3BE9A

Structure-based design and synthesis of novel macrocyclic pyrazolo[1,5-a] [1,3,5]triazine compounds as potent inhibitors of protein kinase ck2 and their anticancer activities
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
328
structure length
327
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II subunit alpha
publication title Structure-based design and synthesis of novel macrocyclic pyrazolo[1,5-a] [1,3,5]triazine compounds as potent inhibitors of protein kinase CK2 and their anticancer activities.
pubmed doi rcsb
source organism Zea mays
total genus 110
structure length 327
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3be9A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3be9A02
2J51A 3OROA 3MYGA 3EIDA 3F5XA 5F1ZA 1ND4A 4HVIA 4FUXA 1R3CA 4X6QC 1FGKA 3ROCA 4ALWA 4S33A 2XKFA 3N4VA 4GIHA 4FEWA 1YXXA 1UWJA 4J96A 5EK7A 3AGLA 4NIFB 4PL5A 2VNWA 4I6HA 2RKUA 4PV0A 3NUNA 4GG7A 4ACGA 2NRYA 4ZZMA 2JKKA 5TF9A 3QUEA 2EB3A 2XKCA 3EFWA 4H39A 3HRFA 3MDYA 1HCKA 2O0UA 1J1BA 2DWBA 4ERWA 1KE6A 4UYNA 5H8EA 2F7XE 4ZTNA 2YLFA 3S4QA 4XP2A 4FKQA 4TXCA 5M4FA 4IVBA 5TKDA 2G2HA 3BBTB 4QMVA 3AMBA 4JG8A 3TIYA 4O0YA 2GNFA 4UZDA 5D10A 3V5WA 5E8ZA 3R7EA 2QVSE 3P9JA 4PNKA 3R21A 1R78A 1GIHA 4WBOA 4K18A 3MIAA 3FI4A 3NIEA 3S00A 5BUEA 4YBJA 1XJDA 3R28A 4YSJA 2FGIA 3CR0A 4LGGA 5KBRA 3NVMB 5H2UA 5CTPA 3KULB 3ZEPA 4ANBA 4DHFA 4F09A 3U55A 5IA4A 4FSNA 5E8VA 3DKOA 1STCE 3QGWA 3RWQA 1ERKA 3A2CA 4NKSA 4UMRA 2I1MA 2JD5A 5JFXA 4PL3A 4FSTA 4J1RA 3NSZA 4ZEGA 4G5JA 3I81A 1W98A 3ALNA 2QOHA 4AS0A 4IIRA 4CZUA 5CI7A 2GHMA 2P55A 4JBQA 4AF3A 2VO6A 2YCQA 3OW3A 4FKSA 5GINE 3CD8A 3QTWA 2W1IA 2IN6A 2VO3A 3HLLA 4UEUA 1FPUA 3C4XA 4FTOA 4LFIA 4RZVA 4IW0A 4YZCA 2GNGA 3TIZA 4CVAA 3S3IA 4DH3A 1JPAA 2G15A 3QC9A 5F4NA 3MH0A 3M1SA 4OTPA 4M3QA 4DFUA 4K33A 4XYFA 5DRDA 5T6KA 4QP8A 3LFSA 3OC1A 3RALA 3PE2A 1Y6BA 2WTIA 4O0VA 5FP5A 3HGKA 1W82A 3FQEA 3S2PA 5KBQA 4DFXE 4TKSA 3OTVA 1GAGA 4O6EA 2BUJA 4EH4A 4S2ZA 2Y7JA 3D9VA 1Q8UA 4GJ2A 4EYMA 4C0TA 3BGPA 5HO7A 1IG1A 3GU6A 3NUPA 5C27A 3HV7A 4I6QA 4LUDA 2XMYA 4RWKA 3TEIA 2GTNA 2BRHA 2X2LA 3MA6A 2BFYA 4C36A 4HW7A 3DOGA 4IWPA 4BBMA 3KB7A 3RM7A 4NU1A 4BKYA 2IG7A 4PPCA 1OITA 3MH3A 3EHAA 1UU3A 4MXXA 4ZZNA 3DJ5A 4O0TA 3PY1A 2O63A 3KRWA 4GYIA 4R1VA 2PPQA 2ITNA 2WTVA 4V0GB 1IAHA 5FLFA 4MBIA 4TWOA 3Q2MA 4DH5A 4L8MA 4EBVA 3HVCA 3G51A 2VAGA 4M69A 3T3UA 4BHNA 1Y8YA 4U7ZA 1NW1A 3LHJA 5J8IA 3DAKA 2E9OA 3QRKA 3NRMA 3MVLA 1PKDA 3LFQA 2ZM1A 4DEAA 3R8VA 2UVXA 3GI3A 4E5WA 2B53A 3ORTA 4RIYB 1J7IA 1OL6A 4DE4A 4EEVA 3IKAA 4CXAA 3FI8A 3DBQA 2PVRA 5AP4A 1F3MC 5JN2A 5HE1A 3KXHA 4C37A 3HMNA 5FGKA 3TACA 1OL5A 3EYHA 2XP2A 3MVHA 4QP6A 4IWQA 4PDYA 4FTQA 3PLAE 4UMQA 4MKCA 4TWNA 4DITA 4KIKA 5LJJA 5LVMA 4DT8A 1AD5A 3HEGA 3UPXA 1PJKA 2Z02A 3BU6A 4FA2A 1XHAA 4L3PA 2XYUA 4O0XA 4U45A 4LI5A 5IQCA 2ZVAA 1APME 3P7BA 4EK8A 5I3RA 5L2TA 3Q5ZA 4RJ8A 4XG7A 2QOLA 3OTUA 3O8UA 2OFUA 4HCUA 4YZMA 4RC4A 5EH0A 3KF7A 2J9MA 3QA0A 4RJ4A 3AXWA 3F66A 4FG9A 4APPA 2HOGA 1S9IA 3DZOA 3RP9A 4DEGA 4DH8A 5HIEA 3DGKA 2JC6A 3F6XA 3KRXA 1YI4A 4U0IA 4ZLYA 3PWYA 3UPZA 2PMLX 1V0OA 2HZ0A 3PVBA 4U40A 2VV9A 3KK8A 2PE1A 5IDPA 1KWPA 5CYIA 5K4JA 1WBTA 5DEWA 1OIRA 4D4SA 2R3LA 3FSKA 3PXRA 4E6DA 3VULA 3SG9A 3G9LX 3VHEA 4F99A 4DEEA 4Q5HA 2Y4PA 3A7JA 3EL7A 5AR7A 1AQ1A 4TYJA 2EVAA 4C38A 5DMZA 3SXRA 1CSNA 2XM9A 3W8LA 3LFCA 4E6QA 4EJ7A 3A7HA 4ALVA 3ZDIA 2P4IA 3BWFA 4EOJA 3ZBXA 1XH9A 4CQGA 3ZO1A 4ACDA 4IAAA 3TKUA 2GHGA 3PSDA 3Q60A 5I9XA 3AOXA 1RJBA 2VWVA 4IX3A 4D5KA 2FSTX 3Q4CA 3QLFA 4BKJA 4PWNA 4O82A 5CNOA 3GU4A 3C50A 4HCTA 2O2UA 5DGZA 4U3YA 2IZSA 3AC1A 3RCDA 1YWVA 4I0TA 3PA4A 3UOKA 3KC3A 3QAME 4GU6A 4FVPA 4FT0A 4RT7A 3E8DA 2BRMA 1L3RE 2WMQA 4FK6A 3VRYA 3KA0A 3Q53A 5AAEA 1Z5MA 4OTHA 3EB0A 2C6OA 4IWOA 4GK2A 1PW2A 3L9MA 4FKLA 3MSSA 3G90X 3BKBA 4O0UA 3OWJA 4H1JA 3R7GA 3SAYA 3SKCA 2J7TA 4M14A 4YHJA 3OCBA 3SRVB 3LMHA 4UB7A 4YHFA 4FEXA 2C69A 5EW9A 3E88A 5ANGA 2WQNA 4FC0A 4GFMA 4FODA 4RA4A 4IAFA 4ITJA 3NVKI 3LLAA 4EOIA 1U54B 1OB3A 2LGCA 2OWBA 3ORLA 5HG8A 5IQBA 2BZHB 4EQMA 1SYKA 4BVUA 3UG1A 1T46A 4H3QA 1GZNA 4IDTA 2J0KA 2QOKA 4Q9SA 2VTOA 4G6NA 1OZ1A 1TQPA 4LGDA 4GFGA 4P5ZA 1KOAA 2J0MB 4HZRA 5AP5A 5HX6A 3JY9A 4FE2A 3MVJA 4I6BA 4CRSA 2FYSA 3BV2A 4IFCA 3R1YA 2WU7A 4IB3A 4B6LA 4AT3A 3DAEA 3UE4A 4EHEA 2XIZA 4EZ5A 4ARKA 4NT4A 4FT7A 4YC8A 5LQFA 5EDQA 4QQ5A 5E91A 2FSOX 1WBPA 2RFDA 2WNTA 3ZUUA 3AT4A 4BDBA 2W5HA 3BIZA 3GU8A 3LXKA 5EKOA 4BC6A 1FINA 2WFYA 3GU7A 2ZM4A 4V04A 4XP3A 4EWQA 4QQJA 3MJ2A 4U43A 4RX8A 2QQ7A 5EDPA 4CNHA 1ZRZA 4L42A 1WCCA 3I7CA 3LCDA 3NZ0A 3QHWA 4GUBA 3IONA 3LCOA 4LRKA 2WTKC 3O17A 5F94A 3WF8A 5LCJA 2X9EA 5EYMA 2VTSA 3B8QA 4O27B 5GJFA 5HESA 3FXWA 4XUFA 3SQQA 5ACBC 3MFRA 5AV4A 4A9UA 4Z16A 3I60A 4RLLA 5C8MA 3VVHA 1XBAA 2WKMA 3NYXA 2JDVA 4CKRA 3P1AA 5AR5A 3U9CA 2I6LA 3BYSA 4RIWA 3BE2A 2UZLA 3LFNA 5CU4A 3TTIA 2ZYBA 1UVRA 4HPTE 3PRIA 4JR7A 5J7BA 3R22A 3OVVA 2X8DA 3P7CA 1W83A 3KGAA 4C61A 3QWJA 5HQ0A 5CXHA 3BHVA 4AW5A 3MN3A 2B9HA 3FZSA 4HZSA 4MBLA 3U6HA 4EI4A 3UP7A 2OF4A 3DKCA 1MRYA 2UV2A 4D2VA 5BYYA 2WAJA 1KOBA 4K2RA 5HVYA 4TYHB 4ASDA 4D9UA 4IX6A 1Q99A 1ZYJA 5A4TA 3CTJA 5L4QA 5FXQA 3UIXA 4L67A 3JUHA 2OU7A 2Y8OA 3LFEA 2FUMA 3E7OA 3GCPA 4GYGA 3KRLA 1QPEA 3R9DA 2C4GA 2VTAA 2X1NA 4G2FA 4I23A 4K6ZA 4DC2A 4F6WA 4F7NA 5JRQA 1H0WA 5HO6A 3HZTA 4KUJA 3D0EA 3LCSA 2V5QA 2W4OA 2UZWE 4YJRA 4ASZA 5HNIX 1LUFA 4O7VA 2IZUA 2V22A 3C9WA 3TKHA 3ZLXA 3BELA 2REIA 2XJ0A 4CTCA 3KN6A 3IS5A 5M06A 1SNXA 2YM3A 3RMFA 3NW5A 3PG1A 4NSTA 3M2WA 4EK5A 2GNHA 4ERKA 3MH2A 4FX3A 4ITIA 4C34A 3QTXA 3FDNA 3KKVA 3R7UA 2VRXA 4K1BA 4FKUA 2ZV8A 3EL8A 1KV2A 3D5WA 3ACJA 3BYUA 4I5PA 3FYJX 4H3BA 2Z60A 5LVOA 4FSUA 4HGTA 5IF1A 3NDMA 4YTFA 3V8SA 3EQRA 3VBVA 3RWPA 5DLSA 3ZH8A 5IQFA 2CHLA 2Y6MA 1JVPP 4EOLA 4CZTA 2YAKA 3RK5A 3KMUA 3MB7A 1VJYA 2XYNA 2VX1A 5K5XA 3LZBA 5AUYA 3F3ZA 1FOTA 4ZTRA 1KUTA 4D1SA 4LGHA 3OCTA 5D11A 5KMLA 5FEQA 3Q6WA 4PX6A 1E1XA 1PXJA 4ZTQA 5AM7A 4QMWA 1Q3DA 3BLQA 4IH8A 4HGLA 3VUMA 2PY3A 1TQMA 4B4LA 5IEVA 5DR6A 2BMCA 4PPBA 4JQEA 4EH5A 3NUYA 5K0KA 2YIYA 2ITOA 3NUUA 1QL6A 4RVMA 3GEQA 3ZRLA 3PVWA 4I92A 1SVEA 3FLWA 4OTIA 5AM6A 3UOJA 5CF4A 3PSBA 4CD0A 3PJ1A 5IUHA 1QPCA 3MS9A 1MRVA 5LVLA 5LWMA 3CPCA 3FQSA 4X3JA 3WZUA 4QMOA 4XV3A 4BWXA 5IA5A 3PJCA 4K0YA 5HE2A 3KN5A 3PP1A 5HE3A 3MY1A 4LG4A 4DH1A 3QTUA 5AV2A 4O0RA 1QMZA 2V62A 2QHNA 4UZHA 3BBWA 1NT2A 2ZAZA 4KAOA 4W8EA 4Y73A 2PVLA 2UZEA 4AZEA 2CGWA 3EMGA 4Z7GA 3TZ9A 3L9NA 1BKXA 4C57A 4PPAA 1ZOHA 2WQOA 3QLGA 1U5RA 1A9UA 2Y6OA 5HI2A 4XBUA 3F61A 3E5AA 1H1RA 3GCUA 4IHPA 4L9IA 2BDFA 2R9SA 1M7QA 4XG6A 5FBOA 4CT2A 2QKWB 5HIDA 2X6EA 5K5NA 5HCXA 3AC3A 3OS3A 1FBNA 3QTSA 1OUKA 4BZNA 4ALUA 4UWBA 5JRSA 1PYXA 4QMMA 4AWIA 2Q83A 5I4NA 1G5SA 3KXGA 3E92A 3I1AA 2QOFA 4LYNA 4ZK5A 3VHKA 4BZDA 4YO4A 2ZB0A 4FSMA 3ORMA 3SV0A 2G2IA 1O6LA 2H96A 2UW8A 3HUBA 3D94A 3W2RA 3RPVA 5J5TA 1URWA 2BIYA 2XJ2A 3CIKA 4OTDA 2YFXA 5M07A 3BEAA 3CKXA 3LE6A 3QZHA 4YZ9A 3A7FA 4U97A 3GU5A 3C4ZA 4F65A 2WZJA 3GC9A 4QNYA 4QP2A 3FKNA 3UNKA 5H3QA 2W1ZA 3DBEA 4MNEB 1E1VA 2F2UA 3QZIA 4AZTA 4HPUE 1JKKA 3FUPA 1GY3A 3W55A 5EM6A 4FV2A 3TUDA 4BWPA 4NW5A 5FEEA 4IMYA 3TN8A 3P7AA 1UNHA 4YUQA 3SA0A 4PP9A 1Q61A 1NVRA 4I5MA 3EWHA 1Q8YA 4RLKA 3H10A 4BDAA 4FIGA 3CQUA 5M56A 4HYHA 4FV6A 4I20A 4U42A 1YOMA 2XNOA 4CZYB 2YA9A 3N51A 4JJRA 4RIXA 2EUFB 3EQPA 3TL8A 1PKGA 3OCSA 5CSWA 3TTJA 3DFAA 3VBTA 4DH7A 3M42A 5E8YA 5AFVA 5CVGA 1M14A 2E9UA 4ZTLA 2CKPA 4JIKA 2JIUA 4YNEA 4BBEA 1ZY5A 3O8TA 4O7SA 2C0OA 1ZOGA 4FVQA 3HP2A 4IVDA 4MHAA 5AUZA 3BPRA 5HG7A 4PQNA 1BMKA 3QHRA 4Y8DA 5IQEA 4RWJA 3Q96A 4A06A 4CG9A 4BI2A 3DTWA 5ETFA 4X2KA 4KKHA 3KMWA 3FLNC 4V0GA 3PRFA 2ETRA 3DV3A 4TYGA 5EM8A 4E4LA 4EOKA 4F70A 4FV8A 2HWOA 1B38A 1U4DA 1J1CA 4DAWA 3EYGA 3NUSA 3W2CA 3JVRA 4NYEA 1R0PA 2YIRA 2QD9A 3HL7A 4KSPA 5KE0A 4O84A 3E3PA 3ORKA 2WPAA 4G3DA 4U80A 5J7HA 1G3NA 4RC3A 1JOWB 4XG8A 5ANIA 2C3KA 4RIYA 5AA8A 3CC6A 5BUJA 4RX5A 4C7TA 3RPYA 3C1XA 4TT7A 4Z7HA 3AG9A 1Y91A 4ZS0A 5CSPA 5AMNA 4BDKA 4QMTA 4BIDA 5CEOA 3Q5IA 4HYIA 2Z7SA 3CJGA 2VTNA 3Q04A 4CCUA 4AUAA 4CRLA 5GZ8A 3D7TB 2R3FA 4NH1A 4AE6A 4DTKA 5B2MA 4GKHA 3ERKA 4JG6A 5A46A 1UU8A 2XCHA 3TNPC 3F7ZA 4GT3A 3VJOA 2YCRA 4DGMA 3VS7A 3GFEA 4FNWA 3ZEWA 3SDJA 4AXAA 1OUYA 3GC0A 4GEOA 4HVDA 5E4HA 3DB8A 3ZMMA 4IEBA 2ITYA 3HAVA 5BPYA 4NUSA 3KF4A 4QTAA 4ZSJA 3RZFA 4MWIA 1YHSA 4IC8A 4O38A 4J8NA 5K3YA 3EKNA 4IANA 3UIMA 4A07A 5M08A 1TVOA 1P4OA 3BRBA 3R9HA 3E63A 4I4EA 4FEUA 2EU9A 1PMUA 4CFUA 1O9UA 2BILB 5JSMA 5L6PA 1V1KA 3PDTA 1O6YA 3P5KA 3FMLA 2NNWB 2W1EA 1OL7A 2I0VA 3BI6A 4RQKA 3D5VA 3ULIA 4QQTA 3R2YA 4FVRA 4GUEA 2P3GX 2W0JA 3GB2A 4L7FA 3TWJA 1ZWSA 1LEZA 4N0SA 4F7SA 5DVRA 5EI6A 3C7QA 3RPRA 4I0SA 4GKIA 4TYEA 4L01A 2YITA 5DPVA 1TKIA 2QG7A 4IC7A 4QMPA 3EQBA 1LEWA 3NS9A 4C35A 3ZO3A 2PL0A 4FTMA 3VS4A 1J7UA 1JLUE 4TNDA 4QP9A 1REKA 4Z55A 4HOKA 4R7IA 4WKQA 2WGJA 3V5PA 2HZ4A 3QYZA 2JKMA 2OJJA 1JBPE 2X4FA 3A4OX 4NKAA 5AIRA 3DT1A 3FL4A 1PF8A 2VWZA 3I79A 4O0WA 4BDIA 4D4YA 3I7BA 3MTFA 2X6DA 3UBDA 4YO6A 4AT5A 3MGYA 4C3RA 4BCHA 2FO0A 2VWWA 3FKOA 4N6YA 3UC4A 4BWKA 4RGJA 2F9GA 4MYGA 3BQCA 4LRJA 5GIOE 4I93A 4DF3A 3PY3A 3H0ZA 1H24A 3EN9A 2C5NA 3REPA 3V51A 4ANSA 3NUAA 2OIBA 2YM8A 4FZDB 1XH6A 3BHHA 1XBBA 4WT6A 4XLVA 4B9DA 3MPTA 4J52A 1A06A 4AGWA 4ACMA 4FTKA 3KXNA 5B2KA 3VW6A 2X39A 2GFSA 2VD5A 1CTPE 2YN8A 2GNIA 2R64A 3HV6A 3IG7A 2WMRA 3FC1X 3H9RA 3G9NA 5JGBA 2CPKE 2VO0A 3DQWA 5DNRA 3EFLA 3BU5A 3FLYA 3LOKA 4JAJA 4YZDA 3QRIA 3D15A 3ID6C 2UZDA 4FBXA 3A61A 2Q0BA 3JS2A 1WFCA 3OOMA 2BCJA 5L2QA 2IW9A 4QD6A 5A9UA 1YHVA 3QGYA 5ACKA 4YP8A 3FMNA 3RI1A 2JKQA 4D5HA 5C4LA 1ZMVA 2KTYA 3VJNA 3BHTA 2R7IA 3MV5A 2OBJA 1GZKA 4EKKA 2H8HA 4FKWA 4Y46A 3C0HA 4XOZA 3LXNA 2Y4IB 3UNZA 2R3IA 3Q9YA 3QQLA 2W4JA 1E9HA 2WEVA 3NNVA 4U3ZA 3QRTA 5LCKA 4F9WA 5IDNA 4FZ7A 4BGHA 2IPXA 3HP5A 2BKZA 3G33A 5BVOA 4IM2A 3H30A 4JBPA 4G5PA 4IADA 2AC3A 2HZIA 2JDSA 4I3ZA 3FMDA 4MTAA 4M66A 5JMSA 1CM8A 1DAWA 3EQHA 3BQRA 3FPMA 3LQ3A 4RC2A 2ZOQA 2BRBA 4MX9A 4CYIA 4ZY4A 3TV4A 5G1XA 2VX0A 1LP4A 3NYVA 1REJA 3K3IA 3KCKA 2GDOA 4DT9A 5C8NA 5A3XA 3IPHA 4LQMA 2BZKB 3E93A 3TNHA 3OWKA 3WF6A 3BEGA 4OAVB 2C0IA 4TYHA 4CLIA 3FXXA 4M12A 1UKIA 2P0CA 4EUUA 3B2WA 3CTQA 3PG3A 2C5XA 4FNXA 2WMSA 4QYFA 3V6SA 3R1QA 3WE8A 5CZHA 4IB0A 4EUTA 1H07A 4PMTA 3CSVA 4KS7A 1P4FA 3UGCA 3DY7A 5AX9A 3TZ7A 4FV7A 3WZDA 3NYNA 5IZFA 3FE3A 2PTKA 4LOOA 5EHOA 4FV5A 5H8BA 3ZBFA 3ATSA 3HNGA 4WA9A 2DS1A 4QYGA 3DXPA 2BFXA 1M2RA 2YZAA 2C6EA 2ZMCA 3R8UA 4Q9ZA 4QMXA 5CEIA 5KKRB 1H4LA 4O86A 4M68A 4FZAB 5M55A 3AD4A 4JRVA 4TW9A 5E8TA 3VS0A 2YM4A 4DEHA 4Q5EA 4F1OA 4UN0C 3FWQA 3G2FA 5L2SA 3ETAA 3QRJA 1ZYLA 1MP8A 3KVWA 4KB8A 3OHTA 4GJ3A 3FMEA 3NPCA 4ZXTA 3UO4A 3DCVA 5FEDA 2OJGA 3WE4A 1ZYDA 3F7WA 4JR3A 5DRBA 4ZTSA 2LAVA 4XH6A 3R7VA 2RGPA 3RKBA 2YDJA 1IA9A 4XRJA 4I21A 5JFWA 2OH4A 3DFCB 1BI8A 2FH9A 1I44A 3Q9WA 4FMQA 4CSVA 2W96B 4KBCA 3FZ1A 2OO8X 4O7LA 3GBZA 3V8WA 1W7HA 4DG3E 3HKOA 2XEZA 5E1SA 5EOLA 3ZRMA 1KE9A 3B2TA 3BYMA 4RFMA 2H9VA 2GQSA 4MNFA 5IQIA 1BLXA 4NFMA 1W84A 4Q2AA 3ZUTA 3LM5A 4FV3A 2WIPA 4PP7A 1NVQA 2QOQA 4C4HA 3EQIA 4BN1A 3P08A 3ENHA 4DBXA 4QOXA 3ENMA 4BL1A 4QMLA 1H01A 1O6KA 3O7LB 4HYSA 3POOA 5AJQA 1WVYA 2VUWA 4FNZA 4P2KA 2XIXA 2PVYA 2YCSA 3QZGA 4OTGA 4CFXA 4YC6A 2YJRA 5I9VA 4FICA 4I6FA 3FI3A 4FK3A 4FR4A 3R9NA 2XS0A 4XG2A 3LQ8A 3CKWA 4E1ZA 1YRPA 5KNJA 2PZPA 4G31A 3ZYAA 3IW5A 2I0EA 4B99A 4FKTA 4WHZA 5KHXA 2ZV9A 5ITAA 1P14A 4XP0A 2PVHA 3NIZA 3R1NA 4D0XA 2WXVA 5EDRA 3AT2A 3DLZA 1IRKA 2RFEA 2GU8A 3LMGA 4KS8A 1HOWA 4X3FB 3C0GA 2B9FA 3P79A 4QMSA 2W1CA 5IH6A 2HW6A 4NWMA 4E5AX 3F3WA 1SZMA 3UYSA 4QQCA 4DGNA 4I94A 4FKIA 4NM0A 4BICA 5AV0A 3I0OA 3DTCA 2PUUA 1QCFA 2VN9A 3HV4A 4ZOGA 4E4XA 3Q4UA 2WTWA 3W8QA 1PRYA 4BDGA 3CXWA 3IOPA 4RQVA 5JK3A 5KO1A 2C3LA 3NCZA 2PMIA 3KRJA 3O51A 5LMKA 4H58A 4ZY5A 5EQPA 4G6LA 4CFMA 2RF9A 4IJPA 3V01A 5KCVA 3WF7A 1GZ8A 4RJ7A 2W1DA 5CNNA 3NW7A 4XBRA 4P7EA 3EN4A 2NO3A 3BGQA 4FL2A 4EONA 2RG6A 4L7SA 1Q8TA 1WBOA 4C4JA 3PY0A 4WBBB 4EH9A 1FGIA 4EKLA 1VYZA 3OXIA 2RFSA 2JBPA 3GOPA 5CT7A 3UQCA 3ZONA 4MNEA 5IEXA 3BE9A 3UMWA 1R0EA 2ZM3A 2PSQA 4OUCA 3RK9A 4D2WA 5KMOA 2W9ZB 4R3PA 4BF2A 1H1QA 3I4BA 3E8CA 5LMKC 2R3QA 4XV1A 3VRZA 3D4QA 4IM0A 1OPLA 2PMNX 3ZUVA 5DI1A 1SM2A 3DAJA 3UZTA 4ZJVA 5DA3A 4ZLZA 3OF0A 5FQDC 4NFNA 3P86A 2Z7QA 4LOQA 3VUKA 3ZC6A 2E9NA 4UV0A 3PPJA 5LWNA 1GZOA 4USDA 4WNPA 3EN6A 3HECA 3RVGA 3V5JA 2C30A 3W10A 1YXSA 5K9IA 1YXTA 2WQEA 4JRNA 1PY5A 3K2LA 5HG9A 1XH5A 5FD2A 3O2MA 4DG0E 3A99A 2HXLA 2QLUA 3C4FA 2W06A 3PXQA 3KU2A 4IZYA 3II5A 4YJQA 2ZDUA 3OWLA 5BVFA 4DGOA 4RJ6A 1CKPA 2BAKA 3JY0A 2UW0A 5AA9A 2XRWA 3P78A 1YKRA 2C1AA 4N70A 4AAAA 1U5QA 4WSQA 2ZJWA 4AQCA 2YM7A 5AUXA 4G6OA 4OTWA 3EH9A 1M52A 4G3GA 1JKSA 3CQEA 3QZFA 1L8TA 1IA8A 4ZSEA 3KEXA 3WZJA 3UOHA 4C58A 4QRCA 1A48A 3W33A 4D55A 1KE7A 4XG9A 4BB4A 3FLSA 2X4ZA 3SC1A 3ORZA 3ET7A 2VWXA 4FSRA 4EH7A 1H1WA 4DEDA 2B0QA 4PY1A 4QO9A 3DS6A 2XK3A 4DFYA 3VS2A 4D4RA 4QYHA 4RZWA 2QO9A 2W5BA 4U41A 3OUKA 2WOTA 1OPKA 5T68A 5EQEA 1BUHA 2J2IB 2YACA 4FIFA 4KKGA 2YIWA 4PTGA 4QPMA 4FNYA 3ROYA 4PF4A 5CF6A 4EK3A 1PMEA 4GVJA 3D7TA 4I4FA 2VWIA 2VGOA 4B7TA 1QPDA 4A4LA 4W9XA 4ZSAA 1RE8A 5CT0A 5JEBA 3QTZA 1I09A 2OIDA 3N4TA 3AD5A 4FT9A 1PXLA 2VGPA 3FQHA 4DGLC 5DYJA 3VO3A 5EM5A 4IZ7A 1BX6A 1TQIA 2R3PA 3DK7A 3MFUA 3A8XA 3QRUA 4YC3A 4AOIA 4I41A 2VTPA 5IMXA 4JX7A 4TNBA 5C03A 1QPJA 2XCKA 3DXNA 2ZV2A 1P2AA 1FVVA 4U8ZA 1Y8GA 4XNEA 4IACA 4U79A 4ZY6A 4X7QA 3VUGA 3ZHPC 4D2RA 3F69A 5LMBA 3C4WA 3FYKX 4OTQA 5M4CA 3GENA 3BGZA 5DE2A 3MY0A 4FTTA 3UQFA 5HLWA 3C0IA 2AC5A 3C5UA 4WG4A 4ENXA 4EBWA 4E20A 5GIPE 4RRVA 3AC8A 4YPDA 3HAMA 5CF5A 5AP0A 2X0GA 5E90A 2JKOA 3KK9A 3D14A 3ZFXA 4CTBA 5FM2A 3SXFA 4E4NA 1FQ1B 4NM5A 4YR8A 3R8MA 4WSYA 3L9LA 4DN5A 5CVHA 5CENA 1PXMA 1Y57A 3AMAA 3EJ1A 3R30A 2X2MA 3KVXA 3V3VA 4N6ZA 4FI1A 4EHGA 4JOAA 4RJ5A 5IQGA 3OD6X 3D5XA 3F3TA 3Q4ZA 4QP4A 4XV2A 1SNUA 1VYWA 4XCUA 5DR2A 4QYYA 2CKQA 1J3HA 1U46A 2QOOA 1XH7A 4V01A 3QWKA 2G01A 3HRBA 4TL0A 3HMPA 3PVUA 4KRDA 5CWZA 3RAKA 2O8YA 4X2FA 4JDIA 2ETMA 2QR7A 3F9NA 4CV9A 4EHZA 4IX5A 3RNYA 3EKKA 1MRUA 1DS5A 2FSMX 4RBLA 2VTIA 5CLPA 3W2QA 3JR1A 5E8WA 4FG7A 4F9BA 3UO5A 5AR3A 4L00A 1VZOA 2QCSA 4ZSGA 3JYAA 1XQZA 2DQ7X 2JBOA 2R3HA 4WRGA 4YLLA 2R3KA 2XNNA 4IDVA 5ETCA 4USFA 5K4IA 2Y9QA 2F2CB 3LAUA 2G1TA 4RSSA 4MVFA 1V0BA 2JGZA 4YTHA 2C6IA 2GFCA 3LFDA 4MAOA 3CE3A 4Y5HA 4QTEA 4ORKA 2CMWA 4QMZA 5HNBA 2VO7A 2BDJA 3GCVA 4FT3A 2HWPA 4O96A 1GIJA 5IU2A 5L3AA 4I1ZA 1JSVA 2UW7A 3VIDA 3AC4A 4CFFA 3QKKA 3L8PA 2B55A 3IK3A 3OXZA 4J8MA 4LV8A 4GSBA 4OT5A 2XK7A 4A7CA 4I24A 4E8AA 3QKLA 3KCFA 4IVAA 1CKIA 3PTGA 4JLCA 2OJIA 3K5UA 5JFVA 2OZAB 4IM3A 4UXQA 5C4KA 5B0XA 2VTTA 4BFMA 2XKDA 3NAXA 5BMMA 4NEUA 3WOWA 4JIAA 5J9ZA 4CQEA 4MH7A 4S34A 3FMHA 4F4PA 3W2SA 3RNIA 1M2PA 4BDEA 1PXPA 4EHVA 4OW8A 1JSUA 5M51A 5CANA 1OPJA 1XH8A 3R7OA 3AD6A 3EQDA 4C3FA 2I0YA 3QTQA 4QTCA 4C4GA 5KHWA 2IVVA 3GVUA 3OT3A 4QP1A 5IH5A 1YDSE 4NIFA 3MA3A 3UVRA 4UY9A 3VN9A 3ORXA 3LXLA 3IW8A 4XG3A 3TNWA 1ZMWA 5AR2A 4L44A 1WAKA 4R3CA 3E8EA 3LFBA 4GV1A 4XEYA 1JAMA 5HD4A 5IMEA 3WF5A 3KL8A 4FSYA 5DIAA 2YAAA 3VF9A 3N9XA 5HOAA 4DINA 2PMOX 4FEQA 4TYIA 3VS6A 4M69B 3VS3A 4GG5A 5B7VA 4MF0A 5DFPA 3VC4A 2ONLA 4HNIA 5HBJA 3DJ6A 5EKNA 1J91A 4G34A 3LCKA 4G3EA 4KWPA 4BCGA 1Z9XA 4BCMA 3EFKA 3G0FA 1WBNA 4C4FA 4H36A 4MF1A 4DG2E 3LCTA 3ORNA 2R0UA 3HDMA 3H0YA 3QQFA 5FP6A 2PK9A 2QHMA 3U6IA 4UALA 2VNYA 3LIJA 4LM5A 1MQ4A 3BHYA 4DCAA 2J0LA 3KULA 2SRCA 4KIKB 4QP3A 3W2OA 2PVJA 2YABA 2XA4A 3VS1A 3NLBA 2B54A 4G16A 4YJUA 5HLNA 3AC5A 5IUGA 3CS9A 4QPSA 2QC6A 3SG8A 3WF9A 3ORIA 4GW8A 4IQ6A 4FL3A 1OL2A 4EOPA 3VBYA 3GXLA 3FEGA 3DXQA 5A14A 1XWSA 2R7BA 5EHYA 5E92A 2YWPA 3I5NA 4L6QA 5EI2A 3KXXA 3BX5A 1WVXA 5LVNA 4G17A 5LXMA 3T9IA 4Y5QA 3AT3A 4XX9A 1OIUA 3PJ8A 4K8AA 4UMTA 3RHXA 2CN8A 4WG5A 2RIOA 5AUVA 4A9SA 3VUTA 5BNJA 5K0XA 5M57A 4DFNA 2FB8A 3BV3A 4ZJIA 1OBGA 3OY1A 5D7AA 2FVDA 4D0WA 4J99A 3A60A 3OEZA 4UMPA 3AMYA 3PIXA 2J0JA 4YBKA 1P5EA 3R9OA 2R3GA 4RWLA 2OXXA 2HCKA 2JDOA 5HORA 5D9HA 4O7WA 3ATTA 3AQVA 5HBHA 2YM6A 5JT2A 4O2PA 3KRRA 2WU6A 4BY9E 4RG0A 5CASA 3R8LA 5FUTA 5CAUA 4FYNA 4DLIA 5GZAA 4IB1A 3ZFYA 2GNLA 1Q41A 4M15A 5I0BA 3PXKA 4YJTA 4KBKA 2WQBA 4M0ZA 3UVPA 4NW6A 1SVHA 3IW7A 4LL0A 1URCA 2ITWA 5CI6A 3UIUA 2X81A 4B8LA 3Q9XA 2OZOA 4KRCA 4AZVA 3SW7A 5IA3A 3SLSA 5KKRC 4OBQA 1YXUA 4J71A 4C4IA 4DEBA 1YHWA 4E6CA 3CCNA 2BAJA 2QODA 3VNTA 3U87A 3FPQA 1BYGA 1PXKA 3QCSA 5CU6A 5DT4A 5JH6A 3R7YA 4R7BA 1OGUA 2E9PA 4ZTHA 2QU6A 3W1FA 4EWHA 4YNOA 5IKWA 1K9AA 1B6CB 3DZQA 4O2ZA 4ZJJA 4EZ3A 5GZ9A 3KFAA 2ITVA 3MWUA 4LMUA 3QF9A 3GFWA 4PDOA 5J5SA 2JIIA 4FEVA 3QCXA 5GJDA 2PYWA 1IEPA 3E64A 4TZRA 5JQ8A 4XOYA 5DOSA 1H27A 2CNQA 4RFYA 2B9IA 2OLCA 3Q52A 2BZIB 5C26A 3VW8A 4YJOA 2WMBA 3WIKA 5C8KA 4WD5A 3IGGA 1H28A 4D28A 3MPAA 4L68A 3FC2A 4PMMA 3UOLA 4GVAA 5BVEA 2QR8A 3NUXA 4TRLA 2CNVA 4YTCA 4IB5A 5CQWA 3IECA 2HY0A 3F5UA 3CBLA 3C4CA 4G3FA 2UW9A 4BCJA 3C5IA 2JIVA 3MB6A 4WNOA 4X3FA 5BVKA 4C3PA 2ITUA 3EZRA 4R8QA 2QKRA 3TT0A 3IGOA 3OCGA 4FT5A 1U59A 4MD7E 2WTKB 3NW6A 4MWHA 2OXYA 1DI9A 3V5TA 3BCEA 2C3IB 3JPVA 1F5QA 4RVTA 5KMJA 4NZWB 4XJ0A 5E8SA 2IVUA 3MH1A 3S1HA 1XBCA 4PMSA 3W2PA 5BVNA 4CV8A 3SXSA 2J6MA 4O83A 2PZRA 2HYYA 1YOJA 3QUDA 5AADA 4Y83A 5HX8A 3QQHA 2GTMA 1FMKA 5HE0A 1YOLA 4MK0A 4J53A 2A1AB 4QTDA 4QNAA 1ZXEA 2GS7A 4QMQA 4F7LA 4AW0A 4AT4A 1YWNA 5IA2A 5C1QB 3ZDUA 2GNJA 2HELA 3R00A 4L52A 4BCOA 3K5VA 3FMMA 2BHHA 3F3UA 4C59A 2VWUA 2CN5A 5DBXA 4FIIA 4BTFA 5CEMA 2G2FA 5E8UA 4C02A 5CU0A 2J50A 5KMKA 2YLEA 5ANDA 4YGAA 5KMMA 4O7TA 2R3MA 4MQ2A 4TPTA 4X0MA 2X7GA 4W8DA 3RAHA 3EQFA 2R5TA 4M84A 3WIGA 4AGUA 3L9PA 2I0HA 3FLZA 5JZNA 3G15A 5AP7A 2CSNA 2HIWA 5I5ZA 4CFNA 2YM5A 3LQ5A 5KMIA 4O91A 5HU9A 4AZFA 3C4EA 1ZYSA 4BIEA 1CMKE 3RINA 3R73A 2Z7RA 2B52A 4MD9E 5E1EA 2OK1A 3WYYA 3TDVA 2ITZA 3UNJA 4GFOA 5B2LA 4ANQA 5AX3A 4D2TA 2YJSA 2W4KA 2JEDA 2O3PA 2WMUA 1BI7A 4XG4A 2GSFA 1PHKA 2VTLA 2OH0E 2R0IA 3QCQA 3D5UA 3QA8A 4LMNA 3FHRA 2IVTA 2P2IA 3BU3A 4JDKA 3ZXTA 4CMTA 4R6VA 2ESMA 5CEPA 5HZNA 3FZPA 5CALA 5EYDA 2BPMA 4YMJA 2R4BA 4P4CA 3SRVA 3ZS5A 4BKZA 4WUAA 3LM0A 1G8AA 2O5KA 2XNMA 4YHTA 1ZMUA 3IDPA 2QONA 4CMUA 2GQGA 4FOCA 2JITA 2W05A 3TUBA 2PULA 1OIYA 4GT4A 2YERA 5M53A 1U54A 2UZTA 3DB6A 4GK3A 3S95A 4JVGA 5F95A 3OW4A 2WTDA 5D7VA 1WMKA 4MEDA 4BCPA 2ITXA 5EI8A 4EK6A 4NM7A 5HGIA 4F9YA 2BRNA 4F0GA 3TXOA 4FIHA 3FI2A 4PDSA 2IZRA 2Y0AA 2WO6A 3VAPA 2C6LA 2PZYA 3VUHA 1KE8A 3ANQA 4PL4A 4O81A 4EC9A 1SVGA 5LARA 3DNEA 4CGAA 4D2SA 3OP5A 4XRLA 4TWPA 3OBGA 5H8GA 5HLPA 5TO8A 2H6DA 2B7AA 3E8NA 4BHZA 3PUPA 3FZOA 2IJMA 2YIQA 4UBAA 4WO5A 3VF8A 3V5QA 5T3QA 4CFWA 2C0TA 3DLSA 2XNGA 4IAYA 2V7OA 3H9OA 5ETIA 4E73A 3BZ3A 3CPBA 5CAVA 1K2PA 2I40A 4HYUA 4XHKB 5FXSA 3ORPA 3RAIA 4IZ5A 3COMA 2ETKA 4O7ZA 3TCPA 1NY3A 4FF8A 3RJCA 3F2AA 3O96A 1ZZLA 2RL5A 2C1BA 4FIJA 3RBWA 5AUUA 3NMUF 5CSXA 3D2IA 5KZIA 3LW0A 3HA8A 3LFAA 2W9FB 3HMMA 5CQUA 3WI6A 3U8WA 4M7IA 5ANOA 4RPVA 3G5DA 5AAFA 3UODA 4UX9A 1JWHA 4CT1A 3QC4A 3P23A 4GIIA 1JKTA 4PTEA 4EL9A 2QG5A 4DLJA 5BVDA 4EC8A 4CKJA 1DAYA 5HTBA 5EW8A 3NEWA 2R3OA 4CYJA 3ZSIA 5BUIA 5D41A 2GMXA 3PWDA 3QD3A 5GHVA 4AW2A 3THBA 4O7NA 4X6RA 2CGVA 4L46A 1KV1A 2I7QA 5FG8A 3P4KA 2YEXA 1OBDA 2VWBA 3GQIA 4FTUA 4RVKA 1RDQE 4Y85A 4YSMA 3SGCA 3MW1A 3SD0A 5HVKA 4EORA 3TG1A 4QYEA 2XZSA 3ZO4A 5F20A 2CCHA 4RX7A 5ANKA 4NK9A 1PXNA 1Z57A 2P33A 3GT8A 1R1WA 5EQYA 3PVGA 4G1WA 4NCTA 4WNKA 4YJPA 5AAGA 4O7YA 2HZNA 2V0DA 3EOCA 3V8TA 4WG3A 3F88A 2ITTA 3TNIA 3PXYA 4ACHA 3NWWA 3COKA 2UW6A 2OJ9A 4F1TA 2UVYA 2BIKB 2GPHA 1PMVA 4EH3A 2JFMA 3EZVA 3A4PA 4IAKA 2X7FA 1W8CA 2JLDA 4Y95A 2QI8A 3QQUA 3L8SA 5EG3A 3G6HA 3AC2A 2C47A 2CGUA 4UWYA 3PSCA 1ZLTA 3DDQA 1YQJA 1MUOA 2H34A 5L6WL 5CX9A 4PMPA 4C4EA 2ZB1A 4W4XA 3ZZWA 2ITPA 4NCTC 4C8BA 2R3RA 3FL5A 1GJOA 3OXTA 2OGVA 4K77A 4S31A 5AP2A 5HCYA 4BTKA 4FTLA 3VUIA 5L8JA 2BTRA 3ALOA 3CP9A 2VWYA 3FKLA 3PIYA 5FTQA 3LXPA 3PA3A 4F9CA 3NCGA 4O7RA 5HTCA 4TN6A 3MESA 3QD4A 4GH2A 2YIXA 3WILA 4YLJA 4GCJA 2OZAA 4MQ1A 4RIXB 5AP6A 3QUPA 5HTIA 4O1OA 1YXVA 2WOUA 1YWRA 3A62A 4F0FA 2C5VA 4O1PA 3R8ZA 4EQCA 4CG8A 3U9NA 4LL5A 3ZLSA 4KSQA 4YTIA 2WELA 4G9RA 4CLJA 3ZM9A 3DJ7A 2PHKA 4NJDA 2QNJA 4U6RA 3E87A 4BYJA 2ZV7A 4F6UA 5FTOA 2GHLA 5I9ZA 5L8LA 3EN5A 4YJNA 1G8SA 2QO2A 5CAQA 3JXWA 4S32A 4AZSA 3PE1A 3VUDA 3FBVA 2YCFA 3R2BA 2WMVA 4YU2A 3UVQA 5EOBA 4FL1A 5CAOA 2UW3A 2YISA 4MCVA 1WVWA 2XB7A 4JL9A 5A6NA 2CGXA 3TM0A 2DYLA 4D1XA 3R02A 2VU3A 4NJ3A 5F9EA 1H26A 4GRBA 1FMOE 1Q3WA 2XKEA 4QMUA 3OY3A 2XUUA 4GMYA 4D2PA 1WZYA 3QCYA 4G9CA 2F7ZE 5CF8A 3UMXA 3BYOA 2WQMA 3LJ0A 4R3RA 4U5JA 2PZ5A 5DG5A 4O21A 3R71A 2YZLA 3UTOA 2EXCX 5D1JA 1KE5A 2A27A 4KKEA 4TY1A 2JFLA 2WIHA 3OUNB 4ENYA 1ZAOA 3BLRA 3QD2B 3WBLA 4AOTA 2BR1A 4DA5A 1NVSA 4J97A 3CY2A 4J95A 4AG8A 2BROA 3G0EA 3OT8A 4U44A 1OKZA 5M4UA 1PMNA 2VTJA 2XEYA 3VBWA 2V7AA 5A4LA 2BTSA 4FTJA 4ZAUA 2WHBA 1WBVA 3PFQA 4R5YA 1DI8A 1UNLA 1YDRE 2IVSA 4DCEA 4FUYA 3Q32A 5KUPA 2GS6A 5EW3A 3GUBA 4QPAA 4BGQA 1JSTA 3DQXA 5IUIA 5A6OA 5ICPA 1RQQA 4R5SA 2BHEA 2XF0A 4EOMA 3PJ3A 4AACA 2OKRA 3H9FA 3RPOA 4JXFA 5FXRA 2QLQA 3E7VA 1CKJA 4FGBA 4KIPA 1UKHA 4JBVA 4PUZA 5ANJA 2YDKA 4DFZE 4IFGA 3K3JA 4RIOA 5CAPA 3LLTA 5ANEA 3F5PA 3MFTA 5AIKA 5DR9A 4BIBA 2QURA 4XV9A 4DYMA 5HG5A 3B8RA 5L2IA 2OFVA 3UG2A 5AR8A 3CGFA 3DPKA 5DEYA 4MD8E 4BCFA 3UC3A 4N57A 2WTCA 2BALA 3FAAA 3HMOA 1IASA 4OR5A 4BDFA 1H25A 1Q8ZA 3R83A 3SW4A 3QQGA 2UZUE 4FIEA 3EQGA 1H8FA 5BMSA 4P90A 4O22A 5JGAA 4AA0A 3V6RA 3WZKA 3TJCA 4A4OA 1ZARA 2QO7A 2A19B 2E9VA 2XJ1A 4YJSA 2XK9A 2XNBA 2BRGA 5HD7A 5I3OA 2GQRA 3FMKA 2O64A 3OEFX 4L45A 4O6LA 2BDWA 5IQDA 1KSWA 5AEPA 2CKOA 3ODZX 3ITZA 2QOCA 3CEKA 4FTCA 3TDWA 1OKVA 3O7LD 4ZZOA 2C5OA 3MIYA 1WBSA 4V05A 4W4WA 3F2RA 3LMIA 3TUCA 3HMIA 1Q4LA 3CQWA 3ZC5A 2OXDA 3ZSHA 4DEIA 3TZ8A 5BX0A 1M7NA 1OKYA 1Q24A 1ZYCA 3DU8A 3P0MA 1SMHA 5KMNA 4UWCA 1UU7A 2YHVA 4D4VA 5E8XA 4RWIA 1RW8A 4F0IA 5EHLA 4FZ6A 4F08A 4DTAA 4RX9A 3E3BX 4ANOA 1XR1A 3QTIA 3BHUA 2QOIA 4AP7A 2V55A 4AA5A 4QMNA 5LOHA 1YI6A 4IAZA 3FZTA 3LFFA 2XBJA 4JQ8A 3ZSGA 5JFSA 2XNPA 5IG1A 4J7BA 5M4IA 2W7XA 2F49A 4PTCA 5D12A 5A4EA 3A7GA 2HW7A 5HEZA 2Z8CA 3RGFA 2CLXA 3MPMA 4ZMEA 4FKOA 3K54A 3LJ1A 5HHWA 2C5YA 2A4LA 2W1HA 3RZBA 4ZLOA 3V5LA 3PPZA 4APCA 3CTHA 3D2KA 5CU2A 4RFZA 5CY3A 4A9RA 5HCZA 1K3AA 4EH2A 4AFEA 3CJFA 3O0GA 4D1ZA 3W32A 4NL0A 3NNUA 2XRUA 4BRXA 4QT1A 4Y72A 4N4SA 3SOCA 1JKLA 4D9TA 1H0VA 4KABA 4MXOA 3DK3A 3ZCLA 4PRJA 5BVWA 4F7JA 2NPQA 3RPSA 5TE0A 3GCQA 3GQLA 4FKVA 4X2GA 4AN9A 5DT3A 2DUVA 1BL7A 4AN3A 2XM8A 4ID7A 4MBJA 3UQGA 2XH5A 3ZLYA 1YI3A 3KY2A 3FJQE 3PLSA 3D83A 1NXKA 2A2AA 4FTRA 5M09A 3ODYX 3BWJA 3U54A 3BLHA 4WNMA 4ZSLA 3F2NA 1Q5KA 3HV5A 4M8TA 3RCJA 1UNGA 2XVDA 4D58A 3QXOA 1H08A 1GOLA 3L8VA 3QQKA 2UW5A 5HO8A 3LPBA 3RM6A 2R3JA 3DKGA 3ZU7A 3IO7A 4EOSA 4F63A 1YW2A 3ZM4A 4AA4A 2VZ6A 3QBNA 5BYZA 4R7HA 3Q9ZA 2WEIA 4GL9A 3QL8A 2WTJA 4E7WA 4EOOA 5J1VA 3OWPA 4EH8A 4MXAA 3PP0A 4FKPA 4W4YA 3GOKA 2CKEA 2OW3A 3FZRA 4G3CA 3CD3A 1V0PA 2IO6A 4CMOA 4QTBA 1OVEA 1S9JA 2PVFA 3DDPA 3QX2A 4JQ7A 4BR3A 1Y6AA 5AWMA 4EQUA 2XIYA 4PNIA 3PJ2A 4DTBA 1F0QA 3QFVA 2QU5A 2F7EE 4B8MA 4DFBA 3VS5A 3FY2A 4CCBA 1OI9A 2OI4X 2ERZE 4FSQA 1GIIA 3MVMA 4MXCA 5LMAA 5H9BA 4BZOA 5JGDA 4IX4A 5AP3A 3QYWA 2ACXA 4EZ7A 4AE9A 4TTHB 4I0RA 3LVPA 4OT6A 4UXLA 3KXZA 3M11A 3R8PA 3DNDA 3QD0A 4ASXA 5IEYA 4JBOA 2ITQA 2W99B 5I9YA 4BI1A 3ZRKA 2VTMA 4KIOA 4W9WA 3OG7A 3DA6A 5E9EA 3PIZA 4FSZA 2RSVA 4XMOA 3EFJA 3GNIB 5HBEA 3HDNA 4PDPA 4F1MA 3A8WA 3TNQB 4HVGA 1UU9A 1LR4A 3GC8A 5J95A 5TR6A 5I9WA 3PA5A 4HGEA 2PE2A 1XKKA 3I6WA 5CEQA 5J9LA 3HYHA 4YZBA 4JDJA 3G6GA 4NTTA 4CEGA 1BL6A 3TI1A 4FGRA 2PVNA 4BDCA 3N4UA 3SVVA 3OOGA 5J79A 2JDTA 3C51A 5FBNC 3UIBA 3KREA 1ATPE 4JNWA 1Q97A 2A0CX 3POZA 1YVJA 2BVAA 2OICA 1PYEA 2W1FA 4RMZA 2UZNA 5C01A 1GNGA 4L3JA 2XK4A 4ONAA 4IJ9A 4E3CA 2HY81 1UV5A 4UYAA 2X9FA 4ZS4A 5DH3A 3R7IA 5JKGA 4BDDA 2R2PA 4HGSA 2VTQA 4II5A 4OBOA 4IVCA 5KZ0A 4OTRA 4RVLA 4XLIA 3Q3BA 3UJGA 2UW4A 4JI9A 3HX4A 4F9AA 4H05A 5L2WA 1ZOEA 2WMXA 4DBNA 3UZRA 4M67A 5DN3A 3DKFA 3RAWA 3COIA 4AZWA 4U9AA 4Z9LA 3EQCA 2J5FA 3NAYA 3ULZA 2Y4IC 3OBJA 4I5HA 3UO6A 2W17A 3R63A 3BYVA 3E62A 3TV7A 4F64A 2EXEA 4C33A 1XO2B 2VTHA 3DBDA 2PZIA 4L43A 5IPJA 5EFQA 3IDCA 3O8PA 5EYKA 2G9XA 2XIRA 5CVFA 2X2KA 3DK6A 4FYOA 4A9TA 3D7ZA 4FKJA 3ZO2A 4MXYA 2GS2A 3I5ZA 5FTGA 1OL1A 2XIKA 3W16A 4NM3A 3Q2JA 4IXPA 1ZZ2A 2B4SB 2ONLC 1MQBA 4BCIA 5GNKA 4FV9A 4FOBA 4DFLA 1EH4A 2OIQA 4E26A 3ZTXA 2BKKA 3DBCA 5C9CA 3QTRA 3NX8A 4GK4A 4S30A 4BDHA 2C3JA 3DBFA 4JX3A 4FKGA 2PUPA 2HENA 4L3LA 4NTSA 3O71A 2FA2A 4TWCA 4BI0A 3R9RA 3TV6A 1VEBA 5BYLA 1J7LA 3FMJA 4H3PA 4KA3A 5CSHA 3JVSA 3QXPA 4FKRA 4LOPA 4U81A 5CU3A 5FDXA 4C2VA 4M13A 3UP2A 2J5EA 2NRUA 2WMWA 5HICA 2OG8A 4AGCA 3PZEA 3MBLA 2B1PA 4BCQA 3SHEA 3NR9A 5J87A 2J90A 2HK5A 2JAMA 3MFSA 3F3VA 5M44A 2RFNA 2WMTA 5DWRA 1LPUA 3MY5A 5DT0A 4A4XA 1AGWA 4AN2A 4LRMA 4JDHA 4IZAA 1OM1A 4K11A 2FSLX 3Q6UA 4JG7A 1B39A 3QKMA 5A4CA 5CS6A 1PXOA 3I6UA 2PWLA 1YDTE 5JZJA 1OIQA 3IOKA 3L1SA 4ANLA 4GS6A 3H3CA 3TJDA 2UZVA 4P5QA 5HKMA 3FY0A 5KX8A 2PUNA 4YJVA 4IWDA 4J98A 4BCNA 4H1MA 1Q8WA 3I0QA 3NNXA 3RK7A 1ZY4A 2BAQA 1H1SA 2R3NA 3RTPA 2HAKA 4OTFA 1OECA 4JT3A 2ERKA 2VX3A 1IAJA 3TZMA 4M97A 5IA0A 4FTNA 4EK4A 2PU8A 2C6MA 4BTMA 4MXZA 4WUNA 2W1GA 1DM2A 1FVTA 4R1YA 4YLKA 5FM3A 4CKIA 4ZTMA 5JQ5A 5TOZA 2P2HA 5CZIA 5L8KA 4M0YA 4FV1A 4DGGA 3U4UA 3GC7A 3C13A 3RHKA 4CFVA 3CLYA 4ASEA 4B0GA 5IQAA 3S0OA 3QQJA 2EWAA 1M17A 3SX9A 3LKMA 4AGDA 1UA2A 5HU3A 4W4VA 2Q0NA 2WD1A 1X8BA 3FV8A 2UZBA 2NP8A 4HVSA 5TT7A 2YWVA 4ZMFA 5AUTA 3UDBA 3FHIA 2XNEA 3TKIA 2JAVA 4O0SA 4OLIA 3F82A 3CY3A 2AUHA 5L6OA 4E6AA 3NYOA 4AX8A 5AR4A 3OFMA 4FTIA 4A9YA 2F4JA 1CDKA 2BZJA 3FLQA 4KNBA 3EN7A 4E93A 2X7OA 1WBWA 4ZP5A 3O50A 3MTLA 1NA7A 2C6KA 2OJFE 4HVHA 4WOVA 5HIBA 3IQ7A 3F5GA 3WARA 2QOBA 2ZDTA 3ZLWA 2EXMA 3KXMA 3PXZA 3ZZEA 4QP7A 4BTJA 3OMVA 2JDRA 2WMAA 4R78A 2C6DA 3R0TA 2Z7LA 4ANNA 5HVJA 3U51A 5IA1A 3H4JA 3HUCA 4FTAA 4IBMA 4X3FC 1W0XC 3ZOSA 3IW4A 5IQHA 4AW1A 4OAUC 3ZFMA 4ANMA 2PUIA 3VBXA 2KULA 4AU8A 5AV3A 3HA6A 5AV1A 1UWHA 4X21A 3VQHA 3R01A 3A7IA 2CJMA 5AUWA 3AGMA 4I22A 2O65A 1H1PA 3WZEA 3ZXZA 2WB8A 1JQHA 4ACCA 4EOQA 4WRSA 3NNWA 5I9UA 5FDPA 5J1WA 4YURA 5CXZA 3PXFA 2IW6A 2VTRA 4WIHA 3PPKA 3CGOA 4RIWB 2OF2A 2AYPA 2Z2WA 4FSWA 3PYYA 2EB2A 2CCIA 4BBFA 2IZTA 3U4WA 3ACKA 4LV5A 3VWAA 4LUEA 4C2WA 1H00A 4FV4A 5IH4A 2C6TA 3L8XA 4L53A 3HV3A 2UZOA 2F57A 4IE9A 3W18A 3UYTA 4Z3VA 5IISA 5CEKA 2YDIA 3SOAA 4C62A 1OKWA 4EYJA 3R6XA 2IW8A 4F6SA 5A54A 2UVZA 3GP0A 4X2JA 5ETAA 5AP1A 4KINA 3R1SA 2J0IA 4BCKA 4KIQA 2CDZA 2J4ZA 3GCSA 2C68A 2PVKA 4X2NA 3T8OA 3VQUA 1M2QA 3WYXA 3T3VA 4BGGA 4E4MA 4YZNA 3U6JA 1R39A 4BYIA 1XH4A 2CNUA 5CSVA 1FVRA 5LVPA 2E2BA 4KBAA 1OMWA 3KMMA 5DHJA 3PZHA 3QX4A 2XK6A 1PXIA 3HRCA 2GCDA 3COHA 4EH6A 3IDBA 4HCVA 4E5BA 2PE0A 4OGRA 5J9YA 4AOJA 5FRIA 4RA5A 2X8EA 4AFJA 3GGFA 2B9JA 3OZ6A 4BDJA 3LJ2A 3MI9A 2RG5A 3Q4TA 3T9TA 1JNKA 3R04A 3NGAA 5G6VA 4FZFB 3UZPA 4R77A 4HNFA 3O23A 5EM7A 4GT5A 3FSFA 4XS2A 2ZMDA 4IAIA 4I5CA 2UUEA 1HCLA 2IWIA 2W5AA 4OBPA 3VBQA 3ELJA 3ANRA 4FG8A 3FXZA 2CLQA 3QU0A 3V04A 4EJNA 3IW6A 4ZIMA 4FV0A 4USEA 3MJ1A 3KQ7A 2PVMA 3QALE 4KD1A 2X8IA 2HXQA 5GJGA 5EYCA 4QMYA 1IR3A 4ITHA 4K9YA 4YPSA 2XBAA 2OSCA 1T45A 1VR2A 5A4QA 1Q62A 2XK8A 4UMUA 4JAIA 4GU9A 4JS8A 4RJ3A 5E7RA 5BQ0A 5FWKK 4HJOA 5HNGA
chains in the Genus database with same CATH superfamily
2J51A 3OROA 3MYGA 3EIDA 3F5XA 5F1ZA 1ND4A 4HVIA 4FUXA 1R3CA 4X6QC 1FGKA 3ROCA 4ALWA 4S33A 2XKFA 3N4VA 4GIHA 4FEWA 1YXXA 1UWJA 4J96A 4LV7A 5EK7A 3AGLA 4NIFB 4PL5A 2VNWA 4I6HA 2RKUA 4PV0A 3NUNA 4GG7A 4ACGA 2NRYA 4ZZMA 2JKKA 5TF9A 3QUEA 2EB3A 2XKCA 3EFWA 4H39A 3HRFA 3MDYA 1HCKA 2O0UA 1J1BA 2DWBA 4ERWA 1KE6A 4UYNA 5H8EA 2F7XE 4ZTNA 2YLFA 3S4QA 4XP2A 4FKQA 4TXCA 5M4FA 4IVBA 5TKDA 2G2HA 3BBTB 4QMVA 3AMBA 4JG8A 3TIYA 4O0YA 2GNFA 4UZDA 5D10A 3V5WA 5E8ZA 3R7EA 2QVSE 3P9JA 4PNKA 3R21A 1R78A 1GIHA 4WBOA 4K18A 3MIAA 3FI4A 3NIEA 3S00A 5BUEA 4YBJA 1XJDA 3R28A 4YSJA 2FGIA 3CR0A 4LGGA 5KBRA 3NVMB 5H2UA 5CTPA 3KULB 3ZEPA 4ANBA 4DHFA 4F09A 3U55A 5IA4A 4FSNA 5E8VA 3DKOA 1STCE 3QGWA 3RWQA 1ERKA 3A2CA 4NKSA 4UMRA 2I1MA 2JD5A 5JFXA 4PL3A 4FSTA 4J1RA 3NSZA 4ZEGA 4G5JA 3I81A 1W98A 4DHIB 3ALNA 2QOHA 4AS0A 4IIRA 4CZUA 5CI7A 2GHMA 2P55A 4JBQA 4AF3A 2VO6A 2YCQA 3OW3A 4FKSA 5GINE 3CD8A 3QTWA 2W1IA 2IN6A 2VO3A 3HLLA 4UEUA 1FPUA 3C4XA 4FTOA 4LFIA 4RZVA 4IW0A 4YZCA 2GNGA 3TIZA 4CVAA 3S3IA 4DH3A 1JPAA 2G15A 3QC9A 5F4NA 3MH0A 3M1SA 4OTPA 4M3QA 4DFUA 4K33A 4XYFA 5DRDA 5T6KA 4QP8A 3LFSA 3OC1A 3RALA 3PE2A 1Y6BA 2WTIA 4O0VA 5FP5A 3HGKA 1W82A 3FQEA 3S2PA 5KBQA 4DFXE 4TKSA 3OTVA 1GAGA 4O6EA 2BUJA 4EH4A 4S2ZA 2Y7JA 3D9VA 1Q8UA 4GJ2A 4EYMA 4C0TA 3BGPA 5HO7A 1IG1A 3GU6A 3NUPA 5C27A 3HV7A 4I6QA 4LUDA 2XMYA 4RWKA 3TEIA 2GTNA 4AXFA 2BRHA 2X2LA 3MA6A 2BFYA 4C36A 4HW7A 3DOGA 4IWPA 4BBMA 3KB7A 3RM7A 1TFFA 4NU1A 4BKYA 2IG7A 4PPCA 1OITA 3MH3A 3EHAA 1UU3A 4MXXA 4ZZNA 3DJ5A 4O0TA 3PY1A 2O63A 3KRWA 4GYIA 4R1VA 2PPQA 2ITNA 2WTVA 4V0GB 1IAHA 5FLFA 4MBIA 4TWOA 3Q2MA 4DH5A 4L8MA 4EBVA 3HVCA 3G51A 2VAGA 4M69A 3T3UA 4BHNA 1Y8YA 4U7ZA 1NW1A 3LHJA 5J8IA 3DAKA 2E9OA 3QRKA 3NRMA 3MVLA 1PKDA 3LFQA 1XMMA 2ZM1A 4DEAA 3R8VA 2UVXA 3GI3A 4E5WA 2B53A 3ORTA 4RIYB 1J7IA 1OL6A 4DE4A 4EEVA 4LDTA 3IKAA 4CXAA 3FI8A 3DBQA 2PVRA 5AP4A 1F3MC 5JN2A 5HE1A 3KXHA 4C37A 3HMNA 5FGKA 3TACA 1OL5A 3EYHA 2XP2A 3MVHA 4QP6A 4IWQA 4PDYA 4FTQA 3PLAE 4UMQA 4MKCA 4TWNA 4DITA 4KIKA 5LJJA 5LVMA 4DT8A 1AD5A 3HEGA 3UPXA 1PJKA 2Z02A 3BU6A 4FA2A 1XHAA 4L3PA 2XYUA 4O0XA 4U45A 4LI5A 5IQCA 2ZVAA 1APME 3P7BA 4EK8A 5I3RA 5L2TA 3Q5ZA 4RJ8A 4XG7A 2QOLA 3OTUA 3O8UA 2OFUA 4HCUA 4YZMA 4RC4A 5EH0A 3KF7A 2J9MA 3QA0A 4RJ4A 3AXWA 3F66A 4FG9A 4APPA 2HOGA 1S9IA 3DZOA 3RP9A 4DEGA 4DH8A 5HIEA 3DGKA 2JC6A 3F6XA 3KRXA 1YI4A 4U0IA 4ZLYA 3PWYA 3UPZA 2PMLX 1V0OA 2HZ0A 3PVBA 4U40A 2VV9A 3KK8A 2PE1A 5IDPA 1KWPA 5CYIA 5K4JA 1WBTA 5DEWA 1OIRA 4D4SA 2R3LA 3FSKA 3PXRA 4E6DA 3VULA 3SG9A 3G9LX 3VHEA 4F99A 4DEEA 4Q5HA 2Y4PA 3A7JA 3EL7A 5AR7A 1AQ1A 4TYJA 2EVAA 4C38A 5DMZA 3SXRA 1CSNA 2XM9A 3W8LA 3LFCA 4E6QA 4EJ7A 3A7HA 3AKLA 4ALVA 3ZDIA 2P4IA 3BWFA 4EOJA 3ZBXA 1XH9A 4CQGA 4O4EA 3ZO1A 4ACDA 4IAAA 3TKUA 2GHGA 3PSDA 3Q60A 5I9XA 3AOXA 1RJBA 2VWVA 4IX3A 4D5KA 2FSTX 2A98A 4MUQA 3Q4CA 3QLFA 4BKJA 4PWNA 4O82A 5CNOA 3GU4A 3C50A 4HCTA 2O2UA 5DGZA 4U3YA 2IZSA 3AC1A 3RCDA 1YWVA 4I0TA 3PA4A 3UOKA 3KC3A 3QAME 4GU6A 4FVPA 4FT0A 4RT7A 3E8DA 2BRMA 3BL7A 1L3RE 2WMQA 4FK6A 3VRYA 3KA0A 3Q53A 5AAEA 1Z5MA 4OTHA 3EB0A 2C6OA 4IWOA 4GK2A 1PW2A 3L9MA 4FKLA 3MSSA 3G90X 3BKBA 4O0UA 3OWJA 4H1JA 3R7GA 3SAYA 3SKCA 2J7TA 4M14A 4YHJA 3OCBA 3SRVB 3LMHA 4UB7A 4YHFA 4FEXA 2C69A 5EW9A 3E88A 5ANGA 2WQNA 4FC0A 4GFMA 4FODA 4RA4A 4IAFA 4ITJA 3NVKI 3LLAA 4EOIA 1U54B 1OB3A 2LGCA 2OWBA 3ORLA 5HG8A 5IQBA 2BZHB 4EQMA 1SYKA 4BVUA 3UG1A 1T46A 4H3QA 1GZNA 4IDTA 2J0KA 2QOKA 4Q9SA 2VTOA 4G6NA 1OZ1A 1TQPA 4LGDA 2XARA 4GFGA 4P5ZA 1KOAA 2J0MB 4HZRA 5AP5A 5HX6A 3JY9A 4FE2A 3MVJA 4I6BA 4CRSA 2FYSA 3BV2A 3AKKA 4IFCA 3R1YA 2WU7A 4IB3A 4B6LA 4AT3A 3DAEA 3UE4A 4EHEA 2XIZA 4EZ5A 4ARKA 4NT4A 4FT7A 4YC8A 5LQFA 5EDQA 4QQ5A 5E91A 2FSOX 1WBPA 2RFDA 2WNTA 3ZUUA 3AT4A 4BDBA 2W5HA 3BIZA 3GU8A 3LXKA 5EKOA 4BC6A 1FINA 2WFYA 3GU7A 2ZM4A 4V04A 4XP3A 4EWQA 4QQJA 3MJ2A 4U43A 4RX8A 2QQ7A 5EDPA 4CNHA 1ZRZA 4L42A 1WCCA 3I7CA 3LCDA 3NZ0A 3QHWA 4GUBA 3IONA 3LCOA 4LRKA 2WTKC 3O17A 5F94A 3WF8A 5LCJA 2X9EA 5EYMA 2VTSA 3P5JC 3B8QA 4O27B 5GJFA 5HESA 3FXWA 4XUFA 3SQQA 5ACBC 3MFRA 5AV4A 4A9UA 4Z16A 3I60A 4RLLA 5C8MA 3VVHA 1XBAA 2WKMA 3NYXA 2JDVA 4CKRA 3P1AA 5AR5A 3U9CA 2I6LA 3BYSA 4RIWA 3BE2A 2UZLA 3LFNA 5CU4A 3TTIA 2ZYBA 1UVRA 4HPTE 3PRIA 4JR7A 5J7BA 3R22A 3OVVA 2X8DA 3P7CA 1W83A 3KGAA 4C61A 3QWJA 5HQ0A 5CXHA 3BHVA 4AW5A 3MN3A 2B9HA 3FZSA 4HZSA 4MBLA 3U6HA 4EI4A 3UP7A 2OF4A 3DKCA 1MRYA 2UV2A 4D2VA 5BYYA 2WAJA 1KOBA 4K2RA 5HVYA 4TYHB 4ASDA 4D9UA 4IX6A 1Q99A 1ZYJA 5A4TA 3CTJA 5L4QA 5FXQA 3UIXA 4L67A 3JUHA 2OU7A 2Y8OA 3LFEA 2FUMA 3E7OA 3GCPA 4GYGA 3KRLA 1QPEA 3R9DA 2C4GA 2VTAA 2X1NA 4G2FA 4I23A 4K6ZA 4DC2A 4F6WA 4F7NA 5JRQA 1H0WA 5HO6A 3HZTA 4KUJA 3D0EA 3LCSA 2V5QA 2W4OA 2UZWE 4YJRA 4ASZA 5HNIX 1LUFA 4O7VA 2IZUA 2V22A 3C9WA 3TKHA 3ZLXA 3BELA 2REIA 2XJ0A 4CTCA 3KN6A 3IS5A 5M06A 1SNXA 2YM3A 3RMFA 3NW5A 3PG1A 4NSTA 3M2WA 4EK5A 2GNHA 4ERKA 3MH2A 4FX3A 4ITIA 4C34A 3QTXA 3FDNA 3KKVA 3R7UA 2VRXA 4K1BA 4FKUA 2ZV8A 3EL8A 1KV2A 3D5WA 3ACJA 3BYUA 4I5PA 3FYJX 4H3BA 2Z60A 5LVOA 4FSUA 4HGTA 5IF1A 3NDMA 4YTFA 3V8SA 3EQRA 3VBVA 3RWPA 5DLSA 3ZH8A 5IQFA 2CHLA 2Y6MA 1JVPP 4EOLA 4CZTA 2YAKA 3RK5A 3KMUA 3MB7A 1VJYA 2XYNA 2VX1A 5K5XA 3LZBA 5AUYA 3F3ZA 1FOTA 4ZTRA 1KUTA 4D1SA 4LGHA 3OCTA 5D11A 5KMLA 5FEQA 3Q6WA 4PX6A 1E1XA 1PXJA 4ZTQA 5AM7A 4QMWA 1Q3DA 3BLQA 4IH8A 4HGLA 3VUMA 2PY3A 1TQMA 4B4LA 5IEVA 5DR6A 2BMCA 4PPBA 4JQEA 4EH5A 3NUYA 5K0KA 2YIYA 2ITOA 3NUUA 1QL6A 4RVMA 3GEQA 3ZRLA 3PVWA 4I92A 1SVEA 3FLWA 4OTIA 5AM6A 3UOJA 5CF4A 3PSBA 4CD0A 3PJ1A 5IUHA 1QPCA 3MS9A 1MRVA 5LVLA 5LWMA 3CPCA 3FQSA 4X3JA 3WZUA 4QMOA 4XV3A 4BWXA 5IA5A 3PJCA 4K0YA 5HE2A 3KN5A 3PP1A 5HE3A 3MY1A 4LG4A 4DH1A 3QTUA 5AV2A 4O0RA 1QMZA 2V62A 2QHNA 4UZHA 3BBWA 1NT2A 2ZAZA 4KAOA 4W8EA 4Y73A 2PVLA 2UZEA 4AZEA 2CGWA 3EMGA 4Z7GA 3TZ9A 3L9NA 1BKXA 4C57A 4PPAA 1ZOHA 2WQOA 3QLGA 1U5RA 1A9UA 2Y6OA 5HI2A 4XBUA 3F61A 3E5AA 1H1RA 3GCUA 4IHPA 4L9IA 2BDFA 2R9SA 1M7QA 4XG6A 5FBOA 4CT2A 2QKWB 5HIDA 2X6EA 5K5NA 5HCXA 3AC3A 3OS3A 1FBNA 3QTSA 1OUKA 2IF8A 4BZNA 4ALUA 4UWBA 5JRSA 1PYXA 4QMMA 4AWIA 2Q83A 5I4NA 1G5SA 3KXGA 3E92A 3I1AA 2QOFA 4LYNA 4ZK5A 3VHKA 4BZDA 4YO4A 2ZB0A 4FSMA 3ORMA 3SV0A 2G2IA 1O6LA 2H96A 2UW8A 3HUBA 3D94A 3W2RA 3RPVA 5J5TA 1URWA 2BIYA 2XJ2A 3CIKA 4OTDA 2YFXA 5M07A 3BEAA 3CKXA 3LE6A 3QZHA 4YZ9A 3A7FA 4U97A 3GU5A 3C4ZA 4F65A 2WZJA 3GC9A 3UDSA 4QNYA 4QP2A 3FKNA 3UNKA 5H3QA 2W1ZA 3DBEA 4MNEB 1E1VA 2F2UA 3QZIA 4AZTA 4HPUE 1JKKA 3FUPA 1GY3A 3W55A 5EM6A 4FV2A 3TUDA 4BWPA 4NW5A 3ML1A 5FEEA 4IMYA 3TN8A 3P7AA 1UNHA 4YUQA 3SA0A 4PP9A 1Q61A 1NVRA 4I5MA 4QDEA 3EWHA 1Q8YA 4RLKA 3H10A 4BDAA 4FIGA 3CQUA 5M56A 4HYHA 4FV6A 4I20A 4U42A 1YOMA 2XNOA 4CZYB 2YA9A 3N51A 4JJRA 4RIXA 2EUFB 3EQPA 3TL8A 1PKGA 3OCSA 5CSWA 3TTJA 3DFAA 3VBTA 4DH7A 3M42A 5E8YA 5AFVA 5CVGA 1M14A 2E9UA 4ZTLA 3AKJA 2CKPA 4JIKA 2JIUA 4YNEA 4BBEA 1ZY5A 3O8TA 4O7SA 2C0OA 1ZOGA 4FVQA 3HP2A 4IVDA 4MHAA 5AUZA 1G8KA 3BPRA 5HG7A 4PQNA 1BMKA 3QHRA 4Y8DA 5IQEA 4RWJA 3Q96A 4A06A 4CG9A 4BI2A 3DTWA 5ETFA 4X2KA 4KKHA 3KMWA 3FLNC 4V0GA 3PRFA 2ETRA 3DV3A 4TYGA 5EM8A 4E4LA 4EOKA 4F70A 4FV8A 2HWOA 1B38A 1U4DA 1J1CA 4DAWA 3EYGA 3NUSA 3W2CA 3JVRA 4NYEA 1R0PA 2YIRA 2QD9A 3HL7A 4KSPA 5KE0A 4O84A 3E3PA 3ORKA 2WPAA 4G3DA 4U80A 5J7HA 1G3NA 4RC3A 1JOWB 4XG8A 5ANIA 2C3KA 4RIYA 5AA8A 3CC6A 5BUJA 4RX5A 4C7TA 3RPYA 3C1XA 4TT7A 4Z7HA 3AG9A 1Y91A 4ZS0A 5CSPA 5AMNA 4BDKA 4QMTA 4BIDA 5CEOA 3Q5IA 4HYIA 2Z7SA 3CJGA 2VTNA 3Q04A 4CCUA 4AUAA 4CRLA 5GZ8A 3D7TB 2R3FA 4NH1A 4AE6A 4DTKA 5B2MA 4GKHA 3ERKA 4JG6A 5A46A 1UU8A 2XCHA 3TNPC 3F7ZA 4GT3A 3VJOA 2YCRA 4DGMA 3VS7A 3GFEA 4FNWA 3ZEWA 3SDJA 4AXAA 1OUYA 3GC0A 4GEOA 4HVDA 5E4HA 3DB8A 3ZMMA 4IEBA 2ITYA 3HAVA 5BPYA 4NUSA 3KF4A 4QTAA 4ZSJA 3RZFA 4MWIA 1YHSA 4IC8A 4O38A 4J8NA 5K3YA 3EKNA 4IANA 3UIMA 4A07A 5M08A 1TVOA 1P4OA 3BRBA 3R9HA 3E63A 4I4EA 4FEUA 2EU9A 1PMUA 4CFUA 1O9UA 2BILB 5JSMA 5L6PA 1V1KA 3PDTA 1O6YA 3P5KA 3FMLA 2NNWB 2W1EA 1OL7A 2I0VA 3BI6A 4RQKA 3D5VA 3ULIA 4QQTA 3R2YA 4FVRA 4GUEA 2P3GX 2W0JA 3GB2A 4L7FA 3TWJA 1ZWSA 1LEZA 4N0SA 4F7SA 5DVRA 5EI6A 3C7QA 3RPRA 4I0SA 4GKIA 4TYEA 4L01A 2YITA 5DPVA 1TKIA 2QG7A 4IC7A 4QMPA 3EQBA 1LEWA 3NS9A 4C35A 3ZO3A 2PL0A 4FTMA 3W0OA 5BV3A 3VS4A 1J7UA 1JLUE 4TNDA 4QP9A 1REKA 4Z55A 4HOKA 4R7IA 4WKQA 2WGJA 3V5PA 2HZ4A 3QYZA 2JKMA 2OJJA 1JBPE 2X4FA 3A4OX 4NKAA 5AIRA 3DT1A 3FL4A 1PF8A 2VWZA 3I79A 4O0WA 4BDIA 4D4YA 3I7BA 3MTFA 2X6DA 3UBDA 4YO6A 4AT5A 3MGYA 4C3RA 4BCHA 2FO0A 2VWWA 3FKOA 4N6YA 3UC4A 4BWKA 4RGJA 2F9GA 4MYGA 3BQCA 4LRJA 5GIOE 4I93A 4DF3A 3PY3A 3H0ZA 1H24A 3EN9A 2C5NA 3REPA 3V51A 4ANSA 3NUAA 2OIBA 2YM8A 4FZDB 1XH6A 3BHHA 1XBBA 4WT6A 4XLVA 4B9DA 3MPTA 4J52A 1A06A 4AGWA 4ACMA 4FTKA 3KXNA 5B2KA 3VW6A 2X39A 2GFSA 2VD5A 1CTPE 2YN8A 2GNIA 2R64A 3HV6A 3IG7A 2WMRA 3FC1X 3H9RA 3G9NA 5JGBA 2XALA 2CPKE 2VO0A 3DQWA 5DNRA 3EFLA 3BU5A 3FLYA 3LOKA 4JAJA 4YZDA 3QRIA 3D15A 3ID6C 2UZDA 4FBXA 4AXDA 3A61A 2Q0BA 3JS2A 1WFCA 3OOMA 2BCJA 5L2QA 2IW9A 4QD6A 5A9UA 1YHVA 3QGYA 5ACKA 4YP8A 3FMNA 3RI1A 2JKQA 4D5HA 5C4LA 1ZMVA 2KTYA 3VJNA 3BHTA 2R7IA 3MV5A 2OBJA 1GZKA 4EKKA 2H8HA 4FKWA 4Y46A 3C0HA 4XOZA 3LXNA 2Y4IB 3UNZA 2R3IA 3Q9YA 3QQLA 2W4JA 1E9HA 2WEVA 3NNVA 4U3ZA 3QRTA 5LCKA 4F9WA 5IDNA 4FZ7A 4BGHA 2IPXA 3HP5A 2BKZA 3G33A 5BVOA 4IM2A 3H30A 4JBPA 4G5PA 4IADA 2AC3A 2HZIA 2JDSA 4I3ZA 3FMDA 4MTAA 4M66A 5JMSA 1CM8A 1DAWA 3EQHA 3BQRA 3FPMA 3LQ3A 4RC2A 2ZOQA 1VLRA 2BRBA 4MX9A 4CYIA 4ZY4A 3TV4A 5G1XA 2VX0A 1LP4A 3NYVA 1REJA 3K3IA 3KCKA 2GDOA 4DT9A 5C8NA 5A3XA 3O5AA 3IPHA 4LQMA 2BZKB 3E93A 3TNHA 3OWKA 3WF6A 3BEGA 4OAVB 2C0IA 4TYHA 4CLIA 3FXXA 2XANA 4M12A 1UKIA 2P0CA 4EUUA 3B2WA 3CTQA 3PG3A 2C5XA 4FNXA 2WMSA 4QYFA 3V6SA 3R1QA 3WE8A 5CZHA 4IB0A 4EUTA 1H07A 4PMTA 3CSVA 4DDIA 4KS7A 1P4FA 3UGCA 3DY7A 5AX9A 3TZ7A 4FV7A 3WZDA 3NYNA 5IZFA 3FE3A 2PTKA 4LOOA 5EHOA 4FV5A 5H8BA 3ZBFA 3ATSA 3HNGA 4WA9A 2DS1A 4QYGA 3DXPA 2BFXA 1M2RA 2YZAA 2C6EA 2ZMCA 3R8UA 4Q9ZA 4QMXA 5CEIA 5KKRB 1H4LA 4O86A 4M68A 3UDTA 4FZAB 5M55A 3AD4A 4JRVA 4TW9A 5E8TA 3VS0A 2YM4A 4DEHA 4Q5EA 4F1OA 4UN0C 3FWQA 3G2FA 5L2SA 3ETAA 3QRJA 1ZYLA 1MP8A 3KVWA 4KB8A 3OHTA 4GJ3A 3FMEA 3NPCA 4ZXTA 3UO4A 3DCVA 5FEDA 2OJGA 3WE4A 1ZYDA 3F7WA 4JR3A 5DRBA 4ZTSA 2LAVA 4XH6A 3R7VA 2RGPA 3RKBA 2YDJA 1IA9A 4XRJA 4I21A 5JFWA 2OH4A 3DFCB 1BI8A 2FH9A 1I44A 3Q9WA 4FMQA 4CSVA 2W96B 4KBCA 3FZ1A 2OO8X 4O7LA 3GBZA 3V8WA 1W7HA 4DG3E 3HKOA 2XEZA 5E1SA 5EOLA 3ZRMA 1KE9A 3B2TA 3BYMA 4RFMA 2H9VA 2GQSA 4MNFA 5IQIA 1BLXA 4NFMA 1W84A 4Q2AA 3ZUTA 3LM5A 4FV3A 2WIPA 4PP7A 1NVQA 2QOQA 1W2CA 3EQIA 4C4HA 4BN1A 3P08A 3ENHA 4DBXA 4QOXA 3ENMA 4BL1A 4QMLA 1H01A 1O6KA 3O7LB 4HYSA 3POOA 5AJQA 1WVYA 2VUWA 4FNZA 4P2KA 2XIXA 2PVYA 2YCSA 3QZGA 4OTGA 4CFXA 4YC6A 2YJRA 5I9VA 4FICA 4I6FA 3FI3A 4FK3A 4FR4A 3R9NA 2XS0A 4XG2A 3LQ8A 3CKWA 4E1ZA 1YRPA 5KNJA 2PZPA 4G31A 3ZYAA 3IW5A 2I0EA 4B99A 4FKTA 4WHZA 5KHXA 2ZV9A 5ITAA 1P14A 4XP0A 2PVHA 3NIZA 3R1NA 4D0XA 2WXVA 5EDRA 3AT2A 3DLZA 1IRKA 2RFEA 2GU8A 3LMGA 4KS8A 4O4DA 1HOWA 4X3FB 3C0GA 2B9FA 3NFFB 3P79A 4QMSA 2W1CA 5IH6A 2HW6A 4NWMA 4E5AX 4BJJB 3F3WA 1SZMA 3UYSA 4QQCA 4DGNA 4I94A 4FKIA 4NM0A 4BICA 5AV0A 3I0OA 3DTCA 2PUUA 1QCFA 2VN9A 3HV4A 4ZOGA 4E4XA 3Q4UA 2WTWA 3W8QA 1PRYA 4BDGA 3CXWA 3IOPA 4RQVA 5JK3A 5KO1A 2C3LA 3NCZA 2PMIA 3KRJA 3O51A 5LMKA 4H58A 4ZY5A 5EQPA 4G6LA 4CFMA 2RF9A 4IJPA 3V01A 5KCVA 3WF7A 1GZ8A 4RJ7A 2W1DA 5CNNA 3NW7A 4XBRA 4P7EA 3EN4A 2NO3A 3BGQA 4FL2A 4EONA 2RG6A 4L7SA 1Q8TA 1WBOA 4C4JA 3PY0A 4WBBB 4EH9A 1FGIA 4EKLA 1VYZA 3OXIA 2RFSA 2JBPA 3GOPA 5CT7A 3UQCA 4O4FA 3ZONA 4MNEA 5IEXA 3W0QA 3BE9A 3UMWA 1R0EA 2ZM3A 2PSQA 4OUCA 3RK9A 4D2WA 5KMOA 2W9ZB 4R3PA 4BF2A 1H1QA 3I4BA 3E8CA 5LMKC 2R3QA 4XV1A 3VRZA 3D4QA 4IM0A 1OPLA 2PMNX 3ZUVA 5DI1A 1SM2A 3DAJA 3UZTA 4ZJVA 5DA3A 4ZLZA 3OF0A 5FQDC 4NFNA 3P86A 2Z7QA 4LOQA 3VUKA 3ZC6A 2E9NA 4UV0A 3PPJA 5LWNA 1GZOA 4USDA 4WNPA 3EN6A 3HECA 3RVGA 3V5JA 2C30A 3W10A 4FJVA 1YXSA 5K9IA 1YXTA 2WQEA 4JRNA 1PY5A 3K2LA 5HG9A 1XH5A 5FD2A 3O2MA 4DG0E 3A99A 2HXLA 2QLUA 3C4FA 2W06A 3PXQA 3KU2A 4IZYA 3II5A 4YJQA 2ZDUA 3OWLA 5BVFA 4DGOA 4RJ6A 1CKPA 2BAKA 3JY0A 2UW0A 5AA9A 2XRWA 3P78A 1YKRA 2C1AA 4N70A 4AAAA 1U5QA 4WSQA 2ZJWA 4AQCA 2YM7A 5AUXA 4G6OA 4OTWA 3EH9A 1M52A 4G3GA 1JKSA 3CQEA 3QZFA 1L8TA 1IA8A 4ZSEA 3KEXA 3WZJA 3UOHA 4C58A 4QRCA 1A48A 3W33A 4D55A 1KE7A 4XG9A 4BB4A 3FLSA 2X4ZA 3SC1A 3ORZA 3ET7A 2VWXA 4FSRA 4EH7A 1H1WA 4DEDA 2B0QA 2ZFYA 4PY1A 4QO9A 3DS6A 2XK3A 4DFYA 3VS2A 4D4RA 4QYHA 4RZWA 2QO9A 2W5BA 4U41A 3OUKA 2WOTA 1OPKA 5T68A 5EQEA 1BUHA 2J2IB 2YACA 4FIFA 4KKGA 2YIWA 4PTGA 4QPMA 4FNYA 3ROYA 4PF4A 5CF6A 4EK3A 1PMEA 4GVJA 3D7TA 4I4FA 2VWIA 2VGOA 4B7TA 1QPDA 4A4LA 4W9XA 4ZSAA 1RE8A 5CT0A 5JEBA 3QTZA 1I09A 2OIDA 3N4TA 3AD5A 4FT9A 1PXLA 2VGPA 3FQHA 4DGLC 5DYJA 3VO3A 5EM5A 4IZ7A 1BX6A 1TQIA 2R3PA 3DK7A 3MFUA 3A8XA 3QRUA 4YC3A 4AOIA 4I41A 2VTPA 5IMXA 4JX7A 4TNBA 5C03A 1QPJA 2XCKA 3DXNA 2ZV2A 1P2AA 1FVVA 4U8ZA 1Y8GA 4XNEA 4IACA 4I6LA 4U79A 4ZY6A 4X7QA 3VUGA 3ZHPC 4D2RA 3F69A 5LMBA 3C4WA 3FYKX 4OTQA 5M4CA 3GENA 3BGZA 5DE2A 3MY0A 4FTTA 3UQFA 5HLWA 3C0IA 2AC5A 3C5UA 4WG4A 4ENXA 4EBWA 4E20A 5GIPE 4RRVA 3AC8A 4YPDA 3HAMA 5CF5A 5AP0A 2X0GA 5E90A 2JKOA 3KK9A 3D14A 3ZFXA 4CTBA 5FM2A 3SXFA 4E4NA 1FQ1B 4NM5A 4YR8A 3R8MA 4WSYA 3L9LA 4DN5A 5CVHA 5CENA 1PXMA 1Y57A 3AMAA 3EJ1A 3R30A 2X2MA 3KVXA 3V3VA 4N6ZA 4FI1A 4EHGA 4JOAA 4RJ5A 5IQGA 3OD6X 3D5XA 3F3TA 3Q4ZA 4QP4A 4XV2A 1SNUA 1VYWA 4XCUA 5DR2A 1G8JA 4QYYA 2CKQA 1J3HA 1U46A 2QOOA 1XH7A 4V01A 3QWKA 2G01A 3HRBA 4TL0A 3HMPA 3PVUA 4KRDA 5CWZA 3RAKA 2O8YA 4X2FA 4JDIA 2ETMA 2QR7A 3F9NA 4CV9A 4EHZA 4IX5A 3RNYA 3EKKA 1MRUA 1DS5A 2FSMX 4RBLA 2VTIA 5CLPA 3W2QA 3JR1A 5E8WA 4FG7A 4F9BA 3UO5A 5AR3A 4L00A 1VZOA 2QCSA 4ZSGA 3JYAA 1XQZA 2DQ7X 2JBOA 2R3HA 4WRGA 4YLLA 2XAOA 2R3KA 2XNNA 4IDVA 5ETCA 4USFA