3BE9A

Structure-based design and synthesis of novel macrocyclic pyrazolo[1,5-a] [1,3,5]triazine compounds as potent inhibitors of protein kinase ck2 and their anticancer activities
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
328
structure length
327
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha
publication title Structure-based design and synthesis of novel macrocyclic pyrazolo[1,5-a] [1,3,5]triazine compounds as potent inhibitors of protein kinase CK2 and their anticancer activities.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 110
structure length 327
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3be9A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3be9A02
3Q4UA 5IA3A 4WA9A 5E8VA 1BI8A 1XH4A 1ZZ2A 3ZO1A 5E92A 5IQDA 3W18A 4I4FA 4DFLA 4J71A 3D14A 3TJCA 1REJA 4XMOA 5KKRB 4RC2A 2QHMA 3F88A 3OS3A 3ZHPC 4GK3A 3DB6A 1PXKA 3NR9A 5D7AA 2ERZE 4YLKA 4DFXE 4JQ8A 3DAJA 4O86A 5EQEA 4LG4A 2BHHA 2WTWA 3OBGA 3EN7A 3PPZA 3BYMA 4TNBA 2OXYA 4CFMA 1WBNA 3GOPA 3OTUA 5AR4A 2BDWA 2VWBA 4LMNA 4KA3A 5AMNA 4ZSLA 3U51A 1Y6BA 2UW8A 4L01A 4AA4A 3CBLA 4CXAA 2RFDA 3COIA 4GG7A 5C26A 3R6XA 4ID7A 5KHXA 4O7VA 5IEXA 5EM7A 3DFCB 3KF4A 4EQMA 1CTPE 4PP7A 2PU8A 4BDBA 1SVEA 4YJPA 4CYIA 4O7WA 2OICA 1XBCA 1UKIA 2VRXA 3GU5A 4HCUA 4U97A 2R3RA 5BMMA 4H1MA 2EVAA 4X21A 2BVAA 4IFGA 3W32A 3MESA 3IW8A 3QU0A 1KE5A 4O81A 4U0IA 2BZIB 2F7ZE 5AR5A 3L9MA 3OCBA 3EQFA 3QXOA 4NJDA 1UU7A 3VS1A 2C6MA 2B9IA 5AV3A 4R7IA 4R1VA 3OTVA 3QTZA 2UZVA 4DT8A 4FG7A 2CN5A 3D94A 5HLPA 3D7ZA 3MH0A 4TWCA 2ITXA 4FIEA 4YTHA 3F3UA 3UC3A 4E6CA 2YLFA 2ZM4A 4NL0A 3C4ZA 4YZMA 1PXIA 2W1FA 4RJ8A 4IZAA 1JAMA 3JVSA 4UYAA 3F61A 5CLPA 3UIMA 4ANQA 4AOJA 1H07A 3BE9A 3FL4A 2QO9A 4FV1A 5J9YA 2ZV7A 3OOMA 4AZFA 2CN8A 3PZEA 2WTJA 2XRUA 5LVMA 2P33A 3QL8A 4ENYA 4KIKA 4L9IA 2XK3A 4BTKA 3A7FA 3UZPA 3TNHA 1QPDA 2C3KA 4FKGA 4EONA 3ORXA 4GKIA 5HIEA 3PA5A 4XG4A 1XHAA 2ETRA 1LEZA 2YEXA 2WMUA 1P4OA 4R7HA 3NUUA 4BCJA 4CG9A 3QAME 2QOBA 4ITHA 2QOOA 2QKWB 3A99A 1DI8A 1Q62A 3ULIA 4AN3A 4BC6A 4EHGA 2VWWA 3BLRA 2VTTA 4EEVA 5M4IA 3WIGA 3TV6A 5IDPA 1WCCA 2XNBA 3R04A 5FEQA 3TCPA 2X6EA 4QTDA 3PLAE 4RIXA 1OIYA 2F57A 3GU4A 5IISA 4YR8A 3PP1A 3RPYA 3PVUA 2JIIA 2CDZA 4YZNA 3G6HA 4L43A 4EWHA 4O7RA 3FY2A 3IS5A 3DKFA 2J7TA 4QP6A 3F2NA 4EOJA 3C4FA 1HCLA 2ETMA 3LCTA 3U8WA 4FX3A 4FKJA 5IKWA 5KNJA 4DITA 4EOKA 4ZMEA 5A4QA 3RWQA 4Y95A 4JQ7A 4EOIA 3CS9A 4U6RA 1O9UA 2XRWA 2VO7A 4EH9A 4L53A 2BIKB 2ZOQA 1URCA 3QYWA 4ALWA 3UP2A 5HESA 5CXZA 4MH7A 5DMZA 3UMWA 5CQWA 5JQ8A 3I1AA 1OGUA 4DH3A 4E4MA 2JC6A 4YJRA 3MI9A 1U4DA 3ORPA 3Q4ZA 3WYYA 5L2TA 3RNIA 4OAUC 4FEWA 3BU3A 4Q5EA 2CKOA 5CS6A 3DGKA 4OTRA 5BVOA 4DF3A 4O21A 3EN6A 3EFLA 2WMAA 3FZ1A 3QKKA 3W8QA 4O7TA 4JDJA 3KK8A 4AN9A 5EYMA 1T46A 1ZMUA 3ATSA 3ZEWA 4TXCA 2XA4A 4JX3A 3QCSA 3CR0A 4J8NA 3U6HA 4E6DA 4QP3A 4BDJA 4L00A 4XV2A 3ZLSA 4F9CA 4KIPA 4FT0A 4ZZOA 5CU2A 2WTKB 5JQ5A 2PUPA 5EM8A 3DXQA 3CXWA 1ZOGA 4I5HA 4O84A 2F2CB 3E7OA 2RL5A 4NU1A 2WQMA 5A4LA 4BHNA 5KX8A 3F2AA 1KE7A 2J50A 4JR7A 3F5PA 5IUGA 4FGRA 5M4UA 1G8SA 3L8VA 4X6QC 3P5KA 5CNOA 5EW8A 3R2YA 3HV6A 2OSCA 4AN2A 3RAWA 2CKEA 3U4WA 1JSVA 5JGBA 3C0IA 3BWJA 4O0XA 2WMVA 3V5WA 4RLKA 4AOIA 4ZLOA 5AR2A 1URWA 3Q32A 2R2PA 4O1OA 3RNYA 3ALNA 4ACMA 4C62A 2EU9A 4C4GA 3NUYA 4AGUA 4G31A 3GOKA 2I7QA 1YI4A 3SXFA 2QOIA 5AV2A 1EH4A 5EQYA 4ZTMA 1KOBA 4DG2E 5BPYA 5FQDC 2H34A 4QYGA 4BRXA 4H3PA 5M07A 4E6AA 3Q60A 4QPAA 3QA8A 1CM8A 4P5QA 3OT8A 5CALA 4MCVA 5L2QA 3TKIA 2G2HA 3CTQA 4EQUA 2ONLA 3QRUA 4M3QA 3VBXA 4FV3A 3KRLA 4Z7HA 1FVRA 5CF5A 2XCKA 4O0VA 4UWBA 3TV4A 2CNQA 4L46A 4CZTA 3FZPA 4B6LA 4CVAA 3A7HA 3TI1A 4BKZA 1H00A 4HVSA 4TZRA 2I6LA 1VYZA 4O0YA 4F6UA 4X2JA 1RJBA 5EHYA 1REKA 3QTRA 4MD8E 5BYYA 4EH7A 4FI1A 3CP9A 2CKQA 4F9WA 3MH2A 3NNUA 3FC2A 4HNIA 4F1MA 2WEIA 5A6NA 2ITVA 1U5QA 3HRCA 4FSRA 5IH4A 5DRDA 3PY1A 4M0ZA 4GJ2A 2WMXA 1ZARA 4FV7A 4RX8A 4AAAA 3MJ1A 5BVWA 2IPXA 3DNEA 1P4FA 4OW8A 4RWLA 1SMHA 2JIVA 3F9NA 4M67A 3U54A 1YDSE 2C5XA 5F9EA 3ID6C 3GQLA 4YHFA 3P78A 4Y73A 1WMKA 4PRJA 3F5XA 4G3DA 3FI2A 2HY0A 3AG9A 4FV2A 4BDGA 4XRJA 4BTFA 3FLSA 4U81A 2PMOX 4QMQA 4XH6A 4ACGA 3ZFMA 5L4QA 4RIYB 4TPTA 4EZ7A 2Z7LA 5JFSA 3IQ7A 5DN3A 3OXIA 3GENA 4UEUA 4HYSA 3KGAA 1ZYSA 2VZ6A 3AT2A 3IW4A 5E8WA 2Y9QA 3VAPA 4HGEA 2C6OA 3FZRA 3QC4A 1H1QA 4DTKA 2QI8A 2HXQA 2XS0A 4F99A 3OD6X 4I0RA 4L3PA 4AT5A 1SYKA 5AEPA 4BGGA 2ZV8A 3GC9A 5J7BA 2W1ZA 2FSTX 3TZ9A 1UWHA 3LFAA 3PXZA 4NYEA 1VJYA 3PG1A 4NIFB 3LHJA 2VWIA 3MPAA 1S9IA 4B8LA 4OTDA 2R0UA 2OJJA 4C4JA 2HZ4A 4JG6A 2BRBA 4CT2A 5EK7A 3N51A 4BCGA 4RX7A 3KMUA 5T6KA 2ZMCA 5IQEA 4EKLA 3L1SA 3SXSA 2CPKE 3NSZA 1OPKA 2WZJA 4BDFA 5ANIA 3PVWA 2HZIA 2XJ2A 3ZSIA 3OY3A 4EZ5A 2R3MA 3FZTA 4YU2A 5E8SA 2YDIA 4IM3A 1Q3WA 3SGCA 5A9UA 1H25A 4W4VA 3MYGA 1RDQE 2FSLX 4NFMA 4I6HA 4G34A 2BRHA 3OXZA 3F2RA 2SRCA 5FM2A 2IO6A 3PE2A 4BTMA 4C57A 4ZS0A 2OG8A 1TVOA 2W5AA 3NUPA 1BI7A 4NFNA 5FRIA 5FTQA 3UOKA 1XWSA 3Q52A 3IW7A 5FWKK 2GNHA 3FMMA 4GSBA 2WO6A 4UWYA 4UXLA 3QKMA 4H1JA 2GU8A 4P4CA 4MF0A 4MD7E 4KBCA 4X3JA 4ZLYA 5AV4A 5AP1A 3F82A 4UZHA 4AT3A 2BROA 2X4ZA 4CTCA 5CEMA 4CZYB 4RMZA 5J5TA 4FNZA 2BILB 1O6YA 3WOWA 4E4NA 3V5TA 1XH8A 3LQ8A 4MNEB 4ZK5A 5F94A 3BBTB 3O7LD 2BFXA 4M0YA 2R3NA 1FBNA 5A4TA 2XB7A 1KUTA 2FH9A 3D9VA 3EN4A 3PYYA 3IK3A 3SRVB 1OL7A 1KE9A 2XNEA 5ICPA 2JKMA 3EKNA 4DEHA 5L3AA 4UY9A 3QQHA 4CCBA 5AUWA 3D2IA 3AMYA 4FV0A 4RX9A 4C38A 2WMSA 4IAFA 3KKVA 1SNUA 3FMHA 3BPRA 3G2FA 4C4IA 5GZ8A 4NUSA 4L8MA 2DUVA 4L67A 4CD0A 3SG9A 3A8WA 5M51A 4WOVA 5DI1A 4MXXA 2EXCX 2EUFB 4QMXA 1WVYA 5JT2A 3KXNA 3IDPA 4EWQA 4RA4A 2XIKA 3NWWA 4YBKA 4DN5A 3V8SA 3VQUA 3QGWA 5C27A 4FT3A 1IASA 1P14A 2FA2A 2E9UA 3FUPA 4J95A 3D83A 4E3CA 2BKKA 2XP2A 1FQ1B 5HO8A 1JSTA 2BR1A 2WMQA 3C0GA 3IW6A 4YC8A 2VO6A 5DE2A 3KRRA 5JFWA 1PXPA 3AOXA 3RHXA 1UNLA 4GCJA 3TT0A 3ET7A 4AA5A 2YM8A 4L52A 4GK2A 4QP4A 4GU9A 1ZAOA 4L44A 1H26A 5LVLA 3TTIA 3VQHA 3VRZA 5D12A 3BGPA 4M68A 3W33A 2JIUA 3EZVA 2JKQA 2I0YA 2J0LA 3FMDA 4QMWA 3RZFA 4C34A 5C1QB 3GI3A 2J6MA 4QOXA 3QALE 5LARA 2NO3A 5B2LA 2RGPA 2OWBA 2X8EA 2XM8A 3OHTA 2X2LA 4QMVA 4Y72A 3W2RA 2GPHA 4G6NA 3QUDA 4ALVA 2J5FA 1Y8YA 4QQJA 4EOMA 3G0EA 1WBWA 4LOOA 4CRLA 4YTCA 3HAVA 4PF4A 4AZVA 4DEEA 1XO2B 1JSUA 2WD1A 3P79A 4MXOA 4PQNA 2X81A 4ZXTA 2VTRA 4B8MA 4KKHA 4EC9A 1FGKA 4AX8A 4GJ3A 3R7VA 3NAXA 3E8EA 1B38A 4F6WA 3O0GA 3DBDA 3GGFA 4TTHB 2JFMA 4AACA 5E8XA 4EHVA 5CEPA 2DWBA 1GZ8A 2FYSA 3K3JA 3I0QA 4LUEA 5BYZA 5DOSA 3WF6A 4DH5A 5IQBA 3WARA 4O7YA 2QOLA 4GIHA 4KIOA 4CNHA 5IUHA 3MPTA 4JR3A 1BUHA 2P2IA 2P0CA 2G15A 3DJ6A 3HDMA 4GU6A 3U87A 4ZSAA 2YHVA 4IB1A 1Y8GA 4IVBA 5FXRA 5KMMA 3DBEA 4I20A 4MXAA 4D4VA 1Q61A 4GK4A 5E1EA 2UZNA 4ANMA 2X2MA 1OITA 3LM5A 4YPSA 2BZHB 4XLIA 3POOA 5CAVA 4IX5A 3KULB 5AV1A 4APPA 3QHRA 4AXAA 3S1HA 2UZWE 3QQUA 4R8QA 3FEGA 3K54A 2PUUA 2QO2A 4JQEA 2AUHA 4BHZA 4RZWA 3SKCA 3QUEA 4U3YA 1GY3A 5EKNA 2G01A 4AGDA 3S4QA 2VTAA 1JLUE 4JAIA 4I5CA 5H8EA 3THBA 5IA0A 2WIHA 2JBPA 3BHVA 3EQHA 5HVJA 3VBTA 4RIWB 1PKGA 5CSWA 3BE2A 4RVTA 4IC8A 1PF8A 3R7UA 3VW6A 4D2TA 5DVRA 5CF6A 5L2IA 3CJFA 5DNRA 3WZEA 5IZFA 3MVJA 3QTUA 4FSNA 2CGVA 4I94A 3QGYA 2O5KA 3D2KA 3PA4A 2FB8A 3FQEA 4IFCA 4K9YA 4OTHA 3GC7A 4FVPA 2PZ5A 3MVLA 4KB8A 1G3NA 1T45A 4CG8A 2PVNA 2C5NA 2VGPA 1WVXA 2XZSA 4FKOA 4FG8A 4G1WA 4S31A 5HU9A 2QURA 3TEIA 4ZIMA 4BKJA 5AA8A 5JSMA 2O63A 2OU7A 3GCQA 3OF0A 4O0SA 3C4CA 3VF9A 2W4JA 2UV2A 4YZ9A 2YM5A 4YZDA 4CQGA 4EOSA 4X7QA 4O1PA 2QC6A 4A4OA 3I4BA 4QNYA 4DC2A 4HVGA 5E9EA 1SNXA 4RC4A 4RIYA 3R8PA 1KE6A 2HWOA 2Y6OA 3BLHA 2GQRA 3PJ3A 4MBLA 3CE3A 5CVFA 4FIHA 4B9DA 4JRNA 4PNIA 3TJDA 1M2RA 2PUIA 4HZRA 3F6XA 5AM7A 2Q0BA 2R7IA 3BQCA 4QMOA 2BAJA 4QPSA 3A8XA 2RFSA 3FSFA 3GNIB 3SX9A 4AT4A 3EFJA 2GHMA 4EORA 1YRPA 2Z8CA 1NVSA 1UNGA 3L9NA 3BEAA 5TO8A 2JDRA 3BHUA 5I3OA 4APCA 4IAKA 1STCE 4BCFA 4FKVA 5AP0A 3G0FA 1WBPA 2PSQA 4ARKA 4NIFA 2GS2A 2XEYA 2Z02A 4IWDA 1PMVA 2C6KA 2EXEA 3DK3A 5FM3A 4CCUA 4O96A 2O64A 3EN5A 3ROYA 4L3JA 5JEBA 3U6IA 3RGFA 4S30A 5AIKA 3I0OA 5AX3A 3FMLA 3NYVA 4BDHA 3NCGA 1NXKA 3T3VA 2RSVA 4MQ2A 3R7EA 1W98A 4L3LA 2JEDA 3HP2A 1CDKA 4BVUA 2YM3A 4O7SA 4QQTA 3FSKA 4BIBA 5DT3A 1GZNA 3G51A 3QCQA 3R7OA 4CYJA 5L2SA 3V8TA 3KY2A 4YSJA 3PSBA 2W1GA 5A3XA 4AW2A 4FTLA 5IF1A 2HYYA 5K9IA 3FV8A 4FL1A 5HICA 4KNBA 5AUVA 4F9YA 3OOGA 4TL0A 5EI8A 5HD7A 4D1ZA 4EOLA 2XIZA 3M42A 4E6QA 1YOMA 1UKHA 4D4RA 4JVGA 4P5ZA 4H05A 1YXXA 4FOBA 4AW0A 4JX7A 5LCKA 5EOBA 3QWJA 2GTNA 1V0BA 4R78A 4KKGA 2PZIA 5HVKA 5BQ0A 2R3GA 3BYOA 3C9WA 4FG9A 1BX6A 3W2OA 5GIOE 2PVMA 5G1XA 3OFMA 4RWKA 2UVYA 3R7GA 4I92A 3DT1A 4UWCA 5I3RA 3S0OA 2XK7A 2R3JA 3BV3A 4RWJA 4DCEA 1FVTA 2YIRA 2ZDTA 3GXLA 4LGHA 3A61A 5JZNA 2PTKA 3WF9A 4CZUA 4ZY5A 4MNEA 3BU5A 5C9CA 4JNWA 3II5A 1JKKA 4TYEA 2UZDA 2VN9A 4WIHA 5AIRA 2BRMA 3UGCA 3ORTA 3KMWA 4Y83A 4MVFA 5CT7A 3RVGA 3SRVA 3KXZA 3CGOA 3KL8A 2KTYA 3I81A 3MY5A 4UALA 1YWNA 3R1YA 2VNWA 3GCSA 5IQGA 2CMWA 4NEUA 5EW9A 3GUBA 3WIKA 4DLIA 3BWFA 5AR8A 3UVPA 4RQKA 5LVNA 3D5WA 2YDJA 4E7WA 5ANKA 3I7CA 4UMQA 1P5EA 5IQAA 4PL4A 5AFVA 4NT4A 3W10A 1NT2A 2RG5A 2H96A 2QO7A 3RAHA 4QMZA 3MY0A 1JPAA 4UMUA 4TYJA 1FOTA 3HAMA 1PY5A 5EHOA 4BF2A 1FMOE 2ZM1A 4C35A 1U54B 4DINA 5BMSA 3PDTA 4D2VA 4FTOA 4XV9A 2BALA 4FMQA 2VTJA 2Z7SA 3EHAA 5T68A 3N4VA 4PDOA 3AC4A 3FY0A 2UZOA 2VTNA 4PPCA 3UTOA 3VS4A 4IEBA 4X2NA 4QT1A 4XS2A 3W8LA 2GQGA 3AMAA 3GCUA 3UVRA 3NX8A 1CKJA 2F9GA 2GNFA 4G3FA 4H58A 3G15A 1GIHA 4D4SA 3ZM9A 5I9XA 3OMVA 2XKEA 4C8BA 2EWAA 5CXHA 4U8ZA 5HTBA 4L6QA 4JG8A 4EH5A 3PTGA 4WO5A 2WMWA 2ZMDA 4I5PA 4TNDA 3QLFA 5CEOA 2C30A 4PTEA 5A6OA 3NYOA 2WQNA 4ZSEA 3ZCLA 4C2WA 3CTHA 2GHGA 3BKBA 4YJOA 2XEZA 5LVOA 1A48A 3QQGA 3VUGA 2PZRA 3ZUTA 3CGFA 5IG1A 3EMGA 2Y4IC 3ZUVA 4WRSA 3P7CA 1IA8A 3QCYA 3QYZA 3H9RA 5HOAA 4FTAA 4S2ZA 3OEZA 1I09A 2W17A 3C0HA 4XV3A 2B52A 4EKKA 3ZLXA 2YM7A 3TDWA 4FUXA 4K77A 2W5BA 5J9ZA 2R3IA 2PHKA 3DKGA 2C6EA 3MWUA 3Q9XA 4UMTA 2NNWB 2QOQA 3DXNA 4FVQA 1WBOA 3MH3A 4C2VA 4EH3A 3FLZA 4ZEGA 2J51A 5EHLA 5KZIA 3RBWA 4FGBA 4O0WA 3V5JA 4FODA 4WG5A 3ZDIA 3L9LA 3IOKA 4FNYA 4I0TA 3ZXTA 3EQGA 5CU3A 2UW0A 4KBAA 3D7TB 3TM0A 3PSDA 3LOKA 1FINA 2VTLA 4RC3A 5LXMA 1ZYDA 2YAAA 3FLNC 4OAVB 3FC1X 1WBVA 4C61A 3BYUA 5TE0A 4FK6A 3VVHA 2R64A 3S00A 4AE6A 5AP5A 4Z16A 2VTIA 3ZO4A 4E20A 5TR6A 4FSUA 4IE9A 3B8RA 1H28A 2YJSA 1Q8YA 5CSVA 3KULA 3EZRA 2XNOA 3UIXA 4FTIA 2ESMA 3EL7A 1S9JA 4E26A 4EBVA 4M8TA 4DCAA 3C5UA 3PXRA 5JKGA 1ZY5A 2EXMA 3Q4CA 4BDKA 3MB7A 1HOWA 4PMPA 2XK9A 3ZC5A 4GT5A 4F6SA 2YIYA 5GJGA 4K6ZA 3LFBA 1B39A 2QLQA 4FV4A 2R0IA 4RIWA 4XP3A 4K1BA 3AGMA 2IN6A 3NRMA 3A4PA 4O22A 4ASZA 5BUIA 3GC0A 5HU3A 4R77A 4QMTA 5FUTA 4BCPA 5K0KA 3HYHA 4RFZA 5HLWA 2PWLA 4DGLC 1CKPA 3MFUA 2NP8A 3LCKA 4FIIA 5FEDA 4XG8A 4G5JA 3ZRKA 1UU3A 4M97A 4OTFA 1PXMA 2P2HA 4EH4A 3MVMA 3O71A 1OL5A 4IJ9A 3E62A 2VUWA 3QZGA 3PPJA 5DHJA 3UE4A 3DCVA 4D1SA 4Z9LA 5AA9A 4FEXA 5FTOA 2R3OA 5M06A 4EBWA 1ZOHA 3PIZA 3VJNA 4I23A 3N9XA 4QTBA 3RKBA 1ZRZA 2JAMA 4NJ3A 2BRNA 3JS2A 2JFLA 3DJ7A 3ZM4A 4F7SA 3LXNA 2W1CA 3MS9A 3NYXA 3OWPA 2ZYBA 3LLTA 3ZRLA 3SOCA 4ALUA 4AZEA 4QO9A 2W5HA 2ONLC 4JOAA 2BCJA 4J7BA 1MUOA 1OKVA 4GG5A 4U42A 1IA9A 4HZSA 3ALOA 2IVSA 2UZUE 3K5UA 3UYSA 5EM5A 2W96B 4M13A 4I24A 4CMOA 4PDSA 1Y91A 4BTJA 3UO5A 4J52A 4MX9A 4XBUA 4FICA 4XYFA 3HGKA 4BGQA 2WTVA 3UQFA 2VO0A 3MSSA 3TXOA 3NW7A 5KZ0A 3KCFA 4IX6A 4P2KA 2LAVA 3TUBA 4GVAA 1LR4A 4QTAA 2X9EA 3LVPA 4D28A 2BIYA 3ETAA 4QP1A 5HKMA 3WI6A 4O91A 1Z5MA 3LFCA 5CU0A 3F3WA 4FYOA 2C5YA 3Q5IA 3FXXA 3FLYA 5HE3A 4F7LA 2V7AA 3COMA 4XG2A 4WNOA 1H24A 5ANDA 3ZBXA 4PX6A 3DKCA 4MBJA 1YOLA 2HY81 3LW0A 4DGNA 3LFNA 2B7AA 5CAOA 3W2SA 3NS9A 3DBCA 4CLIA 2UW9A 4UBAA 4ZY6A 1MQBA 3E8DA 4TN6A 2VWYA 3HV7A 4MD9E 5KKRC 4LI5A 2X7GA 4A9TA 4BDEA 3PIYA 4FVRA 1IG1A 3I79A 3TTJA 5I5ZA 2WQEA 2B54A 5HG8A 2GQSA 5BNJA 3HUCA 3KRJA 1OB3A 3DTCA 2WOTA 3QX2A 4IZ7A 4NM3A 3VIDA 2GNGA 3SHEA 1F3MC 4CFXA 2YERA 3C51A 3MFSA 2XJ1A 4FTUA 4NM0A 4PV0A 4V05A 3W55A 4UN0C 4DG0E 3DQWA 3ROCA 4D4YA 2OKRA 5FD2A 3RALA 4DFYA 4EC8A 5KBRA 3LQ5A 5IMXA 1J7IA 3U9NA 2IZUA 3H10A 1YW2A 2JKOA 3H4JA 4JBQA 3B8QA 5HI2A 1Q24A 2RIOA 4IAYA 3D15A 5G6VA 4LOPA 3ERKA 3RTPA 3TACA 3TIYA 2O2UA 3IDBA 3TNIA 4BDAA 3SA0A 2JD5A 4RWIA 3TNPC 3FPQA 4EH8A 4F0FA 4U45A 4TWNA 1OMWA 2WMRA 4A4LA 2IZSA 2V55A 4DGOA 3N4TA 1QPEA 4S33A 4HYUA 2JDOA 2F7XE 4RGJA 4BYJA 5HHWA 3TG1A 3HMPA 4DH7A 1M2QA 2B55A 2J90A 4Z3VA 3PJ2A 2B9HA 3FI3A 2QQ7A 3FBVA 3V04A 5T3QA 4M84A 3W2QA 3IONA 3VUHA 4Q9SA 3P7BA 4DEDA 2C3LA 2WTIA 4NK9A 2C4GA 1PMUA 2CCHA 4A9SA 4DAWA 1MRVA 3WILA 4F1TA 4A4XA 1LPUA 3PRFA 3A7IA 3NUNA 4Q5HA 1Q3DA 3ZLYA 5FBNC 3HUBA 5HBHA 1BL6A 2OH4A 3WF7A 3O8UA 4ASDA 4QQCA 2XK4A 4PNKA 3DPKA 5HVYA 2WQOA 3TWJA 2HOGA 1U54A 1YXUA 3Q3BA 4N70A 3OWKA 3QZHA 4I6QA 3QD2B 3ZMMA 5IQHA 3PLSA 3R9NA 3QXPA 4J53A 3RPSA 2OXDA 2XMYA 3VO3A 5D7VA 4D0XA 4TYIA 3H9OA 3KK9A 4Z7GA 4FIFA 4G9CA 1OPLA 4JIKA 3ZZWA 3QUPA 2BZJA 2C6LA 2W9ZB 2WKMA 3MJ2A 3TKHA 4ANNA 1TQIA 2C68A 4IC7A 3QD0A 5CY3A 2A2AA 2ZM3A 4F70A 3AC3A 3DQXA 4DFUA 1TQPA 4W9XA 1Y6AA 4NW5A 3OW4A 2CNVA 2YITA 4F0IA 1E1XA 5F95A 2YM6A 2W0JA 4G17A 2NRUA 4FA2A 5IH5A 4IVDA 1O6LA 5EQPA 4LV8A 4JI9A 1OKYA 2A19B 1ZMVA 2WAJA 4XBRA 2YCQA 4ZJVA 3K3IA 3VN9A 3W2CA 4X3FB 3SW7A 3QRKA 3PJ1A 4HPUE 4GH2A 4EH6A 5DYJA 3IKAA 3AD6A 3PY0A 3CC6A 3QZIA 3TUDA 2I0VA 4I41A 1YI3A 4FSQA 4C36A 3OUKA 4D1XA 4YJUA 4N0SA 2ZAZA 4U3ZA 4FUYA 4MKCA 5DEYA 2LGCA 2UZLA 4OTPA 5IPJA 4O82A 4X0MA 2UW5A 4QYEA 2BUJA 3AC1A 4RPVA 5JGAA 4IACA 5CU6A 4O6LA 4IMYA 3Q6UA 5GNKA 3RCDA 5EI6A 1PMNA 2UVXA 4AG8A 4YHTA 4IH8A 3D7TA 4BKYA 4E8AA 3FLQA 5I9UA 3UG2A 4G3CA 3CEKA 4RVLA 5HE2A 3V5QA 3DFAA 4YP8A 4ACDA 2OJ9A 3ZSHA 1V0PA 2PVRA 2G9XA 5I9WA 3POZA 3QTWA 4JS8A 3G9NA 5K4IA 4H36A 4ERKA 3FAAA 1H1RA 3HKOA 3PPKA 2PL0A 4O38A 5JFVA 3T8OA 4ORKA 4AE9A 4RQVA 3QKLA 3RCJA 3NIZA 4U7ZA 5HEZA 3W16A 2XKFA 3VF8A 2VWUA 3AMBA 4O2PA 3QWKA 4WNPA 2VWXA 5EYDA 3R02A 4PMSA 4PY1A 3E3PA 4IB3A 4QMLA 2WEVA 1NY3A 5LMAA 2VWZA 2G2IA 2F4JA 3TIZA 4IWPA 4D0WA 3COHA 3C13A 5E8ZA 3RI1A 4HGSA 1R1WA 5DR2A 2QG7A 3OVVA 3GFEA 3JYAA 4WKQA 1H8FA 4CFNA 5IA5A 4TT7A 2WNTA 3DLZA 3F3VA 5E90A 3LKMA 3CD8A 2PULA 4CSVA 3JXWA 3W1FA 1ZYCA 3DS6A 3FZSA 3HP5A 3KRWA 3SDJA 4BCHA 2Y6MA 2JDTA 2P55A 3V3VA 2XF0A 1KOAA 4USDA 5C8MA 5FDPA 3HMIA 5K5XA 5IQCA 1AGWA 2ACXA 4BYIA 3I7BA 1GIJA 2Y0AA 3KFAA 3OUNB 3F66A 4II5A 2VNYA 5HCZA 1PKDA 5LMKC 3TZ8A 3O8TA 1BL7A 3DU8A 4EK6A 4J99A 3MFTA 2ITNA 3BCEA 4K18A 2X7FA 4OUCA 5K3YA 3NVMB 1XH7A 5M4CA 3Q9YA 5FLFA 2YN8A 3GU8A 4Q2AA 1G5SA 3ZZEA 4M14A 3MDYA 4AU8A 3I5ZA 4F9AA 4BCNA 3PJ8A 4GEOA 4KINA 4PTCA 4D9TA 1B6CB 3VS2A 2Z7QA 3AC2A 4FEQA 4TW9A 5TT7A 4ITIA 4QPMA 5DRBA 3VUMA 4AF3A 4F9BA 3E3BX 4AZSA 3R8MA 2ETKA 3BYSA 3COKA 3IGOA 3QTQA 3OCGA 5DR6A 5E8TA 2QR8A 4IB0A 2ZVAA 4W4WA 5BYLA 4BBEA 1OI9A 3FDNA 3CQWA 4CGAA 5M55A 3CLYA 3E92A 2X6DA 3TZ7A 4XJ0A 4XG9A 4WBBB 3VHEA 4BN1A 2F49A 2IVVA 3ZU7A 2C1BA 4FKTA 2IWIA 2QONA 2ZJWA 5L8KA 4WSYA 2C3JA 4AP7A 4ZTSA 2H6DA 4CV9A 2VTMA 2BAKA 4WUNA 4O83A 4OTWA 5H8BA 4G2FA 2O0UA 4A06A 2OZAB 3HMMA 3EB0A 3QQFA 3NNVA 3R30A 2UZEA 1XBAA 1KE8A 1UVRA 3UODA 4QNAA 3VBYA 4ZAUA 3ZXZA 4X2GA 4IB5A 3HA6A 3LXPA 4EOOA 2F2UA 2VX0A 3ZBFA 4OT5A 1JKLA 4NCTA 4S32A 4YTFA 2VX1A 4E73A 4DTBA 3EQPA 3EWHA 4R6VA 3VS3A 2J4ZA 5DG5A 1W0XC 2Y8OA 1BLXA 4GW8A 3TNQB 2FGIA 3K5VA 4NZWB 3ZDUA 4KS7A 3ZO2A 4RIOA 4L42A 1IAJA 2EB3A 3OWLA 3DDQA 4YJNA 3FQSA 3H30A 2C6TA 4N6YA 5DEWA 3KB7A 4GS6A 2AC3A 3MA6A 2GNLA 4FZAB 2C6IA 4C02A 3UC4A 5CZHA 4MWIA 1XBBA 1Q4LA 5FP6A 3VUKA 1UV5A 3AT3A 1R0PA 2HCKA 2XIYA 5J8IA 2R5TA 4DEAA 4D2WA 1R39A 4EQCA 5HBJA 2BRGA 4XOZA 1DAWA 3A4OX 4RRVA 3CQEA 2E9PA 3E7VA 1H08A 3QTIA 1ZYLA 5AM6A 3DJ5A 3D0EA 3WE8A 4KRDA 4IADA 4TWPA 4DHFA 4QP8A 2R3KA 3C4WA 3IGGA 3R9DA 3FQHA 4FNWA 5M08A 3BI6A 5CEQA 4IX3A 3SQQA 4HVDA 2HZ0A 1RW8A 4JBPA 5AJQA 3N4UA 2JDSA 5JFXA 3UVQA 4M69B 4RJ5A 5CAUA 4JDKA 4XUFA 1H1SA 5AUZA 4DYMA 4EK4A 4UX9A 2Q83A 5CSXA 5KMJA 3BLQA 3S2PA 5I0BA 3I5NA 4LUDA 3AQVA 4D2SA 3DKOA 2W1DA 4RT7A 5KBQA 3VRYA 1PRYA 4BWPA 4BBFA 2CJMA 2GSFA 4F0GA 5KHWA 1LUFA 2OI4X 2ITWA 5BVEA 1X8BA 5DA3A 1H1WA 4EH2A 4RVMA 5JRQA 4C33A 2VU3A 2X8IA 3FKOA 4N57A 4XHKB 4I4EA 4MBIA 2A4LA 2BFYA 3UZTA 5HGIA 4NSTA 4A9YA 1OIUA 3LM0A 4GFOA 4YZCA 4J1RA 3MV5A 4EHZA 2HELA 4B99A 4Y5QA 2YCRA 4KABA 1YHVA 2X9FA 3BV2A 1MP8A 2PY3A 2YCFA 4O6EA 4F64A 2YZLA 1H4LA 2WELA 1AQ1A 2YFXA 3ORKA 4W8DA 4E5BA 5B2MA 2ITYA 4EK5A 5JGDA 4HVHA 2IZRA 2XCHA 4ASXA 4QTCA 1XH6A 4WNMA 1WZYA 3ODYX 4UYNA 1E1VA 4MAOA 3BHHA 2Q0NA 2RF9A 2UW6A 4MXCA 3EQDA 5JRSA 4KD1A 4PL3A 4ZJIA 3HV5A 1CMKE 5J87A 2E9VA 3DK6A 4PTGA 3EN9A 4V04A 4X3FA 3MIYA 1OBGA 1YKRA 4ERWA 3DAKA 3FYJX 4P7EA 3OT3A 3W2PA 4UXQA 2C69A 5HNBA 2PVHA 3EYHA 3ZO3A 4HGLA 2UZBA 5HG9A 4BICA 5H3QA 4NWMA 1KV2A 3LAUA 2W4OA 1PYEA 4QMUA 2GFSA 3RPVA 4Y46A 2Y4IB 3GQIA 3R7YA 1K3AA 3R28A 1YI6A 2XBAA 4MTAA 4IWOA 5LMBA 4H39A 3V8WA 4W4XA 2YIWA 3FI8A 4CQEA 3PY3A 4W4YA 5EW3A 4FL3A 1PXLA 3KXHA 1IR3A 4EUUA 3RK7A 2VTHA 5LOHA 5CQUA 5LWMA 3P9JA 2J2IB 2XH5A 5AR3A 4R5YA 4EHEA 5IUIA 4DLJA 3U55A 5M56A 5E1SA 3RAIA 3R1NA 4RVKA 5CWZA 3FKLA 4CTBA 5BUJA 5H9BA 2W05A 5I9VA 3FI4A 2OO8X 4GT3A 5E91A 2QCSA 4N4SA 4EK8A 4FTMA 2WHBA 3GBZA 4TYHB 3HMOA 4YSMA 5HORA 5KE0A 3R21A 3OCTA 5FP5A 4MEDA 3Q9WA 3JPVA 3B2TA 4IVCA 3QRJA 1UWJA 4YO6A 4YLJA 5L6OA 4I22A 3ELJA 4BCKA 2HENA 1XJDA 2C0TA 4FT9A 4ZY4A 5LWNA 4WD5A 3MH1A 4GV1A 3UJGA 2I1MA 3D5XA 3KN5A 3OWJA 3R63A 2RKUA 3A2CA 4U9AA 5CZIA 2UW4A 4RJ4A 3SXRA 3UPXA 4AUAA 1SM2A 3R22A 4JRVA 3O23A 4MXZA 2IW9A 4AWIA 1JVPP 3SLSA 4O7NA 3DV3A 3UYTA 4BWKA 3C4XA 1PW2A 3CKXA 4OBPA 5DH3A 3E93A 2C5OA 3DOGA 2XUUA 3ORNA 1QL6A 1W8CA 2ZV2A 2DQ7X 2ZB1A 3L8XA 3AGLA 4IVAA 1QMZA 3KF7A 4FOCA 4DTAA 5HO7A 1MRUA 1OIRA 5BVFA 4C58A 3KXMA 1CSNA 4YGAA 4LGGA 4FSWA 5HE0A 2PMLX 3KRXA 3PUPA 5E8YA 4BBMA 5M09A 4PDYA 4I21A 3ZOSA 2W1IA 3Q2MA 2HW7A 2ZV9A 4QP2A 3LCOA 3O96A 3PXYA 4RG0A 2OJGA 3UQCA 2WQBA 3QA0A 2VX3A 4BWXA 4G3GA 3R73A 5FG8A 3OBJA 2XK6A 2IW6A 5IH6A 2HWPA 1OKWA 3ENHA 3R83A 4XP0A 4OR5A 2VD5A 2YABA 1GOLA 2O8YA 3I6WA 3BBWA 1U5RA 3TDVA 4USFA 5HG5A 3A62A 3MPMA 2XYNA 4G16A 4KIQA 4QRCA 4C3RA 3CIKA 3RM6A 3Q6WA 3PSCA 4CEGA 4B4LA 3RK5A 4LRJA 5AP3A 3QD4A 2YLEA 4DEIA 4BI1A 2Z60A 1Q8UA 1ERKA 1GNGA 2WU6A 1NA7A 2XKCA 1YQJA 2BZKB 4LOQA 4EOQA 3JR1A 1VZOA 2E2BA 2OIDA 4FR4A 2R9SA 4MHAA 4FV8A 1XQZA 2C6DA 5HCYA 3KEXA 5B7VA 1H1PA 1WVWA 2FSMX 2BTSA 1OECA 3R1QA 3MBLA 2B9FA 3LXKA 5EG3A 5I9YA 4JBVA 2B9JA 2UVZA 3MIAA 1LP4A 4C37A 4BGHA 2O65A 4FKWA 4I93A 5KCVA 4IM2A 2REIA 4AZWA 2QNJA 4WG3A 1YXVA 3VBQA 5KMOA 2QU5A 4I1ZA 1Q8TA 3Q9ZA 3AT4A 4NKSA 4EK3A 5CYIA 5HQ0A 3IPHA 4G5PA 3FMJA 3R8ZA 3NGAA 2AYPA 4GIIA 4I6FA 4PMTA 4RFMA 1M2PA 4WRGA 3H0YA 1O6KA 3GU7A 4CKIA 3RK9A 4DT9A 4UV0A 4KUJA 4AA0A 2WTDA 5KMIA 5CENA 5L2WA 1M7NA 4ZTNA 5CF8A 3H9FA 3UO6A 3G90X 4QMPA 2V0DA 5C8KA 3NNWA 2XNMA 3KXXA 1F0QA 3ZUUA 2DS1A 2BHEA 1NVRA 4NW6A 3O2MA 3IECA 3DDPA 3H0ZA 1Q5KA 5H8GA 3R01A 3O8PA 2GNIA 5FXSA 3NUSA 3UQGA 3HZTA 2PE0A 4JDIA 3ZRMA 2CLQA 3FMKA 2OBJA 5C4LA 2J0JA 2GDOA 4AQCA 3VUTA 3P23A 2VO3A 3QZFA 2JGZA 3VUIA 3ZS5A 5M57A 3CJGA 3R8LA 4UMPA 3RHKA 4M69A 4JLCA 3FZOA 4OT6A 2IVUA 4FK3A 4YBJA 4PL5A 1Z57A 3NW5A 4HJOA 4ONAA 4ZTHA 3SW4A 4FTQA 3HNGA 4A7CA 2PUNA 1BMKA 4DH8A 4FL2A 3ZEPA 5IU2A 3NW6A 4DG3E 2VGOA 3T3UA 3UBDA 4ANLA 4OBQA 4XP2A 3LIJA 3E63A 1JKSA 3D5VA 4W8EA 4YJTA 5DFPA 4O7ZA 1Q41A 3E88A 3MTLA 5DT4A 5AADA 2QG5A 4FKLA 3CQUA 2ITOA 3DA6A 2B53A 3RP9A 1RQQA 1ZLTA 2EB2A 1OL1A 4FT7A 1GZOA 4M7IA 4XLVA 4CKRA 4FTJA 3F7ZA 2YDKA 3VS0A 2QKRA 2W4KA 1WFCA 4I5MA 4U44A 2OLCA 3E8NA 1ZWSA 4E1ZA 1ZOEA 5GHVA 3GB2A 2DYLA 3FHIA 4JIAA 3QQKA 5AUXA 1YXSA 3WZDA 4F09A 1ND4A 2OJFE 2J5EA 4K0YA 5K5NA 3KVXA 2BPMA 1A9UA 3JUHA 3HX4A 4BCOA 2R4BA 1PMEA 1V1KA 2CHLA 2QODA 3NYNA 4H3QA 4UZDA 4B0GA 4FZ6A 2VAGA 3PWYA 4U79A 3Q5ZA 4X2KA 4JG7A 4U43A 5DIAA 5E8UA 4YO4A 2B0QA 2OJIA 4PMMA 3IO7A 5F1ZA 4R5SA 2I0HA 3FLWA 3QRTA 3VS7A 5IDNA 3E5AA 1JWHA 4FTTA 4MK0A 3UNJA 3OP5A 3HLLA 2XVDA 3RM7A 1Y57A 3ZFXA 3SVVA 2C47A 3HECA 5LJJA 5KO1A 3C50A 3QFVA 4FC0A 2JLDA 2J9MA 3R9RA 1DM2A 2R3QA 4BCQA 5L6WL 1WBTA 2X1NA 5AAEA 5KMNA 4PWNA 3NAYA 5JMSA 2VTSA 4F7JA 3HEGA 2ITQA 3C1XA 4QP9A 5FEEA 2BMCA 3V01A 4BIEA 4QTEA 1UA2A 3VW8A 5IEYA 3AC5A 1OUYA 3PP0A 3KC3A 3ORLA 3V5PA 1Q99A 4LQMA 5M53A 4O27B 1U46A 3Q53A 5CEKA 3ZYAA 2BTRA 4FTRA 4ZTRA 3LFSA 3UOJA 4XCUA 4U40A 3BX5A 3PRIA 2UW7A 4RJ6A 5CASA 2UZTA 4RLLA 4A07A 4YC6A 1J91A 2WGJA 3SD0A 2VV9A 1ATPE 5DGZA 5ACBC 5KMLA 4FTKA 1WAKA 3P1AA 2PMNX 4K33A 2HXLA 2QVSE 4DBXA 5HX8A 3VUDA 4YJSA 1M17A 2AC5A 1IEPA 3HA8A 4OLIA 4TYHA 2VTPA 4ASEA 4EL9A 3WZKA 4FKIA 2BDJA 2V62A 3GT8A 4IAIA 3H3CA 4Q9ZA 3IOPA 2V5QA 3ORZA 4C4EA 2YWVA 3OC1A 5DPVA 4R7BA 2I40A 3B2WA 2CLXA 4MWHA 2XIRA 5M4FA 5D1JA 1IRKA 5JZJA 5KMKA 3OY1A 2X2KA 4ACHA 4J96A 5HTCA 2V22A 2HK5A 1W84A 3DBQA 1FPUA 3OCSA 3QF9A 4NTTA 1NW1A 4EOPA 4E5AX 2A1AB 3D4QA 5ETAA 1J1BA 2GMXA 5HNGA 3T9TA 4D9UA 4DFBA 5IMEA 4RZVA 3S3IA 3T9IA 4XG3A 3LPBA 5ITAA 4YC3A 4Y5HA 4L7SA 1YWRA 1JNKA 4FF8A 3LJ0A 4QYHA 3FL5A 4CFFA 3CSVA 4BIDA 3QTXA 1ZMWA 3KU2A 5M44A 3BYVA 3DAEA 1PXJA 2PVJA 3RZBA 2IZTA 4BB4A 4AW1A 3P7AA 3QHWA 4IX4A 5J79A 1K9AA 5CAPA 4YURA 1H27A 2XBJA 1MRYA 1UNHA 5CI7A 2CCIA 4HYHA 4HCVA 4ZP5A 5K4JA 3VBVA 4GT4A 3VJOA 3NUAA 4BDIA 2GNJA 1F5QA 4C4HA 4D5KA 5JH6A 4YPDA 3QRIA 4HYIA 4IQ6A 4RX5A 5LQFA 3DBFA 1A06A 4GFGA 4CV8A 1XR1A 3FPMA 4CMTA 4F08A 4R1YA 5HZNA 5IA4A 3LFEA 2XYUA 3CPBA 3V6RA 4I6BA 1YWVA 1W7HA 2GCDA 3DLSA 5DT0A 1G8AA 3WZJA 3UNKA 3EFKA 3G9LX 4NKAA 3P0MA 4WSQA 1GAGA 3PXFA 3ANRA 4V01A 4FSMA 3HL7A 3ITZA 4FTNA 4JJRA 3V6SA 4E4XA 4C7TA 5HIDA 2H8HA 3F5GA 1ZZLA 3CY3A 2R3FA 3G33A 3GVUA 4L68A 4JXFA 3VC4A 4HW7A 4C59A 2ITUA 4ZLZA 4ZOGA 4D5HA 5FDXA 2A0CX 4KAOA 5IA1A 3R8UA 1YVJA 5EDQA 5A54A 2YWPA 4GYGA 4RJ7A 2QOHA 2HW6A 4CT1A 1OM1A 4IANA 4A9RA 5HLNA 2CKPA 3KMMA 4IZYA 3TZMA 4QP7A 4GMYA 3BGZA 5C4KA 3IG7A 4AGCA 2GHLA 3BZ3A 3HVCA 1H01A 2C3IB 2BDFA 2C5VA 2XNNA 3LFFA 3NUXA 4IAZA 3MA3A 3RPRA 3NPCA 3OXTA 5EH0A 3P86A 1XKKA 2X39A 1DS5A 4FIJA 4KWPA 4YHJA 5FGKA 3PVGA 3BIZA 4XEYA 1Z9XA 3PIXA 4JAJA 1CKIA 3F3TA 5IQIA 3DK7A 4XV1A 3WE4A 4CMUA 2FVDA 3EL8A 2CSNA 2OF4A 2WMBA 3PZHA 3UG1A 3HV4A 4WT6A 3QX4A 1M52A 2OIBA 4FIGA 4IDTA 3K2LA 2X7OA 5CVHA 3NZ0A 2C0OA 4CFUA 5C8NA 4ZSJA 5FBOA 4YZBA 2YZAA 4B7TA 2ZDUA 3ODZX 3JY0A 4H3BA 2YCSA 2R3HA 5GJDA 1XH5A 3SAYA 5CF4A 3DY7A 4O0TA 1BKXA 3EIDA 4FTCA 5HG7A 1OL6A 4CKJA 3PWDA 4QQ5A 4BCMA 5IQFA 2YISA 4FKPA 5H2UA 4AW5A 1QCFA 2QOCA 3LZBA 4QMSA 4JT3A 5CEIA 3AD4A 3SG8A 1I44A 1Q8ZA 3Q96A 3RJCA 3ULZA 4O2ZA 3ZTXA 3C5IA 3DZQA 4FE2A 3NDMA 1PJKA 2PK9A 2Z7RA 4BFMA 2JBOA 4PUZA 3MVHA 3BRBA 1GIIA 4IM0A 2WTKC 3FE3A 3G5DA 4ZSGA 4NCTC 3ZC6A 2UW3A 3LMIA 4QMYA 3SC1A 3VS5A 3HRFA 2Y4PA 3BELA 3UPZA 1ZYJA 3DTWA 4ANBA 1R3CA 2UUEA 5HCXA 1KSWA 4FSTA 4GYIA 4HGTA 3KN6A 3NCZA 4MYGA 2G2FA 3ACKA 3BHYA 5D9HA 4TKSA 2JAVA 4E93A 2OIQA 3MW1A 4U41A 1L8TA 3EKKA 5L8LA 3DXPA 4HPTE 5AUUA 4KS8A 5D10A 2HAKA 2BAQA 3R2BA 5CU4A 3JY9A 5HE1A 5TOZA 3VNTA 4K2RA 3PFQA 5LCJA 2BKZA 4J98A 3LQ3A 4F1OA 4AOTA 4U5JA 2OF2A 1JQHA 1VYWA 2HZNA 4QYFA 4R3CA 5F4NA 3EQRA 4LL5A 3KA0A 3CKWA 1YOJA 1JKTA 4LFIA 4BI0A 3UZRA 4IIRA 3LFQA 5TF9A 3TKUA 2GS7A 4YMJA 3EQCA 3P4KA 4CRSA 2G1TA 5BX0A 4FKSA 5C01A 3U9CA 4FBXA 4C0TA 4ZTLA 4YUQA 4PPBA 3E64A 2IVTA 1L3RE 3LXLA 1OIQA 1FVVA 3A7JA 4FEUA 4ITJA 1P2AA 4L7FA 2F7EE 4AS0A 2WU7A 3F69A 3RINA 4EJNA 2CGWA 3MFRA 3BQRA 3MN3A 3ZONA 3NVKI 3NNXA 2E9OA 1M14A 3QLGA 3SOAA 3RMFA 3UO4A 2CNUA 2PYWA 2J0IA 4X6RA 4G9RA 3UIBA 4E5WA 3GCVA 2PVLA 3UIUA 5J1WA 5J9LA 3VS6A 3PVBA 2OGVA 3MGYA 3FXZA 4M12A 5HNIX 3EOCA 5CI6A 2ERKA 3F3ZA 3R1SA 1YDRE 2OW3A 3RWPA 4Y8DA 2C1AA 5AP6A 3WF5A 3U6JA 1R0EA 2WFYA 4OTIA 1MQ4A 3CTJA 1M7QA 4ANSA 4EZ3A 5ETCA 2J0MB 2QR7A 3KQ7A 3BGQA 4FNXA 2PVYA 4LRKA 4DGMA 3FMNA 4DEBA 4ZZNA 3LLAA 5F20A 4YNEA 4O7LA 3EFWA 5HD4A 5AUTA 5GZAA 4K8AA 4FEVA 3QQLA 2YAKA 3MB6A 4KRCA 5A14A 1PYXA 4V0GB 3EH9A 5K0XA 1OBDA 4EYMA 3QD3A 4D55A 2QHNA 5BVKA 1APME 5C03A 3EJ1A 4DEGA 3HV3A 3OEFX 3ZFYA 5ACKA 2A27A 3ANQA 3SV0A 5CAQA 4P90A 3E87A 3RPOA 4GKHA 4JL9A 2H9VA 4X3FC 3ZSGA 3VBWA 3L8PA 4IZ5A 5D41A 3UDBA 2FSOX 3ZLWA 4M66A 3PE1A 2PPQA 2YA9A 5AR7A 2YACA 3C7QA 2B1PA 4GUBA 3TL8A 4DH1A 4FZFB 2CGUA 3M1SA 3FJQE 3BHTA 3O17A 4LGDA 1PXOA 4LL0A 4M15A 3AC8A 4RJ3A 2YM4A 4WNKA 2IW8A 1J7UA 4A9UA 3GU6A 4KKEA 1OUKA 2V7OA 3EYGA 3KVWA 4MF1A 1WBSA 3BEGA 2NPQA 3L9PA 2PZPA 3NLBA 4ZTQA 4FKUA 4ZS4A 2R3PA 4IXPA 4C4FA 3TN8A 4LV5A 3KREA 2P3GX 4YLLA 3Q4TA 4MNFA 2PZYA 4BZNA 4O0UA 5BUEA 4AGWA 2OZOA 3FXWA 5AV0A 2GS6A 5JK3A 2ITZA 1SVHA 1ZY4A 2ITPA 3U4UA 3UOHA 1GZKA 1KWPA 3I60A 3LMGA 1QPCA 1J1CA 2W1EA 3DNDA 4DFNA 3S95A 3UP7A 1Q97A 3TUCA 3LJ2A 4BR3A 4MXYA 5EYKA 1OKZA 3LJ1A 2NRYA 3CCNA 5EM6A 5E4HA 1RE8A 5AAFA 4AFJA 1J7LA 1DAYA 4YTIA 5LMKA 1OL2A 1SZMA 4USEA 5AWMA 1YHWA 4PPAA 3MTFA 4D2PA 1H0WA 1YXTA 4ENXA 3F5UA 1HCKA 5AP4A 2VWVA 5AX9A 5J7HA 2QOFA 3R9OA 5CNNA 3ZH8A 3BU6A 3NMUF 5D11A 3LMHA 2QD9A 2RFNA 4HOKA 5CX9A 3TV7A 4NM5A 5CVGA 4FYNA 4N6ZA 3HRBA 4JDHA 4XOYA 2R7BA 1U59A 3GP0A 5HO6A 2W9FB 3NEWA 4EI4A 2GTMA 2VTQA 3CD3A 2ZB0A 3UOLA 3KCKA 4BDCA 4KBKA 4XNEA 2JITA 4OBOA 3REPA 4FV9A 3GC8A 2PVFA 3IDCA 4FKQA 2XNGA 2FUMA 3ORMA 3PXKA 2IJMA 4IBMA 3CPCA 4FZDB 4KIKB 4QYYA 5L6PA 1TKIA 4UB7A 4W9WA 2W1HA 4G3EA 2X8DA 4GRBA 4GVJA 4LMUA 4GUEA 1OVEA 4OTQA 2P4IA 4BI2A 5HX6A 3FYKX 5FXQA 4J97A 4WBOA 2Y7JA 3AXWA 4FSZA 3KXGA 2PVKA 4BZDA 2B4SB 4DE4A 4YJQA 4G6OA 4LM5A 2RFEA 2PMIA 4GL9A 4XG6A 4IWQA 4BZOA 5BVDA 3R8VA 1OPJA 4TYGA 3O50A 4QMNA 4Z55A 5CSPA 1VR2A 4RBLA 5HIBA 3JVRA 1UU9A 5B2KA 1YHSA 3GFWA 4OGRA 3PG3A 3R9HA 1J3HA 3GEQA 4PP9A 5AUYA 4RIXB 4K11A 3R7IA 2XM9A 3UNZA 3Q2JA 4I0SA 4WHZA 2XJ0A 4LYNA 4BL1A 2W99B 5EKOA 2JKKA 4ANOA 3AD5A 2E9NA 2YJRA 2HIWA 2X4FA 3V51A 1XH9A 1FMKA 5A4CA 2IG7A 4R3RA 3NIEA 4TWOA 4FV6A 3O51A 3TNWA 4BCIA 4AZTA 4ACCA 4J8MA 4EYJA 5JN2A 3Q04A 3FMEA 3QBNA 2WTCA 2RG6A 2FO0A 2OFVA 2OK1A 2XNPA 4NTSA 4TRLA 2OH0E 3D5UA 1FGIA 2YIQA 2OXXA 5ANJA 5EDPA 4F65A 1YDTE 4IDVA 4CFVA 1LEWA 3PXQA 4EJ7A 3OW3A 4ZZMA 1TQMA 1KV1A 1DI9A 3A7GA 3LFDA 1Q8WA 5FTGA 2WIPA 4FSYA 4FKRA 5ANOA 3ORIA 2QLUA 4WG4A 4C3FA 5I4NA 4PDPA 5DBXA 2XKDA 4QMMA 4S34A 1H0VA 3WBLA 4X2FA 2OFUA 3IW5A 2WXVA 1V0OA 4WUAA 3MY1A 5B0XA 4BDDA 4DA5A 3PA3A 2QU6A 4HNFA 3C4EA 5J1VA 1E9HA 1W82A 5GZ9A 3E8CA 1OZ1A 4EUTA 3M2WA 3DZOA 4IJPA 2C0IA 5E7RA 5CSHA 2QOKA 3FKNA 5DR9A 5ANGA 5CTPA 5ANEA 3RAKA 3ATTA 3VWAA 3VULA 2Z2WA 4D58A 5I9ZA 4I3ZA 5KUPA 4QD6A 3F7WA 3G6GA 1NVQA 5EDRA 4XG7A 3HMNA 5HBEA 4DGGA 5EYCA 3L8SA 5AP2A 5IA2A 4YNOA 5EI2A 5A4EA 5GINE 3VHKA 3HDNA 5AAGA 4RFYA 3PJCA 2R3LA 4FT5A 4NH1A 1W83A 4FZ7A 4CFWA 4GFMA 1JOWB 1PXNA 4OTGA 4F7NA 4R3PA 5GIPE 1K2PA 2WB8A 2YIXA 2O3PA 2X0GA 4YJVA 3P08A 4RA5A 3EQIA 3ENMA 3A60A 2WOUA 3M11A 4XX9A 2W06A 4L45A 4C3PA 3GCPA 3QC9A 4DFZE 4IW0A 4DBNA 5GJFA 1R78A 3WF8A 3EQBA 2XK8A 1ZXEA 3R0TA 1GJOA 4LRMA 4TY1A 3OG7A 5DLSA 5EOLA 3UMXA 5IEVA 1VEBA 2KULA 1IAHA 5ETIA 2JDVA 4IHPA 4XRLA 2CGXA 5DWRA 4IAAA 4AFEA 5A46A 5CANA 4JBOA 3QQJA 3DB8A 2ITTA 4D2RA 5CT0A 5LVPA 4HCTA 1PHKA 2J0KA 5AP7A 3LE6A 3I6UA 4F63A 4ZJJA 4U80A 4O0RA 3QCXA 3WZUA 2VTOA 2PE2A 3FHRA 3QTSA 1JBPE 4KSQA 3R00A 4E4LA 5L8JA 1BYGA 2WPAA 4FV5A 2XIXA 3LCDA 4RSSA 3OROA 3V5LA 4HVIA 4UMRA 3FWQA 4CLJA 4KSPA 3OZ6A 2OZAA 5TKDA 5EFQA 4ZMFA 1AD5A 3WYXA 1UU8A 4G6LA 5BVNA 2PE1A 2GFCA 3CY2A 3O7LB 5ETFA 1QPJA 5J5SA 4MQ1A 4BY9E 2W7XA 1SVGA 3LCSA 4NM7A 2I0EA 4Y85A 4F4PA 5HTIA 3ACJA 2WMTA 5J95A 4V0GA 3R71A
chains in the Genus database with same CATH superfamily
3Q4UA 5IA3A 4WA9A 5E8VA 1BI8A 1XH4A 1ZZ2A 3ZO1A 5E92A 5IQDA 3W18A 4I4FA 4DFLA 4J71A 3D14A 3TJCA 1REJA 4XMOA 5KKRB 4RC2A 1ST4A 2QHMA 3F88A 3OS3A 3ZHPC 4GK3A 3DB6A 1PXKA 4O4EA 3NR9A 5D7AA 2ERZE 4YLKA 4DFXE 4JQ8A 3DAJA 4O86A 5EQEA 4LG4A 2BHHA 2WTWA 3OBGA 3TYKA 3EN7A 3PPZA 3BYMA 4TNBA 2OXYA 4CFMA 1WBNA 3GOPA 3OTUA 5AR4A 2BDWA 2VWBA 4LMNA 4KA3A 5AMNA 4ZSLA 3U51A 1Y6BA 2UW8A 4L01A 4AA4A 3CBLA 4CXAA 2RFDA 3COIA 4GG7A 5C26A 3R6XA 4ID7A 5KHXA 4O7VA 5IEXA 5EM7A 3DFCB 3KF4A 4EQMA 1CTPE 4PP7A 2PU8A 4BDBA 1SVEA 4YJPA 4CYIA 4O7WA 2OICA 1XBCA 1UKIA 2VRXA 3GU5A 4HCUA 4U97A 2R3RA 5BMMA 3NFGB 4H1MA 2EVAA 4X21A 2BVAA 4IFGA 3W32A 3MESA 3IW8A 3QU0A 1KE5A 4O81A 4U0IA 2BZIB 2F7ZE 5AR5A 3L9MA 3OCBA 3EQFA 3QXOA 4NJDA 1UU7A 3VS1A 2C6MA 2B9IA 5AV3A 4R7IA 4R1VA 3OTVA 3QTZA 2UZVA 4DT8A 4FG7A 2CN5A 3D94A 5HLPA 3D7ZA 3MH0A 4TWCA 2ITXA 4FIEA 4YTHA 3F3UA 3UC3A 4E6CA 2YLFA 2ZM4A 4NL0A 3C4ZA 4YZMA 1PXIA 2W1FA 4RJ8A 4IZAA 1JAMA 3JVSA 4UYAA 3F61A 5CLPA 3UIMA 4ANQA 4AOJA 1H07A 3BE9A 3FL4A 3BLAA 2QO9A 4FV1A 5J9YA 2ZV7A 3OOMA 4AZFA 2CN8A 3PZEA 2WTJA 2XRUA 5LVMA 2P33A 3QL8A 4ENYA 4KIKA 4L9IA 2XK3A 4BTKA 3A7FA 3UZPA 3TNHA 1QPDA 2C3KA 4FKGA 4EONA 3ORXA 4GKIA 5HIEA 3PA5A 4XG4A 1XHAA 2ETRA 1LEZA 2YEXA 2WMUA 1P4OA 4R7HA 3NUUA 4BCJA 1XMMA 4CG9A 3QAME 2QOBA 4ITHA 2QOOA 2QKWB 3A99A 1DI8A 1Q62A 3ULIA 4AN3A 4BC6A 3BL9A 4EHGA 2VWWA 3BLRA 2VTTA 4EEVA 5M4IA 3WIGA 3TV6A 5IDPA 1WCCA 2XNBA 3R04A 5FEQA 3TCPA 2X6EA 4QTDA 3PLAE 4RIXA 1OIYA 2F57A 3GU4A 5IISA 4YR8A 3PP1A 3RPYA 3PVUA 2JIIA 2CDZA 4YZNA 3G6HA 4L43A 4EWHA 4O7RA 3FY2A 3IS5A 3DKFA 2J7TA 4QP6A 3F2NA 4EOJA 3C4FA 1HCLA 2ETMA 3LCTA 3U8WA 4FX3A 4FKJA 5IKWA 5KNJA 4DITA 4EOKA 4ZMEA 5A4QA 3RWQA 4Y95A 4JQ7A 4EOIA 3CS9A 4U6RA 1O9UA 2XRWA 2VO7A 4EH9A 4L53A 2BIKB 2ZOQA 1URCA 3QYWA 4ALWA 3UP2A 5HESA 5CXZA 4MH7A 5DMZA 3UMWA 5CQWA 5JQ8A 3I1AA 1OGUA 4DH3A 4E4MA 2XANA 2JC6A 4YJRA 3MI9A 1U4DA 3ORPA 3Q4ZA 3WYYA 5L2TA 3RNIA 4OAUC 4FEWA 3BU3A 4Q5EA 2CKOA 5CS6A 3DGKA 4OTRA 5BVOA 4DF3A 4O21A 3EN6A 3EFLA 2WMAA 3FZ1A 3QKKA 3W8QA 4O7TA 4JDJA 3KK8A 4AN9A 5EYMA 1T46A 1ZMUA 2XAMA 3ZEWA 3ATSA 4TXCA 2XA4A 4JX3A 3QCSA 3CR0A 4J8NA 3U6HA 4E6DA 4QP3A 4BDJA 4L00A 4XV2A 3ZLSA 4F9CA 4KIPA 4FT0A 4ZZOA 5CU2A 2WTKB 5JQ5A 2PUPA 5EM8A 3DXQA 3CXWA 1ZOGA 4I5HA 4O84A 2F2CB 3E7OA 3AKKA 2RL5A 4NU1A 2WQMA 5A4LA 4BHNA 5KX8A 3F2AA 1KE7A 2J50A 4JR7A 3F5PA 5IUGA 4FGRA 5M4UA 1G8SA 3L8VA 4X6QC 3P5KA 5CNOA 5EW8A 3R2YA 3HV6A 2OSCA 4AN2A 3RAWA 2CKEA 3U4WA 1JSVA 5JGBA 3C0IA 3BWJA 4O0XA 2WMVA 3V5WA 4RLKA 4AOIA 4ZLOA 5AR2A 1URWA 3Q32A 2R2PA 4O1OA 3RNYA 3ALNA 4ACMA 4C62A 2EU9A 4C4GA 3NUYA 4AGUA 4G31A 3GOKA 2I7QA 1YI4A 3SXFA 2QOIA 5AV2A 1EH4A 5EQYA 4ZTMA 1KOBA 4DG2E 5BPYA 5FQDC 2H34A 4QYGA 4BRXA 4H3PA 5M07A 4E6AA 3Q60A 4QPAA 3QA8A 1CM8A 4P5QA 3OT8A 5CALA 4MCVA 5L2QA 3TKIA 2G2HA 3CTQA 4EQUA 2ONLA 3QRUA 4M3QA 3VBXA 4FV3A 3KRLA 4Z7HA 1FVRA 5CF5A 2XCKA 4O0VA 4UWBA 3TV4A 2CNQA 4L46A 4CZTA 3FZPA 4B6LA 4CVAA 3A7HA 3TI1A 4BKZA 4AXDA 1H00A 4HVSA 4TZRA 4AAYA 2I6LA 3NFFB 1VYZA 4O0YA 4F6UA 4X2JA 4LDTA 1RJBA 5EHYA 1REKA 3QTRA 4MD8E 5BYYA 4EH7A 4FI1A 3CP9A 2CKQA 4F9WA 3MH2A 3NNUA 3FC2A 4HNIA 4F1MA 2WEIA 5A6NA 2ITVA 1U5QA 3HRCA 4FSRA 5IH4A 5DRDA 3PY1A 4M0ZA 4GJ2A 2WMXA 1ZARA 4FV7A 4RX8A 4AAAA 3MJ1A 5BVWA 2IPXA 3DNEA 1P4FA 4OW8A 4RWLA 1SMHA 2JIVA 3F9NA 4M67A 3U54A 1YDSE 2C5XA 5F9EA 3ID6C 3GQLA 4YHFA 3P78A 4Y73A 1WMKA 4PRJA 3F5XA 4G3DA 3FI2A 2HY0A 3AG9A 4FV2A 4BDGA 4XRJA 4BTFA 3FLSA 4U81A 2PMOX 4QMQA 4XH6A 4ACGA 3ZFMA 5L4QA 4RIYB 4TPTA 4EZ7A 2Z7LA 5JFSA 3IQ7A 5DN3A 3OXIA 3GENA 4UEUA 4HYSA 3KGAA 1ZYSA 2VZ6A 3AT2A 3IW4A 5E8WA 2Y9QA 3VAPA 4HGEA 2C6OA 3FZRA 3QC4A 1H1QA 4DTKA 2QI8A 2HXQA 2XS0A 4F99A 3OD6X 4I0RA 4L3PA 4AT5A 1SYKA 5AEPA 4BGGA 2ZV8A 3GC9A 5J7BA 2W1ZA 2FSTX 3TZ9A 1UWHA 3LFAA 3PXZA 4NYEA 1VJYA 3PG1A 4NIFB 3LHJA 2VWIA 3MPAA 1S9IA 4B8LA 4OTDA 2R0UA 2OJJA 4C4JA 3W0RA 2HZ4A 4JG6A 2BRBA 4CT2A 5EK7A 3N51A 4BCGA 4RX7A 3KMUA 5T6KA 2ZMCA 5IQEA 4EKLA 3L1SA 3SXSA 2CPKE 3NSZA 1OPKA 2WZJA 4BDFA 5ANIA 3PVWA 2HZIA 2XJ2A 3ZSIA 3OY3A 4EZ5A 2R3MA 3FZTA 4YU2A 5E8SA 2YDIA 4IM3A 1Q3WA 3SGCA 5A9UA 1H25A 2IF8A 4W4VA 3MYGA 1RDQE 2FSLX 4NFMA 4I6HA 4G34A 2BRHA 3OXZA 3F2RA 2SRCA 5FM2A 2IO6A 3PE2A 4BTMA 4C57A 4ZS0A 2OG8A 1TVOA 2W5AA 3NUPA 1BI7A 4NFNA 5FRIA 5FTQA 3UOKA 1XWSA 3Q52A 3IW7A 5FWKK 2GNHA 3FMMA 4GSBA 2WO6A 4UWYA 4UXLA 3QKMA 4H1JA 2GU8A 4P4CA 4MF0A 4MD7E 4KBCA 4X3JA 4ZLYA 5AV4A 5AP1A 3F82A 4UZHA 4AT3A 2BROA 2X4ZA 4CTCA 5CEMA 4CZYB 4RMZA 5J5TA 4FNZA 2BILB 1O6YA 3WOWA 4E4NA 3V5TA 1XH8A 3LQ8A 4MNEB 4ZK5A 5F94A 3BBTB 3O7LD 2BFXA 4M0YA 2R3NA 1FBNA 5A4TA 2XB7A 1KUTA 3UDSA 2FH9A 3D9VA 3EN4A 3PYYA 3IK3A 3SRVB 1OL7A 1KE9A 2XNEA 5ICPA 2JKMA 3EKNA 4DEHA 5L3AA 4UY9A 3QQHA 4CCBA 5AUWA 3D2IA 2ZFYA 3AMYA 4FV0A 4RX9A 4C38A 2WMSA 4IAFA 3KKVA 1SNUA 3FMHA 3BPRA 3G2FA 4C4IA 5GZ8A 4NUSA 4L8MA 2DUVA 4L67A 4CD0A 3SG9A 3A8WA 5M51A 4WOVA 5DI1A 4MXXA 2EXCX 2EUFB 4QMXA 1WVYA 5JT2A 3KXNA 3IDPA 4EWQA 4RA4A 2XIKA 3NWWA 4YBKA 4DN5A 3V8SA 3VQUA 3QGWA 5C27A 4FT3A 1IASA 1P14A 2FA2A 2E9UA 3FUPA 4J95A 3D83A 4E3CA 2BKKA 2XP2A 1W2CA 1FQ1B 5HO8A 1JSTA 2BR1A 2WMQA 3C0GA 3IW6A 4YC8A 2VO6A 5DE2A 3KRRA 5JFWA 1PXPA 3AOXA 3RHXA 1UNLA 4GCJA 3TT0A 3ET7A 4AA5A 2YM8A 4L52A 4GK2A 4QP4A 4GU9A 1ZAOA 4L44A 1H26A 5LVLA 3TTIA 3VQHA 3VRZA 5D12A 3BGPA 4M68A 3W33A 2JIUA 3EZVA 2JKQA 2I0YA 2J0LA 3FMDA 4QMWA 3RZFA 4C34A 5C1QB 3GI3A 2J6MA 4QOXA 3QALE 5LARA 2NO3A 5B2LA 2RGPA 2OWBA 2X8EA 2XM8A 3OHTA 2X2LA 4QMVA 4Y72A 3W2RA 2GPHA 4G6NA 3QUDA 4ALVA 2J5FA 1Y8YA 4QQJA 4EOMA 3G0EA 1WBWA 4LOOA 1ST0A 4CRLA 4YTCA 3HAVA 4PF4A 4AZVA 4DEEA 1XO2B 1JSUA 2WD1A 3P79A 4MXOA 4PQNA 2X81A 4ZXTA 2VTRA 4B8MA 4KKHA 4EC9A 1FGKA 4AX8A 4GJ3A 3R7VA 3NAXA 3E8EA 1B38A 4F6WA 3O0GA 3DBDA 3GGFA 4TTHB 2JFMA 4AACA 5E8XA 4EHVA 5CEPA 2DWBA 1GZ8A 2FYSA 3K3JA 3I0QA 4LUEA 5BYZA 5DOSA 3WF6A 4DH5A 5IQBA 3WARA 4O7YA 2QOLA 4GIHA 4KIOA 4CNHA 5IUHA 3MPTA 4JR3A 1BUHA 2P2IA 2P0CA 2G15A 3DJ6A 3HDMA 4GU6A 3U87A 4ZSAA 2YHVA 4O4BB 4IB1A 1Y8GA 4IVBA 5FXRA 5KMMA 3DBEA 4I20A 4MXAA 4D4VA 1Q61A 4GK4A 5E1EA 2UZNA 4ANMA 2X2MA 1OITA 3LM5A 4YPSA 2BZHB 4XLIA 3POOA 5CAVA 4IX5A 3KULB 5AV1A 4APPA 3QHRA 4AXAA 3S1HA 2UZWE 3QQUA 4R8QA 3FEGA 3K54A 2PUUA 2QO2A 4JQEA 2AUHA 4BHZA 4RZWA 3SKCA 3QUEA 4U3YA 1GY3A 5EKNA 2G01A 4AGDA 3S4QA 2VTAA 1JLUE 4JAIA 4I5CA 5H8EA 3THBA 5IA0A 2WIHA 2JBPA 3BHVA 3EQHA 5HVJA 3VBTA 4RIWB 1PKGA 5CSWA 4JMQA 3BE2A 4RVTA 4IC8A 1PF8A 3R7UA 3VW6A 4D2TA 5DVRA 5CF6A 5L2IA 3CJFA 5DNRA 3WZEA 5IZFA 3MVJA 3QTUA 4FSNA 2CGVA 4I94A 3QGYA 2O5KA 3D2KA 3PA4A 2FB8A 3FQEA 4IFCA 4K9YA 4OTHA 3GC7A 4FVPA 2PZ5A 3MVLA 4KB8A 1G3NA 1T45A 4O4CA 4CG8A 2PVNA 2C5NA 2VGPA 1WVXA 2XZSA 4FKOA 4FG8A 4G1WA 4S31A 5HU9A 2QURA 3TEIA 4ZIMA 4BKJA 5AA8A 5JSMA 2O63A 2OU7A 3GCQA 3OF0A 4O0SA 3C4CA 3VF9A 2W4JA 2UV2A 4YZ9A 2YM5A 4YZDA 4CQGA 4EOSA 4X7QA 4O1PA 2QC6A 4A4OA 3I4BA 4QNYA 4DC2A 4HVGA 5E9EA 1SNXA 4RC4A 4RIYA 3R8PA 1KE6A 2HWOA 2Y6OA 3BLHA 2GQRA 3PJ3A 4MBLA 3CE3A 5CVFA 4FIHA 4B9DA 4JRNA 4PNIA 3TJDA 1M2RA 2PUIA 4HZRA 3F6XA 5AM7A 2Q0BA 2R7IA 3BQCA 4QMOA 2BAJA 4QPSA 3A8XA 2RFSA 3FSFA 3GNIB 3SX9A 4AT4A 3EFJA 2GHMA 4EORA 1YRPA 2Z8CA 1NVSA 1UNGA 3L9NA 3BEAA 5TO8A 2JDRA 3BHUA 5I3OA 4APCA 4IAKA 1STCE 4BCFA 4FKVA 5AP0A 3G0FA 1WBPA 2PSQA 4ARKA 4NIFA 2GS2A 2XEYA 2Z02A 4IWDA 1PMVA 2C6KA 2EXEA 3DK3A 5FM3A 4CCUA 4O96A 2O64A 3EN5A 3ROYA 4L3JA 5JEBA 3U6IA 3RGFA 4S30A 5AIKA 3I0OA 5AX3A 3FMLA 3NYVA 4BDHA 3NCGA 1NXKA 3T3VA 2RSVA 4MQ2A 3R7EA 1W98A 4L3LA 2JEDA 3HP2A 1CDKA 4BVUA 2YM3A 4O7SA 4QQTA 3FSKA 4BIBA 5DT3A 1GZNA 3G51A 3QCQA 3R7OA 4CYJA 5L2SA 3V8TA 3KY2A 4YSJA 3PSBA 2W1GA 5A3XA 4AW2A 4FTLA 5IF1A 2HYYA 5K9IA 3FV8A 4FL1A 5HICA 4KNBA 5AUVA 4F9YA 3OOGA 4TL0A 5EI8A 5HD7A 4D1ZA 4EOLA 2XIZA 3M42A 4E6QA 1YOMA 1UKHA 4D4RA 4JVGA 4P5ZA 4H05A 1YXXA 4FOBA 4AW0A 4JX7A 5LCKA 5EOBA 3QWJA 2GTNA 1V0BA 4R78A 4KKGA 2PZIA 5HVKA 5BQ0A 2R3GA 3BYOA 3C9WA 4FG9A 1BX6A 3W2OA 5GIOE 2PVMA 5G1XA 3OFMA 4RWKA 2UVYA 3R7GA 4I92A 3DT1A 4UWCA 5I3RA 3S0OA 2XK7A 2R3JA 3BV3A 4RWJA 4DCEA 1FVTA 2YIRA 2ZDTA 3GXLA 4LGHA 3A61A 5JZNA 2PTKA 3WF9A 4CZUA 4ZY5A 4MNEA 3BU5A 5C9CA 4JNWA 3II5A 1JKKA 4TYEA 2UZDA 2VN9A 4WIHA 5AIRA 2BRMA 3UGCA 3ORTA 3KMWA 4Y83A 4MVFA 5CT7A 3RVGA 3SRVA 3KXZA 3CGOA 3KL8A 2KTYA 3I81A 3MY5A 4UALA 1YWNA 3R1YA 2VNWA 3GCSA 5IQGA 2CMWA 4NEUA 5EW9A 3GUBA 3WIKA 4DLIA 3BWFA 5AR8A 3UVPA 4RQKA 5LVNA 3D5WA 2YDJA 4E7WA 5ANKA 3I7CA 4UMQA 1P5EA 5IQAA 4PL4A 5AFVA 4NT4A 3W10A 1NT2A 2RG5A 2H96A 2QO7A 3RAHA 4QMZA 3MY0A 1JPAA 4UMUA 4TYJA 1FOTA 3HAMA 1PY5A 5EHOA 4BF2A 1FMOE 2ZM1A 4C35A 1U54B 4DINA 5BMSA 3PDTA 4D2VA 4FTOA 4XV9A 2BALA 4FMQA 2VTJA 2Z7SA 3EHAA 5T68A 3N4VA 4PDOA 3AC4A 3FY0A 2UZOA 2VTNA 4PPCA 3UTOA 3VS4A 4IEBA 4X2NA 4QT1A 4XS2A 3W8LA 2GQGA 3AMAA 3GCUA 3UVRA 3NX8A 1CKJA 2F9GA 2GNFA 4G3FA 4H58A 3G15A 1GIHA 4D4SA 3ZM9A 5I9XA 3OMVA 2XKEA 4C8BA 2EWAA 5CXHA 4U8ZA 5HTBA 4BJJB 4L6QA 4JG8A 4EH5A 3PTGA 4WO5A 2WMWA 2ZMDA 4I5PA 4TNDA 3QLFA 5CEOA 3P5JC 2C30A 4PTEA 5A6OA 3NYOA 2WQNA 4QDEA 4ZSEA 3ZCLA 4C2WA 3CTHA 2GHGA 3BKBA 4YJOA 2XEZA 2A98A 5LVOA 1A48A 3QQGA 3VUGA 2PZRA 3ZUTA 3CGFA 5IG1A 3EMGA 2Y4IC 3ZUVA 4WRSA 3P7CA 1IA8A 3QCYA 3QYZA 3H9RA 5HOAA 4FTAA 4S2ZA 3OEZA 1I09A 2W17A 3C0HA 4XV3A 2B52A 4EKKA 3ZLXA 2YM7A 3TDWA 4FUXA 4K77A 2W5BA 5J9ZA 2R3IA 2PHKA 3DKGA 2C6EA 3MWUA 3Q9XA 4UMTA 2NNWB 2QOQA 3DXNA 4FVQA 1WBOA 3MH3A 4C2VA 4EH3A 3FLZA 4ZEGA 2J51A 5EHLA 5KZIA 3RBWA 4FGBA 4O0WA 3V5JA 4FODA 4WG5A 3ZDIA 3L9LA 3IOKA 1W2FA 4FNYA 4I0TA 3ZXTA 3EQGA 5CU3A 2UW0A 4KBAA 3D7TB 3TM0A 3PSDA 3LOKA 1FINA 2VTLA 4RC3A 5LXMA 1ZYDA 2YAAA 3FLNC 4OAVB 3FC1X 1WBVA 4C61A 3BYUA 5TE0A 4FK6A 3VVHA 2R64A 3S00A 4AE6A 5AP5A 4Z16A 2VTIA 3ZO4A 4E20A 5TR6A 4FSUA 4IE9A 3B8RA 1H28A 2YJSA 1Q8YA 5CSVA 3KULA 3EZRA 2XNOA 3UIXA 4FTIA 2ESMA 3EL7A 1S9JA 4E26A 4EBVA 4M8TA 4AXEA 3C5UA 3PXRA 5JKGA 1ZY5A 2EXMA 4DCAA 3Q4CA 4BDKA 3MB7A 1HOWA 4PMPA 2XK9A 3ZC5A 4GT5A 4F6SA 2YIYA 5GJGA 4K6ZA 3LFBA 1B39A 2QLQA 4FV4A 2R0IA 4RIWA 4XP3A 4K1BA 3AGMA 2IN6A 3NRMA 3A4PA 4O22A 4ASZA 5BUIA 3GC0A 5HU3A 4R77A 4QMTA 5FUTA 4BCPA 5K0KA 3HYHA 4RFZA 5HLWA 2PWLA 4DGLC 1CKPA 3MFUA 2NP8A 3LCKA 4FIIA 5FEDA 4XG8A 4G5JA 3ZRKA 3UDZA 1UU3A 4M97A 1VLRA 4OTFA 1PXMA 2P2HA 4EH4A 3MVMA 3O71A 1OL5A 4IJ9A 3E62A 2VUWA 3QZGA 3PPJA 5DHJA 3UE4A 3DCVA 4D1SA 4Z9LA 5AA9A 4FEXA 5FTOA 2R3OA 5M06A 4EBWA 1ZOHA 3PIZA 3VJNA 4I23A 3N9XA 4QTBA 3RKBA 1ZRZA 2JAMA 4NJ3A 1G8JA 2BRNA 3JS2A 2JFLA 3DJ7A 3ZM4A 4F7SA 3LXNA 2W1CA 3MS9A 3NYXA 3OWPA 2ZYBA 3LLTA 3ZRLA 3SOCA 4ALUA 4AZEA 4QO9A 2W5HA 2ONLC 4JOAA 2BCJA 4J7BA 1MUOA 1OKVA 4GG5A 4U42A 1IA9A 4HZSA 3ALOA 2IVSA 2UZUE 3K5UA 3UYSA 5EM5A 2W96B 4M13A 4I24A 4CMOA 4PDSA 1Y91A 4BTJA 3UO5A 4J52A 4MX9A 4XBUA 4FICA 4XYFA 3HGKA 4BGQA 2WTVA 3UQFA 2VO0A 3MSSA 3TXOA 3NW7A 5KZ0A 3KCFA 4IX6A 4P2KA 2LAVA 3TUBA 4GVAA 1LR4A 4QTAA 2X9EA 3LVPA 4D28A 2BIYA 3ETAA 4QP1A 5HKMA 3WI6A 4O91A 1Z5MA 3LFCA 5CU0A 3F3WA 4FYOA 2C5YA 3Q5IA 3FXXA 3FLYA 5HE3A 4F7LA 2V7AA 3COMA 4XG2A 4WNOA 1H24A 5ANDA 3ZBXA 4PX6A 3DKCA 4MBJA 1YOLA 2HY81 3LW0A 4DGNA 3LFNA 2B7AA 5CAOA 3W2SA 3NS9A 3DBCA 4CLIA 2UW9A 4UBAA 4ZY6A 1MQBA 3E8DA 4TN6A 2VWYA 3HV7A 4MD9E 5KKRC 4LI5A 2X7GA 4A9TA 4BDEA 3PIYA 4FVRA 1IG1A 3I79A 3TTJA 5I5ZA 2WQEA 2B54A 5HG8A 2GQSA 5BNJA 3HUCA 3KRJA 1OB3A 3DTCA 2WOTA 3QX2A 4IZ7A 4NM3A 3VIDA 2GNGA 3SHEA 1F3MC 4CFXA 2YERA 3C51A 3MFSA 2XJ1A 4FTUA 4NM0A 4PV0A 4V05A 3W55A 4UN0C 4DG0E 3DQWA 3ROCA 4D4YA 2OKRA 5FD2A 3RALA 4DFYA 4EC8A 5KBRA 3LQ5A 5IMXA 1J7IA 3U9NA 2IZUA 3H10A 1YW2A 2JKOA 3H4JA 4JBQA 3B8QA 5HI2A 1Q24A 2RIOA 4IAYA 3D15A 5G6VA 4LOPA 3ERKA 3RTPA 3TACA 3TIYA 2O2UA 3IDBA 3TNIA 4BDAA 3SA0A 2JD5A 4RWIA 3TNPC 3FPQA 4EH8A 4F0FA 4U45A 4TWNA 1OMWA 2WMRA 4A4LA 2IZSA 2V55A 4DGOA 3N4TA 1QPEA 4S33A 4HYUA 2JDOA 2F7XE 4RGJA 4BYJA 5HHWA 3TG1A 3HMPA 4DH7A 1M2QA 2B55A 2J90A 4Z3VA 3PJ2A 2B9HA 3FI3A 2QQ7A 3FBVA 3V04A 5T3QA 4M84A 3W2QA 3IONA 3VUHA 4Q9SA 3P7BA 4DEDA 2C3LA 2WTIA 4NK9A 2C4GA 1PMUA 2CCHA 4A9SA 4DAWA 1MRVA 3WILA 4F1TA 4A4XA 1LPUA 3PRFA 3A7IA 3NUNA 4Q5HA 1Q3DA 3ZLYA 5FBNC 3HUBA 5HBHA 1BL6A 2OH4A 3WF7A 3O8UA 4ASDA 4DDGA 4QQCA 2XK4A 3AKJA 4PNKA 3DPKA 5HVYA 2WQOA 3TWJA 2HOGA 1U54A 1YXUA 3Q3BA 4N70A 3OWKA 3QZHA 4I6QA 3QD2B 3ZMMA 5IQHA 3PLSA 3R9NA 3QXPA 4J53A 3RPSA 2OXDA 2XMYA 3VO3A 5D7VA 4D0XA 4TYIA 3H9OA 3KK9A 4Z7GA 4FIFA 4G9CA 1OPLA 4JIKA 3ZZWA 3QUPA 2BZJA 2C6LA 2W9ZB 2WKMA 3MJ2A 3TKHA 4ANNA 1TQIA 2C68A 4IC7A 3QD0A 5CY3A 2A2AA 2ZM3A 4F70A 3AC3A 3DQXA 4DFUA 1TQPA 4W9XA 1Y6AA 4NW5A 3OW4A 2CNVA 2YITA 4F0IA 1E1XA 5F95A 2YM6A 2W0JA 4G17A 4BJJA 3BL7A 2NRUA 4FA2A 5IH5A 4IVDA 1O6LA 5EQPA 4LV8A 4JI9A 1OKYA 2A19B 1ZMVA 2WAJA 4XBRA 2YCQA 4ZJVA 3K3IA 3VN9A 3W2CA 4X3FB 3SW7A 3QRKA 3PJ1A 4HPUE 4GH2A 4EH6A 5DYJA 3IKAA 3AD6A 3PY0A 3CC6A 3W0MA 3QZIA 3TUDA 2I0VA 4I41A 1YI3A 4FSQA 4C36A 3OUKA 4D1XA 4YJUA 4N0SA 2ZAZA 4U3ZA 4FUYA 4MKCA 5DEYA 2LGCA 2UZLA 4OTPA 5IPJA 4O82A 4X0MA 2UW5A 4QYEA 2BUJA 3AC1A 4RPVA 5JGAA 4IACA 5CU6A 4O6LA 4IMYA 3Q6UA 5GNKA 3RCDA 5EI6A 1PMNA 2UVXA 4AG8A 4YHTA 4IH8A 3D7TA 4BKYA 4E8AA 3FLQA 5I9UA 3UG2A 4G3CA 3CEKA 4RVLA 5HE2A 3V5QA 3DFAA 4YP8A 4ACDA 2OJ9A 3ZSHA 1V0PA 2PVRA 2G9XA 5I9WA 3POZA 3QTWA 4JS8A 3G9NA 5K4IA 4H36A 4ERKA 3FAAA 1H1RA 3HKOA 3PPKA 2PL0A 4O38A 5JFVA 3T8OA 4ORKA 4AE9A 4RQVA 3QKLA 3RCJA 3NIZA 4U7ZA 5HEZA 3W16A 2XKFA 3VF8A 2VWUA 3AMBA 4O2PA 3QWKA 4WNPA 2VWXA 5EYDA 3R02A 4PMSA 4PY1A 3E3PA 4IB3A 4QMLA 2WEVA 1NY3A 5LMAA 2VWZA 2G2IA 2F4JA 3TIZA 4IWPA 4D0WA 3COHA 3C13A 5E8ZA 3RI1A 4HGSA 1R1WA 5DR2A 2QG7A 3OVVA 3GFEA 3JYAA 4WKQA 1H8FA 4CFNA 5IA5A 4TT7A 2WNTA 3DLZA 3F3VA 5E90A 3LKMA 2X0OA 3CD8A 2PULA 4CSVA 3JXWA 3W1FA 1ZYCA 3DS6A 3FZSA 3HP5A 3KRWA 3SDJA 4BCHA 2Y6MA 2JDTA 2P55A 3V3VA 2XF0A 1KOAA 4USDA 5C8MA 5FDPA 3HMIA 5K5XA 4DHIB 1AGWA 2ACXA 4O4FA 3I7BA 4BYIA 1GIJA 2Y0AA 3KFAA 3OUNB