3TN8A

Cdk9/cyclin t in complex with can508
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
318
structure length
304
Chain Sequence
VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Cyclin-dependent kinase 9
publication title The CDK9 C-helix Exhibits Conformational Plasticity That May Explain the Selectivity of CAN508.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 304
sequence length 318
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tn8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tn8A01
2WMVA 4FTIA 4CFUA 4DC2A 3OXTA 5K4IA 4FSUA 4FKIA 4Y83A 3VUDA 3AMAA 1Q62A 4BDCA 5JGBA 3O23A 4YSMA 5BVFA 3TTJA 4O86A 2Z7QA 4MNFA 3LXLA 2YZAA 3IDBA 3OWKA 3OCSA 4O84A 3RNYA 3PRIA 4FZDB 2YABA 3U8WA 3R7IA 2VN9A 3BYVA 3FYJX 1WBOA 4JI9A 4YZNA 3VJNA 1GAGA 4K1BA 3NIEA 4ZZOA 4DT9A 4LRKA 4TWOA 2UVXA 2VWWA 5A6OA 2FH9A 4G2FA 1U5QA 2EUFB 3LHJA 5H3QA 5TR6A 4CVAA 5CU4A 1OBGA 3FI3A 2X0GA 2VTPA 3C4FA 3FDNA 4FIGA 3TKUA 2UZLA 3KVWA 4XCUA 5TT7A 2C0IA 2IVUA 2CGWA 4OUCA 4UYAA 5HIEA 4DBNA 3FXWA 1ND4A 3Q2JA 3O8TA 3Q9XA 3FUPA 4JIKA 4YLJA 2G2IA 2RG6A 3ITZA 4ANSA 2GS7A 1R0EA 3FZRA 4RIYB 4G16A 4EK5A 3PXYA 3EMGA 5AX3A 2UW5A 3NNXA 1WMKA 3NUPA 4CYJA 3TNPC 2ITNA 4C38A 3WI6A 4XG6A 5M44A 4BWXA 4EYJA 3C4EA 4APCA 3ZO3A 4X21A 2VWIA 4RIXA 4LRJA 3E3PA 4JG7A 2QOQA 3RWPA 1U4DA 1Y91A 4H05A 5IISA 4YBJA 3UZPA 2P0CA 3POZA 3O51A 4DEAA 3DPKA 4HZRA 1PJKA 2JKOA 2KTYA 4Y95A 1ZOGA 4EK6A 4ZLYA 4EQMA 3BKBA 2PVLA 3HMOA 3MTFA 4YP8A 4C2WA 3QD4A 4KS7A 5M07A 5FXQA 3SGCA 3Q52A 2W9ZB 4G5JA 4Q9ZA 2JDSA 3U55A 3EN5A 4ZTLA 4BGHA 1OECA 4AXAA 3KA0A 2B53A 3A7HA 5EHYA 1MRVA 5JKGA 4ZTSA 4GCJA 4WD5A 3RK5A 4FSNA 3NUUA 5J9YA 3MDYA 3KQ7A 1HCKA 5ETCA 4O7VA 4RJ5A 2WTIA 2R3FA 4ZS4A 2W05A 4ZTHA 1PXOA 2P55A 1YOMA 3ZU7A 4NW6A 2OIDA 3RMFA 4R7IA 3LMIA 3CR0A 4GKHA 3DK7A 2X9FA 4Y8DA 4RVKA 1YI4A 3DY7A 2YM6A 4A9RA 1W82A 5AA8A 4GEOA 3W2CA 2VO6A 1CKIA 2FVDA 3TNIA 3MVMA 4ALVA 2CDZA 2J5FA 5AAFA 2PK9A 4D9TA 5BVWA 3G33A 1OPJA 2BFYA 2YM3A 3MJ2A 3R9HA 4BC6A 2RFDA 3GB2A 3UTOA 3B8QA 5ETAA 5CF8A 2Z7SA 4LV5A 4KIKA 2XS0A 4I5PA 3PXQA 3QXOA 3WZEA 4FSMA 5HORA 2ETRA 1PHKA 1ZOHA 4O21A 4UMTA 1R3CA 4S32A 4YUQA 3UMWA 4USEA 2CKOA 2IG7A 5FDXA 5EQPA 1YI6A 3FMMA 3FY2A 4KS8A 3UIUA 2Y0AA 1WAKA 3ORPA 1YXVA 4BF2A 3FPMA 5KMOA 5I9UA 4JIAA 4HGLA 4D2PA 4ANMA 3R1QA 2UZBA 5EK7A 4XNEA 1HCLA 4BRXA 2EVAA 5F9EA 1XH8A 5HVJA 5HKMA 2WPAA 5HLWA 4EBWA 4J71A 5C03A 1ZZLA 3D5WA 5CEQA 1J1CA 2NO3A 2EXEA 4XRJA 1J7UA 4CCUA 4YURA 4HVDA 4GFGA 3G6HA 4FTOA 2XZSA 2IW6A 2IJMA 4W9WA 1KUTA 5JFVA 2GHMA 4PDPA 5DBXA 3RKBA 3ZZWA 4EH7A 3COMA 1GIHA 2R3MA 3IW6A 3QHRA 4G9CA 4H39A 2WHBA 4FIEA 5HCYA 3ROYA 4BDEA 4AQCA 4BYIA 4JG8A 3HRBA 3QZFA 5E1EA 1PY5A 3OBGA 4EQUA 1YDSE 4CV8A 2GNHA 3WZDA 3KCFA 4ANQA 3GCSA 4W8EA 3W16A 4EHZA 1XBBA 1YHSA 2WMAA 5FBNC 3QKKA 4FKOA 3EIDA 3BE9A 1UNLA 4M15A 3I1AA 4YZMA 3G15A 4EI4A 4I0SA 3ORKA 4RJ4A 2VGOA 5A4QA 5KMIA 4GYGA 4IZAA 1UNHA 1S9JA 3MFTA 3A8WA 4QMWA 4U80A 2BAJA 3EQIA 1UVRA 3WBLA 2B54A 3EZVA 2V7AA 4M3QA 3KEXA 4FX3A 4EOMA 5AEPA 1JSUA 3MH2A 3ZOSA 4EOQA 2C3LA 4H36A 2C0OA 4ZSEA 3KB7A 3O7LD 3MPMA 4H1JA 2DWBA 2FO0A 1FQ1B 1G3NA 3UDBA 1TKIA 4EORA 2XIKA 3FL5A 3G0FA 3QZHA 3ZUVA 4ZJIA 3FMNA 3TV6A 5E8ZA 1O6YA 5JN2A 1URCA 3CY3A 2QOFA 1JKKA 3MESA 5CSWA 4B8LA 4ZXTA 4O2PA 4KUJA 4QTCA 2OKRA 3DXPA 3WZJA 3EQHA 3I79A 3BYSA 3D2KA 2YIXA 3GENA 1BI8A 1M17A 1SNUA 2I1MA 4UEUA 3RPVA 1XH4A 3GC0A 4XG4A 5HNGA 3TZ8A 3D7TB 5D41A 5FXSA 1RJBA 2GNGA 2GTMA 4RJ6A 2RKUA 3LFBA 3OROA 4PTGA 4XG2A 5FM3A 3EL8A 3HMMA 1O6KA 3PIYA 5KUPA 2PUNA 2OXYA 1WVWA 3NYVA 3RPYA 3PG1A 4L53A 4E26A 5HNIX 4IFGA 4FE2A 2C68A 4O83A 2ZOQA 3HV5A 2R3GA 3HAVA 3QQHA 2FSMX 4ZZMA 4CSVA 2C3IB 4IJ9A 4FV5A 4IB3A 1PYXA 4CT1A 4D5HA 3MY1A 1YXSA 4KSPA 2F9GA 2WQEA 3MY0A 3FBVA 4UY9A 4ALUA 1U59A 4JOAA 5DVRA 4X3FB 3R8UA 3S3IA 3U51A 4G6OA 5HTIA 4PDYA 2BKZA 2QOCA 3OCGA 4R3RA 2OF4A 5M4FA 3ZEPA 3D2IA 4O7NA 3LW0A 4AFEA 3CJFA 3F7WA 3GI3A 4QMVA 2BMCA 3AG9A 3COKA 3FKLA 5AUVA 2WEIA 5D7AA 3MH1A 2X2KA 3KXMA 4PF4A 1NVRA 2UV2A 1STCE 4M97A 4QPMA 5DRBA 2ITZA 3L8PA 2R3RA 1J1BA 1OVEA 3WF6A 4Y5QA 2VD5A 3NUXA 4AAAA 3Q5ZA 3AC1A 4IIRA 4IANA 4XX9A 4FSRA 5KMLA 1H00A 3SA0A 4Z9LA 1BI7A 3MW1A 5J1VA 4N0SA 2P33A 4IZYA 3BU6A 3W33A 5KNJA 3ORNA 4G6LA 1WFCA 3RALA 2FSTX 3ZUTA 5D12A 4F08A 2O0UA 1QPCA 4EK8A 4G34A 5JGAA 3V6SA 3GP0A 2BRHA 2ONLC 3HLLA 4RSSA 2UZNA 5KMKA 3NUYA 1ZYDA 4O0SA 4PPBA 1PRYA 2QO2A 3HAMA 4NK9A 4U43A 4V0GA 5JFWA 4D28A 5AP7A 3EN9A 2QG5A 1H1SA 2HOGA 2OJIA 1M7NA 3VS4A 5B2LA 2I40A 4M0ZA 3VW6A 5M56A 3KMWA 5A9UA 4DEHA 4FKSA 4NT4A 3VHKA 5C1QB 4F4PA 3AD5A 3TZMA 3EQPA 4BTFA 2BCJA 3OWPA 2ITPA 2R7BA 4HGEA 4U44A 4AZTA 4E73A 4FNZA 3PYYA 4WBBB 4GK3A 4CQGA 5AV2A 2X2MA 4NM7A 2O65A 3JY9A 3OUKA 1IA8A 5CX9A 3UQFA 2NRUA 4N6YA 4EZ3A 2RL5A 2X7FA 3NNUA 4KBCA 4CFXA 4EWHA 2E2BA 3NUNA 5BNJA 2PVKA 3R2YA 1NA7A 2YDJA 2YLFA 1AD5A 3QX2A 4YPSA 4CFWA 2BRBA 2CGXA 3F66A 2P2HA 4TWCA 3QUDA 4UMUA 3HP5A 2JKKA 4DEEA 4DGNA 5BVEA 2YA9A 4OBPA 3DCVA 4TWPA 4FYNA 3QQFA 3FKNA 2UW0A 3FLNC 5KHXA 4EZ7A 3RM7A 5AV1A 1Q4LA 2R3LA 4F9YA 3AD4A 2W9FB 5GNKA 2UZDA 3WE4A 3R2BA 4E93A 1ZYSA 1ZARA 4IAIA 5A4CA 3ALNA 3SQQA 1TQMA 3ODYX 2UW6A 3KN6A 4FK3A 5CYIA 2JKMA 3V01A 3LCDA 3HA8A 3NAXA 5L8JA 4MBLA 4OT6A 3RP9A 3EYGA 5FDPA 1REJA 1YKRA 2B9JA 3SG8A 2C69A 4XG9A 4ZZNA 3SOAA 4C7TA 3UIMA 1RW8A 4CKRA 1K2PA 5LMKC 4U81A 5B0XA 3ZFMA 5AP0A 2F7EE 2QURA 2ZM4A 4OTWA 3PG3A 1U54B 1E9HA 4PTCA 5DGZA 4D2SA 3A8XA 4YJVA 4GIHA 4J53A 3IS5A 4EOLA 3HV6A 5IEXA 2G2HA 2W5BA 2VUWA 3CCNA 3VUHA 4XV1A 4Z7HA 2UZWE 5HLNA 4V05A 3QTIA 4MEDA 5CZIA 3QQGA 3PZEA 4DA5A 2R0UA 3C1XA 4RJ7A 3P78A 2X8IA 4JDIA 4EONA 5J8IA 3ZSGA 4GUBA 5CF6A 1E1VA 3N4TA 4R7BA 4EBVA 4BCMA 3EQRA 4FL2A 5AADA 3QXPA 3UQCA 3BIZA 3C5IA 4KNBA 4I4EA 4B7TA 1XH6A 4TT7A 3PJ1A 1UU3A 1FGKA 4WNPA 2XUUA 3DJ6A 2XMYA 3R7OA 3K54A 4ITJA 4FG8A 5CU6A 4DFZE 2R7IA 3QZGA 3L9PA 2OU7A 2WKMA 2YJSA 3FKOA 3HDNA 3LKMA 4JDHA 4HPUE 3ORTA 2DUVA 3R8ZA 3I7BA 4ZY6A 4C37A 1XWSA 5HEZA 5I0BA 5DYJA 4IDTA 4IVCA 3DA6A 1CDKA 4HYSA 4P5QA 4O7ZA 5F20A 5FEDA 5M4UA 3GBZA 4KWPA 3PXKA 2Y6OA 1EH4A 5DR2A 3UVRA 3OC1A 5TKDA 3N51A 2FA2A 4JRNA 5CT0A 5CAVA 3FL4A 3BQCA 4HVHA 3PPZA 3VRYA 4NKAA 1ATPE 3NYOA 5IMXA 5IPJA 2ZAZA 4OR5A 3BI6A 1KE5A 1WBWA 4AT4A 1O9UA 2JAVA 3CE3A 4MHAA 3NDMA 3R7UA 3VBWA 4A06A 3CQUA 4CGAA 2WXVA 3VW8A 3FXZA 4C58A 4IZ5A 2HY81 3DJ5A 3U54A 2VNYA 3S4QA 4DF3A 3NW6A 2B52A 1OL2A 4QQCA 4TYHA 2SRCA 3WF9A 3MI9A 2BALA 5DT4A 5GJDA 4WIHA 5DHJA 4I6BA 1TQPA 3CQWA 3FHRA 3QTWA 1OL7A 1OKZA 4R6VA 4IX4A 3E92A 3PXRA 1KE6A 4R3PA 4QQJA 2PVJA 4RVLA 4YJUA 3LFQA 5AP2A 3RAWA 4LG4A 4ERWA 4PDSA 5GJGA 3UP7A 1W84A 2XYUA 3VS3A 5AUXA 4BBMA 1FOTA 2XKCA 2PE2A 4IC8A 4DH3A 3A61A 3V51A 5L2IA 4D4RA 4GT3A 2PUUA 5C8MA 3LFFA 5FP5A 3G90X 3PSBA 3NVMB 3UMXA 2QOLA 3AXWA 4DTBA 1Z5MA 1OL1A 4L9IA 4NWMA 3TV7A 1OKYA 5T3QA 2BAQA 3MB6A 4AACA 5L8KA 1WBPA 1UV5A 2PMIA 3ANQA 4WNKA 4O82A 4FV0A 4QOXA 3D4QA 4TYIA 1ZXEA 3LPBA 4APPA 5J7HA 3FMLA 5DFPA 4XMOA 2XIXA 4AT3A 4D4YA 5HTCA 2BROA 3W1FA 2OI4X 4BY9E 4G17A 3I4BA 4TKSA 4FIJA 4FVPA 5AV3A 4AE6A 2UW9A 3ROCA 4K11A 5M06A 4ZMEA 4LOQA 2JKQA 4J97A 1MRUA 2VTSA 3MN3A 5LCJA 1OMWA 4RWLA 2RSVA 2F4JA 3QD2B 4EWQA 4FEUA 4FK6A 4FL3A 5ANGA 3VBQA 5D9HA 2WAJA 3TNQB 2QOIA 1OIYA 2OH0E 5KBRA 4YSJA 2VZ6A 4PL4A 2LGCA 3NUAA 3D94A 4U45A 4BI1A 3PA5A 4RA5A 4MD7E 2QKWB 5E8YA 1WZYA 3D83A 2PHKA 4CRLA 2JC6A 4D4VA 1Q61A 4YU2A 4XV9A 4H3BA 4P7EA 2PZ5A 5HE0A 4EYMA 2WTJA 5CU3A 4DFXE 3O8PA 4J7BA 3UPXA 2HW6A 4UZDA 5IG1A 4M69B 4CFNA 2ESMA 4RFMA 5DE2A 2JBOA 4AGUA 4QPSA 5HOAA 5E7RA 1V1KA 4GV1A 3TNHA 2C3KA 3P08A 4FA2A 3IGOA 3WF8A 5CXHA 3RBWA 1WVXA 3ORXA 4O0UA 4QP7A 4J95A 3QGYA 3E3BX 5F1ZA 3DXNA 3LFAA 5GJFA 4BDDA 5FEQA 4DGLC 3C4XA 3HGKA 4IX5A 4IAAA 3W8QA 2W1GA 3DBDA 3VJOA 1B38A 1Y8YA 3WE8A 4TWNA 4IWQA 4JDKA 5GINE 4WG3A 3TDVA 2IWIA 1M2QA 3O2MA 5K5NA 1Y8GA 2FYSA 3UC3A 5EM6A 3KVXA 3M42A 3RHKA 4QD6A 4XG3A 5HG7A 4PUZA 4R1YA 5J5SA 4XHKB 5AWMA 4UWCA 4G3CA 1A06A 2X4FA 5JQ8A 4I5HA 2VTMA 2BFXA 2QU5A 3DB6A 3IOKA 4FI1A 5TO8A 4IVBA 3QTXA 3T9IA 2ZDTA 2HZNA 4XG8A 4CQEA 4MNEA 2XK4A 3PRFA 1UU9A 3UJGA 3SG9A 2HZ4A 4A4XA 2OFUA 3QRTA 4HNIA 3IOPA 3ZRMA 4I1ZA 3ZO1A 4AT5A 3QRJA 3HMPA 4EOOA 3MY5A 3O96A 3C0IA 3OT8A 5J9ZA 3LQ8A 4O0VA 5BQ0A 2PSQA 3A60A 3WIGA 3SD0A 4QP9A 3NCZA 4E6CA 3T3UA 1IEPA 1ZYJA 4IWDA 3WARA 3PVWA 4JAJA 5IU2A 3GOKA 3KFAA 3NZ0A 5EDPA 4O0YA 4HCUA 3FC1X 1P14A 4PV0A 4HCVA 3Q53A 3R7YA 2CJMA 4YC6A 5DA3A 2HK5A 4LQMA 5A4EA 1L3RE 5KO1A 4N70A 2YISA 3Q4TA 3DZOA 2HW7A 3SW7A 4E5BA 1FVRA 4O91A 1M14A 4FV2A 3DDPA 5C4KA 4NCTC 2XJ0A 4IX3A 3FI4A 4RBLA 1ERKA 3LFDA 4B6LA 3LFEA 4DCEA 2WZJA 2QO7A 3D5XA 5BMMA 1ZLTA 5HBEA 3R83A 4AN9A 3H9RA 4Q5EA 4O1OA 4FEWA 4GUEA 5BVKA 1OIQA 3PJCA 3R1NA 1ZAOA 2YACA 2O8YA 3DK3A 4X2FA 3ZSHA 2JDTA 4JR3A 4NIFB 3QBNA 5HG5A 1XH5A 3F5UA 4NM5A 5JZNA 3WZUA 1P5EA 4EHVA 5CAOA 3AC4A 4IWOA 1YXXA 4ARKA 2Y4IC 2XNBA 2PL0A 4MH7A 4HW7A 4JT3A 3H3CA 4ACCA 3ZLXA 5DMZA 3B8RA 4ZK5A 4ZS0A 4BHZA 3OY1A 4FKVA 4YR8A 2VV9A 1CKJA 4A9UA 4RPVA 5GZ8A 5D7VA 1I09A 3ORMA 5CAQA 4L45A 3U6JA 4E3CA 3S95A 3JPVA 5CQUA 3ATTA 4EOJA 2QD9A 2C5OA 3CC6A 3I60A 5HVYA 2AC3A 2QOKA 4JNWA 3R1YA 4HYHA 3RAHA 3TT0A 5BYLA 3NMUF 2GDOA 3BCEA 5C9CA 4F9WA 3ZM4A 2I0VA 3CQEA 2JGZA 3ZEWA 2W99B 3GCPA 4KIPA 3W18A 4KAOA 4GJ3A 2UZOA 2C4GA 3G51A 3MVJA 4X3FC 5EKNA 2IZRA 4S33A 2CLXA 1PMNA 3ORIA 1JWHA 2C1BA 3WILA 2VTQA 4GVAA 2CKQA 3TM0A 4JRVA 3AC5A 2EXCX 2JD5A 4JLCA 3BLQA 4IMYA 4TYEA 4FZFB 4QO9A 3ZYAA 3KF4A 2QU6A 4BBFA 4PNKA 2W1HA 3BLHA 1UKIA 4IAYA 3QCXA 4U42A 1OI9A 3F3VA 2YCSA 5EH0A 1IR3A 2IVTA 3E5AA 3HMNA 3DFAA 4GK2A 4BZNA 5EDRA 4E7WA 4P2KA 5K9IA 1LUFA 1PKGA 3CTQA 5AUZA 4ENYA 2B0QA 5IQDA 3ZZEA 2QOOA 4BDBA 4F9BA 3NVKI 4EJNA 4PDOA 4AOJA 5EYMA 1OGUA 4ACGA 3CEKA 4L00A 2PTKA 2FB8A 3PA4A 3CGFA 2UVYA 3CIKA 5BVDA 4E6QA 2X6DA 4YJOA 4F1TA 2JDRA 1AQ1A 2Z7LA 1JBPE 4ENXA 3IK3A 4HCTA 3F61A 2Z2WA 2ITOA 1FVVA 1UNGA 5AR8A 1MRYA 2YN8A 3BGZA 3ZLYA 4U41A 1UU8A 3GCUA 4BCNA 4DEIA 2G2FA 3IKAA 2QR7A 4QYHA 5GHVA 1Z9XA 3R6XA 1H28A 4MQ1A 2JDVA 3IECA 4MAOA 4PQNA 4W9XA 5HLPA 1PXKA 3CD8A 4YJSA 2XNMA 5AM7A 3UO6A 4NL0A 5EYCA 3QQJA 4IACA 3FZPA 3KL8A 4TTHB 3K3JA 2BDFA 5E8SA 4CFVA 3Q3BA 4WA9A 3GFEA 5LQFA 2PUPA 4PL5A 3F3WA 4UXQA 3S2PA 2WQNA 1Q97A 2V7OA 3CTJA 3KULB 3A99A 3A4PA 3F69A 4R7HA 1IRKA 4I23A 3SRVB 3BYUA 4D58A 3EWHA 2VWVA 3R8PA 3DTCA 1E1XA 4H1MA 2Y6MA 1IG1A 2W17A 3ZUUA 4MD8E 4FTLA 3F3ZA 4GU6A 2IW9A 5CANA 2GPHA 3K2LA 1PXNA 4X6QC 5HG8A 5HO8A 3F88A 3HA6A 4FV3A 1JSVA 2J5EA 2E9NA 2R3HA 3COIA 3MBLA 5CVHA 2WIPA 4U3YA 5JH6A 4C8BA 4QTDA 5M57A 4DLIA 2PVYA 2I0YA 3E8NA 4LOPA 4A9TA 4RIWA 1LPUA 4FICA 3R9RA 2VAGA 3E7VA 2GFCA 2WEVA 5IQEA 2EB2A 3LMHA 4EK3A 4YLLA 3ZXTA 5LVLA 3CKWA 3IW5A 2H8HA 4RWKA 4BDIA 4F7LA 3PY3A 4CXAA 2ZV2A 3E7OA 4WHZA 5L2SA 2CNQA 3PP0A 4EH8A 2XEZA 4TL0A 3O71A 4HYUA 3ZMMA 5K3YA 3EZRA 4D9UA 4MYGA 3MVLA 2JDOA 1Z57A 4LRMA 5FBOA 2DS1A 5KMJA 2W4OA 1FPUA 5CI7A 3HUBA 3PWDA 5EG3A 3N4VA 4G3DA 4DFYA 4L01A 3VUIA 3I5NA 4BCFA 2I0HA 3FMEA 4R5SA 1PW2A 4A9SA 4P5ZA 3G9LX 4Z3VA 4BCJA 4FR4A 3FMJA 2QODA 3DZQA 3ACKA 4QMYA 4IWPA 5FG8A 3EH9A 4RVTA 4FV9A 4IHPA 3KCKA 4YJTA 3DOGA 5JEBA 2G1TA 2A1AB 3FSKA 4DAWA 1H4LA 1IASA 3D5UA 2ZM3A 1KOBA 3CGOA 4ORKA 2YDIA 5IF1A 4AA4A 3R21A 2BKKA 2VWXA 4BWPA 4LMUA 1H26A 3DKOA 5DOSA 1XJDA 2XNGA 3Q4ZA 3RPSA 2J51A 3QYWA 4XJ0A 4L52A 5ICPA 5JFSA 4KSQA 3HEGA 1BLXA 2BHHA 5CXZA 3TL8A 3FXXA 3LCKA 5CLPA 5T68A 4YTCA 4UBAA 4K33A 2F49A 4C4IA 4CKJA 2Y9QA 5CZHA 4FG9A 2CPKE 3A7GA 2C5NA 1FINA 2F2CB 3HRFA 1ZY4A 2XRUA 2YJRA 5FEEA 5HESA 3ELJA 4G31A 2ETKA 4JAIA 5IQHA 2VO7A 2XCKA 5AA9A 2IO6A 5DLSA 3QALE 3MVHA 2H9VA 4HVSA 1XQZA 4I6FA 4DTAA 3IPHA 4E5AX 4O7TA 1UWHA 4CYIA 2F57A 3TN8A 2BDWA 2BAKA 5L2WA 4J1RA 4DN5A 3PJ8A 3QZIA 2VWZA 1XBAA 3EFKA 2R9SA 3LM0A 5GIPE 4BZOA 4QMZA 4JBPA 5KZ0A 4QMXA 4IAFA 2IZUA 3LLAA 4UWYA 3L9MA 4IZ7A 3V5JA 3K5UA 5E4HA 3NCGA 3R73A 2GQGA 4RX8A 3V6RA 4H58A 4RLKA 3SLSA 3Q9YA 2Y8OA 4G3GA 4AOIA 3M2WA 2YCRA 4FSYA 5LVOA 3HV7A 1Q41A 4ONAA 1WBVA 4L44A 4BZDA 3H4JA 2R3NA 5AUWA 2VTRA 2Y4IB 2BPMA 4W8DA 4LGHA 4NTSA 5HGIA 4ZJJA 4TNBA 4M0YA 4DH1A 1T46A 3QD0A 3DT1A 4RC2A 3IDPA 4CMOA 3DXQA 2BZHB 4FKQA 3MGYA 3UZRA 1YHWA 3OWJA 5IQAA 3NLBA 4GT5A 5KX8A 5AR2A 2OZAA 1A48A 3MSSA 4RIYA 3GCQA 4L46A 4O27B 4IVDA 1XHAA 4IM2A 1YXUA 3L9LA 3R0TA 4DEDA 2ITWA 5J5TA 2YWPA 3C51A 2YZLA 3KMMA 4GT4A 4RWIA 5KMNA 4PPAA 1BKXA 2ZJWA 2XM9A 2W0JA 3GC8A 3QUEA 4Q9SA 1OPKA 2PVHA 4CTCA 4BBEA 2I0EA 3EJ1A 4RA4A 4U7ZA 5I4NA 4NJDA 5EI2A 2HAKA 4AX8A 2C6IA 5IA0A 4RFZA 3LIJA 2VNWA 4EOSA 3K3IA 4UXLA 3KMUA 3F7ZA 4FNWA 2PZIA 2OH4A 3CBLA 3F3TA 3QL8A 5CEMA 1H1WA 2VTAA 3AQVA 4AGWA 4R1VA 4FNYA 4MXYA 4RVMA 4BDAA 4QRCA 4I24A 1H24A 2X8DA 4E8AA 3VVHA 3DTWA 2YM7A 1YWVA 4MVFA 3WYYA 4O7RA 2HIWA 1B6CB 3GQIA 4MK0A 5CVFA 3LQ5A 2J0IA 5I3OA 2NPQA 4FT3A 4AG8A 3B2WA 2RFNA 2ERZE 2W1CA 2QKRA 4IQ6A 3BGQA 4NSTA 3TWJA 1W83A 4JL9A 3HRCA 2NNWB 4ACMA 4CFFA 3E88A 3OTUA 2YM5A 1ZYLA 3VS0A 2XNOA 4NU1A 4X2KA 5HU3A 2G15A 3P23A 4IM3A 4QP2A 3V8TA 1JQHA 2CSNA 1Q8UA 2OO8X 3FZ1A 3GU4A 2XNPA 1CMKE 3OEFX 4OBOA 4ZIMA 4H3QA 1QCFA 4BI2A 4DH7A 4C3PA 3F9NA 4U5JA 5CU0A 3L9NA 5E1SA 3ORLA 4F1MA 4EUTA 5G6VA 5JRSA 4ZY5A 2BILB 3NSZA 4TYGA 4B9DA 2Z60A 4CZUA 4I94A 2XVDA 2YDKA 3LJ0A 3IQ7A 3OEZA 1K9AA 4QYGA 3EOCA 4WRSA 4A4OA 4BCKA 3VQHA 3U9NA 4U3ZA 3CTHA 5BUEA 3DBQA 4L42A 5C4LA 1JKSA 2A27A 4FTNA 3RWQA 5DR6A 3WZKA 3FEGA 1H08A 5B7VA 5F95A 5L3AA 1OKVA 4UALA 4DCAA 3GOPA 2HELA 3RAKA 2P4IA 2A0CX 2JFLA 3C0GA 4IH8A 2PVFA 4C62A 1JNKA 3RTPA 4S30A 2HXLA 2HWOA 3C7QA 1PXLA 2C6KA 3DGKA 3QTSA 4S34A 3HZTA 2BRGA 3DQXA 4EC8A 2O5KA 5AIRA 2J2IB 3PIXA 4M67A 5AUYA 3VAPA 3FC2A 1V0PA 4HYIA 1SYKA 5JRQA 3TUDA 2EB3A 4RGJA 3ZM9A 5J7BA 2GHGA 5CENA 2J90A 1JLUE 2R3OA 4WRGA 3AC8A 4BL1A 4BR3A 3I7CA 2ACXA 2CGVA 4LMNA 4C57A 5CAPA 2J4ZA 3LZBA 3NNVA 4GSBA 4YTFA 2CKPA 3O7LB 2QVSE 4LGGA 2V62A 2W1IA 4OBQA 4YHTA 3C4WA 4C61A 1KWPA 4QNAA 3E87A 1Y57A 1JPAA 4HNFA 2ZDUA 4WBOA 4YJNA 2XM8A 4O7SA 4L43A 3SW4A 5I9XA 3GEQA 3Q6UA 5JMSA 2GNLA 4AOTA 5AP3A 3KN5A 4GIIA 2WELA 4MD9E 5IH5A 1V0OA 3O50A 4FIIA 2PUIA 4RRVA 4UWBA 3REPA 3UQGA 2QQ7A 1NVSA 3DFCB 3R28A 5LVPA 2YIRA 3R7GA 2UW4A 4RQVA 4WSYA 2WTKC 2X8EA 5DR9A 3V5TA 3TV4A 3FLSA 4O0XA 1YQJA 4O6LA 4QP8A 3PVUA 5H2UA 4F6SA 4L3PA 4MWIA 1VJYA 3DS6A 4YJQA 5H8GA 4M7IA 4O1PA 2UZVA 3FI2A 4A4LA 2BIKB 4M68A 5E8VA 2V5QA 4XRLA 1KSWA 3RPOA 4HVIA 3UNZA 1YI3A 1X8BA 3QTQA 5A4LA 5CSXA 3NYNA 3PE2A 4I21A 3RINA 2R5TA 3ENHA 4GMYA 3R7EA 2XRWA 3II5A 3UO4A 4CEGA 1DAYA 2YIWA 2OIQA 3BEAA 4UV0A 4DGMA 5L2TA 4BI0A 3UG1A 4ZAUA 4E6AA 5AP4A 3Q6WA 3MTLA 3NX8A 2OJGA 3JS2A 3RCDA 3P7BA 2VWBA 4OAVB 4ANOA 1R1WA 4EH4A 1NVQA 2XNNA 4WSQA 3FQHA 3TCPA 2QONA 5EYKA 4MBIA 4QQ5A 3BBWA 4LI5A 3BRBA 4JX3A 4NM3A 2Q83A 4FEXA 1PXMA 2B7AA 4JQ7A 3RCJA 4HOKA 2PU8A 4O0TA 4RFYA 4FIFA 4M84A 4FOBA 2Z7RA 4MTAA 4PL3A 5CSPA 4ERKA 5HIBA 3ZFYA 4FF8A 2GNJA 4TYJA 5CT7A 1WBTA 3TJCA 4WG5A 3ULIA 4EH3A 4ALWA 5EOLA 1XH7A 5D11A 5J1WA 1Q8WA 2HENA 3CY2A 5FRIA 3R8LA 2CCHA 3UBDA 4AUAA 4GFMA 1F0QA 4PMMA 4U6RA 4DGOA 4DE4A 3PA3A 3N4UA 4ASZA 5EQYA 4MBJA 2GTNA 5DRDA 3VUMA 5HU9A 4FZ6A 4QP3A 3W2RA 2O63A 4J8NA 3AGLA 4F9AA 4FNXA 4QTEA 1OITA 3R71A 4UMPA 2V22A 5AR5A 2HZIA 5E8XA 1UA2A 2X7GA 3KRXA 4ANBA 4FTMA 3TNWA 4E20A 4QMPA 5HI2A 2PPQA 2PYWA 2ZB0A 1H1PA 5HNBA 3PIZA 4QMTA 3KREA 3G2FA 3DQWA 3OUNB 1XR1A 3Q96A 5E91A 3DAEA 5H9BA 4GG5A 2J0JA 3V5WA 4I0RA 5LWMA 2YWVA 4DFBA 3KK8A 4RT7A 1LEWA 4QP1A 1OIRA 5EW3A 2FSLX 5HIDA 5ANJA 4DH5A 1BUHA 4IAZA 1H1QA 3VBVA 4FEVA 5LXMA 3PJ2A 4QQTA 2V0DA 2C6LA 4MXZA 2OXDA 4MWHA 5IUHA 4XH6A 2OXXA 4F99A 3QC9A 2HWPA 2R4BA 3L8XA 3LMGA 1KV2A 2QCSA 3F6XA 3P5KA 4J98A 4V01A 3PVGA 4BKZA 5AP1A 4XOYA 4O22A 3VBTA 5AAEA 3F2NA 5BUIA 4AZFA 5HD7A 5HX6A 4CFMA 4AFJA 5KKRC 2QI8A 5JT2A 2X81A 4I92A 4D1ZA 5HZNA 3QC4A 4FIHA 4WG4A 3VQUA 3I0QA 1PMUA 3VBYA 2VU3A 4FTRA 3HX4A 4L3JA 4XP3A 3V3VA 4R8QA 3LLTA 3QX4A 5DG5A 4F7JA 1I44A 3DLSA 5E92A 3ORZA 1V0BA 4IVAA 4TRLA 4WUNA 4UMRA 4F7NA 4L68A 4FT9A 3EQFA 4M12A 1SMHA 4TN6A 4FZAB 3W2PA 3FI8A 3T3VA 4E4LA 2BIYA 4KRDA 4MF0A 3TTIA 2WB8A 4NYEA 5FUTA 3OWLA 4F63A 2PMNX 3TZ7A 2J0MB 2O2UA 4D2VA 1H1RA 1ZOEA 4M14A 4PMTA 3RK9A 1OIUA 4C35A 4QMQA 2FUMA 3OW3A 3ZLWA 3GCVA 3SV0A 5DH3A 3RK7A 4BHNA 4I93A 5CI6A 4ZLZA 3GC9A 4YPDA 2AUHA 4FV1A 1ZZ2A 3KY2A 1O6LA 4QMUA 4JBOA 4DH8A 3C9WA 2YITA 3TG1A 4MQ2A 4MXOA 4WNOA 4CCBA 1KOAA 1KE7A 2JIUA 4DHFA 3WYXA 2KULA 3W2QA 3FLQA 3MB7A 2C6TA 3OS3A 4BCGA 4CMTA 3LFCA 2ITXA 3SXFA 4O38A 2WTDA 2RGPA 3PJ3A 4XLIA 5EFQA 1DAWA 5HBHA 4ASDA 3M11A 3QTRA 3NUSA 5CWZA 2IZSA 3RNIA 2Z02A 2VTIA 3ZH8A 2YLEA 3VN9A 2ITTA 5C8KA 5CSHA 3POOA 4YBKA 2DYLA 4HJOA 2VX3A 4F09A 4KA3A 2PE1A 1ZMVA 3BU3A 3UG2A 3HDMA 5HE2A 3UYSA 2XEYA 4YJRA 3ZO4A 5HE3A 2Y7JA 1XO2B 3H9OA 5IH6A 3BPRA 3U9CA 4CLIA 4IE9A 4GU9A 4CMUA 1CKPA 5HX8A 5AFVA 3ATSA 3KGAA 1BL6A 3BHUA 4EL9A 5E8UA 1Q8ZA 5AM6A 3RJCA 4CTBA 3HKOA 4JJRA 4AN3A 4NEUA 4RIXB 1APME 4DBXA 4OTGA 3R9OA 2UW7A 5CY3A 1DI8A 2C6OA 4YHJA 5LWNA 1M2PA 1XKKA 4FL1A 2C1AA 2WNTA 4AZWA 5E90A 4L6QA 3SDJA 2Y4PA 3FMKA 3QCYA 3VS7A 2A2AA 3P1AA 5BUJA 3GU6A 4EH2A 5CF4A 4U97A 2PWLA 4RG0A 1NY3A 5ANKA 1GIIA 4PP7A 4FKWA 2BZJA 3C5UA 3OP5A 3PLSA 2WOTA 1WVYA 3NGAA 3ZLSA 3ID6C 3MFUA 3UVPA 4FT7A 4GYIA 2PMLX 3PE1A 4JDJA 3LM5A 3PSCA 2GS6A 2GQRA 5BYZA 2X6EA 3QYZA 3ALOA 3BE2A 3BQRA 3KK9A 3OF0A 3JYAA 4O81A 4DITA 2XIYA 4EHEA 3ZRKA 2WTWA 1JKTA 4YO4A 4C4EA 3R9DA 1XBCA 4I20A 4FKGA 5AX9A 3SOCA 2Q0NA 4ID7A 4PP9A 4M8TA 4JBQA 5L6OA 3BYMA 4JBVA 5JFXA 5ACBC 2W5HA 5DPVA 1DM2A 4R3CA 3LFSA 3MA6A 4FYOA 3TIZA 3OY3A 4ZTQA 1K3AA 1ZMUA 2JEDA 3LCSA 3PPJA 4YGAA 5AP6A 4AF3A 5AUUA 3GU7A 2WTKB 2VTTA 2OWBA 3FMHA 2VTJA 4D2TA 3QA0A 1UWJA 2OGVA 4JG6A 4KIKB 3F82A 2X1NA 4FBXA 4XP0A 3KXZA 4P90A 2GHLA 2JITA 2HCKA 4RC4A 1KE9A 5EM7A 3FYKX 3D15A 4O7WA 2XKFA 4ZSAA 4NKSA 5EDQA 3ZTXA 3DNDA 4YNOA 1YXTA 3P86A 3F3UA 4USFA 3VC4A 3G5DA 4ZSGA 3B2TA 4XP2A 2YM4A 3R8VA 4NFNA 3R8MA 4BGQA 3LCOA 2XK8A 4O96A 3LQ3A 3JY0A 4JXFA 4J99A 1DI9A 5FTGA 2QLQA 4OTIA 4Y85A 3BBTB 2B1PA 1OPLA 3MPAA 4K0YA 4K18A 4Q5HA 4M66A 5M51A 1U46A 3AD6A 3BV2A 4PX6A 4C4GA 3KXGA 3MPTA 4FKRA 4A7CA 2B9HA 4AW0A 3OTVA 5E8TA 1FBNA 3BHTA 4BN1A 4EH5A 4RQKA 1J91A 2XK7A 3FLWA 3CD3A 2XP2A 3OHTA 3QTZA 4JR7A 3ULZA 3S0OA 3ANRA 3AT4A 3D0EA 3QQKA 3QCQA 5F4NA 4C33A 3QRUA 4QPAA 2RF9A 3PLAE 4IX6A 5HICA 1NT2A 5LARA 3IW4A 3GC7A 4ZP5A 2GU8A 4FKPA 4E4MA 4FGRA 2BVAA 4UB7A 5DEWA 3P9JA 4XBRA 5A3XA 4ACHA 5I9VA 4QT1A 3OZ6A 4F0FA 4YZBA 5L8LA 4EOPA 4KKEA 4EJ7A 1YDTE 3FE3A 2CLQA 2W1ZA 2WMBA 2OLCA 3RHXA 2YCQA 3KU2A 4ITHA 5FTOA 4EOKA 4Z7GA 4M69A 4KKHA 4FKLA 3R01A 5IA4A 4LM5A 4GKIA 3QWKA 1VYZA 4ANNA 4W4WA 4C4JA 2BRMA 3VUTA 1QPJA 3V8SA 5L4QA 4K6ZA 4Y5HA 3G0EA 3V5QA 4GS6A 2QG7A 3KRLA 3P4KA 2IW8A 5HTBA 1IAJA 2OSCA 2PVNA 4C59A 4XS2A 5GIOE 2QNJA 3NYXA 3FY0A 5IA3A 2OJ9A 3TXOA 4N57A 1JKLA 4NH1A 1Y6BA 2WMSA 4BWKA 4FT0A 4CNHA 5KHWA 1VEBA 1Q3WA 5AV0A 4ZEGA 5A14A 2YAAA 1FMKA 5IH4A 2ONLA 3E8EA 2OZAB 2R64A 3EL7A 3R30A 5L2QA 3NRMA 5KKRB 1W98A 4WNMA 2YAKA 4I22A 2WU6A 3ZRLA 4RWJA 1CTPE 4ACDA 2Q0BA 5HO7A 2P3GX 3K5VA 3ZXZA 2XA4A 2GS2A 3FZTA 2X9EA 2ZV7A 4IEBA 1OKWA 3JXWA 3QRKA 4LOOA 2F7XE 4I4FA 4EKKA 2QOBA 5JQ5A 5EW9A 5IQIA 2JBPA 3CLYA 4DLJA 3PY0A 5C01A 3TIYA 2GCDA 2ITYA 2XIZA 2VRXA 4MKCA 3GNIB 4C3RA 3UPZA 4OTDA 3LXNA 3PP1A 3DV3A 3PZHA 5H8EA 3HV3A 1JSTA 3QQUA 4LGDA 4E5WA 4QMSA 4FTJA 4BTKA 1IAHA 4ANLA 2W1FA 3UOLA 4WKQA 4FKUA 3THBA 1VZOA 2WTVA 4EC9A 5BMSA 4W4XA 5J79A 5EW8A 3DLZA 3WOWA 4ASXA 2XJ1A 3KKVA 3A7IA 4X2NA 3SHEA 3UOHA 4QTAA 3G9NA 1BMKA 3CJGA 4O2ZA 3WF5A 1J7LA 1G8AA 4OW8A 2HXQA 1PXIA 3KXXA 4XOZA 4FV4A 2ZVAA 3FQSA 3NWWA 4QTBA 1H07A 2BZIB 3NIZA 2NP8A 3RM6A 3C0HA 4F9CA 2C3JA 4L3LA 4F1OA 2ZV8A 3S00A 4YTIA 4FUXA 3COHA 1Q8YA 2G01A 5IEYA 4QMMA 4FTKA 4K9YA 1MQ4A 2C5YA 2GSFA 3L8SA 3OMVA 4L67A 4RX9A 3VHEA 3QLGA 4AN2A 1R78A 4G3EA 2JIIA 3HL7A 4YO6A 5IA2A 4AZSA 2I7QA 5EYDA 2A4LA 4X3JA 3AMBA 3VRZA 4DINA 5LMKA 3OBJA 4NIFA 4FGBA 4W4VA 3TKIA 3QTUA 4V0GB 5AV4A 1YOJA 4XG7A 3SKCA 4NM0A 3Q04A 2GMXA 2WOUA 3VUKA 1J7IA 4RX5A 3FLZA 1Q99A 1FVTA 5M53A 2QC6A 1W8CA 5EOBA 3ZS5A 3UOKA 3CS9A 1OB3A 4U40A 5EQEA 4UMQA 4F0IA 1H0VA 3VF8A 4ZTRA 3PY1A 4LYNA 1J3HA 2REIA 2W4JA 3C4CA 4FZ7A 4G6NA 4TPTA 3WF7A 5A54A 4J52A 5LMBA 1IA9A 2Z8CA 1P2AA 1OL6A 2BTRA 3BHVA 5EI6A 4PMSA 4ZLOA 3C4ZA 1SVGA 2VTHA 4ZY4A 1RDQE 2ZMCA 1ZY5A 4PY1A 2HYYA 3Q4CA 1KE8A 4GK4A 3EFWA 5FP6A 2C6MA 3R9NA 4D0XA 4YZDA 3QKLA 1F3MC 3GUBA 5IQBA 4CZYB 5AR4A 4GL9A 5CNNA 5FM2A 5E8WA 3KF7A 1PMVA 1AGWA 4Y73A 1LEZA 4D1XA 1OUKA 3R22A 3IDCA 3QRIA 2ZB1A 2CKEA 3PPKA 3NAYA 1YHVA 4RJ3A 3UNJA 3ZSIA 5CASA 1H0WA 2WMQA 1ZRZA 5ITAA 1GNGA 3H0YA 2C30A 3AMYA 3MFRA 3Q5IA 2CNVA 4C4HA 2CGUA 5L6PA 3SX9A 5CTPA 3IW7A 3VS6A 4L7SA 4E6DA 4BICA 1YRPA 3UODA 3MYGA 4B4LA 5CALA 2PY3A 3DDQA 5DNRA 3QA8A 4CG8A 4U0IA 5KMMA 4IADA 4C36A 4KABA 2WQOA 2B9FA 4FUYA 2WMWA 4NUSA 4PRJA 4IB5A 5IKWA 1Q24A 3OXIA 1MQBA 1OM1A 1Q5KA 3BHYA 2IVSA 3Q9ZA 3FV8A 5IQFA 4AS0A 3TUBA 3PXZA 2DQ7X 3ZDUA 4D0WA 3OW4A 5G1XA 5T6KA 3ZC5A 5K4JA 1LR4A 2GNIA 5DN3A 3MV5A 2GNFA 4H3PA 4C4FA 5IZFA 1XH9A 5AIKA 4EK4A 1R39A 4M13A 2VTOA 1BL7A 4IM0A 3BU5A 2ERKA 3FMDA 4BCOA 4MXCA 2C0TA 4IJPA 5EHOA 5BX0A 3EQDA 3LE6A 5HG9A 2J6MA 4BTMA 2VWYA 3HV4A 3KXHA 1B39A 3HECA 3QF9A 4KD1A 1H01A 2RFSA 2ZYBA 4FG7A 3N9XA 4I5CA 5A46A 5JZJA 3GU5A 2H34A 5CSVA 2R3PA 4RIOA 5JSMA 3VS5A 3NNWA 3QCSA 5TF9A 2WMXA 2BZKB 4DFLA 5FXRA 3I81A 3QFVA 4CG9A 4WUAA 5IUGA 2HZ0A 4TXCA 3EN4A 4Z55A 5CVGA 3Q32A 3KULA 3IONA 3R02A 2C5VA 4CT2A 3SRVA 4DGGA 3MIAA 3P7CA 5M4CA 4X2GA 2E9VA 4USDA 3VIDA 4BTJA 2OFVA 2BHEA 3QAME 3LFNA 1H27A 3H9FA 2WD1A 4QP6A 3BWFA 3PXFA 4YMJA 4BCPA 4ZJVA 3F2RA 2YHVA 5HO6A 3E8CA 4U9AA 3BYOA 2XBAA 5CEIA 4F70A 3PUPA 2V55A 2C6DA 2YIYA 4TYHB 5HCXA 3RPRA 5BPYA 1ZYCA 2HY0A 3U87A 5L6WL 2BUJA 4WT6A 1YOLA 3PTGA 2WQMA 4LUDA 4AU8A 4BDFA 4ZOGA 2EWAA 3AC2A 5A6NA 4ASEA 3FZOA 1L8TA 5M09A 3I5ZA 4XUFA 4UYNA 1UKHA 5AP5A 5J95A 4IFCA 4AWIA 4QMNA 2WIHA 4FKTA 2XF0A 4BCQA 3E64A 4HVGA 2CHLA 3U6IA 2PZYA 4CLJA 2X7OA 4DYMA 2XK3A 3CKXA 2NRYA 3H10A 3LXPA 4RC3A 4XLVA 3UVQA 1FGIA 2W4KA 1G8SA 1M2RA 4FEQA 3TZ9A 2H96A 3P79A 3QLFA 1GY3A 4LUEA 4BIEA 3OOMA 5B2MA 5HCZA 3AT2A 4N4SA 5BYYA 3ENMA 3ODZX 2B9IA 3GQLA 2FSOX 4QP4A 4F6WA 3Q60A 5BVOA 3V8WA 3U4UA 5GZAA 4BDHA 3A2CA 2BR1A 4FV8A 5M4IA 1ZWSA 1S9IA 4FODA 1PKDA 4U8ZA 4I41A 3TKHA 4FC0A 3ACJA 3IW8A 3MH0A 4AW5A 3JUHA 4FSQA 4DG3E 4BIDA 4FOCA 1GZNA 4I0TA 3VS1A 3CSVA 3V04A 1Q3DA 1W7HA 1UU7A 4MX9A 2W1DA 2X4ZA 5HE1A 5D1JA 3GU8A 2QHNA 4QNYA 3V5PA 2YEXA 5EM8A 3HP2A 2IPXA 1GZOA 3EYHA 3QGWA 4IC7A 3H0ZA 4F7SA 4RZVA 5FLFA 3ZONA 5HBJA 3FSFA 2J50A 3FLYA 1R0PA 2OG8A 2R2PA 4J96A 4GRBA 1GOLA 4RZWA 1HOWA 4C02A 2C6EA 4FT5A 4L7FA 3A4OX 2UW3A 4IB1A 3F5GA 3OFMA 1YWNA 3E8DA 3MH3A 2J7TA 1FMOE 4YNEA 4YZCA 3BZ3A 1MP8A 4IAKA 4O6EA 5A4TA 3W32A 2WQBA 3LJ1A 1M7QA 3D5VA 2PVRA 2XK6A 4PMPA 3HVCA 4OTRA 4RX7A 5H8BA 3KC3A 5C26A 2VTLA 1QL6A 2FGIA 2PVMA 4BB4A 1T45A 4P4CA 1MUOA 3EQGA 5I9YA 3R63A 3PFQA 4QYFA 4DEBA 2EXMA 4IBMA 3JR1A 4TNDA 4UZHA 2R3KA 3R7VA 4BCIA 4ZMFA 3EQCA 4KINA 2OBJA 3ZDIA 5ANOA 1QMZA 4JS8A 4QYYA 4WOVA 3OCTA 4E1ZA 4LV8A 4XYFA 5F94A 4EH6A 3NS9A 5CAUA 2CN8A 3PWYA 5K0KA 2JAMA 3O17A 3PDTA 3CPBA 4F6UA 3FWQA 2A19B 5K0XA 1P4OA 2XK9A 3Q2MA 2GFSA 2OJJA 1BYGA 4NCTA 5DT0A 2XYNA 2XH5A 3ETAA 4D1SA 4KBKA 5IEVA 4OAUC 4O0RA 2QO9A 2WU7A 1SVHA 4IB0A 4MCVA 2IZTA 1YDRE 3FPQA 5LVMA 3BHHA 2UUEA 4EQCA 5K5XA 4I6HA 3V5LA 1SM2A 4XBUA 5AR7A 3LJ2A 3LVPA 1RQQA 3JVRA 2WO6A 2UW8A 5IA5A 4K77A 4I6QA 4FVQA 5EHLA 2W06A 2OW3A 3TI1A 2UZTA 4AGDA 4EEVA 3UE4A 4EZ5A 1RE8A 2W5AA 1BX6A 5EM5A 4JVGA 2VGPA 4CZTA 3UC4A 5CF5A 3D7TA 4CD0A 4G9RA 4MNEB 3DBFA 3U4WA 2GQSA 4EUUA 3GXLA 4F65A 2OICA 1Y6AA 3UOJA 3MWUA 1DS5A 3QKMA 5ANDA 4YTHA 2YCFA 3LXKA 2E9UA 3BEGA 3FQEA 2YFXA 4G3FA 3UNKA 3T9TA 3F2AA 1WCCA 5J87A 3BX5A 2VX1A 3O8UA 4PWNA 1JOWB 3FHIA 1SZMA 3WIKA 3SC1A 1KV1A 5DWRA 1YW2A 3CXWA 5HVKA 3S1HA 3AGMA 4QMOA 3VO3A 4CKIA 3VS2A 2R3JA 4MXXA 4II5A 3IO7A 4NTTA 4XEYA 4QMLA 4X3FA 3UP2A 4A07A 5CS6A 3RVGA 3PVBA 5JGDA 4KBAA 3DAJA 2UZUE 3I6WA 3KXNA 4OLIA 5CU2A 3EB0A 3LCTA 4BYJA 2PE0A 4S2ZA 3O0GA 3R1SA 4ZSJA 2YM8A 3DKCA 4BIBA 3UYTA 2P2IA 3KRJA 1GZ8A 5C27A 4DFUA 1H8FA 2F2UA 2VTNA 2VO3A 4B99A 3W55A 4G5PA 2OIBA 3ERKA 4C2VA 3SXSA 4RMZA 2LAVA 4I5MA 4D5KA 3RGFA 3QHWA 5IQCA 4EOIA 2XB7A 3SXRA 2B55A 2VX0A 5FTQA 4DG2E 4F0GA 5FQDC 2WGJA 4XV2A 4GJ2A 2ZM1A 4IXPA 3R00A 3ZCLA 4C3FA 3OG7A 4N6ZA 4PPCA 1P4FA 2W7XA 3E63A 3LOKA 4KIOA 3D14A 3EKKA 1JVPP 3AOXA 4PTEA 4J8MA 2JIVA 4HZSA 2UZEA 2C47A 5DT3A 4AZVA 4D4SA 2OZOA 4FTCA 5KE0A 3M1SA 3PSDA 4E4NA 4V04A 4QYEA 4UN0C 5I5ZA 3DBCA 4ZTNA 3VBXA 5E9EA 4KB8A 3NPCA 3EN6A 4TY1A 5CEOA 3DBEA 3QD3A 4GVJA 4RLLA 1URWA 2J9MA 5M55A 2PZRA 1M52A 3OCBA 4JX7A 4YZ9A 1WBSA 3R04A 4HPTE 4OTFA 3I6UA 5I9WA 4YC8A 4AGCA 1OBDA 2CN5A 5FWKK 5IQGA 3AC3A 2E9OA 2ITUA 4KKGA 4ZSLA 5IDPA 4D2RA 4W4YA 4Q2AA 4X6RA 4BVUA 3OOGA 3DKFA 3RAIA 1GZKA 4YJPA 4JQEA 3ZC6A 5AJQA 3IG7A 2BDJA 2AC5A 2G9XA 1G5SA 2IN6A 2WFYA 2WMUA 4KIQA 4O0WA 1SNXA 4TW9A 4O7LA 4DG0E 2WMRA 5FD2A 1F5QA 5ACKA 4BDGA 5LMAA 2C5XA 3RZFA 2XKDA 2PULA 4GW8A 3HMIA 3TEIA 3IGGA 2CNUA 3ZFXA 5AMNA 1VYWA 3MFSA 2CMWA 3VULA 2X2LA 3GFWA 5LCKA 2VO0A 5DI1A 5HD4A 4FSZA 3MJ1A 3DU8A 4AZEA 3VF9A 4LFIA 4BKJA 4B8MA 3HNGA 3KRRA 1PXJA 3UIXA 4FKJA 5CQWA 5C8NA 2R0IA 1PMEA 5KZIA 4EKLA 5AUTA 2QLUA 4MXAA 1QPDA 4BCHA 2IVVA 3P0MA 5EKOA 5LJJA 3DKGA 3QWJA 4X7QA 1U54A 3OXZA 4GH2A 5M08A 3RZBA 2VWUA 4OT5A 4DFNA 2W96B 4HGSA 4K8AA 3SVVA 4BDJA 4BDKA 5CNOA 3OT3A 3MA3A 3HUCA 1W0XC 4MF1A 4AP7A 5CEPA 1CSNA 5LVNA 1GJOA 2QOHA 3QUPA 3BGPA 3EFLA 3NW7A 5LOHA 2ZMDA 4AW1A 4L8MA 4X0MA 3DAKA 3ET7A 4BFMA 3BELA 3LAUA 3EHAA 2EU9A 1TQIA 5ANEA 4OGRA 5JK3A 4G1WA 3ZO2A 2B4SB 3VNTA 3NW5A 3HYHA 1YVJA 2R3IA 2XJ2A 5IDNA 5IA1A 3AT3A 2ITVA 3BWJA 2F7ZE 3P7AA 3DNEA 2WMTA 4GFOA 4OTHA 1TVOA 5I3RA 1NW1A 4E4XA 5B2KA 3OVVA 3QQLA 1VR2A 4FSWA 4YHFA 3MS9A 3F5PA 4UX9A 4NFMA 3T8OA 2WTCA 5ANIA 3RI1A 3DB8A 3GT8A 2H6DA 4YC3A 4YLKA 4FTAA 3H30A 1CM8A 3ZHPC 2X39A 4FV7A 5DIAA 1OZ1A 1YWRA 3SAYA 4D2WA 3EQBA 3NR9A 1PXPA 3Q9WA 3E62A 4FTTA 1JAMA 4EHGA 3KRWA 4S31A 1SVEA 3D9VA 1PF8A 3DK6A 4B0GA 3W2SA 4C0TA 4NJ3A 4F64A 2I6LA 2JFMA 3UO5A 5BVNA 4DEGA 4IW0A 5TE0A 1NXKA 3FJQE 5GZ9A 2XCHA 4RIWB 2W1EA 2ZV9A 3GGFA 4FMQA 2OF2A 5AAGA 3U6HA 3QU0A 2O3PA 4D55A 2J0LA 2YIQA 3L8VA 3TJDA 3W8LA 2XBJA 3TDWA 2XNEA 3D7ZA 2ETMA 4X2JA 4CV9A 2RFEA 1REKA 3GVUA 3UZTA 2O64A 3FAAA 1WBNA 2RG5A 4GG7A 4AE9A 3G6GA 3I0OA 4LL5A 4DTKA 2PMOX 4EH9A 1Q8TA 2XIRA 4JQ8A 4O7YA 3ZBFA 2YERA 4ZTMA 5HHWA 4FV6A 2QR8A 4CRSA 1ZMWA 4HGTA 1A9UA 2JLDA 5ETFA 4XV3A 5I9ZA 2BRNA 4ITIA 5TOZA 2PZPA 1OL5A 5FGKA 4C34A 3BV3A 3F5XA 5J9LA 4R78A 4DT8A 3EKNA 5EI8A 3TACA 4Z16A 4BKYA 2BTSA 4Y46A 5HQ0A 2CCIA 4WO5A 3ZBXA 1H25A 3TUCA 1QPEA 2RIOA 3L1SA 3W2OA 5KCVA 3C50A 3UIBA 3CP9A 5DEYA 4LL0A 3JVSA 3BLRA 4OTQA 3E93A 1PYEA 3VWAA 2XKEA 4NZWB 2UVZA 4I3ZA 3FZSA 2OJFE 3CPCA 5CEKA 5D10A 3Q4UA 2R3QA 4FSTA 4FVRA 3MIYA 2QHMA 5AR3A 2J0KA 2ITQA 3A62A 3W10A 3A7FA 4PNIA 4R5YA 4RJ8A 4NW5A 4U79A 4A9YA 1LP4A 4K2RA 3DJ7A 4KRCA 4AA5A 5KBQA 4Y72A 5IUIA 4AW2A 4AA0A 4R77A 2AYPA 3C13A 1U5RA 3OD6X 3UGCA 4OTPA 5IMEA 2E9PA 4FTUA 3A7JA 4FTQA 4TZRA 5ETIA 3VUGA 1GIJA 2OK1A 3EN7A 1OUYA 4IDVA 4BGGA 3EFJA 3NEWA
chains in the Genus database with same CATH superfamily
2WMVA 4FTIA 4CFUA 4DC2A 3OXTA 5K4IA 4FSUA 4FKIA 4Y83A 3VUDA 3AMAA 1Q62A 4BDCA 5JGBA 4DDIA 3O23A 4YSMA 5BVFA 3TTJA 4O86A 2Z7QA 4MNFA 3LXLA 2YZAA 3IDBA 3OWKA 3OCSA 4O84A 3RNYA 3PRIA 4FZDB 2YABA 3U8WA 3R7IA 2VN9A 3BYVA 3FYJX 1WBOA 4JI9A 4YZNA 3VJNA 1GAGA 4K1BA 3NIEA 4ZZOA 4DT9A 4LRKA 4TWOA 2UVXA 2VWWA 5A6OA 2FH9A 4G2FA 1U5QA 2EUFB 3LHJA 5H3QA 5TR6A 4CVAA 5CU4A 1OBGA 3FI3A 2X0GA 2VTPA 3C4FA 3FDNA 4FIGA 3TKUA 2UZLA 3KVWA 4XCUA 5TT7A 2C0IA 2IVUA 2CGWA 4OUCA 4UYAA 5HIEA 4DBNA 3FXWA 1ND4A 3Q2JA 3O8TA 3Q9XA 3FUPA 4JIKA 4YLJA 2G2IA 2RG6A 3ITZA 4ANSA 2GS7A 1R0EA 3FZRA 4RIYB 4G16A 4EK5A 3PXYA 3EMGA 5AX3A 2UW5A 3NNXA 1WMKA 3NUPA 4CYJA 3TNPC 2ITNA 4C38A 3WI6A 4XG6A 5M44A 4BWXA 4EYJA 3C4EA 4O4DA 4APCA 3ZO3A 4X21A 2VWIA 4RIXA 4LRJA 3E3PA 4JG7A 2QOQA 3RWPA 1U4DA 1Y91A 4H05A 5IISA 4YBJA 3UZPA 2P0CA 3POZA 3O51A 4DEAA 3DPKA 4HZRA 1PJKA 2JKOA 2KTYA 4Y95A 1ZOGA 4EK6A 4ZLYA 4EQMA 3BKBA 2PVLA 3HMOA 3MTFA 4YP8A 4C2WA 3QD4A 4KS7A 5M07A 5FXQA 4MUQA 3SGCA 3Q52A 2W9ZB 4G5JA 4Q9ZA 2JDSA 3U55A 3EN5A 4ZTLA 4BGHA 1OECA 4AXAA 3KA0A 2B53A 3A7HA 5EHYA 1MRVA 5JKGA 4ZTSA 4GCJA 4WD5A 3RK5A 4FSNA 3NUUA 5J9YA 3MDYA 4QDEA 3KQ7A 1HCKA 5ETCA 4O7VA 4RJ5A 2WTIA 2R3FA 4ZS4A 2W05A 4ZTHA 1PXOA 2P55A 1YOMA 3ZU7A 4NW6A 2OIDA 3RMFA 4R7IA 3LMIA 3CR0A 4GKHA 3DK7A 2X9FA 4Y8DA 4RVKA 1YI4A 3DY7A 2YM6A 4A9RA 1W82A 5AA8A 1VLRA 4GEOA 3W2CA 2VO6A 1CKIA 2FVDA 3TNIA 3MVMA 4ALVA 2CDZA 2J5FA 5AAFA 2PK9A 4D9TA 5BVWA 3G33A 1OPJA 2BFYA 2YM3A 3MJ2A 3R9HA 4BC6A 2RFDA 3GB2A 3UTOA 3B8QA 5ETAA 5CF8A 2Z7SA 4LV5A 4KIKA 2XS0A 4I5PA 3PXQA 3QXOA 3WZEA 4FSMA 5HORA 2ETRA 1PHKA 1ZOHA 4O21A 4UMTA 1R3CA 4S32A 4YUQA 3UMWA 4USEA 2CKOA 2IG7A 5FDXA 5EQPA 1YI6A 3FMMA 3FY2A 4KS8A 3UIUA 2Y0AA 1WAKA 3ORPA 1YXVA 4BF2A 3FPMA 5KMOA 5I9UA 4JIAA 4HGLA 4D2PA 4ANMA 3R1QA 2UZBA 5EK7A 4XNEA 1HCLA 4BRXA 2EVAA 5F9EA 1XH8A 5HVJA 5HKMA 2WPAA 5HLWA 4EBWA 4J71A 5C03A 1ZZLA 3D5WA 5CEQA 1J1CA 2NO3A 2EXEA 4XRJA 1J7UA 4CCUA 4YURA 4HVDA 4GFGA 3G6HA 4FTOA 2XZSA 2IW6A 2IJMA 4W9WA 1KUTA 5JFVA 2GHMA 4PDPA 5DBXA 3RKBA 3ZZWA 4EH7A 3COMA 1GIHA 2R3MA 3IW6A 3QHRA 4G9CA 4H39A 2WHBA 4FIEA 5HCYA 3ROYA 4BDEA 4AQCA 4BYIA 4JG8A 3HRBA 3QZFA 5E1EA 1PY5A 3OBGA 4EQUA 1YDSE 4CV8A 2GNHA 3WZDA 3KCFA 4ANQA 3GCSA 4W8EA 3W16A 4EHZA 1XBBA 1YHSA 2WMAA 5FBNC 3QKKA 4FKOA 3EIDA 3BE9A 1UNLA 4M15A 3I1AA 4YZMA 3G15A 4O4EA 4EI4A 4I0SA 3ORKA 4RJ4A 2VGOA 5A4QA 5KMIA 4GYGA 4IZAA 1UNHA 1S9JA 3MFTA 3A8WA 4QMWA 4U80A 2BAJA 3EQIA 1UVRA 3WBLA 2B54A 3EZVA 2V7AA 4M3QA 3KEXA 4FX3A 3TMOA 4EOMA 5AEPA 1JSUA 3MH2A 3ZOSA 4EOQA 2C3LA 4H36A 2C0OA 4ZSEA 3KB7A 3O7LD 3MPMA 4H1JA 2DWBA 2FO0A 1FQ1B 1G3NA 3UDBA 1TKIA 4EORA 2XIKA 3FL5A 3G0FA 3QZHA 3ZUVA 4ZJIA 3FMNA 3TV6A 5E8ZA 1O6YA 5JN2A 1URCA 3CY3A 2QOFA 1JKKA 3MESA 5CSWA 4B8LA 4ZXTA 4O2PA 4KUJA 4QTCA 2OKRA 3DXPA 3WZJA 3EQHA 3I79A 3BYSA 3D2KA 2YIXA 3GENA 1BI8A 1M17A 1SNUA 2I1MA 4UEUA 3RPVA 1XH4A 3GC0A 4XG4A 5HNGA 3TZ8A 3D7TB 5D41A 5FXSA 1RJBA 2GNGA 2GTMA 4RJ6A 2RKUA 3LFBA 3OROA 4PTGA 4XG2A 5FM3A 3EL8A 3HMMA 1O6KA 3PIYA 5KUPA 2PUNA 2OXYA 1WVWA 3NYVA 3RPYA 3PG1A 4L53A 4E26A 5HNIX 4IFGA 4FE2A 2C68A 4O83A 2ZOQA 3HV5A 2R3GA 3HAVA 3QQHA 2FSMX 4ZZMA 4CSVA 2C3IB 4IJ9A 4FV5A 4IB3A 1PYXA 4CT1A 4D5HA 3MY1A 1YXSA 4KSPA 2XALA 2F9GA 2WQEA 3MY0A 2A98A 3FBVA 4UY9A 4ALUA 1U59A 4JOAA 5DVRA 4X3FB 3R8UA 3S3IA 3U51A 4G6OA 5HTIA 4PDYA 2BKZA 2QOCA 3OCGA 4R3RA 2OF4A 5M4FA 3ZEPA 3D2IA 4O7NA 3LW0A 4AFEA 3CJFA 3F7WA 3GI3A 4QMVA 2BMCA 3AG9A 3COKA 3FKLA 5AUVA 2WEIA 5D7AA 3MH1A 2X2KA 3KXMA 4PF4A 1NVRA 2UV2A 1STCE 4M97A 4QPMA 5DRBA 2ITZA 3L8PA 2R3RA 1J1BA 1OVEA 3WF6A 4Y5QA 2VD5A 3NUXA 4AAAA 3Q5ZA 3AC1A 4IIRA 4IANA 4XX9A 4FSRA 5KMLA 1H00A 3SA0A 4Z9LA 1XMMA 1BI7A 3MW1A 5J1VA 4N0SA 2P33A 4IZYA 3BU6A 3W33A 5KNJA 3ORNA 4G6LA 1WFCA 3RALA 2FSTX 3ZUTA 5D12A 4F08A 2O0UA 1QPCA 4EK8A 4G34A 5JGAA 3V6SA 3GP0A 2BRHA 2ONLC 3HLLA 4RSSA 2UZNA 5KMKA 3NUYA 1ZYDA 4O0SA 4PPBA 1PRYA 2QO2A 3HAMA 4NK9A 4U43A 4V0GA 5JFWA 4D28A 5AP7A 3EN9A 2QG5A 1H1SA 2HOGA 2OJIA 1M7NA 3VS4A 5B2LA 2I40A 4M0ZA 3VW6A 5M56A 3KMWA 5A9UA 4DEHA 4FKSA 4NT4A 3VHKA 5C1QB 2XAOA 4F4PA 3AD5A 3TZMA 3EQPA 4BTFA 2BCJA 3OWPA 2ITPA 2R7BA 4HGEA 4U44A 4AZTA 4E73A 4FNZA 3PYYA 4WBBB 4GK3A 4CQGA 5AV2A 2X2MA 4NM7A 2O65A 3JY9A 3OUKA 1IA8A 5CX9A 3UQFA 2NRUA 4N6YA 4EZ3A 2RL5A 2X7FA 3NNUA 4KBCA 4CFXA 4EWHA 2E2BA 3NUNA 5BNJA 2PVKA 3R2YA 1NA7A 2YDJA 2YLFA 1AD5A 3QX2A 4YPSA 4CFWA 2BRBA 2CGXA 3F66A 2P2HA 4TWCA 3QUDA 4UMUA 3HP5A 2JKKA 4DEEA 4DGNA 5BVEA 2YA9A 4OBPA 3DCVA 5BV3A 4TWPA 4FYNA 3QQFA 3FKNA 2UW0A 3FLNC 5KHXA 4EZ7A 3RM7A 2AEGA 5AV1A 1Q4LA 3UDTA 2R3LA 4F9YA 3AD4A 2W9FB 5GNKA 2UZDA 3WE4A 3R2BA 4E93A 1ZYSA 1ZARA 4IAIA 5A4CA 3ALNA 3SQQA 1TQMA 3ODYX 2UW6A 3KN6A 4FK3A 5CYIA 2JKMA 3V01A 3LCDA 3HA8A 3NAXA 5L8JA 4MBLA 4OT6A 3RP9A 3EYGA 5FDPA 1REJA 1YKRA 2B9JA 3SG8A 2C69A 4XG9A 4ZZNA 3SOAA 4C7TA 3UIMA 1RW8A 4CKRA 1K2PA 5LMKC 4U81A 5B0XA 3ZFMA 5AP0A 2F7EE 2QURA 2ZM4A 4OTWA 3PG3A 1U54B 1E9HA 4PTCA 5DGZA 4D2SA 3A8XA 4YJVA 4GIHA 4J53A 3IS5A 4EOLA 3HV6A 5IEXA 2G2HA 2W5BA 2VUWA 1W2FA 3CCNA 4JMQA 3VUHA 4XV1A 4Z7HA 2UZWE 5HLNA 4V05A 3QTIA 4MEDA 5CZIA 3QQGA 3PZEA 4DA5A 2R0UA 3C1XA 4RJ7A 3P78A 2X8IA 4JDIA 4EONA 5J8IA 3ZSGA 4GUBA 5CF6A 1E1VA 3N4TA 4R7BA 4EBVA 4BCMA 3EQRA 4FL2A 5AADA 3QXPA 3UQCA 3BIZA 3C5IA 4KNBA 4I4EA 4B7TA 1XH6A 4TT7A 3PJ1A 1UU3A 1FGKA 4WNPA 2XUUA 3DJ6A 2XMYA 3R7OA 3K54A 4ITJA 4FG8A 5CU6A 4DFZE 2R7IA 3QZGA 3L9PA 2OU7A 2WKMA 2YJSA 3FKOA 3HDNA 3LKMA 4JDHA 4HPUE 3ORTA 2DUVA 3R8ZA 2AQXA 3I7BA 4ZY6A 4C37A 1XWSA 5HEZA 5I0BA 5DYJA 4IDTA 4IVCA 3DA6A 1CDKA 4HYSA 4P5QA 4O7ZA 5F20A 5FEDA 5M4UA 3GBZA 4KWPA 3PXKA 2Y6OA 1EH4A 5DR2A 3UVRA 3OC1A 5TKDA 3N51A 2FA2A 4JRNA 5CT0A 5CAVA 3FL4A 3BQCA 4HVHA 3PPZA 3VRYA 4NKAA 1ATPE 3NYOA 5IMXA 5IPJA 2ZAZA 4OR5A 3BI6A 1KE5A 1WBWA 4AT4A 1O9UA 2JAVA 3CE3A 4MHAA 3NDMA 3R7UA 3VBWA 4A06A 3CQUA 4CGAA 2WXVA 3VW8A 3FXZA 4C58A 4IZ5A 2HY81 3DJ5A 3U54A 2VNYA 3S4QA 4DF3A 3NW6A 2B52A 1OL2A 4QQCA 4TYHA 2SRCA 3WF9A 3MI9A 2BALA 5DT4A 5GJDA 4WIHA 5DHJA 4I6BA 1TQPA 3CQWA 3FHRA 3QTWA 1OL7A 1OKZA 4R6VA 4IX4A 3E92A 3PXRA 1KE6A 4R3PA 4QQJA 2PVJA 4RVLA 4YJUA 3LFQA 5AP2A 3RAWA 4LG4A 4ERWA 4PDSA 5GJGA 3UP7A 1W84A 2XYUA 3VS3A 5AUXA 4BBMA 1FOTA 2XKCA 2PE2A 4IC8A 4DH3A 3A61A 3V51A 5L2IA 4D4RA 4GT3A 2PUUA 5C8MA 3LFFA 5FP5A 3G90X 3PSBA 3NVMB 3UMXA 2QOLA 3AXWA 4DTBA 1Z5MA 1OL1A 4L9IA 4NWMA 3TV7A 1OKYA 5T3QA 2BAQA 3MB6A 4AACA 5L8KA 1WBPA 1UV5A 2PMIA 3ANQA 4WNKA 4O82A 4FV0A 4QOXA 3D4QA 4TYIA 1ZXEA 3LPBA 4APPA 5J7HA 3FMLA 5DFPA 4XMOA 2XIXA 4AT3A 4D4YA 5HTCA 2XARA 2BROA 3W1FA 2OI4X 4BY9E 4G17A 3I4BA 4TKSA 4FIJA 4FVPA 5AV3A 4AE6A 2UW9A 3ROCA 4K11A 5M06A 4ZMEA 4LOQA 2JKQA 4J97A 1MRUA 2VTSA 3MN3A 5LCJA 1OMWA 4RWLA 2RSVA 2F4JA 3QD2B 4EWQA 4FEUA 4FK6A 4FL3A 5ANGA 3VBQA 5D9HA 2WAJA 3TNQB 2QOIA 1OIYA 2OH0E 5KBRA 4YSJA 2VZ6A 4PL4A 2LGCA 3NUAA 3D94A 4U45A 4BI1A 3PA5A 4RA5A 4MD7E 2QKWB 5E8YA 1WZYA 3D83A 2PHKA 4CRLA 2JC6A 4D4VA 1Q61A 4YU2A 4XV9A 4H3BA 4P7EA 2PZ5A 5HE0A 4EYMA 2WTJA 5CU3A 4DFXE 3O8PA 4J7BA 3UPXA 1TZDA 2HW6A 4UZDA 5IG1A 4M69B 4BJJA 4CFNA 2ESMA 4RFMA 5DE2A 2JBOA 4AGUA 4QPSA 5HOAA 5E7RA 1V1KA 4GV1A 3TNHA 2C3KA 3P08A 4FA2A 3IGOA 3WF8A 5CXHA 3RBWA 1WVXA 3ORXA 4O0UA 4QP7A 4J95A 3QGYA 3E3BX 5F1ZA 3DXNA 3LFAA 5GJFA 4BDDA 5FEQA 4DGLC 3C4XA 3HGKA 4IX5A 4IAAA 3W8QA 2W1GA 3DBDA 3VJOA 1B38A 1Y8YA 3WE8A 4TWNA 4IWQA 4JDKA 5GINE 4WG3A 3TDVA 2IWIA 1M2QA 3O2MA 5K5NA 1Y8GA 2FYSA 3UC3A 5EM6A 3KVXA 3M42A 3RHKA 4QD6A 4XG3A 5HG7A 4PUZA 4R1YA 5J5SA 4XHKB 5AWMA 4UWCA 4G3CA 1A06A 2X4FA 5JQ8A 4I5HA 2VTMA 2BFXA 2QU5A 3DB6A 3IOKA 4FI1A 5TO8A 4IVBA 3QTXA 3T9IA 2ZDTA 2HZNA 4XG8A 4CQEA 4MNEA 2XK4A 3PRFA 1UU9A 3UJGA 3SG9A 2HZ4A 4A4XA 2OFUA 3QRTA 4HNIA 3IOPA 3ZRMA 4I1ZA 3ZO1A 4AT5A 3QRJA 3HMPA 4EOOA 3MY5A 3O96A 3C0IA 3OT8A 5J9ZA 3LQ8A 4O0VA 5BQ0A 2PSQA 3A60A 3WIGA 3SD0A 4QP9A 3NCZA 4E6CA 3T3UA 1IEPA 1ZYJA 4IWDA 3WARA 3PVWA 4JAJA 5IU2A 3GOKA 3KFAA 3NZ0A 5EDPA 4O0YA 4HCUA 3FC1X 1P14A 4PV0A 4HCVA 3Q53A 3R7YA 2CJMA 4YC6A 5DA3A 2HK5A 4LQMA 5A4EA 1L3RE 5KO1A 4N70A 2YISA 3Q4TA 3DZOA 2HW7A 3SW7A 4E5BA 1FVRA 4O91A 1M14A 4FV2A 3DDPA 5C4KA 4NCTC 2XJ0A 4IX3A 3FI4A 4RBLA 1ERKA 3LFDA 4B6LA 3LFEA 4DCEA 2WZJA 2QO7A 3D5XA 5BMMA 1ZLTA 5HBEA 3R83A 4AN9A 3H9RA 4Q5EA 4O1OA 4FEWA 4GUEA 5BVKA 1OIQA 3PJCA 3R1NA 1ZAOA 2YACA 2O8YA 3DK3A 4X2FA 3ZSHA 2JDTA 4JR3A 4NIFB 3QBNA 5HG5A 1XH5A 3F5UA 4NM5A 5JZNA 3WZUA 1P5EA 4EHVA 5CAOA 3AC4A 4IWOA 1YXXA 4ARKA 2Y4IC 2XNBA 2PL0A 4MH7A 4HW7A 4JT3A 3H3CA 4ACCA 3ZLXA 5DMZA 3B8RA 4ZK5A 4ZS0A 4BHZA 3OY1A 4FKVA 4YR8A 2VV9A 1CKJA 4A9UA 4RPVA 5GZ8A 5D7VA 1I09A 3ORMA 5CAQA 4L45A 3U6JA 4E3CA 4DHZA 3S95A 3JPVA 5CQUA 3ATTA 4EOJA 2QD9A 2C5OA 3ML1A 3CC6A 3I60A 5HVYA 2AC3A 2QOKA 4JNWA 3R1YA 4HYHA 3RAHA 3TT0A 1G8JA 5BYLA 3NMUF 2GDOA 3BCEA 5C9CA 4F9WA 3ZM4A 2I0VA 3CQEA 2JGZA 3ZEWA 2W99B 3GCPA 1W2CA 4KIPA 3W18A 4KAOA 4GJ3A 2UZOA 3W0OA 2C4GA 3G51A 3MVJA 4X3FC 5EKNA 2IZRA 4S33A 2CLXA 1PMNA 3ORIA 1JWHA 2C1BA 3WILA 2VTQA 4GVAA 2CKQA 3TM0A 4JRVA 3AC5A 2EXCX 2JD5A 4JLCA 3BLQA 4IMYA 4TYEA 4FZFB 4QO9A 3ZYAA 3KF4A 2QU6A 4BBFA 4PNKA 2W1HA 3BLHA 1UKIA 4IAYA 3QCXA 4U42A 1OI9A 3F3VA 2YCSA 5EH0A 1IR3A 2IVTA 3E5AA 3HMNA 3DFAA 4GK2A 4BZNA 5EDRA 4E7WA 4P2KA 5K9IA 1LUFA 1PKGA 3CTQA 5AUZA 4ENYA 2B0QA 5IQDA 3ZZEA 2QOOA 4BDBA 4F9BA 3NVKI 4EJNA 4PDOA 4AOJA 5EYMA 1OGUA 4ACGA 3CEKA 4L00A 2PTKA 2FB8A 3PA4A 3CGFA 4O4FA 2UVYA 3CIKA 5BVDA 4E6QA 2X6DA 4YJOA 4F1TA 2JDRA 1AQ1A 2Z7LA 1JBPE 4ENXA 3BLAA 3IK3A 4HCTA 3F61A 2Z2WA 2ITOA 1FVVA 1UNGA 5AR8A 1MRYA 2YN8A 3BGZA 3ZLYA 4U41A 1UU8A 3GCUA 4BCNA 4DEIA 2G2FA 3IKAA 2QR7A 4QYHA 5GHVA 1Z9XA 3R6XA 1H28A 4MQ1A 2JDVA 3IECA 4MAOA 4PQNA 4W9XA 5HLPA 1PXKA 3CD8A 4YJSA 2XNMA 5AM7A 3UO6A 4NL0A 5EYCA 3QQJA 4IACA 3FZPA 3KL8A 4TTHB 3K3JA 2BDFA 5E8SA 4CFVA 3Q3BA 4WA9A 3GFEA 5LQFA 2PUPA 4PL5A 3F3WA 4UXQA 3S2PA 2WQNA 1Q97A 2V7OA 3CTJA 3KULB 3A99A 3A4PA 3F69A 4R7HA 1IRKA 4I23A 3SRVB 3BYUA 4D58A 3EWHA 2VWVA 3R8PA 3DTCA 1E1XA 4H1MA 2Y6MA 1IG1A 2W17A 3ZUUA 4MD8E 4FTLA 3F3ZA 4GU6A 2IW9A 5CANA 2GPHA 3K2LA 1PXNA 4X6QC 5HG8A 5HO8A 3F88A 3HA6A 4FV3A 1JSVA 2J5EA 2E9NA 2R3HA 3COIA 3MBLA 5CVHA 2WIPA 4U3YA 5JH6A 4C8BA 4QTDA 5M57A 4DLIA 2PVYA 2I0YA 3E8NA 4LOPA 4F78A 1ST0A 4A9TA 4RIWA 1LPUA 4FICA 3R9RA 2VAGA 3E7VA 2GFCA 2WEVA 5IQEA 2EB2A 3LMHA 4EK3A 4YLLA 3ZXTA 5LVLA 3CKWA 3IW5A 2H8HA 4RWKA 4BDIA 4F7LA 3PY3A 4CXAA 2ZV2A 3E7OA 4WHZA 5L2SA 2CNQA 3PP0A 4EH8A 2XEZA 4TL0A 3O71A 4HYUA 3ZMMA 5K3YA 3EZRA 4D9UA 4MYGA 3MVLA 2JDOA 1Z57A 4LRMA 5FBOA 2DS1A 5KMJA 2W4OA 4DDGA 1FPUA 5CI7A 3HUBA 3PWDA 5EG3A 3N4VA 4G3DA 4DFYA 4L01A 3VUIA 3I5NA 4BCFA 2I0HA 3FMEA 4R5SA 1PW2A 4A9SA 4P5ZA 3G9LX 4Z3VA 4BCJA 4FR4A 3FMJA 2QODA 3DZQA 3ACKA 4QMYA 4IWPA 5FG8A 3EH9A 4RVTA 4FV9A 4IHPA 3KCKA 4YJTA 3DOGA 5JEBA 2G1TA 2A1AB 3FSKA 4DAWA 1H4LA 1IASA 3D5UA 2ZM3A 1KOBA 3CGOA 4ORKA 2YDIA 5IF1A 4AA4A 4AAYA 3R21A 2BKKA 2VWXA 4BWPA 4LMUA 1H26A 3DKOA 5DOSA 1XJDA 2XNGA 3Q4ZA 3RPSA 2J51A 3QYWA 4XJ0A 4L52A 5ICPA 5JFSA 4KSQA 3HEGA 1BLXA 2BHHA 5CXZA 3TL8A 3FXXA 3LCKA 5CLPA 5T68A 4YTCA 4UBAA 4K33A 2F49A 4C4IA 4CKJA 2Y9QA 5CZHA 4FG9A 2CPKE 3A7GA 4AXCA 2C5NA 1FINA 2F2CB 3HRFA 1ZY4A 2XRUA 2YJRA 5FEEA 5HESA 3ELJA 4G31A 2ETKA 4JAIA 5IQHA 2VO7A 2XCKA 5AA9A 2IO6A 5DLSA 3QALE 3MVHA 2H9VA 4HVSA 1XQZA 4I6FA 4DTAA 3IPHA 4E5AX 4O7TA 1UWHA 4CYIA 2F57A 3TN8A 2BDWA 2BAKA 5L2WA 4J1RA 4DN5A 3PJ8A 3QZIA 2VWZA 1ST4A 1XBAA 3EFKA 2R9SA 3LM0A 5GIPE 4BZOA 1TFFA 4QMZA 4JBPA 5KZ0A 4QMXA 4IAFA 2IZUA 3LLAA 4UWYA 3L9MA 4IZ7A 3V5JA 3K5UA 5E4HA 3NCGA 3R73A 2GQGA 4RX8A 3V6RA 4H58A 4RLKA 3SLSA 3Q9YA 2Y8OA 4G3GA 4AOIA 3M2WA 2YCRA 4FSYA 5LVOA 3HV7A 1Q41A 4ONAA 1WBVA 4L44A 4BZDA 3H4JA 2R3NA 5AUWA 2VTRA 2Y4IB 2BPMA 4W8DA 4LGHA 4NTSA 5HGIA 4ZJJA 4TNBA 4M0YA 4DH1A 1T46A 3QD0A 3DT1A 4RC2A 3IDPA 4CMOA 3DXQA 2BZHB 4FKQA 3MGYA 3UZRA 1YHWA 3OWJA 5IQAA 3NLBA 4I6LA 4GT5A 5KX8A 5AR2A 2OZAA 1A48A 3MSSA 4RIYA 3GCQA 4L46A 4O27B 4IVDA 1XHAA 4IM2A 1YXUA 3L9LA 3R0TA 4DEDA 2ITWA 5J5TA 2YWPA 3C51A 2YZLA 3KMMA 4GT4A 4RWIA 5KMNA 4PPAA 1BKXA 2ZJWA 2XM9A 2W0JA 3GC8A 3QUEA 4Q9SA 1OPKA 2PVHA 4CTCA 4BBEA 2I0EA 2IEWA 3EJ1A 4RA4A 4U7ZA 5I4NA 4NJDA 5EI2A 2HAKA 4AX8A 2C6IA 5IA0A 4RFZA 4AXFA 3LIJA 2VNWA 4EOSA 3K3IA 4UXLA 3KMUA 3F7ZA 4FNWA 2PZIA 2OH4A 3CBLA 3F3TA 3QL8A 5CEMA 1H1WA 3P5JC 2VTAA 3AQVA 4AGWA 4R1VA 4FNYA 4MXYA 4RVMA 4BDAA 4QRCA 4I24A 1H24A 2X8DA 4E8AA 3VVHA 3DTWA 2YM7A 1YWVA 4MVFA 3WYYA 4O7RA 2HIWA 1B6CB 3GQIA 4MK0A 5CVFA 3LQ5A 2J0IA 5I3OA 2NPQA 4FT3A 4AG8A 3B2WA 2RFNA 2ERZE 2W1CA 2QKRA 4IQ6A 3BGQA 4NSTA 3TWJA 1W83A 4JL9A 3HRCA 2NNWB 4ACMA 4CFFA 3E88A 3OTUA 2YM5A 1ZYLA 3VS0A 2XNOA 4NU1A 4X2KA 5HU3A 2G15A 3P23A 4IM3A 4QP2A 3V8TA 1JQHA 2CSNA 1Q8UA 2OO8X 3FZ1A 3GU4A 2XNPA 1CMKE 3OEFX 4OBOA 4ZIMA 4H3QA 1QCFA 4BI2A 4DH7A 4C3PA 3F9NA 4U5JA 5CU0A 3L9NA 5E1SA 3ORLA 4F1MA 4EUTA 5G6VA 5JRSA 4ZY5A 2BILB 3NSZA 4TYGA 4B9DA 2Z60A 4CZUA 4I94A 2XVDA 2YDKA 3LJ0A 3IQ7A 3OEZA 1K9AA 4QYGA 3EOCA 4WRSA 4A4OA 4BCKA 3VQHA 3U9NA 4U3ZA 3CTHA 5BUEA 2NYAA 3DBQA 4L42A 3UDZA 5C4LA 1JKSA 2A27A 4FTNA 3RWQA 5DR6A 3WZKA 3FEGA 1H08A 5B7VA 5F95A 5L3AA 1OKVA 4UALA 4DCAA 3GOPA 2HELA 3RAKA 2P4IA 2A0CX 2JFLA 3C0GA 4IH8A 2PVFA 4C62A 1JNKA 3RTPA 4S30A 2HXLA 2HWOA 3C7QA 1PXLA 2C6KA 3DGKA 3QTSA 4S34A 3HZTA 2BRGA 3DQXA 4EC8A 2O5KA 5AIRA 2J2IB 3PIXA 4M67A 5AUYA 3VAPA 3FC2A 1V0PA 4HYIA 1SYKA 5JRQA 3TUDA 2EB3A 4RGJA 3ZM9A 5J7BA 2GHGA 5CENA 2J90A 1JLUE 2R3OA 4WRGA 3AC8A 4BL1A 4AXDA 4BR3A 3I7CA 2ACXA 2CGVA 4LMNA 4C57A 5CAPA 2J4ZA 3LZBA 3NNVA 4GSBA 4YTFA 2CKPA 3O7LB 2QVSE 4LGGA 2V62A 2W1IA 4OBQA 4YHTA 3C4WA 4C61A 1KWPA 4QNAA 3E87A 1Y57A 1JPAA 4HNFA 2ZDUA 4WBOA 4YJNA 2XM8A 4O7SA 4L43A 3SW4A 5I9XA 3GEQA 3Q6UA 5JMSA 2GNLA 4AOTA 5AP3A 3KN5A 4GIIA 2WELA 4MD9E 5IH5A 1V0OA 3O50A 4FIIA 2PUIA 4RRVA 4UWBA 3REPA 3UQGA 2QQ7A 1NVSA 3DFCB 3R28A 5LVPA