3TN8A

Cdk9/cyclin t in complex with can508
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
318
structure length
304
Chain Sequence
VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 9
publication title The CDK9 C-helix Exhibits Conformational Plasticity That May Explain the Selectivity of CAN508.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 89
structure length 304
sequence length 318
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tn8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tn8A01
1K3AA 4G3CA 2I1MA 1RJBA 4AGUA 3PA4A 3BYOA 3LZBA 4MXXA 3FMDA 4DTKA 2C30A 5ANKA 4BYIA 4EZ7A 3GI3A 2IN6A 3S00A 4CKIA 4FV6A 3SQQA 3FKOA 4FTNA 4LRKA 4WRGA 4BY9E 3TN8A 4E1ZA 2R3QA 3GC8A 3W8LA 3EB0A 4DLIA 1ZMVA 3OTVA 5CVFA 3FLNC 3R9HA 5LVPA 3DAEA 4FYOA 5AX3A 4O86A 1H1RA 1NVRA 4ZMFA 1JNKA 3G5DA 4JIAA 4GG7A 4QMZA 4R5YA 5AV4A 3JR1A 3FL4A 1W0XC 3OEZA 2X8IA 4BWKA 3KU2A 5JH6A 4D2WA 3DB6A 3MTFA 4IACA 4BI1A 4C4JA 1J1CA 3LFQA 2VX3A 1OKYA 4L45A 4CFFA 3Q32A 5AR8A 4BDHA 4EYMA 1IA8A 3DXNA 4GU9A 3PJCA 5LWMA 2VWBA 3EKNA 2XCKA 4QMVA 4ZP5A 3RZFA 4ZSAA 1JKSA 3E63A 2PE0A 2H6DA 1K9AA 4M0YA 2HXQA 3FKNA 5FXSA 4IM0A 4L68A 3FLWA 4X2KA 3EYGA 3HMNA 4K1BA 4C3RA 1KOAA 3WZEA 3V5TA 2VTIA 5HVYA 1SNUA 2UZVA 4BCHA 3C0HA 1YXTA 2PVJA 3FEGA 2B9FA 4UMTA 2OI4X 5HNBA 3AC1A 2YM3A 3R1YA 4F6SA 2PPQA 2BUJA 2JFMA 3SDJA 5AR3A 3FMLA 4KKHA 4QMWA 2ZV2A 3PYYA 3GQLA 5HORA 4JR3A 3O96A 4X6QC 4K6ZA 3R00A 4AGWA 3F61A 4BKJA 4C59A 1OL5A 5DHJA 4TYEA 1JKTA 4YJOA 4C33A 3FLQA 4DH5A 4RX9A 1QPCA 4FICA 2YN8A 4DGOA 4BN1A 1KE7A 1V0PA 2OICA 3FMNA 3QUEA 4AF3A 2BDFA 5BUIA 5E8ZA 3VF9A 2CSNA 5J9ZA 5IQFA 4KS7A 3GCUA 3OY1A 2HOGA 4NJ3A 3VUIA 3PSCA 2QKWB 5KBRA 2IW9A 4FKJA 3QD2B 3NIZA 4L3PA 4RT7A 5DRDA 1DAYA 2WMTA 3FLZA 2XA4A 5TOZA 5C9CA 4F1OA 3D0EA 3QZFA 5AFVA 1WFCA 3LFEA 3IECA 4WOVA 1FMOE 3NRMA 4GKIA 5AP3A 4JBPA 4ZY6A 3HMPA 3OWPA 3RKBA 3HV6A 4S31A 2YM7A 4CQGA 4YSJA 3G6HA 5EW3A 4R7IA 3QTWA 1SVGA 4KIQA 4BHNA 4EOOA 4RQVA 3DKOA 2AC3A 5TO8A 3E7OA 5J7HA 3O0GA 2UW0A 5M4UA 3L1SA 4FTCA 4TW9A 5HU3A 4FC0A 2JIIA 2PUPA 2SRCA 1PMUA 2UW7A 3OCGA 2PULA 5KNJA 5E92A 1ZWSA 1U4DA 2UZBA 4HCTA 4WUNA 5DYJA 4EH8A 2I0HA 2QODA 2RSVA 2Z7SA 5K0KA 4BDEA 3ETAA 3ORZA 3EQFA 4UEUA 4CMOA 5EQYA 4EJ7A 2YCQA 4I4FA 3BRBA 1LPUA 5HQ0A 2V7OA 1CKIA 1WVXA 3POOA 4JQEA 4AZFA 5JRQA 3COHA 3ZTXA 4EKLA 3IW7A 4FKTA 3ZONA 3C1XA 1KWPA 4FV2A 2C6EA 3GUBA 4J53A 4X2GA 4BGQA 3KC3A 4C58A 3N4VA 4QYFA 4QPSA 4ZEGA 4OTDA 2WQMA 3TJCA 2PHKA 2F7XE 1URWA 5F1ZA 3TEIA 3VS5A 3ORLA 2QOFA 4D9TA 2X2KA 4DEDA 5HTBA 3AQVA 3MJ1A 4OW8A 5CT0A 1SZMA 2HENA 1Q97A 2OXXA 2XNOA 3N51A 4HGEA 4IAYA 4IXPA 4IWQA 4NIFB 4QYHA 4RFYA 4X3JA 4RWIA 4ALUA 1PXOA 2AC5A 4GS6A 3CTJA 1VZOA 4A9UA 2OLCA 1P4FA 3NEWA 4UMQA 4KINA 5ACBC 3MY0A 2YERA 3UVPA 4FYNA 3UYTA 3QFVA 2R5TA 5EDQA 4NU1A 4QRCA 4RRVA 3OF0A 3DLSA 4AT5A 3QC9A 2PL0A 3FC1X 3DY7A 3Q96A 1V0BA 4BKZA 3R01A 3AGMA 3VJNA 4BIBA 4JDKA 3IOKA 4PP7A 2CNVA 4CZTA 4PTCA 4XOZA 4RJ3A 2Z60A 4R8QA 1REKA 3C51A 3U55A 2YZLA 2W5BA 4OGRA 4ACCA 2X7GA 5IF1A 4JI9A 4G1WA 2PZRA 1FVRA 1GZOA 3Q4TA 4XNEA 2XIRA 4D28A 4PF4A 3V8SA 4F63A 2B52A 5AA9A 5L6PA 5GHVA 1BMKA 5G6VA 4OAUC 4O82A 4CFUA 3AC3A 3K3IA 1OUKA 1YWVA 4FKRA 4RC2A 4RVLA 5EW8A 4O7SA 1F3MC 2PMOX 3H9RA 4RC4A 2YDJA 4O7TA 3NNXA 1DAWA 3BHUA 3MH0A 4F1MA 2PUUA 4K18A 2WAJA 4RIOA 3LQ8A 4D9UA 4EHGA 5L8KA 2PZPA 1PMNA 2XKCA 2JDSA 3CY3A 3O8UA 2BAJA 4FNWA 3BYSA 4R3PA 3G33A 4O7LA 4U80A 3E5AA 5DRBA 3GGFA 2W4JA 5F9EA 5L2IA 4E93A 2NRUA 2OH0E 2UW4A 1U5RA 3Q04A 1UKHA 1XBBA 3DFCB 3FLYA 3ROYA 3D4QA 5FDPA 3JY0A 3AG9A 3H0ZA 4MBIA 3IS5A 1L8TA 4Y8DA 2Y9QA 3BU5A 3KCFA 5C03A 4M68A 3F7ZA 2OIBA 4K77A 2FUMA 5D9HA 3VBWA 4EL9A 4FTUA 5T3QA 5EOLA 4PPAA 4MHAA 3VUMA 4FSTA 4DH8A 5LWNA 1MQ4A 2BFYA 5FTGA 2P3GX 3WILA 1ZXEA 4FTKA 2GMXA 5HVJA 3JS2A 2XK7A 1PW2A 2O65A 3NYNA 5J79A 4HNIA 5L8LA 2VTMA 2XCHA 2OJGA 4O0UA 2XNPA 4LQMA 1PYXA 5CEPA 2R3KA 3R71A 2WOTA 2YJSA 3RK5A 5L4QA 4FEXA 4FZ6A 2IW6A 4EC8A 5HVKA 3BYVA 4G17A 1BL6A 4A07A 4MD8E 4XUFA 3THBA 3ZSHA 4I94A 3OT8A 4AN9A 5L2TA 1YI6A 4HYSA 5AP1A 2XNBA 3BKBA 4FKVA 4Z16A 5JSMA 5DFPA 3FZOA 3MVHA 1P5EA 5A3XA 2XVDA 1J1BA 2GNJA 3TNQB 1YDSE 3QCXA 5CASA 1JKKA 5K5NA 1H26A 3QRIA 2R64A 2WQEA 4FNYA 4I5PA 3LFNA 3HAVA 2R3NA 3TJDA 3QKMA 1HCKA 2WU6A 4GVAA 3DCVA 3SKCA 2J51A 3Q5IA 4TN6A 1AD5A 4F0FA 2XYNA 1Q8TA 3FXZA 5CVGA 2IZTA 4YJSA 4CVAA 2GQSA 4L44A 4IVAA 5CTPA 4B6LA 4ACHA 4RLLA 2HZNA 3QCQA 2HY81 2QO2A 2Y0AA 2ETKA 2OW3A 3MS9A 3MWUA 3Q2MA 4FV7A 1JBPE 5J9YA 4U42A 3O2MA 3FPQA 4QP4A 3R8VA 2GFCA 4BTKA 4JR7A 2PE1A 4BWXA 3EN9A 2XJ0A 4G9CA 3K2LA 4MH7A 5AMNA 2GTMA 4JJRA 4YBJA 5EYDA 3TNPC 3CBLA 4P5ZA 3VVHA 5L2QA 3NVMB 2YDIA 4AU8A 4KBCA 4NEUA 5GZ9A 4ZS0A 4OUCA 3AMBA 3OCTA 4ZSLA 3HA6A 3TL8A 3O51A 4QT1A 4RPVA 5CF8A 5HX8A 3BEAA 3RPVA 2JKKA 2LGCA 4FL1A 4D0XA 4IADA 3B8QA 3C4XA 3NSZA 2QO9A 3OVVA 4GKHA 4G3FA 1FGIA 4GL9A 4G31A 1J91A 4Q5EA 3NS9A 3PXRA 3UNJA 1ERKA 4C02A 4AQCA 3C5UA 4EK8A 2QC6A 3F7WA 3RCDA 4DA5A 1WVWA 4GIIA 2V22A 4RIXB 4MNEB 4O0VA 3UC4A 3LMHA 5AX9A 2BILB 4C57A 4FV9A 4IM2A 3W2QA 2QG7A 2W4OA 1H0WA 4FEWA 3VS0A 4C8BA 4FGRA 2J2IB 4NW6A 4BCFA 3GFWA 3S1HA 1OB3A 5EQEA 4NFMA 3OFMA 3F9NA 3OEFX 4KB8A 5AEPA 3LLAA 4MAOA 2X6DA 2OKRA 4XS2A 3TTIA 3EN5A 3WBLA 5BYLA 4QP3A 4IB5A 5FUTA 4J8MA 3R7GA 3F6XA 4YTCA 4UXLA 3U87A 5C4KA 4AZSA 3W2PA 3AT3A 3QBNA 4M3QA 3W55A 4AACA 2GHGA 3KL8A 4UWBA 4E4NA 4RJ4A 3JVRA 4KKEA 2PY3A 1O9UA 4MWIA 3R1QA 1MRUA 2XK9A 5AAGA 1VR2A 1Y6AA 4L46A 3LXKA 5CENA 3RM6A 2IZSA 4PMMA 4QTEA 1R1WA 5AIRA 5IA1A 3R1SA 3RHXA 1OBGA 4MQ2A 5IA4A 3G2FA 1SNXA 4UZDA 3QTZA 2PVRA 5HG7A 3R2BA 4UWYA 3D5UA 4JG7A 5AM6A 4ASEA 2R0IA 4I6QA 5CSHA 4E3CA 3G51A 4PMSA 2BFXA 5IQEA 2WEVA 2JDRA 3R30A 5ACKA 3S2PA 3QA8A 4UALA 3FMEA 4XG2A 1CSNA 3KFAA 3Q2JA 5HTIA 2OO8X 1KSWA 4KAOA 2ONLA 5IH4A 5KCVA 4XV9A 4QTDA 3I5NA 3NPCA 3GQIA 2R7BA 4RBLA 4I5HA 3UIMA 2Y4IC 2C0IA 3F2AA 4YZ9A 4FZ7A 2YLFA 4YC3A 4IHPA 5ANGA 4BDBA 5BUEA 1Q61A 3D14A 4L9IA 3V5PA 3NUPA 5CY3A 5D12A 1B39A 3R04A 3BWFA 2EB2A 4B8MA 1XWSA 3I1AA 3E8CA 3O7LD 3OUKA 4EONA 3PA3A 4YJVA 4C34A 4D4RA 3ZO4A 2W1CA 2Y7JA 1PF8A 3RTPA 3L9MA 5TF9A 4E6CA 5LMKC 2W5AA 2C69A 3HX4A 1YOJA 4EHEA 2BTSA 5FM3A 3WYYA 3RBWA 2BKKA 2GSFA 3P9JA 1GAGA 2C6DA 4LOOA 5HNGA 2A27A 3RAWA 3VWAA 4MK0A 2R3HA 1H24A 4PMTA 3ELJA 2WMVA 3QRTA 1A9UA 5J7BA 3IONA 4OAVB 3V5JA 1DM2A 4NSTA 2OZOA 3HV4A 3L8PA 4PV0A 5FEQA 5DOSA 3SLSA 1H0VA 5C27A 3ZZWA 5CU6A 5CSVA 4AS0A 1YOMA 3R63A 4AT3A 4DFXE 4FT0A 4NFNA 3Q9YA 2W99B 4BZNA 4RJ7A 1H00A 3VS6A 3BI6A 4LV5A 3F3ZA 1JSTA 2YCSA 4BDGA 4TL0A 5JQ8A 2R3GA 3MW1A 3Q4UA 3ODZX 4AGDA 4V05A 4BDKA 2B4SB 1GIHA 3TWJA 1RQQA 4O27B 1FPUA 3KN5A 5JT2A 3FPMA 3BLRA 2X39A 1P4OA 2HELA 3FZ1A 3COKA 4AE9A 3WIGA 4FT9A 1BI7A 2EU9A 3QC4A 5M07A 3IO7A 4YSMA 4CZYB 1B38A 1ZLTA 1Y91A 1M14A 3QX4A 3RJCA 4RVMA 4BDFA 3IDPA 1GY3A 3ZUUA 5BYZA 2RF9A 3RWPA 1WCCA 1OGUA 3EMGA 1MP8A 3ENMA 4AFJA 4P4CA 5FG8A 2UZUE 4QPMA 3TT0A 3DTWA 1SM2A 2BHHA 2REIA 3DKGA 3UPZA 1DI8A 2X2MA 4FNXA 3SAYA 5C1QB 4IX5A 2IJMA 1WMKA 2CN5A 4FSYA 4I4EA 4TY1A 5BVDA 3C4WA 2B7AA 1K2PA 4PRJA 1VJYA 3E92A 3ZMMA 2OIDA 3E62A 4JG6A 4EH7A 1PXLA 5IQAA 3LW0A 5FBNC 1XH8A 3QQJA 4IVBA 4WA9A 4CZUA 4EOPA 5CZIA 2DQ7X 2O63A 4FKOA 5E8XA 3H30A 2BRHA 4W4VA 1QCFA 5HX6A 5CAVA 3MGYA 3FLSA 2VWWA 3EH9A 2QNJA 4FVPA 1CMKE 3LFCA 2GFSA 3QX2A 4ZIMA 4EOLA 2Y4PA 2X4ZA 4D2VA 1CKJA 2YACA 4BCQA 3OT3A 3BX5A 4LV8A 4F0IA 4GW8A 2JGZA 3DBFA 5FRIA 2B9IA 3G9NA 3IK3A 3MJ2A 4R1VA 3C5IA 3DKFA 4Z7GA 4IQ6A 2RFDA 2P0CA 4DG2E 4XH6A 1BI8A 3BU6A 3IOPA 3P5KA 4YPDA 4EYJA 3OD6X 4I22A 3GENA 4UY9A 5CSPA 4NKAA 2PE2A 2UZEA 1NW1A 1IR3A 2QVSE 4ANOA 3WZUA 4EBVA 4NIFA 2PVNA 3WE4A 4BC6A 2UZWE 2GPHA 2VO0A 2WPAA 1BL7A 1R3CA 2PU8A 4L53A 4NM0A 4KIPA 4XLVA 3HUBA 4IZ5A 3UG1A 4PPCA 1YHWA 4FZAB 4KSQA 5JN2A 3I0QA 5HBEA 4AA5A 2O5KA 1OM1A 2R3JA 4DGNA 3GBZA 4E4LA 2F49A 4YO6A 4EC9A 4CFMA 3DDQA 4FIHA 2VTLA 4Y46A 4Z9LA 3ZXTA 4H1MA 4J1RA 4JNWA 4EK5A 2YLEA 3UQFA 3F3TA 4DE4A 1H25A 4XLIA 3FJQE 4YNOA 2RFNA 3QTIA 4GSBA 1OITA 3UO5A 2GNLA 3CTHA 4OTIA 5FBOA 2XKDA 3QWKA 3CTQA 3ZH8A 4RA5A 3RPYA 2X6EA 2X8EA 3RNYA 4CFNA 3DNDA 3NAYA 4FOCA 3IDBA 4O0RA 5J9LA 4FK6A 2WGJA 4FKIA 3M2WA 3ZBXA 1S9IA 5LMAA 3NR9A 1EH4A 4F6WA 2R9SA 4EKKA 2IVTA 3MA6A 2WOUA 4DT8A 4AP7A 3R28A 4I0TA 3KKVA 2BMCA 1YXVA 2C0TA 2QR8A 5KHWA 4PWNA 4O83A 3ORXA 3KRWA 4YJUA 3Q52A 1UU3A 1ZZ2A 3VUTA 1MRYA 1NVQA 5IH6A 4RX5A 4PPBA 4LL5A 1G8AA 5KHXA 4M69B 2QURA 3C13A 5AP4A 3LQ5A 3L8SA 3R1NA 1PMVA 3RGFA 2XB7A 4APPA 4ZLZA 4UXQA 3AOXA 3A61A 4IBMA 4ZTLA 5F94A 3W10A 3C4CA 4IWPA 3HMMA 4BCMA 3LMIA 3ORNA 4LM5A 4FSMA 2BALA 4P5QA 5HLPA 3EQIA 2YM4A 5I9ZA 3DK7A 4FV0A 1Q3WA 2A2AA 5LCKA 3RPOA 5HIEA 3CY2A 4GT4A 5IUGA 3L9PA 3H9FA 2YITA 3IG7A 1YI3A 4YNEA 5GJDA 3F5UA 2ETRA 4N70A 3LFSA 4DG0E 2VTNA 5EHYA 5KBQA 4D5KA 2V55A 2ZOQA 2PVLA 2UVYA 3DAJA 3DJ5A 3W2OA 4C2VA 2JAVA 5D7AA 1ZYDA 1Q3DA 4K9YA 4NCTA 4PNIA 3EQPA 4L3JA 4BFMA 2XNNA 1BYGA 1BKXA 1JSVA 2HWPA 3HRBA 3R21A 2J7TA 4E7WA 3OBGA 4ORKA 3QLGA 3MA3A 4ERKA 2VTAA 4CGAA 4C38A 4CYIA 4YLJA 1LR4A 1X8BA 3P78A 4AZEA 2UW3A 4L67A 4R78A 1M7QA 4JAIA 3KK8A 4XG9A 5FP5A 4C0TA 4DC2A 3E7VA 2NPQA 4BCGA 3PRIA 3RVGA 3QTUA 5E8TA 5KKRB 4I6FA 3QTXA 5M44A 5HO7A 4EH5A 5A9UA 2GNFA 4TNBA 1W84A 3RNIA 4C3PA 4DBNA 1WBTA 3H3CA 1XHAA 3VNTA 4RSSA 4XEYA 3ULZA 1PY5A 3D7ZA 5E8YA 4MVFA 4I5MA 2VNYA 2W1FA 2WFYA 4FKWA 3MPAA 1DS5A 3F82A 2I0VA 3NNUA 1UNHA 2VTQA 4AOIA 3CKWA 3O7LB 3A7FA 2OU7A 1AGWA 2OZAA 3UGCA 3F2RA 1YXUA 2X7OA 5LARA 4OTGA 4D2SA 4BDCA 2XK4A 5E8UA 2R3PA 4Y95A 3R7YA 3FI3A 1PXIA 2XK8A 3E3PA 2E9OA 3QUPA 4RZWA 2E9PA 3NUUA 2LAVA 3C0IA 4NWMA 4RX7A 2E9UA 5HG8A 3V51A 2WTCA 4O7NA 3WZJA 4FT3A 4A06A 3FAAA 4HVSA 5DGZA 1KUTA 2A1AB 3V6RA 2FSMX 5DT3A 2BIYA 3UZRA 4DFUA 1OIQA 3DU8A 4ZTRA 4BF2A 4Z7HA 4Z3VA 4QD6A 4OBQA 2OGVA 4PDSA 3EFJA 4X6RA 2W1IA 4D58A 4DEGA 4F9AA 3HVCA 4YO4A 1PRYA 3OS3A 4O2ZA 2XMYA 3A7GA 3PVGA 4O6EA 4QTCA 2IZRA 2JIVA 3TACA 3T8OA 5FM2A 4C36A 1ZAOA 4B4LA 2WTKB 2OBJA 3RAKA 4EH9A 3HRFA 1H28A 2PSQA 4CG9A 3ZLYA 3DS6A 4EH6A 4IDVA 4KIKB 3KK9A 4RIXA 3EQBA 4MNEA 3U4UA 2YIYA 3LFAA 1TVOA 4MYGA 3ZYAA 4IZ7A 4LYNA 5AP0A 5J1WA 4EK4A 2YIXA 4V04A 4YBKA 4EBWA 3A62A 3R8MA 2VWVA 1T46A 3I79A 4FV8A 5IEYA 1WBOA 5CF5A 3MY5A 1PJKA 2HK5A 4L42A 2W96B 3DBDA 4QTBA 3LCTA 2J6MA 3IW8A 3EYHA 3RINA 3QLFA 3SX9A 4IC7A 5A54A 4O1PA 5AP6A 3Q60A 4I21A 3UYSA 3ZEPA 4E8AA 3KXNA 3UMWA 4BDIA 4CD0A 2YEXA 1J7LA 3ZDUA 2R0UA 5AJQA 2WTJA 4ZS4A 3LM0A 1O6KA 5KE0A 3VS1A 4OBPA 2RKUA 5AM7A 4CKJA 3UNKA 3ET7A 3QALE 3DPKA 2R4BA 3PLSA 4QP2A 2WELA 4LMUA 3HECA 4YZCA 3R7IA 4BI0A 3O8PA 5T68A 3E8EA 4NL0A 4YHFA 4FIFA 4GV1A 5IPJA 5DEWA 4J8NA 3RZBA 3FZPA 4ZSEA 3V3VA 1Y8YA 2H9VA 3FYKX 3SV0A 2WTWA 1Q99A 3NW5A 4OR5A 3SC1A 1OL6A 4QQJA 4C4EA 3TKIA 4YZBA 1XJDA 3UPXA 4E4XA 5JKGA 3EIDA 4BCJA 3EFWA 1P14A 2V7AA 5KO1A 1BUHA 5FD2A 2PUNA 2XK3A 3JXWA 5CNOA 1VYWA 3QWJA 3QYWA 3WYXA 4ZLYA 4UZHA 3U8WA 2PVYA 2YABA 2EXMA 1GIJA 1M2RA 3R9NA 3KQ7A 4O0SA 3ZC6A 4F08A 3ZU7A 4IX4A 4GK3A 4N57A 4F9WA 2QOBA 3WF6A 4YU2A 3TV4A 3CGFA 4PL5A 4PNKA 3NW6A 2GS6A 2HXLA 5M55A 4EWHA 2YWVA 3JPVA 4FTJA 5BMMA 1WBNA 5M06A 4U44A 1H4LA 4D1SA 5IEVA 4QOXA 4DEIA 2YZAA 2P33A 3OOGA 4BRXA 2WU7A 4EQUA 3HAMA 3U9CA 4AFEA 3HUCA 3QGYA 1CKPA 3V5WA 3ZO3A 4ZZMA 5JFWA 4MX9A 4DH3A 2RL5A 2W0JA 5E4HA 1SMHA 2W06A 2UZNA 2XRUA 4G5JA 5CF4A 5K5XA 1Q5KA 3O50A 3LQ3A 3NGAA 3TV7A 3FL5A 4QPAA 3OOMA 3D5XA 4O7WA 4ITHA 4LI5A 2X9FA 2QO7A 4NTSA 3O71A 4GFOA 4XG3A 4F1TA 1QPJA 3A2CA 4O7RA 1XBAA 4FKPA 4WKQA 3AD5A 4QO9A 3F3UA 3QYZA 1OUYA 3LKMA 2ZV7A 5DNRA 3S4QA 4MF0A 2DWBA 1TQPA 4UV0A 3UO6A 5BYYA 2HZ4A 3AMAA 4IZYA 4GCJA 2WTDA 1A48A 1FBNA 1Q24A 2X4FA 3PA5A 5LCJA 2WKMA 5CEQA 4E20A 4A4OA 2XM8A 3UOJA 5IA2A 2C68A 3FY2A 1YKRA 3K5VA 3ZUTA 4DTAA 4U45A 4RWLA 5ANDA 4AOJA 1R39A 5H8GA 4LGDA 3EZVA 4USDA 2ZM1A 4J7BA 4QP1A 3ZSGA 2XNEA 3QHWA 3NYVA 1OL2A 4RIYB 2IW8A 3R7UA 5HO8A 1YHSA 4I3ZA 2FGIA 2XKEA 1ND4A 4YR8A 3W2SA 3R22A 4DGLC 5EI6A 1H08A 2ZB0A 2OSCA 4GK4A 1F5QA 5CU0A 4M12A 2F7EE 3KRRA 3UOKA 2H8HA 3CP9A 2ACXA 4XRLA 4ZSJA 4JQ7A 3VF8A 1SYKA 1MRVA 5CU4A 1BLXA 3OWLA 2VRXA 5I9UA 3UOHA 4TZRA 5DT0A 4DH1A 4FX3A 3AD6A 3IQ7A 4TPTA 4XRJA 4F70A 4KNBA 5DLSA 3EQHA 5ETIA 3LVPA 4AAAA 5L2SA 3FY0A 4I20A 2WO6A 3OCBA 3QKKA 4F09A 2V62A 2VX0A 4RGJA 4H3BA 5AUXA 4YUQA 3M42A 2VGPA 3EJ1A 5FXRA 3SA0A 5JFXA 2HCKA 5TE0A 4O84A 2R3IA 2Q0BA 4L6QA 5H8EA 3GCQA 2CLQA 4ASZA 4C61A 4W9WA 1GNGA 3BLHA 3MFTA 1XO2B 1SVHA 3Q9ZA 4W9XA 4BTFA 4DFYA 5E8WA 5H8BA 3ULIA 3FWQA 2WZJA 3A99A 2OF2A 2WTIA 2VWYA 3GB2A 4ZTHA 4TWOA 4UYAA 4M8TA 5C8MA 5EQPA 3MV5A 5FEEA 5JEBA 3QUDA 4F6UA 5CXZA 5GZAA 3EL8A 2XS0A 3QRKA 4AA4A 4DN5A 2VWUA 4L8MA 2AYPA 2GQGA 3QRJA 4JDJA 4JVGA 3ZFYA 4BIDA 3E64A 3NUNA 5IMXA 1BX6A 5DIAA 5A4LA 2FYSA 4CFWA 2YCRA 1OPKA 3OY3A 5EHLA 3VQUA 2J50A 4FV3A 2XEYA 5AAFA 3HV5A 4C35A 2JDTA 3OMVA 1H1SA 2B53A 3ZOSA 3QKLA 3QXPA 4FSWA 4XX9A 4YMJA 1ZY5A 2F2CB 2WTVA 5A14A 3EHAA 3PPJA 4TXCA 4DHFA 4FZFB 5DI1A 1VEBA 3LOKA 3NIEA 4RIWB 4NH1A 4CTCA 1FQ1B 2CJMA 2BTRA 4FTLA 3AC8A 5EKNA 4P2KA 4FKQA 1ZZLA 3QTSA 5AR5A 5C01A 4D4SA 2JAMA 3R0TA 2VAGA 3HP2A 5EYMA 2WMWA 4IIRA 5BVKA 5AA8A 5ETAA 4AN2A 4B8LA 3BIZA 3HMIA 3ZC5A 3QL8A 4LGHA 4M69A 4WHZA 2WQBA 4IWDA 3I7CA 4FKSA 5HOAA 2IG7A 3PE2A 3R9RA 4CT2A 4XG8A 1AQ1A 3V6SA 1PXNA 2EB3A 3CCNA 4HZRA 3VS7A 2OZAB 4ANNA 5HBJA 4C4HA 2WHBA 3GC7A 2WQOA 5IQHA 5CI6A 3PDTA 4MCVA 4EEVA 2WIHA 3MESA 4IAZA 3SOCA 3DQWA 4DFBA 3DBQA 3NNWA 3QA0A 2I6LA 5H2UA 3T3VA 3MN3A 1TKIA 3T9IA 4WUAA 4BTMA 3E88A 3GU8A 5HE3A 5LVMA 2JDVA 2QOQA 1OVEA 5EYKA 4E5WA 3PWDA 4IAKA 2CCHA 4C62A 4HYHA 4U40A 3UOLA 3I4BA 1TQIA 4QMTA 3R8PA 4FV5A 3D2KA 2XKFA 2A4LA 3AD4A 3QCYA 5ITAA 5M4FA 5AWMA 3UVQA 3GOPA 1UWHA 3ALOA 4B7TA 5CAQA 4YHTA 5CEOA 3ZLWA 3PIZA 2I7QA 5ICPA 3BE2A 2BRGA 4GMYA 2WMQA 2WMXA 4N0SA 2BDJA 3EFLA 3QQFA 2XEZA 1QMZA 4JOAA 3OTUA 4R3CA 3BZ3A 4Q2AA 4RLKA 3BQCA 2A0CX 2BZJA 1R0PA 5CNNA 1UU8A 4I93A 1A06A 3P0MA 3FZTA 2UZDA 4WNMA 4IX6A 1VYZA 5TT7A 2ERKA 4RFZA 4ZTNA 1JPAA 3R8UA 1ZY4A 3CJGA 4RG0A 3COMA 4MTAA 1Y8GA 3QU0A 5TKDA 4U81A 4JX7A 4ASDA 2R3RA 3LE6A 3C50A 1ZOHA 1KE8A 4EZ3A 4JQ8A 4O6LA 3FQEA 2P2IA 4IJ9A 5KKRC 2JBPA 1YRPA 3D94A 2BVAA 3EL7A 4UWCA 5E91A 1LUFA 3ERKA 3UIBA 4BIEA 3VRYA 4XBRA 4I23A 4ZJIA 3WZDA 5K9IA 3KRLA 3LIJA 4QP6A 5I9YA 3LXNA 5IU2A 4BHZA 5I5ZA 5LXMA 1OKZA 1XH4A 2VGOA 2OJ9A 1PKGA 3AC5A 3RP9A 5HTCA 5DVRA 3ZDIA 5IA0A 3VBQA 2B1PA 2HIWA 5FWKK 2J0IA 2ITUA 3Q6UA 3QAME 4XJ0A 4BZOA 4DEBA 1O6LA 4IANA 4FTQA 4X21A 4USEA 4YPSA 4USFA 4F9CA 3MI9A 2XK6A 3RCJA 4AGCA 4F9BA 4H36A 2QG5A 1ZMWA 2PUIA 2F7ZE 4KIKA 3K3JA 5DR6A 2NP8A 2V0DA 1GZNA 5TR6A 3UP7A 4F65A 1REJA 5CANA 5IZFA 2YWPA 5KMKA 1GJOA 1Z5MA 4HOKA 5EH0A 5E90A 4TYGA 4II5A 3HLLA 4NW5A 4HPUE 4ID7A 4FKGA 4G3EA 5I9WA 3G6GA 4PQNA 2ONLC 3LJ2A 5EFQA 3QQHA 2VTSA 4O22A 4FODA 3FMKA 2WTKC 2UW8A 5ANEA 5DR2A 4DFZE 2XBAA 2XP2A 3VQHA 4CFVA 3VC4A 4HVIA 5EI8A 4QYGA 3TV6A 4CCUA 2ITYA 4J52A 4TT7A 4AW5A 3MIAA 4BZDA 4PDYA 2BRNA 5K3YA 5AADA 1R0EA 2Y6OA 4FUXA 4WO5A 3PUPA 3Q3BA 3TI1A 1H1QA 4IAFA 4G6LA 3NNVA 5CSXA 4TYJA 3FHIA 4NM3A 5EKOA 5HIBA 4AN3A 2QQ7A 3KN6A 5HNIX 2C3LA 3QQKA 3BV2A 4GJ2A 5K4IA 2PZ5A 3QQUA 3HV7A 4OT5A 3NCZA 3GU7A 3OCSA 1H07A 3QQGA 4W8DA 2HW6A 2VWIA 4QNAA 3NVKI 3IDCA 3ITZA 3RMFA 5BNJA 3ZXZA 4IWOA 3CKXA 3QZIA 4JAJA 5DWRA 4ZZNA 4UMPA 1IAHA 2C0OA 3SXFA 4G3DA 4ZK5A 3PIYA 4YLLA 3HGKA 3UZTA 4KRCA 1FGKA 3ORKA 3P7CA 4G34A 5AV3A 2X81A 4AW2A 3SGCA 5EYCA 3MH1A 3GU5A 5HICA 4ZY5A 3P7AA 3LXLA 2FB8A 5EOBA 4QNYA 3QZGA 4FIIA 4XP3A 3FUPA 2JKMA 5CU3A 3REPA 4EH3A 4ZXTA 3ZO1A 3VO3A 1YXSA 2ITNA 1OIRA 4J96A 3QD0A 4P7EA 4YHJA 3R7OA 3CC6A 3CPCA 4IAAA 5JGAA 4MD7E 1IAJA 3UZPA 4ZJJA 2UUEA 3KULA 3UJGA 2EVAA 1JKLA 1GIIA 2GCDA 4IZAA 2OJJA 3I6UA 3KF7A 1XQZA 2V5QA 2YFXA 4FL2A 4KSPA 5CLPA 3TNWA 1OBDA 3FZRA 5E9EA 4AX8A 5CX9A 5JRSA 4JBQA 2QLUA 2C47A 3BWJA 4RWJA 2OXYA 4BCKA 4TWNA 3P7BA 3P4KA 3VHKA 5T6KA 4QP8A 4QMMA 3RAIA 3C4ZA 3EQCA 3W18A 4A9TA 3LFFA 5HLWA 2UW6A 3FQHA 4U3ZA 3R8ZA 3SW4A 2YA9A 4WG5A 1YOLA 3TXOA 1Z9XA 2YCFA 3NZ0A 3SHEA 5KUPA 4EH2A 4DAWA 3W32A 4XMOA 5J95A 1SVEA 3OP5A 3T9TA 5M51A 2HY0A 3VS2A 2X0GA 4H1JA 4X3FB 4D5HA 1STCE 4U79A 4XHKB 3CD3A 2ESMA 5HESA 3VW6A 3VJOA 4W4YA 5F4NA 5DMZA 4QYYA 5JZJA 4O7ZA 3U6IA 1YWNA 2VTJA 4GU6A 4FSUA 4FVRA 4K33A 3UE4A 3ORPA 5DH3A 4Y85A 3HYHA 3GP0A 2P2HA 1ZOEA 4M67A 2FA2A 3HP5A 4O0WA 2KTYA 5KZIA 4FKLA 4B99A 1YW2A 3D7TB 3MVLA 2JFLA 4RA4A 3BHYA 3T3UA 2CN8A 2VWZA 3PE1A 2PVKA 4BTJA 4ZZOA 3QXOA 4F64A 2Z7RA 4IMYA 4RIYA 5EG3A 3O17A 4FSNA 3UODA 2BKZA 3FI8A 1HOWA 5JGDA 5JGBA 3BYMA 3D9VA 2OFVA 3Q4ZA 2R2PA 1P2AA 4ARKA 4RJ5A 3KMUA 4RWKA 2YM6A 2GHMA 5E1EA 1Q41A 4V01A 4WNPA 5D10A 3WIKA 4NJDA 4R5SA 5JZNA 3ID6C 3PY1A 3ZBFA 4R3RA 5IA3A 2VD5A 1E1VA 5EHOA 5GJGA 1NY3A 2GU8A 3ACKA 2C5NA 3KRJA 4U9AA 2FVDA 4EUTA 2C5YA 4E6DA 1OIYA 4MXYA 5M09A 2XNGA 1JVPP 1KV2A 1OIUA 1OZ1A 2I40A 2NRYA 2RFEA 4H39A 2IVUA 1XH6A 2WB8A 3L8VA 3LCOA 2Q0NA 4CLIA 2JDOA 1IA9A 2CNUA 4Z55A 3CQWA 3MFSA 5I3RA 5GIPE 3PJ1A 3HRCA 3V04A 2QCSA 1I09A 4DH7A 1TQMA 2J5FA 4E5BA 5HLNA 2FH9A 2W05A 4Y73A 4JL9A 4LUDA 1QPDA 3BBTB 2X8DA 3VIDA 4GYGA 1NA7A 2WMRA 3UP2A 2J0KA 3JUHA 2CKPA 3G9LX 4RFMA 4JXFA 4BICA 3G90X 5AUVA 5A4EA 2YIRA 5IUHA 1Q62A 3DK6A 4DT9A 3V5QA 2VX1A 1UNGA 3F3WA 3IGOA 5JK3A 4EI4A 2YAAA 3ORMA 1E1XA 5BPYA 5C4LA 1WBPA 4AZVA 4YJTA 5CI7A 1W98A 4A9YA 2VN9A 4PTGA 2HZIA 3Q4CA 4K2RA 4OTPA 3AC2A 3FKLA 4KKGA 2G15A 5HCYA 4X2NA 3CR0A 3TZ9A 1OKVA 2VTRA 4EOJA 2QR7A 5G1XA 5BX0A 3JY9A 3FSFA 2BCJA 4WNOA 4GRBA 2XJ1A 4FV4A 2UZOA 3D5VA 4MXZA 3M11A 3TNIA 4YP8A 3TIZA 3NMUF 1H1PA 1B6CB 2BZHB 3A4PA 5FDXA 4IDTA 4HNFA 4KS8A 4C4IA 4CG8A 3SD0A 1APME 4KRDA 1FINA 2IVVA 3FMJA 1YWRA 4FF8A 3V01A 4FG8A 2GNGA 4CMUA 4XV1A 4I24A 1LEWA 4LGGA 4CRLA 2W5HA 4NCTC 4FR4A 4RVTA 2ITWA 4RIWA 3CSVA 4GT5A 2IO6A 5D7VA 2KULA 4FVQA 3G0FA 5J87A 3WZKA 3QD3A 4O0XA 1CTPE 4O7YA 4YTFA 4LFIA 4FIJA 3ALNA 3CJFA 5JFSA 1UVRA 3ZM9A 3F88A 3NW7A 3ORIA 4BI2A 5CQWA 4DF3A 4WNKA 4DG3E 4RC3A 4HGLA 5KMJA 3KXMA 5DR9A 4R7BA 4LRMA 3GCVA 3BGPA 5BVEA 2BRMA 2QU6A 3GCPA 2YAKA 2W9FB 4O7VA 4G6NA 1Y6BA 5A6OA 1XH9A 2BPMA 4AOTA 2OXDA 4EZ5A 2XIKA 2G9XA 1WZYA 1H1WA 3DTCA 4X2JA 4EHVA 3BE9A 3BHVA 4IE9A 4I0SA 4FTOA 3O23A 2J90A 1KE6A 2VO6A 4G5PA 2QOOA 1W83A 4DITA 5LOHA 3RALA 4J98A 3E8NA 2YM8A 2E9NA 2PVHA 3C4FA 3I60A 4YTHA 1UU7A 3KMMA 5EDRA 4L00A 1UA2A 3PLAE 4M84A 4MXOA 4U41A 5B0XA 2ZJWA 4OLIA 4ANSA 5CEMA 3QRUA 1Z57A 3PY3A 4ZAUA 4BR3A 3VBTA 2IZUA 2QKRA 3I81A 1O6YA 3E8DA 4JBOA 4TYHB 2I0YA 3UDBA 5EM5A 4O81A 4LOPA 5C26A 4BGHA 2ZV9A 2EXEA 3P08A 2WMAA 4MBLA 4L01A 2WQNA 2B9JA 1W8CA 3CQEA 3PG3A 5FQDC 5EK7A 2Z7LA 3DJ7A 5HE0A 3KREA 4M66A 3VBYA 5CALA 4AXAA 3C0GA 4Y5QA 3F5PA 3TDWA 1OECA 4PDOA 3ZHPC 1MQBA 3TDVA 4ALWA 2BR1A 2ZVAA 5K4JA 4ANLA 2ZM3A 1G8SA 4UMRA 2W1HA 2X7FA 5IQIA 2ITPA 4NZWB 4OTRA 3GC0A 5DBXA 1WBVA 5A4TA 4BYJA 2GS7A 2B54A 5BVFA 4FTMA 4FEVA 3RHKA 3ZM4A 5BVNA 3PTGA 4QMPA 3RI1A 3DQXA 5FEDA 3F5GA 1V0OA 2WIPA 2R7IA 4PL3A 4F7NA 5HCZA 4D2RA 3WOWA 3OXTA 3C4EA 2ZDTA 4ZJVA 3ZRLA 4AZTA 3FE3A 4LG4A 4ACDA 4MQ1A 2JLDA 2YHVA 3MVMA 2XIYA 2OFUA 4F99A 2UZTA 3WF8A 2GTNA 4QTAA 2Q83A 1WBWA 3DXQA 4QYEA 2VTOA 3NUYA 3QD4A 3PXFA 5DE2A 4TWPA 4DEEA 5C8NA 4I41A 4N6ZA 5IISA 3SXSA 4L3LA 2FO0A 5AR4A 4IFCA 3MY1A 3MSSA 3D5WA 5IQCA 3GU4A 4ENYA 3TUCA 4DGGA 2J0JA 4IAIA 5GZ8A 5D41A 3S95A 4HZSA 3UMXA 3FHRA 2WEIA 4HGSA 4ITIA 2C3JA 2XYUA 4I1ZA 2CGXA 3PFQA 3R83A 4NYEA 2C3IB 1ZYCA 5AP2A 4OTHA 2C6KA 3ORTA 4FOBA 5AR7A 2E9VA 4CRSA 3FI4A 3RK9A 4WSYA 5AUZA 5D1JA 3V5LA 3OUNB 3QQLA 3KCKA 3COIA 3KB7A 1PXPA 4ZTSA 2ETMA 3B2WA 4AW1A 4CXAA 3H4JA 3FC2A 1IRKA 3CD8A 4M14A 4M0ZA 2G2IA 4YZMA 2ZM4A 3H0YA 3KGAA 3LFDA 3U6JA 4H05A 4FT5A 4GFGA 3KULB 3U54A 2OJFE 3UG2A 4EH4A 5J5TA 3VUKA 4B9DA 4FTIA 3DB8A 4O2PA 3TUDA 1XKKA 3JVSA 3ZS5A 2X1NA 3IPHA 4BCOA 2O3PA 3KY2A 2QHMA 3P23A 4E6QA 1GOLA 3H10A 3MYGA 3W33A 4FKUA 1JAMA 3RK7A 3ZCLA 3AXWA 3OXZA 5AUTA 5M4CA 3I6WA 4QMSA 2BHEA 4TKSA 4ZTQA 4RX8A 4IVCA 5KMMA 3DFAA 1Q4LA 3U51A 5FLFA 5C8KA 2UVXA 4PDPA 5HKMA 1G3NA 4EOQA 3DOGA 5GJFA 4BBMA 4W4WA 4DCEA 4C7TA 1XR1A 2J9MA 5B2KA 5DPVA 5HE1A 3LXPA 4CT1A 3CXWA 2IPXA 4MEDA 4CLJA 4FV1A 4OTWA 1OKWA 4QQ5A 2BAQA 4ITJA 3WI6A 4YURA 4FBXA 2GS2A 2W7XA 3GT8A 2WXVA 4BDAA 4YJPA 2C6MA 5LVLA 4D4YA 5IH5A 2OG8A 4FNZA 3N9XA 4ZMEA 1GZ8A 1WVYA 2GHLA 4KIOA 2O64A 3AMYA 3U9NA 4KUJA 3I7BA 4JRVA 4D0WA 4G3GA 4HVDA 2PVFA 3DLZA 3GC9A 2EUFB 4C4GA 1ZRZA 4GUBA 5DN3A 4BB4A 5CU2A 5HU9A 4DFNA 5IQBA 3HZTA 3TG1A 2C6LA 2I0EA 1M2QA 2YDKA 2PYWA 2W1GA 3QTRA 4JRNA 3FXXA 4EJNA 3FQSA 2UV2A 4CTBA 3U6HA 5IDPA 4JIKA 3R9OA 2OIQA 4HYIA 4EK6A 3BPRA 3EOCA 4U97A 3LCKA 2QHNA 4ANQA 1PXKA 2OH4A 3MTLA 5AIKA 3F69A 4Q5HA 5I3OA 1XH7A 1U46A 1KOBA 5ANOA 3NCGA 3PSDA 4KBKA 3BCEA 4NM5A 2QU5A 4UB7A 5F20A 3PVUA 4YC6A 1YI4A 2O8YA 3VRZA 4AE6A 4E26A 3A7JA 1UNLA 2VNWA 1Q8ZA 3FBVA 4YZDA 2VTPA 2QI8A 3EKKA 3NAXA 5CXHA 3RM7A 3ZRMA 3BYUA 3HMOA 4HCUA 4AW0A 3KA0A 4HYUA 2Y8OA 3SRVB 5L3AA 4J99A 4S30A 3MB6A 2BDWA 3ZO2A 2PZYA 3BGQA 2JKQA 4XG7A 1WBSA 5HG9A 4X3FA 2WMSA 4ALVA 4J95A 2GQRA 2JITA 1JLUE 2JIUA 4F7JA 2C6OA 2CNQA 2B0QA 5L6WL 3D2IA 3OWKA 4NTTA 3QCSA 5BQ0A 5L6OA 4FE2A 3DK3A 3D7TA 3L8XA 3PPZA 2F2UA 3BBWA 4D1ZA 4JBVA 2CGWA 2VO3A 1OMWA 4QQTA 3DDPA 3BELA 4X3FC 3TKHA 4IB0A 3VBXA 5AP5A 4BGGA 3QZHA 3ZUVA 5HGIA 4NT4A 3FI2A 4QP7A 2DS1A 4LMNA 3F3VA 5KMNA 1S9JA 5EM7A 1E9HA 2R3MA 4FG7A 4DTBA 3EZRA 3UIUA 1YDTE 1JOWB 5BVOA 1KV1A 1OL1A 1U5QA 2Y6MA 3AGLA 4TYIA 4JDIA 3LM5A 3LCSA 4XG4A 4CMTA 1J7UA 2BIKB 5AV0A 3PP1A 3PG1A 4IVDA 3U4WA 3UTOA 4AUAA 2VUWA 3DZQA 2CDZA 4D2PA 4H3PA 5B2MA 5KMOA 4O96A 5E8SA 4CKRA 3DT1A 5AUUA 3ZFMA 1JSUA 2ITOA 3MFRA 1U54A 3GCSA 2R3LA 4HJOA 3R9DA 5A4QA 1M17A 3WF5A 4HVGA 4EOMA 1LP4A 5M57A 4CFXA 4WD5A 5CQUA 5A46A 4U43A 5IUIA 3TTJA 3W8QA 5LQFA 1Q8UA 3NLBA 3Q53A 4BBFA 4Y5HA 2OF4A 5IQGA 2DUVA 2BAKA 4HCVA 1DI9A 1R78A 4QMUA 1OPLA 3KMWA 4MNFA 4HPTE 3PXQA 3WE8A 1RW8A 4FTAA 4JS8A 4WIHA 5HG5A 2QONA 3OC1A 4IW0A 4OT6A 5CF6A 3QGWA 3E93A 4YLKA 1Q8WA 2G2FA 2C5OA 2H96A 4QMLA 3FMHA 4FL3A 4UX9A 2RFSA 2NNWB 2PVMA 2QD9A 4TWCA 3MPTA 4H58A 4KWPA 4GYIA 3L9NA 4OTQA 4NUSA 4M97A 5LJJA 4JLCA 5ETCA 4F4PA 4HGTA 5AR2A 4V0GB 5GNKA 3FXWA 2B55A 1M52A 1YXXA 4ASXA 4YJQA 3OROA 1W7HA 4IB1A 4A9RA 4EHZA 4U3YA 4JX3A 3A7IA 5AV1A 4YC8A 3LJ0A 1IASA 1CM8A 1YVJA 2HYYA 3RAHA 3A8XA 5JFVA 2RGPA 3S0OA 3OXIA 4QMOA 3GU6A 4GUEA 1H01A 4J71A 3WF7A 3D15A 2ZV8A 4D2TA 5GIOE 3VW8A 3VN9A 3NYXA 3A60A 2XH5A 4WRSA 3WF9A 3CLYA 4O1OA 5E8VA 3PXKA 4ONAA 4AWIA 3NUXA 5EW9A 4PL4A 1KE5A 4CQEA 2R3OA 4HW7A 2YIWA 4E5AX 3FMMA 3Q5ZA 3R2YA 4TNDA 5DT4A 2C5XA 3MH2A 2AUHA 2PZIA 3KVXA 4FSRA 4YJNA 2XIZA 4BKYA 3I0OA 2ITVA 4GH2A 4IFGA 2HWOA 2BROA 3TM0A 1ZYSA 4PX6A 4ZY4A 5LVOA 1CDKA 2E2BA 4CNHA 4GEOA 3UQCA 5CWZA 3EN7A 5KZ0A 4DFLA 3R8LA 2CPKE 2OJIA 1UKIA 4FTTA 2ITZA 3IGGA 4MF1A 4NM7A 4R7HA 1H27A 3B2TA 3DBCA 4EK3A 2OWBA 3AT2A 2CKEA 2J4ZA 4AA0A 2NO3A 1PXJA 3HEGA 2BRBA 3Q9WA 2O0UA 3VULA 4QMXA 5EDPA 3LHJA 1Y57A 2CGUA 3CE3A 4GT3A 3ACJA 2YJRA 5HBHA 5AUWA 3MH3A 3ATSA 4ACMA 3O8TA 2ERZE 5CZHA 2O2UA 3ANQA 4YGAA 1T45A 4PY1A 4ACGA 2WMBA 4K0YA 3MBLA 5ANIA 3S3IA 4CSVA 3VHEA 3H9OA 5BMSA 4TTHB 2QOHA 3NUAA 3DA6A 4RMZA 2Z2WA 3BV3A 3IW6A 2XF0A 4APCA 4BCPA 5BVWA 4IJPA 2CHLA 4DYMA 3PRFA 1IEPA 5BUJA 5IG1A 2W1EA 4TYHA 3OG7A 2F57A 2RG5A 5A4CA 5CYIA 5FGKA 2VU3A 1G5SA 3DKCA 5I9VA 2C3KA 3GVUA 3UC3A 2C5VA 3F5XA 3KXGA 5CAOA 5CVHA 5ETFA 3VUDA 3EWHA 4O21A 3VUHA 5B2LA 5LMKA 4O0YA 3R73A 4FEQA 1ZYLA 2RIOA 4WG4A 3VAPA 4QMQA 3HNGA 3LLTA 2ZDUA 4UMUA 2HZ0A 4EQMA 2G1TA 3KF4A 4D4VA 2QOKA 5IA5A 2PK9A 4FZDB 2JC6A 4WT6A 5CEIA 3TZMA 3W1FA 4ZSGA 1LEZA 2JBOA 3A8WA 3BQRA 5AAEA 1OI9A 5E1SA 4WBOA 4BCIA 3MB7A 3EN4A 3SG8A 4XOYA 2J0MB 5M4IA 4Y72A 3EFKA 3HA8A 3SXRA 4C4FA 1IG1A 3KVWA 4K11A 3DXPA 3F66A 3ZEWA 4EOKA 2UVZA 3SW7A 4PP9A 4E6AA 1JQHA 4FEUA 1YQJA 1M7NA 4FK3A 3ZRKA 4AZWA 3SG9A 2JKOA 3EN6A 3LCDA 3CPBA 3D83A 4WBBB 2W4KA 2FSOX 3PZHA 1ATPE 3PJ8A 3UNZA 4XCUA 3N4TA 4MXAA 5I4NA 4OBOA 2QOLA 1Q8YA 1RDQE 3PJ3A 4XG6A 4UN0C 4QMNA 2YISA 2XNMA 3QTQA 2HAKA 4PTEA 2B9HA 2FSLX 1I44A 1YHVA 4YJRA 4EWQA 4K8AA 4S32A 4PMPA 5LVNA 2ITXA 4U5JA 2C6TA 4CV8A 1UWJA 4M13A 4M7IA 2C4GA 4EQCA 4FIGA 4BDJA 3R02A 4N4SA 4WG3A 2VTHA 2DYLA 4DINA 2XIXA 3HKOA 4ANBA 4IB3A 4D1XA 1WAKA 3RPSA 4L43A 4H3QA 5ANJA 4F9YA 3RPRA 3OBJA 4IEBA 4BVUA 4CV9A 4I5CA 2ITTA 3ZLSA 2W17A 3BU3A 1PYEA 3PJ2A 1NVSA 2C1AA 5IQDA 5JQ5A 4A9SA 4DGMA 4XP0A 2CCIA 3ATTA 4MKCA 1ZOGA 4J97A 4X0MA 2XZSA 3BEGA 4MBJA 3AC4A 4O38A 3LFBA 4D55A 2VO7A 4L52A 1W82A 3OWJA 4FI1A 3VS3A 2GNIA 3ZLXA 1L3RE 1KE9A 2PMNX 2P55A 3FZSA 3FDNA 4F7LA 1FOTA 2IVSA 3OHTA 4CCBA 4S34A 2XM9A 5D11A 4DLJA 4FSQA 2CMWA 3DGKA 3VUGA 2F9GA 4BDDA 2C1BA 3LPBA 4NK9A 5FTQA 4R77A 2F4JA 5M08A 3Q6WA 2W1DA 3LAUA 3OZ6A 2G01A 2JD5A 4JG8A 2C6IA 4L7SA 4M15A 2VTTA 4N6YA 3TUBA 3FV8A 4LOQA 5J8IA 5DEYA 2VV9A 2WD1A 5HZNA 5CT7A 3TCPA 3W2CA 3NWWA 4IM3A 3QF9A 2ITQA 3HL7A 4EORA 3TKUA 4BWPA 4U0IA 2J0LA 3MVJA 1FVTA 3BHHA 3F2NA 4Y83A 5AP7A 5IDNA 4RVKA 2QLQA 3SOAA 2OK1A 3ENHA 4X7QA 3HV3A 4W4XA 5IMEA 3GOKA 3ROCA 2Z8CA 5EM6A 1FMKA 3K54A 4R6VA 5H3QA 5HEZA 3HDMA 3PXYA 4FMQA 2ZB1A 4LRJA 3TZ8A 4GG5A 3E3BX 4Q9SA 3K5UA 5HO6A 4E4MA 4TRLA 4ZTMA 3P1AA 5CAPA 2CKOA 4RJ6A 2RG6A 4Q9ZA 5CS6A 3G0EA 4GFMA 3IKAA 3KXZA 4O0TA 2FSTX 4ZLOA 4B0GA 1OPJA 1PHKA 4O91A 3CS9A 5IKWA 1NXKA 3C9WA 5FTOA 3GFEA 4ZOGA 4XYFA 5I0BA 1QL6A 3EQDA 5H9BA 2A19B 4HVHA 1UU9A 3UBDA 1UV5A 2J5EA 3QHRA 1U54B 1ZARA 2P4IA 4OTFA 5FXQA 3R7EA 1M2PA 3SRVA 3RWQA 2EWAA 4I0RA 2VZ6A 4X2FA 4F0GA 5EI2A 2W9ZB 3MDYA 2UW9A 3ODYX 3PWYA 3ZFXA 5LMBA 3ZSIA 1MUOA 3A7HA 4FT7A 4XBUA 5B7VA 4QQCA 2BZIB 4FUYA 4A4LA 3BGZA 2ZMDA 3BLQA 4L7FA 5AV2A 5DA3A 3BHTA 4U8ZA 2ZYBA 4G2FA 4KBAA 4GVJA 5J1VA 4C37A 4IX3A 2IWIA 2GNHA 2ZAZA 3LMGA 2PMLX 4KD1A 5IEXA 4JT3A 4DBXA 2XJ2A 3GEQA 5HHWA 2X9EA 4NKSA 5EM8A 4AT4A 3PSBA 1ZYJA 5KMLA 4EUUA 4ANMA 4BBEA 4AG8A 4MD9E 3OW4A 3II5A 3IW4A 3SVVA 5AUYA 2X2LA 3R7VA 3V8WA 3PP0A 3PVBA 4A4XA 3GNIB 4G9RA 5J5SA 3VBVA 4CYJA 3ANRA 3A4OX 1QPEA 2G2HA 2PMIA 3G15A 3P86A 4UBAA 4KABA 3VS4A 3C7QA 2W1ZA 4BL1A 3FYJX 5KX8A 2PWLA 4G6OA 4JDHA 4FSZA 2XUUA 3DNEA 1PKDA 3KXXA 2H34A 5M56A 5DG5A 5L8JA 4IH8A 3CEKA 1V1KA 3DBEA 4QMYA 4R1YA 3FSKA 4G16A 4U7ZA 3E87A 4A7CA 5HCXA 3CQUA 4E73A 3NX8A 4C2WA 5HD7A 5FP6A 4FGBA 4I92A 2YIQA 3I5ZA 5HI2A 4LUEA 3UIXA 4KA3A 2CKQA 5HD4A 1PXMA 4RQKA 3JYAA 1FVVA 1F0QA 3OW3A 3EQRA 5I9XA 3PXZA 3PY0A 2R3FA 1YDRE 3AT4A 4DEHA 3IW5A 1GZKA 2WMUA 4GJ3A 4GK2A 5F95A 3N4UA 4RZVA 3UVRA 3PPKA 3P79A 3W16A 3B8RA 4PUZA 4DEAA 3PZEA 4I6HA 2XRWA 4S2ZA 4I6BA 4EOSA 3M1SA 5KMIA 1J7IA 4QP9A 4XV2A 5HE2A 2WNTA 3KRXA 2QOCA 3TNHA 5JMSA 2UZLA 3HDNA 5HIDA 3TIYA 4CEGA 3CGOA 2EXCX 2YM5A 1URCA 3DV3A 3PVWA 3Q9XA 2JEDA 4GIHA 3NUSA 4XV3A 3UO4A 4C3FA 4IC8A 3MIYA 5CAUA 5K0XA 5CSWA 3DAKA 1PMEA 3GXLA 1OL7A 2XBJA 3W2RA 3MPMA 3LJ1A 3EQGA 4MXCA 1NT2A 2CLXA 4ENXA 2QOIA 3PIXA 1H8FA 1JWHA 1RE8A 5GINE 2UW5A 4F7SA 5M53A 1J3HA 5CEKA 3MFUA 4BCNA 4UYNA 5A6NA 3V8TA 2ZMCA 4FTRA 4RJ8A 3R6XA 1U59A 2VWXA 4WSQA 3KEXA 3DJ6A 3L9LA 4W8EA 3NYOA 1XBCA 4FIEA 3DZOA 4MWHA 5E7RA 2HW7A 3ZZEA 2Z02A 3POZA 1XH5A 2PTKA 5L2WA 2CGVA 3UQGA 4V0GA 4DCAA 2Z7QA 3NDMA 4YZNA 4FA2A 3CIKA 3TZ7A 2BZKB 4P90A 4FG9A 3WARA 4U6RA 4ERWA 2Y4IB 4EOIA 3KXHA 1HCLA 1ZMUA 2GDOA 4YTIA 4S33A 4LL0A 4XP2A
chains in the Genus database with same CATH superfamily
1K3AA 4G3CA 2I1MA 1RJBA 4AGUA 3PA4A 3BYOA 3LZBA 4MXXA 3FMDA 4DTKA 2C30A 5ANKA 4BYIA 4EZ7A 3GI3A 2IN6A 3S00A 4CKIA 4FV6A 3SQQA 3FKOA 4FTNA 4LRKA 4WRGA 4BY9E 3TN8A 4I6LA 4E1ZA 2R3QA 3GC8A 3W8LA 3EB0A 4DLIA 1ZMVA 3OTVA 5CVFA 3FLNC 3R9HA 5LVPA 3DAEA 4FYOA 5AX3A 4O86A 1H1RA 1NVRA 4ZMFA 1JNKA 3G5DA 4JIAA 4GG7A 4QMZA 4R5YA 5AV4A 3JR1A 3FL4A 1W0XC 3OEZA 2X8IA 4BWKA 3KU2A 5JH6A 4D2WA 3DB6A 3MTFA 4IACA 4BI1A 4C4JA 1J1CA 3LFQA 2VX3A 1OKYA 4L45A 4CFFA 3Q32A 5AR8A 4BDHA 4EYMA 1IA8A 3DXNA 4GU9A 3PJCA 5LWMA 2VWBA 3EKNA 2XCKA 4QMVA 4ZP5A 3RZFA 4ZSAA 1JKSA 3E63A 2PE0A 2H6DA 1K9AA 4M0YA 2HXQA 3FKNA 5FXSA 3W0PA 4IM0A 4L68A 3FLWA 4X2KA 3EYGA 3HMNA 4K1BA 4C3RA 1KOAA 3WZEA 3V5TA 2VTIA 5HVYA 1SNUA 4DHIB 2UZVA 4BCHA 3C0HA 1YXTA 2PVJA 3FEGA 2B9FA 4UMTA 2OI4X 5HNBA 3AC1A 3TMOA 2YM3A 3R1YA 4F6SA 2PPQA 2BUJA 2JFMA 3SDJA 5AR3A 3FMLA 4KKHA 4QMWA 2ZV2A 3PYYA 3GQLA 5HORA 4JR3A 3O96A 4X6QC 4K6ZA 3R00A 4AGWA 3F61A 4BKJA 4C59A 1OL5A 5DHJA 4TYEA 1JKTA 4YJOA 4C33A 3FLQA 4DH5A 4RX9A 1QPCA 4FICA 2YN8A 4DGOA 4BN1A 1KE7A 1V0PA 2OICA 3FMNA 3QUEA 4AF3A 2BDFA 5BUIA 5E8ZA 3VF9A 2CSNA 5J9ZA 5IQFA 4KS7A 3GCUA 3OY1A 2HOGA 4NJ3A 3VUIA 3PSCA 2QKWB 5KBRA 2IW9A 4FKJA 3QD2B 3NIZA 4L3PA 4RT7A 5DRDA 1DAYA 2WMTA 3FLZA 2XA4A 5TOZA 5C9CA 4F1OA 3D0EA 3QZFA 5AFVA 1WFCA 3LFEA 3IECA 4WOVA 1FMOE 3NRMA 4GKIA 5AP3A 4JBPA 4ZY6A 3HMPA 3OWPA 3RKBA 3HV6A 4S31A 2YM7A 4CQGA 4YSJA 3G6HA 5EW3A 4R7IA 3QTWA 1SVGA 4KIQA 4BHNA 4EOOA 4RQVA 3DKOA 2AC3A 5TO8A 3E7OA 5J7HA 3O0GA 2UW0A 5M4UA 3L1SA 4FTCA 4TW9A 5HU3A 4FC0A 2JIIA 2PUPA 2SRCA 1PMUA 2UW7A 3OCGA 2PULA 5KNJA 3O5AA 5E92A 1ZWSA 1U4DA 2UZBA 4HCTA 4WUNA 5DYJA 4EH8A 2I0HA 2QODA 2RSVA 2Z7SA 5K0KA 4BDEA 3ETAA 3ORZA 3EQFA 4UEUA 4CMOA 5EQYA 4EJ7A 2YCQA 4I4FA 3BRBA 1LPUA 5HQ0A 2V7OA 1CKIA 1WVXA 3POOA 4JQEA 4AZFA 5JRQA 4AXFA 3COHA 3ZTXA 4EKLA 3IW7A 4FKTA 3ZONA 3C1XA 1KWPA 4FV2A 2C6EA 3GUBA 4J53A 4X2GA 4BGQA 3KC3A 4C58A 3N4VA 4QYFA 4QPSA 4ZEGA 4OTDA 2WQMA 3TJCA 2PHKA 2F7XE 1URWA 5F1ZA 3TEIA 3VS5A 3ORLA 2QOFA 4D9TA 2X2KA 4DEDA 5HTBA 3AQVA 3MJ1A 4OW8A 5CT0A 1SZMA 2HENA 1Q97A 2OXXA 2XNOA 3N51A 4HGEA 4IAYA 4IXPA 4IWQA 4NIFB 4QYHA 4RFYA 4X3JA 4RWIA 4ALUA 1PXOA 2AC5A 4GS6A 1VZOA 3CTJA 4A9UA 2OLCA 1P4FA 3NEWA 4UMQA 4KINA 5ACBC 3MY0A 2YERA 3UVPA 4FYNA 3UYTA 3QFVA 2R5TA 5EDQA 4NU1A 4QRCA 4RRVA 3OF0A 3DLSA 4AT5A 3QC9A 2PL0A 3FC1X 3DY7A 3Q96A 1V0BA 4BKZA 3R01A 3AGMA 3VJNA 4BIBA 4JDKA 3IOKA 4PP7A 2CNVA 4CZTA 4PTCA 4XOZA 4QDEA 4RJ3A 2Z60A 4R8QA 1REKA 3C51A 3U55A 2YZLA 2W5BA 4OGRA 4ACCA 2X7GA 5IF1A 4JI9A 4G1WA 2PZRA 1FVRA 1GZOA 3Q4TA 4XNEA 2XIRA 4D28A 3NFFB 4PF4A 3V8SA 4F63A 2B52A 4O4EA 5AA9A 5L6PA 1TFFA 5GHVA 1BMKA 5G6VA 4OAUC 4O82A 4CFUA 3AC3A 3K3IA 1OUKA 1YWVA 4FKRA 4RC2A 4RVLA 5EW8A 4O7SA 2X0OA 1F3MC 2PMOX 3H9RA 4RC4A 2YDJA 2XAOA 4O7TA 3NNXA 1DAWA 3BHUA 3MH0A 4F1MA 2PUUA 4K18A 2WAJA 4RIOA 3LQ8A 4D9UA 4EHGA 5L8KA 2PZPA 1PMNA 2XKCA 2JDSA 3CY3A 3O8UA 2BAJA 4FNWA 3BYSA 4R3PA 3G33A 4O7LA 4U80A 3E5AA 5DRBA 3GGFA 2W4JA 5F9EA 5L2IA 4E93A 2NRUA 2OH0E 2UW4A 1U5RA 3Q04A 1UKHA 1XBBA 3DFCB 3FLYA 3ROYA 3D4QA 1ST4A 5FDPA 3JY0A 3AG9A 3H0ZA 4MBIA 3IS5A 1L8TA 4Y8DA 2Y9QA 3BU5A 3KCFA 5C03A 4M68A 3F7ZA 2OIBA 4K77A 2FUMA 5D9HA 3VBWA 4EL9A 4FTUA 5T3QA 5EOLA 4PPAA 4MHAA 3VUMA 4FSTA 4DH8A 5LWNA 1MQ4A 2BFYA 5FTGA 2P3GX 3WILA 1ZXEA 4FTKA 2GMXA 5HVJA 3JS2A 2XK7A 1PW2A 2O65A 3NYNA 5J79A 4HNIA 5L8LA 2VTMA 2XCHA 2OJGA 4O0UA 2XNPA 4LQMA 1PYXA 5CEPA 2R3KA 3R71A 2WOTA 2YJSA 3RK5A 5L4QA 4FEXA 4FZ6A 2IW6A 4EC8A 5HVKA 3BYVA 4G17A 1BL6A 4A07A 4MD8E 4XUFA 3THBA 3ZSHA 4I94A 3OT8A 4AN9A 5L2TA 1YI6A 4HYSA 5AP1A 2XNBA 3BKBA 4FKVA 4Z16A 5JSMA 5DFPA 3FZOA 3MVHA 1P5EA 5A3XA 2XVDA 1J1BA 2GNJA 3TNQB 1YDSE 3QCXA 5CASA 1JKKA 5K5NA 1H26A 3QRIA 2R64A 2WQEA 4FNYA 4I5PA 3LFNA 3HAVA 2R3NA 3TJDA 3QKMA 1HCKA 2WU6A 4GVAA 3DCVA 3SKCA 2J51A 3Q5IA 4TN6A 1AD5A 4F0FA 2XYNA 1Q8TA 3FXZA 5CVGA 2IZTA 4YJSA 4CVAA 2GQSA 4L44A 4IVAA 5CTPA 4B6LA 4ACHA 4RLLA 2HZNA 3QCQA 2HY81 3W0NA 2QO2A 2Y0AA 2ETKA 2OW3A 3MS9A 3MWUA 3Q2MA 4FV7A 1JBPE 5J9YA 4U42A 3O2MA 3FPQA 4QP4A 3R8VA 2GFCA 4BTKA 4JR7A 2PE1A 4BWXA 3EN9A 2XJ0A 4G9CA 3K2LA 4MH7A 5AMNA 2GTMA 4JJRA 4YBJA 5EYDA 3TNPC 3CBLA 3AKLA 4P5ZA 3VVHA 5L2QA 3NVMB 2YDIA 4AU8A 4KBCA 4NEUA 5GZ9A 4ZS0A 4OUCA 3AMBA 3OCTA 4ZSLA 3HA6A 3TL8A 3O51A 4QT1A 4RPVA 5CF8A 5HX8A 3BEAA 3RPVA 2JKKA 2LGCA 4FL1A 4D0XA 4IADA 3B8QA 3C4XA 3NSZA 2QO9A 3OVVA 4GKHA 4G3FA 1FGIA 4GL9A 4G31A 1J91A 4Q5EA 3NS9A 3PXRA 3UNJA 1ERKA 4C02A 4AQCA 3C5UA 4EK8A 2QC6A 3F7WA 3RCDA 4DA5A 1WVWA 4GIIA 2V22A 4RIXB 4MNEB 4O0VA 3UC4A 3LMHA 5AX9A 2BILB 4C57A 4FV9A 4IM2A 3W2QA 2QG7A 2W4OA 1H0WA 4FEWA 3VS0A 4C8BA 4FGRA 2J2IB 4NW6A 4BCFA 3GFWA 3S1HA 1OB3A 5EQEA 4NFMA 3OFMA 3F9NA 3OEFX 4KB8A 5AEPA 3LLAA 4MAOA 2X6DA 3UDSA 2OKRA 4XS2A 3TTIA 3EN5A 3WBLA 5BYLA 4QP3A 4IB5A 5FUTA 4J8MA 3R7GA 3F6XA 4YTCA 4UXLA 3U87A 5C4KA 4AZSA 3W2PA 3AT3A 3QBNA 4M3QA 3W55A 4AACA 2GHGA 3KL8A 4UWBA 4LDTA 4E4NA 4RJ4A 3JVRA 4KKEA 2PY3A 1O9UA 4MWIA 3R1QA 1MRUA 2XK9A 5AAGA 1VR2A 1Y6AA 4L46A 3LXKA 5CENA 3RM6A 2IZSA 4PMMA 4QTEA 1R1WA 5AIRA 5IA1A 3R1SA 3RHXA 1OBGA 4MQ2A 5IA4A 3G2FA 1SNXA 4UZDA 3QTZA 2PVRA 5HG7A 3R2BA 4UWYA 3D5UA 4JG7A 5AM6A 4ASEA 2R0IA 4I6QA 5CSHA 4E3CA 3G51A 4PMSA 2BFXA 5IQEA 2WEVA 2JDRA 3R30A 5ACKA 3S2PA 3QA8A 4UALA 3FMEA 4XG2A 1CSNA 3KFAA 3Q2JA 5HTIA 2OO8X 1KSWA 4KAOA 2ONLA 5IH4A 5KCVA 4XV9A 4QTDA 3I5NA 3NPCA 3GQIA 2R7BA 4RBLA 4I5HA 3UIMA 2Y4IC 2C0IA 3F2AA 4YZ9A 4FZ7A 2YLFA 4YC3A 4IHPA 5ANGA 4BDBA 5BUEA 1Q61A 3D14A 4L9IA 3V5PA 3NUPA 5CY3A 5D12A 1B39A 3R04A 3BWFA 2EB2A 4B8MA 1XWSA 3I1AA 3E8CA 3O7LD 3OUKA 4EONA 3PA3A 4YJVA 4C34A 4D4RA 3PFYA 3ZO4A 2W1CA 2Y7JA 1PF8A 3RTPA 3L9MA 5TF9A 4E6CA 5LMKC 1G8JA 2W5AA 2C69A 3HX4A 1YOJA 4EHEA 2BTSA 5FM3A 3WYYA 3RBWA 2BKKA 2GSFA 3P9JA 1GAGA 2C6DA 4LOOA 5HNGA 2A27A 3RAWA 3VWAA 4MK0A 2R3HA 1H24A 4PMTA 3ELJA 2WMVA 3QRTA 1A9UA 5J7BA 3IONA 4OAVB 3V5JA 1DM2A 4NSTA 2OZOA 3HV4A 3L8PA 4PV0A 5FEQA 5DOSA 3SLSA 1H0VA 5C27A 3ZZWA 5CU6A 5CSVA 4AS0A 1YOMA 3R63A 4AT3A 4DFXE 4FT0A 4NFNA 3Q9YA 2XARA 3BL7A 2W99B 4BZNA 4RJ7A 1H00A 3VS6A 3BI6A 4LV5A 3F3ZA 1JSTA 2YCSA 4BDGA 4TL0A 5JQ8A 2R3GA 3MW1A 3Q4UA 3ODZX 4AGDA 4V05A 4BDKA 2B4SB 1GIHA 3TWJA 1RQQA 4O27B 1FPUA 3KN5A 5JT2A 3FPMA 3BLRA 2X39A 1P4OA 2HELA 3FZ1A 3COKA 4AE9A 3WIGA 4FT9A 1BI7A 2EU9A 3QC4A 4DHJA 3IO7A 4YSMA 4CZYB 5M07A 1B38A 1ZLTA 1Y91A 1M14A 3QX4A 3RJCA 4RVMA 4BDFA 3IDPA 1GY3A 3ZUUA 5BYZA 2RF9A 3RWPA 1WCCA 1OGUA 3EMGA 1MP8A 3ENMA 4AFJA 4P4CA 5FG8A 2UZUE 4QPMA 3TT0A 3DTWA 1SM2A 1TZDA 2BHHA 2REIA 3DKGA 3UPZA 1DI8A 2X2MA 4FNXA 3SAYA 5C1QB 4IX5A 2IJMA 1WMKA 2CN5A 4FSYA 4I4EA 4TY1A 5BVDA 3C4WA 2B7AA 1K2PA 4PRJA 1VJYA 3E92A 3ZMMA 4QDVA 2OIDA 3E62A 4JG6A 4EH7A 1PXLA 5IQAA 3LW0A 5FBNC 1XH8A 3QQJA 4IVBA 4WA9A 4CZUA 4EOPA 5CZIA 2DQ7X 2O63A 4FKOA 5E8XA 3H30A 2BRHA 4W4VA 1QCFA 5HX6A 5CAVA 3MGYA 3FLSA 2VWWA 3EH9A 2QNJA 4FVPA 1CMKE 3LFCA 2GFSA 3QX2A 4ZIMA 4EOLA 2Y4PA 2X4ZA 4D2VA 1CKJA 2YACA 4BCQA 4FRFA 3OT3A 3BX5A 4LV8A 4F0IA 4GW8A 2JGZA 3DBFA 5FRIA 2B9IA 3PUFC 3G9NA 3IK3A 3MJ2A 4R1VA 3C5IA 3DKFA 4Z7GA 4IQ6A 2RFDA 2P0CA 4DG2E 4XH6A 1BI8A 3BU6A 3IOPA 3P5KA 4YPDA 4EYJA 3OD6X 4I22A 3GENA 4UY9A 5CSPA 4NKAA 2PE2A 2UZEA 1NW1A 1IR3A 2QVSE 4ANOA 3WZUA 4EBVA 4NIFA 2PVNA 3WE4A 4BC6A 2UZWE 2GPHA 2VO0A 2WPAA 1BL7A 1R3CA 2PU8A 4L53A 4NM0A 4KIPA 4XLVA 3HUBA 4IZ5A 3UG1A 4PPCA 1YHWA 4FZAB 4KSQA 5JN2A 4AXCA 3I0QA 5HBEA 4AA5A 2O5KA 1OM1A 2R3JA 4DGNA 3GBZA 4E4LA 2F49A 4YO6A 4EC9A 4CFMA 3DDQA 4FIHA 2VTLA 4Y46A 4Z9LA 3ZXTA 4H1MA 4J1RA 4JNWA 4EK5A 2YLEA 3UQFA 3F3TA 4DE4A 1H25A 4XLIA 3FJQE 4YNOA 2RFNA 3QTIA 4GSBA 1OITA 3UO5A 2GNLA 3CTHA 4OTIA 5FBOA 2XKDA 3QWKA 3CTQA 3ZH8A 4RA5A 3RPYA 2X6EA 2X8EA 3RNYA 4CFNA 3DNDA 3NAYA 4FOCA 3IDBA 4O0RA 5J9LA 4FK6A 2WGJA 4FKIA 3M2WA 3ZBXA 1S9IA 5LMAA 3NR9A 1EH4A 4F6WA 2R9SA 4EKKA 2IVTA 3MA6A 2WOUA 4DT8A 4AP7A 3R28A 4I0TA 3KKVA 2BMCA 1YXVA 2C0TA 2QR8A 5KHWA 4PWNA 4O83A 3ORXA 3KRWA 4YJUA 3Q52A 1UU3A 1ZZ2A 3VUTA 1MRYA 1NVQA 5IH6A 4RX5A 4PPBA 4LL5A 1G8AA 5KHXA 4M69B 2QURA 3C13A 5AP4A 3LQ5A 3L8SA 3R1NA 1PMVA 3RGFA 2XB7A 4APPA 4DDIA 4ZLZA 4UXQA 3AOXA 3A61A 4IBMA 4ZTLA 5F94A 3W10A 3C4CA 4IWPA 3HMMA 4BCMA 3LMIA 3ORNA 4LM5A 4FSMA 2BALA 4P5QA 5HLPA 3EQIA 2YM4A 5I9ZA 3DK7A 4FV0A 1Q3WA 2A2AA 5LCKA 3RPOA 5HIEA 3CY2A 4GT4A 5IUGA 3L9PA 3AKJA 3H9FA 2YITA 3IG7A 1YI3A 4YNEA 5GJDA 3F5UA 2ETRA 4N70A 3LFSA 4DG0E 2VTNA 5EHYA 5KBQA 4D5KA 2V55A 2ZOQA 2PVLA 2UVYA 3DAJA 3DJ5A 3W2OA 4C2VA 2JAVA 4AXDA 5D7AA 1ZYDA 1Q3DA 4K9YA 4NCTA 4PNIA 3EQPA 4L3JA 4BFMA 2XNNA 1BYGA 1BKXA 1JSVA 2HWPA 3HRBA 3R21A 2J7TA 4E7WA 3OBGA 4ORKA 3QLGA 3MA3A 4ERKA 2VTAA 4CGAA 4C38A 4CYIA 4YLJA 1LR4A 1X8BA 3P78A 4AZEA 2UW3A 4L67A 4R78A 1M7QA 4JAIA 3KK8A 4XG9A 5FP5A 4C0TA 4DC2A 3E7VA 2NPQA 4BCGA 3PRIA 3RVGA 3QTUA 5E8TA 5KKRB 4I6FA 3QTXA 5M44A 5HO7A 4EH5A 5A9UA 2GNFA 4TNBA 1W84A 3RNIA 4C3PA 4DBNA 1WBTA 3H3CA 1XHAA 3VNTA 4RSSA 4XEYA 3ULZA 1PY5A 3D7ZA 5E8YA 4MVFA 4I5MA 2VNYA 2W1FA 2WFYA 4FKWA 3MPAA 1DS5A 3F82A 2I0VA 3NNUA 1UNHA 2VTQA 4AOIA 3CKWA 3O7LB 3A7FA 2OU7A 1AGWA 2OZAA 3UGCA 3F2RA 1YXUA 2X7OA 5LARA 4OTGA 4D2SA 4BDCA 2XK4A 5E8UA 2R3PA 4Y95A 3R7YA 3FI3A 1PXIA 2XK8A 3E3PA 2E9OA 3QUPA 4RZWA 2E9PA 3NUUA 2LAVA 3C0IA 4NWMA 4RX7A 2E9UA 5HG8A 3V51A 2WTCA 4O7NA 3WZJA 4FT3A 4A06A 3FAAA 4HVSA 5DGZA 1KUTA 2A1AB 3V6RA 2FSMX 5DT3A 2BIYA 3UZRA 4DFUA 1OIQA 3DU8A 4ZTRA 4BF2A 4Z7HA 4Z3VA 4QD6A 4OBQA 2OGVA 4PDSA 3EFJA 4X6RA 2W1IA 4D58A 4DEGA 4F9AA 3HVCA 4YO4A 1PRYA 3OS3A 4O2ZA 2XMYA 3A7GA 3PVGA 4O6EA 4QTCA 2IZRA 2JIVA 3TACA 3T8OA 5FM2A 4C36A 1ZAOA 4B4LA 2WTKB 2OBJA 3RAKA 4EH9A 3HRFA 1H28A 2PSQA 4CG9A 3ZLYA 3DS6A 4EH6A 4IDVA 4KIKB 3KK9A 4RIXA 3EQBA 4MNEA 3U4UA 2YIYA 3LFAA 1TVOA 4MYGA 3ZYAA 4IZ7A 4LYNA 5AP0A 5J1WA 4EK4A 2YIXA 4V04A 4YBKA 4EBWA 3A62A 3R8MA 2VWVA 1T46A 3I79A 4FV8A 5IEYA 1WBOA 5CF5A 3MY5A 1PJKA 2HK5A 4L42A 2W96B 3DBDA 4QTBA 3LCTA 2J6MA 3IW8A 3EYHA 3RINA 3QLFA 3SX9A 4IC7A 5A54A 4O1PA 5AP6A 3Q60A 4I21A 3UYSA 3ZEPA 4E8AA 3KXNA 3UMWA 4BDIA 4CD0A 2YEXA 1J7LA 3ZDUA 2R0UA 5AJQA 2WTJA 4ZS4A 3LM0A 1O6KA 5KE0A 3VS1A 4OBPA 2RKUA 5AM7A 4CKJA 3UNKA 3ET7A 3QALE 3DPKA 2R4BA 3PLSA 4QP2A 2WELA 4LMUA 3HECA 4YZCA 3R7IA 4BI0A 3O8PA 5T68A 3E8EA 4NL0A 4YHFA 4FIFA 4GV1A 5IPJA 5DEWA 4J8NA 3RZBA 3FZPA 4ZSEA 3V3VA 1Y8YA 1XMLA 2H9VA 3BLAA 3FYKX 3SV0A 2WTWA 1Q99A 3NW5A 4OR5A 3SC1A 1OL6A 4QQJA 4C4EA 3TKIA 4YZBA 1XJDA 3UPXA 4E4XA 5JKGA 3EIDA 4BCJA 3EFWA 1P14A 2V7AA 5KO1A 1BUHA 5FD2A 2PUNA 2XK3A 3JXWA 5CNOA 1VYWA 3QWJA 3QYWA 3WYXA 4ZLYA 4UZHA 3U8WA 2PVYA 2YABA 2EXMA 1GIJA 1M2RA 3R9NA 3KQ7A 4O0SA 3ZC6A 4F08A 3ZU7A 4IX4A 4GK3A 4N57A 4F9WA 2QOBA 3WF6A 4YU2A 3TV4A 3CGFA 4PL5A 4PNKA 3NW6A 2GS6A 2HXLA 5M55A 4EWHA 2YWVA 3JPVA 4FTJA 5BMMA 1WBNA 5M06A 4U44A 1H4LA 4D1SA 5IEVA 4QOXA 4DEIA 2YZAA 2P33A 3OOGA 4BRXA 2WU7A 4EQUA 3HAMA 3U9CA 2XAMA 4AFEA 3HUCA 3QGYA 1CKPA 3V5WA 3ZO3A 4ZZMA 5JFWA 4MX9A 4DH3A 2RL5A 2W0JA 5E4HA 1SMHA 2W06A 2UZNA 2XRUA 4G5JA 5CF4A 5K5XA 1Q5KA 3O50A 3LQ3A 3NGAA 3TV7A 3FL5A 4QPAA 3OOMA 3D5XA 4O7WA 4ITHA 4LI5A 2X9FA 2QO7A 4NTSA 3O71A 4GFOA 4XG3A 4F1TA 3TYKA 1QPJA 3A2CA 4O7RA 1XBAA 4FKPA 4WKQA 3AD5A 4QO9A 3F3UA 3QYZA 1OUYA 3LKMA 2ZV7A 5DNRA 3S4QA 4MF0A 2DWBA 1TQPA 4UV0A 3UO6A 5BYYA 2HZ4A 3AMAA 4IZYA 4GCJA 2WTDA 1A48A 1FBNA 1Q24A 2X4FA 3PA5A 5LCJA 2WKMA 5CEQA 4E20A 4A4OA 2XM8A 3UOJA 5IA2A 2C68A 3FY2A 2XANA 1YKRA 3K5VA 3ZUTA 4DTAA 4U45A 4RWLA 5ANDA 4AOJA 1R39A 5H8GA 4LGDA 3EZVA 4USDA 2ZM1A 4J7BA 4QP1A 3ZSGA 2XNEA 3QHWA 3NYVA 1OL2A 4RIYB 2IW8A 3R7UA 5HO8A 1YHSA 4I3ZA 2FGIA 2XKEA 1ND4A 4YR8A 3W2SA 3R22A 4DGLC 5EI6A 1H08A 2ZB0A 2OSCA 4GK4A 1F5QA 5CU0A 4M12A 2F7EE 3KRRA 3UOKA 3KIOC 2H8HA 3CP9A 2ACXA 4XRLA 4ZSJA 4JQ7A 3VF8A 1SYKA 1MRVA 5CU4A 3W0MA 1BLXA 3OWLA 2VRXA 5I9UA 3UOHA 4TZRA 5DT0A 4DH1A 4FX3A 3AD6A 3IQ7A 4TPTA 4XRJA 4F70A 4KNBA 5DLSA 3EQHA 5ETIA 3LVPA 4AAAA 5L2SA 3FY0A 4I20A 2WO6A 3OCBA 3QKKA 4F09A 2V62A 2VX0A 4RGJA 4H3BA 5AUXA 4YUQA 3M42A 2VGPA 3EJ1A 5FXRA 3SA0A 5JFXA 2HCKA 5TE0A 4O84A 2R3IA 2Q0BA 4L6QA 5H8EA 3GCQA 2CLQA 4ASZA 4C61A 4W9WA 1GNGA 3BLHA 3MFTA 1XO2B 1SVHA 3Q9ZA 4W9XA 4BTFA 4DFYA 5E8WA 5H8BA 3ULIA 3FWQA 2WZJA 3A99A 2OF2A 2WTIA 2VWYA 3GB2A 4ZTHA 4TWOA 4UYAA 4M8TA 1G8KA 5C8MA 5EQPA 3MV5A 5FEEA 5JEBA 3QUDA 4F6UA 5CXZA 5GZAA 3EL8A 2XS0A 3QRKA 4AA4A 4DN5A 2VWUA 4L8MA 2AYPA 3NFGB 2GQGA 4O4CA 3QRJA 4JDJA 4JVGA 3ZFYA 4BIDA 3E64A 3NUNA 5IMXA 1BX6A 5DIAA 5A4LA 2FYSA 4CFWA 2YCRA 1OPKA 3UDZA 3OY3A 5EHLA 3VQUA 2J50A 4FV3A 2XEYA 5AAFA 3HV5A 4C35A 2JDTA 3OMVA 1H1SA 2B53A 3ZOSA 3QKLA 3QXPA 4FSWA 4XX9A 4YMJA 1ZY5A 2F2CB 2WTVA 5A14A 3EHAA 3PPJA 4TXCA 4DHFA 4FZFB 5DI1A 1VEBA 3LOKA 3NIEA 4RIWB 4NH1A 4CTCA 1FQ1B 2CJMA 2BTRA 4FTLA 3AC8A 5EKNA 4P2KA 4FKQA 1ZZLA 3QTSA 5AR5A 3UDTA 5C01A 4D4SA 2JAMA 3R0TA 2VAGA 3HP2A 5EYMA 2WMWA 4IIRA 5BVKA 5AA8A 5ETAA 4AN2A 4B8LA 3BIZA 3HMIA 3ZC5A 3QL8A 4LGHA 4M69A 4WHZA 2WQBA 4IWDA 3I7CA 4FKSA 5HOAA 2IG7A 3W0RA 3PE2A 3R9RA 4CT2A 4XG8A 1AQ1A 3V6SA 1PXNA 2EB3A 3CCNA 4HZRA 3VS7A 2OZAB 4ANNA 5HBJA 4C4HA 2WHBA 3GC7A 2WQOA 5IQHA 5CI6A 3PDTA 3ML1A 4MCVA 4EEVA 2WIHA 3MESA 4IAZA 3SOCA 3DQWA 4DFBA 3DBQA 3NNWA 3QA0A 2I6LA 5H2UA 3T3VA 3MN3A 1TKIA 3T9IA 4WUAA 4BTMA 3E88A 3GU8A 5HE3A 5LVMA 2JDVA 2QOQA 1OVEA 5EYKA 4E5WA 3PWDA 4IAKA 2CCHA 4C62A 4HYHA 4U40A 3UOLA 4LV7A 3I4BA 1TQIA 1W2CA 4QMTA 4FV5A 3R8PA 3D2KA 1OGYA 2XKFA 2A4LA 3AD4A 3QCYA 5ITAA 5M4FA 5AWMA 3UVQA 3GOPA 1UWHA 3ALOA 4B7TA 5CAQA 4YHTA 5CEOA 3ZLWA 3PIZA 2I7QA 5ICPA 3BE2A 2BRGA 4GMYA 2WMQA 2WMXA 4N0SA 2BDJA 2IF8A 3EFLA 3QQFA 2XEZA 1QMZA 4JOAA 3OTUA 4R3CA 3BZ3A 4Q2AA 4RLKA 3BQCA 2A0CX 2BZJA 1R0PA 5CNNA 1UU8A 4I93A 1A06A 3P0MA 3FZTA 2UZDA 4WNMA 4IX6A 1VYZA 5TT7A 2ERKA 4RFZA 4ZTNA 1JPAA 3R8UA 1ZY4A 3CJGA 4RG0A 3COMA 4MTAA 1Y8GA 3QU0A 5TKDA 4U81A 4JX7A 4ASDA 2R3RA 3LE6A 3C50A 1ZOHA 1KE8A 4EZ3A 4JQ8A