBA 4TWPA 3POZA 2NNWB 3OT3A 2H96A 3ULZA 5E8XA 2JFLA 2AC5A 4BDJA 5IH5A 4HYUA 4DH3A 4L9IA 2R3MA 2YITA 4ANSA 2PUUA 5A6OA 5E8UA 4I4FA 3KFAA 4CFMA 3V04A 2PTKA 4YJUA 3ZRMA 2HIWA 4EH9A 3FY2A 4TYHB 3E64A 2OXYA 3V6SA 4CG9A 3H3CA 5M55A 3G9LX 3GI3A 3WE8A 3BX5A 2YDKA 3BZ3A 1PMNA 4BTFA 5IQGA 3ZM4A 3D7ZA 4FR4A 3O96A 4ENXA 3LMIA 3NMUF 2FVDA 5JSMA 4L01A 4BBFA 3CKXA 5HEZA 2PVKA 3NUAA 4WBBB 5HE1A 4II5A 4AE6A 4E4LA 2RFSA 4J99A 4IXPA 4G3EA 5F94A 5KMNA 1KE8A 3PPJA 4YZCA 2AC3A 4RC2A 1I09A 3FQSA 3FXXA 2XKFA 4U9AA 4Z7GA 3OVVA 3RHXA 3P7AA 4KSPA 5HESA 4D58A 3QGWA 3BYOA 3F2AA 2GNGA 4HOKA 5HGIA 1HCKA 3PUPA 1ZY4A 3D2KA 4CKRA 2WMVA 3DLSA 3BLQA 3OXTA 2UZOA 4G9CA 5CEKA 1YQJA 2IZSA 3BPRA 4EK3A 3R21A 1OL2A 2PE2A 2J5EA 4FV9A 5IQIA 5CI7A 5CX9A 4FE2A 2GHGA 3R7EA 1W84A 3LFQA 4FV4A 4UBAA 4P5ZA 5M57A 2BDWA 4AUAA 4LMUA 3ZMMA 3RWQA 1V0PA 5CSPA 3S00A 4J98A 4PV0A 3RWPA 4YHFA 3AC3A 5GINE 2QVSE 4ACDA 1OECA 4FEUA 3REPA 3KC3A 3OY3A 4FKWA 4PX6A 3RAIA 1KE9A 1VYWA 2R3IA 5IQDA 2HK5A 4L43A 4D4RA 2GNJA 1GIHA 2A27A 3A60A 3LXKA 2VX3A 3LFFA 2C6DA 4IB5A 2YCSA 3R63A 4RA5A 2WEIA 3QLGA 5K5NA 2BKZA 1PXLA 3D83A 3NYNA 5AUWA 3LXLA 5TO8A 2YZAA 1YXUA 4X2JA 1P2AA 4U41A 2YJSA 3CLYA 4XUFA 1UNHA 2G15A 4QP1A 4D1ZA 5KMMA 4U0IA 2UVYA 2Z8CA 3VC4A 4C61A 2Q83A 3F3UA 3VW6A 2I0YA 5HVKA 1Q8UA 3DB6A 1R0PA 2GS7A 5AA9A 3D5VA 3JVSA 1BL6A 4YJPA 4NM3A 5I3OA 4O7ZA 1WBVA 3TM0A 2O64A 1AGWA 3ZLYA 4ZSEA 3B8RA 4Q5EA 4C3PA 2CKEA 4KBKA 3TIYA 4FNXA 3LCOA 3BRBA 2OF4A 4KINA 3OUNB 3UZTA 4JL9A 1H26A 3PXQA 4I0TA 3TDVA 1URCA 4YTHA 3ZUVA 3VNTA 3B2WA 4AN3A 3FLZA 1E1VA 2QNJA 4M13A 3RPYA 4RRVA 4C58A 2WU7A 2X0GA 3CGOA 3R9NA 3PY1A 3D2IA 3ORPA 3TV4A 4DEHA 4D9TA 4W4XA 4WSQA 3L9NA 3QTUA 4LV5A 4N70A 2R2PA 5HIDA 4BZNA 2R4BA 2ERZE 4TN6A 4USFA 4Y95A 2B4SB 2WXVA 4UWYA 3V8SA 2XBAA 3EN9A 4IMYA 4RMZA 3GOKA 4GUEA 4IJPA 5ANGA 4BL1A 3GQIA 3G6GA 2QOBA 3F5UA 3GCPA 4YLKA 4XHKB 2GFSA 4FGBA 4JS8A 2VWVA 4PPAA 5CU6A 2KULA 2J90A 3I79A
chains in the Genus database with same CATH superfamily
4PDSA 3T9IA 4UMUA 4Y5HA 4U3ZA 5CYIA 2QO7A 3NAXA 4A07A 4DAWA 4BI1A 2XIRA 3TUCA 2FO0A 3BHHA 5CEQA 5KX8A 2HOGA 2I1MA 5ANIA 4YO6A 4EOIA 5JGDA 3OCTA 3HMPA 5ACBC 4EKKA 2VU3A 4HGEA 5M53A 4ZMFA 3FZ1A 1OUYA 4QP6A 4AT4A 3OROA 1IA9A 4JI9A 4NM7A 4DFNA 4GFMA 2GNFA 2XNBA 1GZ8A 3VULA 3PUFC 3CTHA 4RWLA 3EZVA 4QYYA 2ZDUA 3FXZA 1CTPE 4EI4A 4Z7HA 4I92A 4XG4A 3DXPA 1FVTA 5EM5A 4FVPA 3ZSIA 3BLHA 3LHJA 1WBOA 3PA4A 4PPCA 3DS6A 2VO6A 2WPAA 5K4IA 3FMNA 2ZYBA 3CQEA 3PFYA 3MFSA 2VTIA 3AXWA 3FYJX 4U81A 4TTHB 5A4CA 2OIDA 3V8TA 3FKLA 3II5A 4GRBA 3EFLA 2CMWA 3O71A 3UGCA 3C5IA 3AMBA 2W0JA 4QMZA 4S33A 2J0MB 5ANKA 4IB3A 1H1WA 3D4QA 3SX9A 3BYMA 5F1ZA 4AWIA 4BB4A 4ZJVA 2QKWB 3DXQA 2R3HA 3FZTA 4Y73A 3OTUA 1J7LA 1G8AA 5ETIA 3NSZA 4FEQA 4X7QA 2BIYA 5A6NA 2ITOA 5ANJA 5A4EA 1XWSA 4JR3A 3ANRA 3U51A 4GIIA 4XYFA 5AIKA 5BVOA 5GJDA 4UB7A 5E1EA 3DKCA 5L2TA 4NJ3A 3PY0A 4NTSA 2OJIA 3G33A 3UE4A 2YFXA 2ITQA 3R00A 1UWJA 3W0QA 2C6TA 2UUEA 1V0OA 5AAEA 2X2MA 4D1SA 4TYJA 2QCSA 3RZBA 4CZYB 1LUFA 4FRFA 3HZTA 4TNBA 2VWIA 2XNNA 4DEIA 3LCSA 4FSMA 4PQNA 5IEYA 4GS6A 4AN9A 3DPKA 1YW2A 3NNVA 3ZFYA 3ZEWA 4OAVB 4I93A 4UXQA 2IG7A 2IN6A 5HD7A 3VS1A 1OKWA 3G0FA 4FZFB 4IHPA 1W83A 4LOPA 5FGKA 5EQPA 5HU3A 3QXPA 1OITA 3OHTA 1YHWA 1OBDA 3HKOA 2OK1A 4BGQA 4V04A 3NUSA 4CYIA 3EKKA 2CN8A 2F2CB 3HV4A 5H8GA 2XAOA 3EQRA 4ZTNA 2JIIA 2VO0A 1LEWA 2BAJA 2FSMX 4XG6A 3PVBA 4KSQA 3UVRA 5C1QB 4AXCA 4BZDA 2PVMA 4DLJA 4FTIA 4B4LA 5JKGA 4NZWB 1J1CA 4QP3A 4RIYB 3I6WA 2HZIA 3FI8A 2DS1A 1KSWA 3NUPA 5ANEA 5CAVA 4X2KA 3S0OA 2VRXA 1MRUA 3MH0A 4W8DA 4CTBA 5IF1A 4BY9E 3QQUA 4NEUA 2PZIA 4U45A 2PL0A 3NNXA 4XG9A 4XBRA 4EZ3A 3OS3A 4ZY4A 4C4IA 1TQPA 4D2RA 4BGGA 4AE9A 2CPKE 1W7HA 2X0QA 4DGMA 3C51A 4F08A 2IJMA 3ODYX 3AD4A 1XH5A 4CYJA 3BE9A 5LJJA 5HG8A 2P55A 2F57A 3OY1A 5I5ZA 2C68A 4XJ0A 2PZRA 4IZYA 5DN3A 2VTJA 4HGSA 1IRKA 4OGRA 4YJQA 5L3AA 3M42A 5C8MA 2J2IB 4ERKA 3CD8A 2CSNA 3PJ1A 3QXOA 2ITWA 4JBVA 4IWDA 2JKMA 5FLFA 2QOOA 2YABA 3TNQB 4DH5A 5HVYA 2WMQA 4WHZA 1R78A 4QD6A 3VN9A 4E6CA 2UZBA 4CQGA 1OM1A 4JT3A 4EUUA 2CDZA 5ITAA 1TVOA 3RNYA 4FVRA 4ASXA 3CXWA 4XS2A 5B2LA 3QCYA 4GH2A 2PPQA 4EH7A 5C03A 4BDAA 3FEGA 5HLWA 4DEGA 2GU8A 3QCXA 2NRYA 2R3LA 5CU3A 5TOZA 4C4EA 4MBIA 2G9XA 4BBMA 3S95A 3KRRA 3R28A 4WBOA 4EYJA 3MI9A 4L3PA 1PKGA 4FKLA 4BCHA 2V22A 3P5KA 3P0MA 3Q60A 3R7YA 4DG3E 4O2ZA 4F99A 4O81A 4QMLA 5HTBA 4AW2A 2W1EA 1Q24A 2WB8A 4NSTA 3OG7A 3LCKA 4H3BA 3Q53A 3MWUA 4YZBA 3R9OA 4ZMEA 1IG1A 1F3MC 3KXGA 4FZAB 2HXLA 2VZ6A 3BV2A 3K3IA 4FODA 3CP9A 5BUEA 1UVRA 2RGPA 2QR8A 3DFCB 3ODZX 3P79A 4C2VA 2YM4A 2Z7LA 4UYNA 4EQCA 3G5DA 2G01A 4LV7A 5D41A 2X0PA 2EB2A 3F61A 4ASDA 4C7TA 4FSZA 4Y8DA 3VUHA 5DEYA 3TDWA 2O63A 2Y4IB 3BBTB 3OOMA 3LLAA 3QYWA 4OTRA 5J8IA 4AAAA 4O7TA 4IX4A 4KIOA 4DCAA 3TCPA 4QPMA 4ZAUA 4WKQA 3LE6A 4ALWA 2A4LA 4A9YA 4QYEA 4QT1A 4BKJA 1PF8A 3I4BA 2XYUA 3KMUA 4OT6A 4RPVA 4ALUA 2QLUA 1IEPA 3NW6A 3RCDA 3RINA 2BRNA 3BQCA 4MQ2A 3TKUA 1RW8A 4QTEA 4YLJA 5A4QA 4YJNA 1XKKA 4X3FC 4AU8A 3ATTA 2XYNA 4EL9A 3NVMB 2VX0A 2FA2A 1WFCA 1YI3A 5BYZA 3L9MA 5HG7A 4DHZA 1ERKA 3ZRKA 2W4KA 1H01A 2W9ZB 3O2MA 5CU4A 4EQUA 3RM7A 4DEBA 3Q5ZA 2OICA 2YM5A 3HGKA 4QMWA 3F66A 3WI6A 4BDDA 5HHWA 4AQCA 2Y7JA 3D9VA 3ZUUA 2YCRA 1Q41A 3QTZA 4E6DA 3KA0A 5EYDA 4YU2A 4XMOA 2Q0BA 2R3KA 4O82A 4PDYA 3ORTA 2HZ0A 3EQDA 3WBLA 1UU7A 3FSFA 5A4LA 2I0EA 4D9UA 3MESA 4PWNA 3F2NA 5AMNA 4M97A 4BICA 1T45A 4UWBA 4U44A 3ZTXA 4DLIA 3TUDA 4MWHA 4OAUC 4R3RA 2YCQA 2RF9A 3IOPA 4ACGA 3P7CA 2X0OA 1YI4A 4E20A 3QTWA 3RPVA 4OBQA 4EHVA 1BL7A 1MQBA 3M1SA 2PVFA 1YOLA 4CCUA 4S34A 4X21A 4E26A 2YHVA 3MJ1A 1GJOA 2XK4A 3CY2A 1H08A 4LM5A 3S2PA 3G6HA 3ZUTA 3FMKA 3FLYA 4AGDA 4CT1A 3PXYA 5B2MA 5LMAA 3DJ5A 2G2IA 3TV7A 4BDBA 4CFFA 3UQCA 3DK3A 3F5GA 3LZBA 4QP2A 2BZKB 5CSVA 3ZBFA 4K11A 1XH4A 5ANOA 3UIMA 2WTCA 4BC6A 3F69A 4M68A 2B52A 4FSQA 4HPUE 3R7VA 3WF5A 3PTGA 4BDEA 4ZSAA 3OXIA 3O50A 5HBEA 5AV3A 2P3GX 2QO2A 3IGOA 4IFCA 3QQHA 4AXEA 2R9SA 1RE8A 5A46A 3PFQA 4HVHA 4O83A 4GSBA 4D2WA 5A3XA 3VQUA 1WVWA 3PSCA 1WBNA 4C36A 3EQBA 3WZUA 1T46A 4WUAA 4HYHA 3UBDA 1SVHA 4IEBA 1GIJA 3L1SA 2EWAA 2IWIA 5DT4A 4MNFA 4DEEA 4GYIA 3IK3A 3PE1A 3TNIA 5KMOA 4OLIA 3SV0A 3SAYA 1L3RE 4C8BA 1M2PA 2GHLA 2RSVA 2ITUA 1YKRA 5EK7A 4I22A 2ONLA 4S32A 2VAGA 2ZV8A 4JOAA 2VUWA 3LFDA 5AADA 2ZOQA 3W0PA 5H8BA 4ZXTA 3EQCA 5CEMA 3D7TB 4QP8A 4F9WA 2WTIA 3ZEPA 5JGAA 1H8FA 2GNLA 3NEWA 2R3JA 3DKOA 3IDBA 3NVKI 3KREA 2ZMCA 3Q9WA 3HMMA 3R83A 5FTGA 4U43A 4HZRA 4XOZA 5DT3A 5CNOA 4YSMA 2XIXA 4QP7A 4FC0A 3TYKA 3MVHA 4GT4A 4BDFA 1YWNA 2UW3A 2XNMA 4JQ8A 5TT7A 2W1CA 4BCNA 3FC1X 1NY3A 4ASZA 4O7YA 2V5QA 3ZXTA 3W8LA 1YDTE 5FDXA 1YOJA 3GEQA 3DZQA 3DK6A 4R1YA 4F4PA 5EKNA 2VTHA 4ERWA 5AR2A 4NH1A 4JBPA 3W1FA 3L9PA 4BIDA 1ZXEA 1APME 3LOKA 2XNEA 3ORNA 3G15A 2JIUA 3W0RA 3IW6A 3PDTA 4YJOA 5AUVA 4DT8A 3EHAA 2C5XA 4I6HA 4P5QA 3TZ8A 4L68A 4IX5A 2X6DA 4FZ7A 4JRVA 4QYHA 2F49A 2P2IA 5AR8A 2OJGA 2XRUA 3QUEA 1J3HA 2B9HA 3GCQA 3EN7A 4FK3A 5AEPA 3U54A 2YERA 4WD5A 5FDPA 4QEBA 3ROYA 5JT2A 1PKDA 3Q9YA 2BDFA 5CWZA 4OTDA 4IIRA 4QNAA 4FTLA 5J9YA 2QU6A 2OF2A 3HL7A 5D11A 1UU9A 5IKWA 4O6EA 3KXZA 3A8WA 2XNOA 3QX4A 5AA8A 1CM8A 1ZOEA 2WMTA 2W1HA 3BYUA 3R8PA 2XJ0A 4DITA 1NA7A 1CKJA 3LFBA 3SA0A 1J1BA 2V0DA 4CSVA 2W1ZA 2WQEA 3PWYA 1P4OA 4NK9A 4WNPA 4WO5A 5EDRA 5BVWA 4KUJA 4FT9A 1CSNA 3DDQA 3ENHA 2WOTA 3B2TA 3KXNA 4IWPA 4XV9A 4YC6A 4GK3A 3ZFMA 4CKJA 2PVYA 3VS3A 4D55A 1HCLA 5GZ8A 4QQ5A 3EL7A 5EW3A 3QTXA 3S4QA 4EEVA 4FKTA 1H07A 1KV2A 1RJBA 2FSLX 3R6XA 3QCQA 4RA4A 4M14A 5EI2A 5HNGA 5IG1A 3L8SA 4W4YA 3FBVA 2ITXA 2PE1A 4BTMA 4R6VA 5HZNA 4M67A 2X81A 4PPBA 4F7SA 4FTTA 4G9RA 5KCVA 2H34A 3COHA 3SOCA 2JEDA 4YC8A 3QLFA 4K0YA 5IQCA 3NZ0A 1YI6A 2UZWE 4GMYA 2XMYA 4IE9A 5IU2A 3F5PA 1Z9XA 4O4BB 1OGYA 4ZSJA 4GKIA 1GIIA 5IH4A 3BYVA 4AZEA 3FZOA 4D0XA 2Y9QA 1YXVA 4FL1A 5KE0A 3GVUA 4JDIA 4WA9A 3ZM9A 4J7BA 3ORXA 1OL5A 3A7JA 4NTTA 4TYGA 3UC4A 1ZRZA 3E8DA 4NKAA 4BWXA 4FV7A 4E4NA 2XNPA 3MY5A 2UW0A 4FKUA 3GFWA 2WHBA 4FV8A 3RPOA 5E8SA 3OCGA 4I23A 5T68A 4EHEA 1FGIA 2UZEA 2R3GA 3FL5A 3I7CA 3DBEA 3P86A 4LG4A 2HENA 2IF8A 4OTIA 1IASA 3OXZA 3ZO2A 1REKA 4ZZMA 4QDEA 2UZDA 4TPTA 3JY0A 4L44A 3K54A 4FSWA 1ZYLA 4DH7A 2X8IA 5BMMA 3T8OA 4J97A 3UTOA 4YZ9A 2C6IA 3P4KA 1H0VA 2ITZA 2NPQA 2WEVA 3Q9ZA 1BLXA 4IWOA 4JIKA 4QYFA 5HNBA 3FHRA 2R0UA 4V01A 5L8KA 3AT3A 4RWKA 2B9FA 4BYIA 4ALVA 2QOHA 3N4UA 3CPBA 2XB7A 5A4TA 4FL2A 4EOQA 2A0CX 4YHJA 2E9NA 3E8EA 4B7TA 3MFTA 2VN9A 4A7CA 3OUKA 5KNJA 2IEWA 3DQWA 2DQ7X 5KUPA 2XCKA 3HECA 4HCVA 3HUCA 2ZDTA 4KBAA 4A9RA 2EU9A 3LXPA 4FV5A 4AA0A 2ZB0A 3CEKA 3F5XA 4TT7A 4EZ7A 4F78A 5IQFA 4O7WA 4FV3A 2ZM1A 3MIYA 4AG8A 4GG5A 3E8NA 2C6OA 5CF4A 2J51A 2R7IA 3GT8A 3RP9A 4AGUA 4C35A 3EKNA 1W8CA 2OIQA 3BGQA 3ZO3A 3MH1A 3MY1A 4C4HA 3KK8A 4NFMA 4A4OA 1LR4A 1QPDA 3NUXA 5HE2A 2VTTA 4QQTA 3AOXA 5FWKK 1BKXA 1FQ1B 1B39A 4J8NA 2HWPA 3GFEA 3W0MA 4MF0A 1KV1A 2YACA 4AS0A 5LCJA 2XALA 2ITVA 5HX6A 5M44A 3LLTA 4HYIA 5EOLA 2ZV2A 2WTJA 4YPDA 5AP6A 3O5AA 1BX6A 4RC4A 5C9CA 3Q6UA 1G8KA 5IA2A 4IWQA 4XG7A 4LFIA 5EYCA 1OIYA 5H8EA 3MPMA 3QD0A 4ZY6A 5K9IA 4YZNA 5AUUA 2XAMA 5L6OA 1W2CA 4BDKA 3HP2A 5DR2A 4J71A 2BZHB 5E9EA 4RJ5A 5FEDA 3Q2MA 3U6JA 4L7SA 1GOLA 4A06A 2UZLA 3DLZA 3DKGA 3NYOA 3I1AA 4UEUA 2QG5A 3ERKA 3MA3A 3BHTA 3D5XA 3R1NA 4YC3A 3SLSA 3FDNA 4XLVA 3DQXA 1FVVA 2RL5A 1OL1A 2XRWA 3MPAA 3R1YA 1Z57A 3AC2A 4O86A 3V5PA 4FYNA 3QC4A 4LGDA 4EOKA 5JFWA 4CLIA 3MFUA 4O0WA 1KOAA 2XIZA 3FLSA 3QZHA 3VS2A 4FNWA 5F20A 4CTCA 5HNIX 3W2SA 4RFMA 4I24A 1SYKA 4UXLA 4U5JA 4UZHA 4DC2A 5BNJA 3CD3A 3NFFB 3AC5A 2A1AB 5AP1A 4FVQA 3WARA 5EQYA 4Q2AA 3FPMA 3U9CA 3LKMA 5DRDA 4QTDA 3RK9A 2YWPA 4I6BA 1F5QA 3UMXA 3HV6A 3PJ8A 4XRLA 2XIKA 3W10A 2XM8A 1W2FA 1VJYA 5EQEA 4YR8A 4J1RA 4OUCA 5J87A 5IA4A 3FLNC 3HA8A 3EH9A 2HELA 3FZRA 3FLQA 5BUJA 3IW4A 1U59A 3C4EA 1BYGA 3GU7A 3PLAE 2YAAA 1FVRA 4FKRA 4HGTA 1JKLA 4MNEB 3BHVA 3MB7A 5JQ8A 2WFYA 5L8JA 3A7HA 3NUNA 3R2BA 2BALA 2HWOA 2R64A 3C50A 3CJGA 1ATPE 2IVTA 4ZS0A 4MTAA 2NP8A 3HRCA 2VWBA 2X2LA 3QL8A 4FG7A 3R8LA 4O27B 3Q52A 2WZJA 5DEWA 3LPBA 3GOPA 4C4GA 4ZIMA 4H3PA 1KE6A 2YZLA 3R02A 4ARKA 4RIOA 1OIRA 3G51A 3MH2A 3P78A 4KIPA 4G1WA 4QQJA 3FPQA 5L2WA 2C1AA 3PE2A 4BI0A 1ZARA 5IZFA 4RWIA 3EJ1A 4CD0A 2WMXA 3ALOA 3O8TA 1E9HA 4FV0A 3TEIA 1JPAA 2WMWA 2B0QA 4IAFA 3AD5A 4GFOA 4EH8A 3IW5A 3QHWA 5AR5A 2ZFYA 2V55A 3VUTA 4EOPA 2A19B 2C4GA 2OW3A 1PMVA 4IDVA 4QMOA 3EYHA 1CKIA 4FTOA 3U6HA 2YISA 3KMWA 2SRCA 3F88A 4AZWA 1Y6AA 4GG7A 2XKDA 3JY9A 4K6ZA 3VONA 4YMJA 3HYHA 3BU6A 4BRXA 1FPUA 4FKPA 3DNEA 4F9AA 1DS5A 1UNGA 4DGOA 3ZDUA 3QUPA 1M7NA 3OEZA 2J6MA 1YHSA 5HU9A 4BCJA 4EH2A 4HYSA 4GKHA 2XK6A 4FICA 1YWRA 5E8TA 1UNLA 2C0OA 2VGPA 4GVAA 3FUPA 1XQZA 4L42A 4A4LA 2GQSA 4BCPA 1RQQA 2FH9A 1KWPA 4YO4A 4DH8A 3FMLA 2Z02A 2WO6A 4W4VA 4C62A 4BDCA 4I94A 4DEDA 4F7NA 5HTIA 3FY0A 4K77A 2UV2A 2R3PA 2PU8A 1W2DA 1WCCA 2QO9A 1P4FA 3R1SA 1B6CB 4LRKA 4QP9A 4O7RA 2V7OA 5IH6A 3LQ8A 1H1RA 3NCGA 4JG6A 3WOWA 5BVNA 5EM8A 2OH0E 2VWUA 2HAKA 3AC1A 4HGLA 4IBMA 2OG8A 3V3VA 3MN3A 4UMPA 5HORA 2IW8A 5LWNA 4M15A 1BI8A 3V5TA 5AM6A 3VBXA 4GEOA 4G3DA 4KIKA 1OPLA 2I6LA 4GFGA 5B0XA 4UZDA 3V5JA 5HTCA 3C4XA 3NAYA 4GK4A 2HZNA 5GZAA 2P4IA 2R3OA 3FI3A 4WUNA 3D5WA 4O91A 3OC1A 4D2VA 3OCBA 3AKKA 1TQIA 5IUGA 2OJJA 1JSUA 2E9VA 2WQOA 4NW5A 4RIYA 2WD1A 1GZNA 1UU8A 4OTGA 2WMUA 2JDSA 4MX9A 3TZMA 3O51A 3FWQA 3PIXA 3W8QA 5BVDA 2XEYA 3TN8A 5GIOE 4P7EA 4P90A 2BKKA 2P33A 5I4NA 2W17A 2YEXA 2W5BA 4JNWA 3WILA 5C4KA 1Y57A 2H9VA 2VWYA 4E73A 2EVAA 3HAVA 4BCFA 1OI9A 4MAOA 4I6LA 3ORKA 3I60A 4WOVA 5HVJA 3EFWA 1U46A 4QMYA 2C5YA 3OD6X 4F1TA 3K2LA 4IW0A 3BLRA 1J91A 2ZM4A 3MYGA 5AP7A 4F6SA 3CE3A 3HV5A 5KHXA 2UZTA 1W98A 4LMNA 2OJ9A 4PTCA 5AP5A 4AFEA 4BDGA 1CKPA 3F3TA 4IM3A 4P2KA 3TJDA 3SXFA 1O6YA 4KKHA 2I0VA 4EC9A 4MXAA 4RJ7A 4PMMA 5KHWA 3R9DA 3B8QA 4XP0A 1ZOHA 5DLSA 3DBQA 4I5PA 4IC7A 5M56A 4UALA 5LVLA 2BROA 4W9XA 3LMGA 2PYWA 3ANQA 4PL5A 3EB0A 4DCEA 4JMQA 1WBWA 2HY81 3VO3A 4A9UA 3FV8A 3SHEA 3NW7A 3PA5A 3WZKA 3RTPA 2R5TA 4TL0A 5FBOA 3PZEA 3EN4A 2LAVA 4FSYA 4ZTSA 4CMTA 2JKQA 3VBVA 3QRJA 4ZLYA 4FIFA 4O21A 4DINA 4QO9A 3N4VA 1ZYJA 3SD0A 4D28A 3DBDA 4LOQA 4KD1A 3MY0A 3TNPC 5IPJA 4MF1A 1M2QA 4PMPA 4KIKB 5CSHA 4F9BA 4X2FA 1MP8A 1JKSA 2ZVAA 4LDTA 5FEQA 4R5SA 3HUBA 2JDVA 2JC6A 2JBPA 2VWZA 4K9YA 4OTPA 4R3PA 4MVFA 3EN5A 2YLEA 4E5BA 1P14A 2ZV9A 3ZOSA 3QBNA 3KF7A 4FZ6A 4ZTRA 3ZO1A 4HVGA 1XH9A 3PG3A 1JBPE 3D94A 3JS2A 3FZPA 5IISA 2OI4X 5HCZA 5JN2A 4GK2A 1LP4A 3RGFA 5LVNA 3FL4A 2OH4A 3KXMA 4YUQA 4R5YA 4F63A 5AR4A 3BKBA 4EQMA 3COKA 4RVTA 3UIUA 1FMKA 2FUMA 2QOIA 2XKCA 4FKGA 3THBA 3WIGA 3QZIA 2OZOA 3AMAA 3UVPA 1E1XA 3TI1A 2R0IA 2R3NA 3NCZA 4I5MA 4JG8A 4IAKA 5FP6A 4AZVA 3Q9XA 4H39A 3VJOA 5K0KA 1KUTA 4MXZA 4U80A 4M3QA 5KO1A 4ACCA 4C57A 1M14A 3C4CA 4GCJA 5ANDA 3EOCA 2ITPA 2B55A 3R0TA 5AUZA 5HO7A 4DDGA 5DFPA 1J7IA 5HX8A 2VTNA 5J9ZA 2GQRA 3KN5A 4LRMA 4TWNA 5CZIA 3VUGA 3E93A 4E6QA 3VS7A 4AFJA 5HE0A 3ZO4A 3Q5IA 5H9BA 2YM3A 1MUOA 1W0XC 3PJCA 5J5TA 5KMJA 4TYEA 4D4YA 3NR9A 4O22A 2NO3A 2RG5A 1PXPA 4J8MA 3CSVA 2IZUA 4U97A 2B1PA 4MD7E 1U54B 3SQQA 5E8YA 3MW1A 4NJDA 4Z55A 3A8XA 5I9ZA 4ANMA 3FMEA 2OLCA 3RALA 4TY1A 4DT9A 1NXKA 4CFNA 1OGUA 4YJTA 4N6ZA 2BFXA 3VBTA 4ZJJA 5BQ0A 2DUVA 3D0EA 3FMJA 3HLLA 3CY3A 4DGLC 1Y6BA 3RHKA 2JLDA 4FYOA 4XV3A 1ZZ2A 2O2UA 3UP7A 1SZMA 4JIAA 4KRDA 4S31A 4IM2A 4M66A 4X3FA 5AUXA 4AT5A 4ZS4A 3RVGA 3GU8A 5EFQA 1BMKA 3BIZA 3FE3A 2VGOA 2C5VA 3PWDA 4HZSA 5AUTA 4DFBA 2G1TA 1ZZLA 1W82A 3FSKA 4O0YA 1K3AA 4HVIA 3LM0A 2ERKA 1U5QA 5TR6A 1UA2A 3A7IA 3BI6A 3O0GA 5KKRC 1QL6A 3QX2A 1ZWSA 3GC8A 4Y72A 2PUNA 3UIBA 2XJ1A 3PXFA 2F2UA 5IA5A 5DGZA 4K8AA 5DH3A 3EWHA 3JXWA 5CEPA 1Q8ZA 4WRSA 2V7AA 5CTPA 5HOAA 4JXFA 5CF5A 2W06A 5M08A 2W4JA 1R1WA 4HCTA 4D1XA 2YM8A 3E5AA 4WRGA 4XP3A 4ASEA 3KIOC 1FGKA 4A9SA 1M7QA 1Q8TA 3CIKA 3P1AA 3QQJA 4WNMA 1AQ1A 3R8VA 4DFZE 3RCJA 1XMMA 2YN8A 4BCIA 4PUZA 4A4XA 3SRVA 3IECA 3QRKA 3R01A 4FEVA 4WSYA 2YIWA 4AT3A 3VHEA 3FHIA 4IVCA 2X7OA 4G3CA 3FYKX 1KOBA 2VV9A 5CASA 1PHKA 3QF9A 5K5XA 3ALNA 4QYGA 4XH6A 2JIVA 2W7XA 3Q4ZA 1ZMVA 2GTNA 5CNNA 5JH6A 4NL0A 3IKAA 2W1DA 4QNYA 3TNWA 4C3RA 4D2SA 1K9AA 2QOKA 4NIFA 5LOHA 2XVDA 4RZVA 2C6KA 3F6XA 4FSTA 4JAJA 5HO6A 1YXTA 1LEZA 4USEA 5HIBA 4PL4A 5ETAA 4X3FB 2ITNA 5EM7A 1KE5A 4L53A 1JKKA 5J1VA 5KMLA 2OXXA 4NW6A 2C6LA 3ZONA 4AX8A 3FMDA 5DT0A 1M52A 1M17A 2VTLA 5ETCA 4Y5QA 5A54A 1IAJA 2AEGA 5HG9A 4IADA 2ZM3A 3D7TA 3C9WA 4MXCA 3D15A 2X8EA 2R7BA 3NPCA 5ETFA 4LYNA 4QPAA 4RJ4A 4OBPA 3R7OA 3T3UA 2YWVA 2Z7QA 5M09A 2WTKC 3ETAA 4W8EA 4TZRA 4L6QA 3GCUA 3ZHPC 3VF8A 1H00A 4JQEA 2VD5A 5LVOA 2B9JA 3N51A 4C38A 5E8WA 4CVAA 3VW8A 1H27A 3ITZA 5C4LA 3WZEA 2ESMA 5KMKA 2W5HA 2XA4A 4I6FA 5HO8A 5CAUA 3F9NA 4F09A 4RX9A 4CFWA 1Q8YA 3A61A 2YA9A 4UYAA 4FEWA 3LM5A 4GU6A 3G90X 4IVDA 3SRVB 2ETRA 1H1QA 1GAGA 4F1OA 3KVWA 5HD4A 3LIJA 4LGHA 1JLUE 3FZSA 4UMQA 2QI8A 2WMAA 5EOBA 5FM2A 4IZAA 5HI2A 4JDKA 2WTKB 1Q62A 3C4ZA 2RFEA 4J95A 1NT2A 3VIDA 4F1MA 3G9NA 1A48A 4DA5A 2W96B 4FIHA 4ITIA 1TZDA 4EOJA 5GIPE 3NYVA 5C8NA 3DAEA 5GZ9A 5DMZA 4R77A 2GTMA 2BVAA 2FGIA 2GS6A 3GCVA 4LGGA 5BVKA 2F7XE 4NIFB 5AAFA 3JVRA 2ZV7A 3AQVA 4IAZA 2B54A 4FT0A 1B38A 4EONA 3HEGA 4E4MA 3POOA 2CKQA 2CGXA 3K5VA 2C47A 4PY1A 2HXQA 3QYZA 5FBNC 1DI8A 3RK5A 4FV1A 2CNQA 3ORZA 4CZTA 3G0EA 2QQ7A 3KXHA 4FTJA 5B7VA 3GBZA 1OB3A 3DY7A 2QODA 3H9FA 3PSDA 2UW8A 3AKLA 3U8WA 2JDTA 5AR3A 4FA2A 2BILB 3BHUA 5CY3A 2ZJWA 4DBXA 3UDBA 3QWJA 2J50A 5LARA 2XM9A 4QRCA 4ZTLA 3QQKA 3M2WA 3VS6A 4AF3A 3TTIA 3HP5A 4M12A 4XNEA 5CAQA 4QPSA 4AQKA 3RAKA 3OW4A 4DG2E 2BPMA 5D7VA 4RLKA 4F70A 2QOQA 2RIOA 3I5NA 4FX3A 4EH4A 4L46A 4R78A 2QU5A 3KMMA 5IQHA 2CHLA 4WIHA 4EZ5A 2VTAA 2CLQA 4ZZNA 1MRYA 3ZRLA 4UV0A 2JD5A 4NCTC 2WQNA 2J0LA 4DBNA 4MWIA 3F3VA 1YRPA 5D12A 1FMOE 1S9JA 4TNDA 5KBRA 3UDZA 2WMRA 3EQPA 4FIIA 3SGCA 3LCDA 5HBHA 2YDIA 3ZYAA