3A7IA

Human mst3 kinase in complex with adenine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
287
structure length
286
Chain Sequence
MQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine kinase 24 (STE20 homolog, yeast)
publication title Structures of human MST3 kinase in complex with adenine, ADP and Mn2+.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3a7iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3a7iA01
1YI6A 3PJ1A 3EZVA 2VGOA 4QMYA 4EOPA 3NR9A 1XKKA 5HBEA 3F3VA 3EHAA 3DOGA 4X2KA 1PXLA 3D7TA 3GB2A 3GQLA 4XV2A 4EK6A 3LCDA 1H4LA 3LAUA 3PWYA 3UDBA 1ZYSA 5BNJA 2YACA 2DYLA 2VO3A 2WQBA 2JFMA 4L7FA 3SXRA 2VTRA 1IA9A 3JR1A 5JZNA 2EXMA 4IM3A 4LQMA 1W82A 2CKPA 5TO8A 1PYXA 3ET7A 3P1AA 2PMIA 4FODA 4GVJA 4I5MA 5DR9A 3VULA 5CSVA 3NCGA 3FAAA 4C38A 1F3MC 2W1GA 4EK3A 4X2GA 3CIKA 2EB3A 2CN8A 5M53A 5HX8A 4XV9A 4M15A 5CAPA 4L53A 4WNMA 4K77A 2GFCA 2UW7A 3JVSA 3R8ZA 5JMSA 1NVRA 5IQFA 2H6DA 3VRZA 4S31A 5HICA 4G6NA 4YTIA 4DGMA 5AM7A 4IC7A 3BYUA 3OWLA 2B4SB 4KNBA 3A7FA 4YJQA 3UG1A 2J0JA 2QONA 3LFCA 4E93A 4ASXA 4C58A 2PL0A 4GRBA 4FIFA 4G16A 5DG5A 4FTAA 2W4OA 1M2QA 3KVWA 3PA3A 4OBQA 2VTTA 3MIYA 3E63A 4CZYB 3BGQA 1FQ1B 2WEIA 3H0ZA 3LCOA 4QT1A 5LQFA 4WKQA 3QHRA 3R73A 4QP9A 4V01A 2WFYA 3ZSGA 3UQFA 3TZ7A 4ZMFA 2PUNA 3ZLSA 4A4XA 4B6LA 3SOAA 5KKRC 4FSQA 4E6CA 4N57A 1QMZA 3BU6A 3PDTA 5ITAA 2IZTA 3CY2A 3RGFA 1PYEA 2VU3A 3PVWA 5CU3A 5AWMA 3UVRA 3AOXA 4FEVA 3ORXA 1YWRA 3RAKA 2REIA 4BCQA 5IA3A 3O71A 2P33A 3Q32A 3ULZA 4HVDA 2UZNA 2VWXA 4IIRA 4K9YA 5DA3A 2JDRA 5DT3A 1B39A 5F20A 4BIDA 4EK8A 5HTCA 3MY0A 3EN4A 1XH9A 5KMNA 3G9NA 4GT3A 4RJ4A 1M2PA 2PULA 1PXMA 1YW2A 2YABA 4YC6A 5A54A 4XBRA 2SRCA 1H24A 2F57A 4H58A 2IVVA 4E7WA 4R77A 3QGWA 5FP5A 5IMXA 2ZAZA 4R7BA 2VWZA 4WBOA 1WCCA 5HHWA 4ITIA 4R78A 1OPLA 1BX6A 4QYEA 3ATSA 3TG1A 3O7LB 4TYGA 3S4QA 2XB7A 3EFWA 4P5QA 5I9ZA 5JZJA 1GZNA 4MH7A 5H3QA 4UX9A 1P5EA 5HE1A 3G15A 3E5AA 4FSWA 3TV6A 3BGZA 4TNBA 5I9VA 3GC9A 2F7XE 3ZRLA 4O0YA 5J5TA 3H9OA 2ZVAA 3RCDA 4J99A 4EC9A 4H1MA 5JFXA 3A62A 4AT4A 2VAGA 4ZJIA 4F9CA 3VO3A 2B53A 2R3JA 1NY3A 5GZAA 1XO2B 3FXZA 4CFFA 4U42A 4JDKA 4XG2A 3UOHA 3QQJA 4FTTA 2VTQA 4BDGA 3BV3A 3ZFXA 5CEIA 4AT3A 3TDVA 4FSUA 3FZOA 5M06A 5AP0A 5T3QA 4A4OA 2WQMA 3I6WA 3P78A 5IA5A 1YXSA 3R9NA 3CTQA 2QR8A 3M42A 3NLBA 4BZOA 3CR0A 2OBJA 4M12A 3QWJA 4RX5A 4C36A 3B2TA 3D15A 3MFSA 4ZTNA 5M4IA 2OIQA 2QHMA 4BCGA 4H1JA 5IPJA 4LUEA 5JFVA 4CGAA 2W06A 3BBWA 4YJPA 3UOJA 2P0CA 3KN6A 1RJBA 1PY5A 3EQBA 2B9JA 4ASEA 1IRKA 3IW4A 2OW3A 3K5VA 3Q4TA 4QNYA 5A46A 2X7FA 2CHLA 3TN8A 4KD1A 5IH6A 5J8IA 3IW7A 4I1ZA 4J8MA 5KHWA 2IG7A 1JKKA 4YTCA 4MHAA 1PMVA 3AT4A 4EWHA 5HIEA 2QOFA 5CENA 4RLLA 4RWKA 4FV7A 2XCHA 3R8LA 1QPCA 3OF0A 3ZXTA 3L9MA 4U44A 4F1TA 3ZSHA 4JXFA 3OG7A 1ZMWA 4AN3A 3ZZWA 2JIUA 5FEQA 3FLWA 3PFQA 4OTWA 3LIJA 1WBOA 3UYTA 2PZIA 2QO2A 3PA4A 2FVDA 2C1BA 4F99A 3O50A 3EQGA 3KK9A 3DA6A 4R6VA 4KKHA 3OUKA 4ITHA 1U59A 2HOGA 2F2CB 2X9FA 2XYNA 4MK0A 5AX3A 5A3XA 3CGOA 3VBTA 3EN9A 3FI4A 4JLCA 5HCZA 5K3YA 5L6WL 3L1SA 3PJ3A 3DXNA 4YP8A 5IH4A 1AD5A 1URCA 4KAOA 4X7QA 4JVGA 1IAJA 4O7WA 2J0LA 4I23A 4C62A 3WBLA 3ACKA 2HW7A 4LOQA 5BUIA 4ACMA 3CD8A 3Q6UA 3ENMA 3QA8A 3MI9A 1A48A 5F94A 4ZK5A 1I09A 2PE1A 3DDQA 2RSVA 1Q8TA 4E5AX 4BDEA 1IG1A 3PXZA 1SM2A 4PTGA 2VTHA 3OTUA 4O7TA 2X2MA 4C59A 3KN5A 5I4NA 5I9YA 2WMAA 4Y83A 2X7OA 3P7AA 2XNNA 1YOLA 4AW2A 1PXPA 4LV5A 3BGPA 4QP7A 4AX8A 4ZTMA 4L3LA 4MXCA 3V5TA 3FYJX 4GG5A 3RINA 5IDPA 1H07A 1OZ1A 3WF5A 4JX7A 2CPKE 4HCVA 4TWCA 4LRMA 3NNWA 4KSQA 3B8QA 3NUPA 4PWNA 5AV2A 3A7IA 4MXXA 3V3VA 2A27A 4I4EA 2RG5A 2GNJA 2ZV2A 3DKGA 3V5WA 4Y95A 5FP6A 1YWVA 3TNIA 3ZFYA 3BHHA 3Q3BA 2E2BA 3PIXA 1WBNA 1WMKA 3MN3A 2C4GA 2P2IA 2NP8A 3NWWA 4KS8A 4MXOA 3Q04A 3RP9A 2YIXA 3MY5A 2IVSA 3UQGA 2GDOA 3EZRA 3LM0A 4FIHA 5HBJA 3UNKA 4LL5A 2HELA 3PLAE 4M7IA 2YIWA 3NX8A 2UZOA 3PZEA 2O63A 3ZDUA 5EHOA 4KUJA 2YDIA 4FKIA 4HCTA 3NSZA 4IAAA 1WBPA 4I6QA 2C3KA 3ZCLA 5EQPA 3ATTA 1H0WA 3DY7A 4ENXA 3VS3A 3RNYA 4C0TA 3F7ZA 4FZDB 1ZWSA 3GCUA 3KXGA 3OCTA 4BR3A 5FEEA 4QQJA 3QCXA 2PVJA 4FZ7A 4I93A 3QTWA 4RVTA 5FXQA 4PDOA 4U41A 4W4VA 2FB8A 4BZNA 3F5XA 4HZSA 4C34A 2OXXA 1GIHA 1UVRA 4ZTRA 4AFEA 4EBWA 3QZGA 4S32A 3GOPA 3OD6X 4WG5A 1E9HA 3A7HA 1M2RA 3FMMA 3DBFA 3OY1A 4IAYA 4A9SA 2QOQA 4CRLA 4EKKA 2QOBA 2WTIA 2W1IA 3R8UA 3BE2A 3FSFA 3UJGA 2J0MB 1YOMA 5E8VA 5HVKA 4FTNA 4O7RA 4I41A 4X3JA 5EM8A 4QTBA 2B54A 2G01A 1NXKA 4QMZA 5I9XA 4AE9A 1H26A 4GJ2A 4WA9A 2VWVA 4X3FA 2X81A 4NJ3A 2F2UA 4IEBA 3FKNA 3KU2A 3W8QA 4RJ6A 5J1VA 5CI6A 3SW7A 2GQGA 3DJ6A 4QQ5A 1SNXA 2VTPA 3VS1A 2ZV8A 3AXWA 2OGVA 3D83A 2ONLA 3ORMA 3WYXA 2DUVA 4TPTA 5DEYA 2H34A 3OY3A 4EOMA 4L8MA 4DHFA 4GCJA 4L6QA 2W17A 5C8MA 1JPAA 3TWJA 5AA9A 3LQ3A 2Z7LA 5KKRB 3ULIA 4USDA 1OIUA 5KMLA 3RHKA 3WF8A 3KXZA 4CSVA 1HCLA 3W2QA 3GU5A 4H3PA 4X2JA 3O8UA 2JKOA 3OWPA 1VR2A 3UO6A 5GZ9A 1KE6A 5C26A 5E9EA 5EDRA 3PP1A 1KSWA 3EIDA 2V55A 3R01A 3CE3A 4ZSGA 2WOTA 2YAKA 3DFAA 2QG7A 3SAYA 4P90A 5HD7A 3VWAA 3BLQA 4BHZA 3KQ7A 4GFOA 4GV1A 3VBWA 2BZKB 4ERWA 4Y85A 1H1QA 4M69A 4E1ZA 4BGQA 5IA2A 4X6RA 5GJDA 2O65A 2VTSA 5A6OA 5CVFA 2WXVA 4IE9A 2QO7A 5GIPE 3KULA 4CMOA 4DF3A 5IA4A 3DS6A 1H1SA 3EQPA 3PSDA 4C4FA 3CSVA 1Z57A 4RIXB 4JBVA 1R3CA 3M11A 3WOWA 3SX9A 5CANA 2DQ7X 2WTKC 4YZ9A 4NTTA 5HNGA 4FEUA 4XG3A 2JDVA 3CKXA 4DFYA 5HX6A 2R3FA 3QQLA 3OW4A 4GUBA 3JY9A 3DKFA 3PRFA 4Z3VA 2Y7JA 3LFDA 3KMMA 3TT0A 2X7GA 3FMHA 4PDSA 2YISA 1ZYLA 3EQIA 4FE2A 3R83A 1L3RE 5HEZA 1P2AA 4XOZA 4YC3A 3ORZA 3QHWA 4A06A 3E62A 3EYHA 4QMVA 5AAFA 1R0PA 2IZUA 3PXFA 2WQEA 2XP2A 4FTKA 3VJNA 4CFXA 3N4UA 3H10A 4P2KA 1ZMUA 5HVJA 4CLIA 4OAUC 3CY3A 2XS0A 3LFAA 4O7VA 3D5WA 2P3GX 3HDMA 5BVFA 3AD4A 4J52A 1H08A 5CAQA 4QNAA 2XIZA 4MBIA 2XM8A 5IQGA 2PMNX 4FOBA 4NSTA 3O7LD 5DNRA 3RMFA 3WILA 4AA4A 3Q2JA 5CEMA 1FOTA 4FYOA 3DTWA 2QLQA 3REPA 1UWHA 3NCZA 4JAIA 4QPSA 1CDKA 3FC1X 4UMPA 2ZMCA 2F9GA 5EK7A 2R4BA 3QX4A 5L8JA 2BVAA 4FKLA 4UB7A 5B2KA 4FTIA 4Y73A 2QOHA 4LM5A 5EKOA 3VUMA 1ZZ2A 5M56A 5BVEA 4XH6A 5L2QA 3UP7A 3KGAA 1ZY5A 3I0OA 3KC3A 4HVHA 1OKWA 1OKYA 4IVDA 3FKLA 1KWPA 2WMQA 3MA6A 1KE5A 3UODA 2BAKA 4CLJA 4DA5A 2YFXA 5CXHA 4NJDA 4ZSJA 2JITA 4U45A 4RX7A 2HXLA 4Q5EA 4BF2A 4YO6A 1WBTA 4EZ3A 5DEWA 2IJMA 1OL5A 4APCA 3CPCA 4EWQA 5ETCA 1Q8YA 3D2KA 3FPQA 4JS8A 4DH3A 4EOOA 4Z7GA 4U80A 4C02A 3CTHA 3FC2A 3LCKA 4WNOA 1YHWA 4XUFA 3JVRA 5KZIA 4PMSA 4CZUA 4DBNA 2VZ6A 3FLNC 4ZJJA 3TL8A 3ZO3A 3V8SA 4D2TA 4IM0A 4V0GB 3WI6A 4DYMA 5CF4A 2J5EA 4GT4A 3PXRA 3R02A 4OUCA 2YLEA 2FSMX 3PY3A 3N4VA 1GNGA 4FC0A 4FEWA 4WRGA 3LXPA 4F7LA 3HA6A 4EJNA 5EYKA 3DXQA 3C13A 2P4IA 3O96A 4U5JA 3NUYA 3NIEA 4QYFA 4UEUA 2G2IA 4G1WA 1Z5MA 1ZZLA 2VX0A 5E90A 4BCMA 2OF2A 3JPVA 3ZO2A 5LVLA 2VWUA 5KBQA 4Q5HA 5LWMA 4FKWA 2C0IA 3NW7A 2RKUA 3DDPA 4ZP5A 2R3LA 5F1ZA 1S9IA 3FI8A 4F9WA 1Q5KA 4KIQA 2ERKA 4FBXA 2PTKA 4UYAA 3DAJA 5DT0A 3C50A 4MNFA 5A4EA 4NW6A 4MQ1A 2QR7A 3MPTA 1OKVA 4EH9A 2C6TA 3UMXA 3UVPA 4XP3A 3GBZA 4MBJA 1JOWB 5HCYA 4ZMEA 4OT5A 4EZ5A 3G6HA 5EM5A 4DLJA 3U6IA 3HZTA 5KMMA 2PVMA 3EH9A 2GS2A 3I1AA 3HNGA 1I44A 3A4OX 3L9PA 2AC3A 3DK6A 3HYHA 1TQMA 4BCOA 4CV9A 2R64A 2XNMA 1ZOHA 4BI2A 4XG9A 2C6EA 4CMTA 2YIYA 2XBJA 3ORKA 3PLSA 3Q9YA 2W96B 3RI1A 1DS5A 3FSKA 2X4FA 2KTYA 3NIZA 3PSBA 1DAWA 3K2LA 4NK9A 3NPCA 4O38A 3NW5A 3V5QA 4RWJA 5CEQA 4BI0A 5J7BA 4O82A 4XG7A 4E26A 3VS4A 4TW9A 4AXAA 2G15A 4DEBA 4NT4A 3UG2A 4II5A 3QGYA 4JDHA 2WHBA 3MVJA 4IACA 2Z7QA 4WSYA 2WEVA 3HMNA 4JX3A 4O91A 3IDCA 4YZBA 5B0XA 5BVDA 3SVVA 4MNEB 4RSSA 4UY9A 3SV0A 3U51A 3AT3A 4RFZA 3DXPA 2XK3A 3R63A 3QXPA 3F5UA 4HPUE 1YKRA 4OTHA 3MH0A 4TZRA 1V1KA 3DFCB 3SC1A 4PTCA 4AW5A 4L68A 1XR1A 5LXMA 2YZAA 4IAZA 4RIWA 2C6OA 2W4KA 4QP8A 4PX6A 5KHXA 5AP5A 3TNQB 1PRYA 4BIBA 3COMA 3OCGA 2R3GA 1JSUA 1XHAA 3QQKA 1J1CA 4M97A 5EYMA 4IXPA 4FT0A 4BL1A 3ZFMA 1OL6A 1WBVA 2XIYA 3EQCA 4GIIA 5E91A 3O17A 1UNGA 2W99B 4MVFA 4ZZOA 4ORKA 1ZARA 3ERKA 5HESA 4GU9A 4XLIA 3WE4A 5IA1A 3LMIA 3ZUVA 3PPJA 3LJ0A 1OMWA 4C3FA 2W4JA 4GK2A 4L3PA 4MCVA 2C5XA 1SMHA 4BY9E 3ORLA 2BILB 3QQHA 4I92A 1BUHA 4N6ZA 4E3CA 2UVYA 2WMRA 4K6ZA 3ZC5A 3DKCA 2WIPA 5CNOA 4RA4A 4G3EA 5A4QA 4QPMA 2C5VA 1UU3A 2OIDA 3FLZA 4GK4A 1FVTA 3ODZX 4CCUA 2JDSA 3GCQA 4RPVA 3EN6A 1AQ1A 3G0EA 4UZDA 4J96A 4HVIA 3HA8A 4U81A 4V04A 4MYGA 4C4HA 4I4FA 3WZKA 1WVXA 3H9FA 4O27B 4BKYA 5BYLA 3UZTA 3LKMA 2ITWA 4I6BA 1RDQE 2UW0A 4JQ7A 2O0UA 1JBPE 2BZHB 1XBAA 4I5PA 4IVBA 4YJOA 3U9NA 4LL0A 4XYFA 1O6LA 2YCQA 4FKGA 3KEXA 3GT8A 4KA3A 4FGRA 5AP6A 3F3UA 4FX3A 4AG8A 2I0YA 2EB2A 2BRNA 3HRCA 5E92A 2CKEA 3QQFA 1X8BA 3ORIA 4BCHA 2Y6MA 3BHUA 4HYIA 2BZIB 5KX8A 2WAJA 2W1CA 4WOVA 4DBXA 4JAJA 4YC8A 3F5PA 3EKKA 1J1BA 3WF9A 3ID6C 3DBDA 5AR7A 5I5ZA 4FICA 3DBEA 5L4QA 3L8PA 3LMHA 3WF6A 1ZRZA 3OCBA 4FG8A 3Q5ZA 2YWPA 3P79A 4ZTLA 3R71A 2HENA 3MA3A 4UWYA 2C0TA 3SLSA 2WTDA 4PDYA 5CYIA 3BYVA 4AGWA 3NRMA 3ZU7A 3ACJA 2X4ZA 2Q0NA 5T6KA 2C5NA 4M3QA 3W16A 3VF8A 4FTOA 4MX9A 4WIHA 4QO9A 4BICA 2IW6A 2QU6A 4RWIA 4O84A 4L52A 4PP9A 3ANQA 3I5ZA 2QNJA 4D58A 1Q8ZA 3KRXA 3TTIA 4FNXA 4S33A 5DI1A 5DBXA 4FKOA 5AR8A 3R9OA 4BDCA 4RZWA 4D1XA 4D9TA 4RX9A 2PK9A 4F0GA 4H05A 3R21A 2OZAA 5JGBA 3LVPA 4DEEA 2RFDA 2CCIA 4EK5A 4QP4A 4TYHA 4F64A 2HY81 3C4ZA 4BGHA 1GJOA 4KKGA 4DFUA 4CG9A 2ITVA 3BYSA 3E88A 4RVLA 3ZONA 3C5IA 2WKMA 3E3BX 4IZYA 3RK9A 4FKRA 3LJ1A 1WBSA 4IW0A 4B8LA 3BEGA 4BHNA 2PZRA 3PE1A 4CFVA 4I6HA 4Y5HA 3VQUA 3AD6A 1E1XA 2H96A 2OH4A 4XBUA 2CKOA 1MRVA 3E8CA 5C03A 4P4CA 3CQWA 4PP7A 3HRBA 2HXQA 2EVAA 1M17A 2XKDA 3Q52A 1UNHA 1ZYCA 4BBFA 5A6NA 1G8AA 2FO0A 2F7EE 4TWNA 4MF0A 4F6UA 1YI4A 2XKCA 4OR5A 4ASDA 4CQEA 1B38A 2BAJA 1H28A 2WMUA 4Y8DA 3QRIA 3R9HA 4ACHA 4D28A 5CEPA 1VYWA 3ALNA 4IBMA 3S1HA 5J1WA 4MF1A 4G5PA 5DR6A 2JIVA 5EW9A 2I7QA 1S9JA 2C0OA 4BWPA 5CF5A 3KXXA 3V04A 3P9JA 2Y4IC 5FM2A 5HBHA 4EEVA 3PVBA 1VEBA 4RIYB 3ZUTA 4EJ7A 3EMGA 2ZB0A 4L44A 3NEWA 2GPHA 3BHYA 1WFCA 3C5UA 2C68A 3CLYA 2UZTA 3NYOA 4ZZNA 4GW8A 5FQDC 4O7ZA 4ZZMA 4RWLA 5J9YA 5HZNA 3C4FA 4GUEA 3A60A 4TNDA 3MTFA 5DRDA 2X2LA 2XKFA 5AV4A 4O0XA 5CVGA 3S00A 4RZVA 5FG8A 2ZV9A 1PW2A 5KE0A 3DBCA 2H8HA 2YM5A 4DE4A 5AUTA 1APME 1FVVA 1Q99A 4U3ZA 4E73A 3BQRA 2XH5A 2F49A 4KKEA 2GQSA 5D7VA 4F70A 1OB3A 3A61A 2WMXA 1REKA 3C1XA 3IDPA 5C27A 3R7VA 4AAAA 3UO5A 1U4DA 2ETKA 3EL7A 4OTPA 2B55A 3BI6A 3OOMA 4CFWA 4M13A 4YJTA 3I4BA 4MXZA 4JBQA 4FTJA 3ROCA 4W8DA 3I79A 2IVUA 4F9AA 4HYHA 5M4FA 4YZDA 4QMSA 2YLFA 1Q3WA 2O64A 2XIXA 2F4JA 3LQ5A 4D5HA 3M1SA 5IQBA 4G3CA 4EH7A 1OL1A 5EHYA 4ANOA 3P7BA 4FK3A 2R7BA 5FRIA 2WB8A 2VRXA 3QZFA 2X2KA 4QRCA 4WD5A 5C01A 3HGKA 3VS0A 4CTCA 3KCKA 5KCVA 3GI3A 4FKJA 4C2VA 5F9EA 5KBRA 4FTUA 4CEGA 3OVVA 4X3FC 4FSZA 4CD0A 4USEA 3QD4A 4O0UA 2Y8OA 3GEQA 3AQVA 3GU6A 3LE6A 3OXTA 4LRJA 4U9AA 3VUTA 3A8WA 4FKSA 3HV7A 2Y0AA 4F1MA 4M8TA 3FXWA 3QCQA 3EN5A 1P4FA 2ONLC 2V7OA 4L43A 5HGIA 2R2PA 3R9RA 1R1WA 5DVRA 1XBBA 4A9YA 4A9UA 2PVYA 3CS9A 4ZXTA 2ITTA 2J90A 4GSBA 3GCSA 4I24A 3HECA 4M0ZA 3QTZA 4WG4A 4DEDA 3BEAA 4XRLA 3ZEWA 2R3OA 3A8XA 5GNKA 3ZMMA 3OXZA 2BROA 3AC2A 4FV3A 4TYJA 5AUVA 2AC5A 3KFAA 5AV0A 5HU9A 4PPAA 3TJCA 3HV5A 3SXSA 5ANEA 4B4LA 2BDWA 2J5FA 1GZOA 3MB7A 4AFJA 1ND4A 3E64A 4E5BA 5KNJA 3SG9A 3OHTA 2ITXA 4LYNA 4IZ5A 1Q4LA 4U6RA 2EXCX 3VJOA 5A4LA 1YDSE 4RJ8A 1CSNA 2UV2A 3F69A 3TZ9A 5AX9A 2XK4A 4XLVA 1YHVA 3OZ6A 3C0HA 4IVAA 4YJSA 4H39A 4ZEGA 2J7TA 4G3GA 3VRYA 2Q0BA 5D11A 1PXIA 4FEQA 1P4OA 4LUDA 4Z55A 2X0GA 2PZYA 5L2IA 3OMVA 4UWBA 5CASA 2V0DA 3LXLA 4IWDA 4ZLZA 3IW5A 3FL5A 4GYGA 4D2VA 4M0YA 4ZSAA 5ETIA 3GENA 4ZY4A 3DNEA 3LFSA 3GFEA 3GCPA 4BYIA 1CKJA 4KIPA 4EOLA 2VTAA 3V8WA 4UMUA 3RPSA 2E9VA 4HGEA 5CU0A 5TF9A 1OBGA 3E7OA 3RPVA 4WO5A 5EW3A 2VWBA 2YM4A 1JVPP 4N6YA 3FMDA 1OBDA 3BCEA 3UQCA 4DH7A 5CNNA 2CNQA 3D5XA 3KXMA 4M66A 2WMBA 3PY0A 1KE8A 1FGKA 4ZS4A 2QLUA 5KZ0A 5DLSA 3SG8A 5IF1A 4IB1A 4DN5A 1HCKA 4EHZA 1CTPE 2A1AB 1GZKA 3VUKA 3MVLA 3OBGA 5BQ0A 3TV7A 3W10A 3NNXA 2Z02A 4XEYA 3W2CA 4AP7A 4IX5A 2J50A 1YWNA 3IDBA 4IB3A 5FLFA 4O0TA 5M57A 3FZPA 4JRVA 3CJFA 2PHKA 4EQMA 5BUEA 1Q3DA 2C6IA 3QQUA 4EQUA 4YR8A 4BCKA 4CKJA 4FIJA 4JL9A 4RC3A 3F7WA 2C6LA 1AGWA 5EM6A 3OEFX 3ZUUA 3MFRA 4RBLA 1IAHA 1SVHA 3WF7A 3R1SA 2UW9A 3QD3A 2ACXA 3RK5A 5I9UA 4PUZA 2RFEA 3CC6A 3C0GA 4G6LA 5KUPA 1YXXA 4O83A 3KMUA 4F9YA 3RZFA 1JKSA 3ORNA 4B8MA 4FVRA 4QP2A 4AZEA 4HGTA 3EL8A 2ZB1A 3NZ0A 4ZJVA 4LGGA 1FGIA 1ZXEA 2JEDA 1IA8A 5GJGA 5IU2A 2FSLX 2W1EA 3MH3A 5IEYA 4EOQA 3H9RA 4R3RA 1PXNA 3BHVA 3H4JA 1Y6BA 1M14A 2JBPA 3PXKA 4AOJA 4UMTA 2C3LA 4YNOA 3LM5A 3SDJA 4FKVA 3TXOA 4APPA 1OVEA 3DK7A 3MESA 2W5HA 2BFXA 2C3IB 2V5QA 4U40A 4W4YA 3ANRA 2W5BA 3L9LA 5HG5A 5LARA 5LMAA 2VD5A 3UYSA 2XEYA 4CZTA 2E9NA 1Q41A 4UXLA 4LOOA 3LPBA 1OIQA 4RJ7A 4YPSA 3RWPA 3TI1A 3CD3A 3FHIA 5AP2A 3ZO1A 1V0PA 4MD9E 5CLPA 4MD7E 3RKBA 3WIKA 5J7HA 2JBOA 4QMXA 5DYJA 2OU7A 4BN1A 1UV5A 3DV3A 4DINA 1LEZA 4FT5A 5HTIA 3POZA 5HOAA 4O96A 5HORA 2EU9A 2B1PA 4K8AA 5EOBA 2PUIA 3W2OA 2PU8A 4H3BA 3JXWA 3LCTA 4AA5A 2R0IA 5FBNC 4EOKA 5AP4A 1STCE 5K0KA 3WARA 4ZY6A 5LVOA 3JUHA 2W1ZA 1PXKA 3QTQA 3COIA 5IMEA 3QLFA 3KVXA 2CN5A 3FJQE 3I0QA 3QYWA 2JKQA 3VUGA 1L8TA 3UNZA 4J53A 3GC0A 3W32A 4UALA 4O7LA 5IKWA 3F88A 1YXTA 3FMNA 4FUXA 5E4HA 3FL4A 3RAHA 1J7UA 5E8UA 2ITZA 3O51A 2UZEA 4MEDA 4W4WA 1VJYA 4PMTA 3NUNA 3P4KA 2R3HA 4LI5A 5JK3A 5K5NA 2Z7RA 4FKUA 3SQQA 2BHHA 2HCKA 1Y57A 3QTIA 4O86A 4GVAA 4ERKA 1BYGA 3IW6A 4BKJA 5CSPA 3QBNA 2J51A 3R22A 4O0VA 3TNWA 2QKWB 5HG8A 5KMKA 4BZDA 2BRBA 4J8NA 2JD5A 2Z7SA 3ODYX 3LOKA 5EI8A 4XP2A 4L01A 5L8LA 2W1DA 3EQFA 4CG8A 4X0MA 5HTBA 4D1SA 4NFMA 3R7OA 3WZDA 4AGUA 5DFPA 4GH2A 5DR2A 3CPBA 1MRYA 3ZLXA 2XNEA 4KWPA 2ZM4A 4QMMA 4WT6A 4JJRA 5TT7A 2ZMDA 4I5HA 4QYHA 3EFJA 4IZAA 3TCPA 4HYUA 4AZWA 3BE9A 2XNBA 1J7IA 1XWSA 4Z9LA 5IQHA 2CGVA 4CV8A 1JAMA 2OLCA 4DH8A 1YQJA 2VO7A 5D12A 3FI2A 3V8TA 5EQEA 3TM0A 3I7CA 4PL5A 5DRBA 5HG7A 3ZC6A 1GIIA 1XH6A 4RC4A 4D0XA 3AC1A 4PMMA 5BVKA 4DGGA 4EHGA 4E20A 5C8NA 1NT2A 5EQYA 5L3AA 4K11A 2PY3A 5JSMA 1GAGA 4IB5A 3WYYA 4O1PA 3UIMA 5BVOA 2IO6A 5BUJA 5DH3A 2VTNA 4R5SA 1GOLA 4R7IA 2XNGA 1Q97A 2YCRA 4KBAA 2E9PA 2W7XA 1OPKA 4OBOA 3QUPA 2GFSA 2VV9A 4DEGA 3OT8A 3FMJA 1ZOEA 2X8DA 4YHJA 4IFCA 3GVUA 4FIEA 3N4TA 1P14A 3OUNB 3U6JA 2ZDUA 4NU1A 5D9HA 4JBOA 3OT3A 4FTRA 4D2PA 2UVZA 3O23A 2G1TA 3P5KA 3QKLA 3PP0A 4GMYA 2WMTA 4OGRA 1U54A 3O8TA 4AOIA 3QRTA 2C69A 3MJ2A 4IWQA 4ALVA 2QHNA 3DZQA 3VHEA 5JRQA 3MYGA 1W84A 1Q24A 3WZJA 4C3RA 4KBKA 5IG1A 2PUPA 4ZSLA 5H8BA 5E1EA 3SOCA 2UZDA 3E8EA 2Y9QA 3KXHA 3QC4A 4QMNA 4FIGA 1WZYA 4ACDA 3P08A 3P0MA 4AW1A 2FUMA 1YXUA 1WVYA 4U7ZA 2F7ZE 3UZPA 2CLXA 4PTEA 1OIRA 4AA0A 3G5DA 3POOA 4FTMA 2UZWE 1FMOE 3IECA 4YLLA 3HEGA 3H3CA 4F6WA 4EL9A 3FYKX 2WTCA 4E6QA 3R7UA 4JIAA 2GTNA 3HMMA 4FF8A 2CDZA 3QRJA 4FIIA 3II5A 2QVSE 3KULB 3LFBA 5CTPA 3TKUA 3VHKA 3IO7A 3HVCA 4O7YA 1OL2A 3Q60A 5CZIA 2XZSA 5EYCA 4QD6A 5CY3A 2IVTA 3M2WA 4H36A 1VZOA 2WPAA 3RWQA 3TZMA 3U8WA 2C47A 5E7RA 4O21A 1BI8A 3A99A 4G17A 4ANBA 4RQVA 3GQIA 4FT7A 4DGNA 4UBAA 2NRUA 4JG6A 3OOGA 2E9UA 4F65A 4NIFA 4IC8A 4B99A 2VTJA 4Z16A 2ITOA 4TWOA 3VUHA 2A4LA 4CFUA 5CEOA 3DJ5A 4XG6A 5FXRA 4O6LA 3ZXZA 3G51A 2YM6A 3DKOA 5IQEA 5AFVA 3NYNA 3U55A 3BPRA 2YITA 2YIQA 4D4VA 4EORA 5EH0A 5A9UA 5LVNA 3SGCA 2QKRA 4U97A 4EH8A 2YCSA 2YIRA 4FKQA 4V0GA 4C4EA 4JRNA 5J9LA 3QCSA 4MKCA 1Q61A 5C4LA 1ZMVA 4EYJA 1FVRA 4OLIA 4R1YA 2QG5A 1M7QA 2XJ0A 3ZTXA 2VWIA 5F95A 4AOTA 2OO8X 3RTPA 3A7JA 1W8CA 5LMKA 4YUQA 2BTRA 3MBLA 2DS1A 4EOSA 3MW1A 4J98A 3UPXA 4K0YA 4RGJA 5JFSA 4JT3A 3R8PA 5TKDA 3HL7A 4EH6A 5AIKA 4AZTA 4BTJA 4DG2E 1UU9A 5AV3A 3TIYA 4XHKB 4QTEA 3HP5A 5EI6A 2XJ2A 3LFEA 3R7GA 4R8QA 2B0QA 4YPDA 4AN9A 2HZIA 4DC2A 4CNHA 4DH5A 1KOBA 2C6KA 2VTLA 3I60A 3BU5A 3VS6A 4S2ZA 4IJPA 4X2NA 2OJJA 5A14A 1MRUA 2C30A 4NH1A 4EHVA 3PIYA 2VX1A 3BWJA 3UC3A 3FDNA 4FSMA 3I81A 5HLWA 5J79A 1K3AA 1Q62A 3OROA 4LRKA 3EB0A 4OBPA 3RPOA 5FGKA 2WELA 4KRCA 4DITA 5BYYA 2PMLX 1ZLTA 3TV4A 5FUTA 1EH4A 4DTKA 5DIAA 3LW0A 2IWIA 5CWZA 1U5RA 3ZBFA 3AMYA 3ZH8A 2ZDTA 1O9UA 3HKOA 3MSSA 4AQCA 3R1QA 3AGLA 3HMOA 4BWKA 2UW6A 3B8RA 3C4CA 2GMXA 4YJRA 3UOKA 3OFMA 4R5YA 1SZMA 1OM1A 5FEDA 2Q83A 3HMIA 3Q9ZA 2JDOA 4MXAA 2O2UA 2XJ1A 4HCUA 2UW3A 4NKSA 1PKDA 2JLDA 3E8NA 3LJ2A 3DPKA 4BCFA 3FWQA 2B9HA 3RNIA 3VS5A 4XV1A 2GTMA 4G9RA 1UA2A 4XS2A 4RX8A 2YM3A 4CFMA 4KIOA 4L00A 5IEXA 4YSJA 4IH8A 4MTAA 5CEKA 3OCSA 4DT9A 2OG8A 2VNWA 3MVMA 4FSYA 4PRJA 4QTAA 2BKKA 5BVWA 1O6YA 2OF4A 4A07A 3GOKA 4FL1A 4RA5A 1YI3A 2GNIA 5DN3A 4EUUA 4AE6A 3AC5A 2PVLA 3PVGA 3QD2B 3O0GA 4C57A 3FY0A 4IDTA 4HGSA 2HZ4A 3QCYA 4AU8A 3V6RA 1PKGA 3VS7A 4CXAA 3QTSA 3D7ZA 4KB8A 4LGHA 3DB6A 4RVMA 3D9VA 5IUHA 2LGCA 3PIZA 1XH7A 3EQHA 5EG3A 4YU2A 4HZRA 3CQUA 4DTAA 5GIOE 5IA0A 2I0EA 1F0QA 3MH1A 5TOZA 2RGPA 5D10A 2QQ7A 4AZVA 3DB8A 3Q4ZA 2NNWB 4QMUA 4MWIA 4QMWA 3R00A 2HAKA 2GNHA 2OJIA 3KRJA 5AV1A 5HKMA 2BRMA 3NGAA 4EHEA 3HV3A 5HO7A 5I3RA 4QMTA 2B9IA 4F7JA 3CBLA 5HG9A 3DCVA 3EOCA 3OW3A 4BKZA 5B7VA 1G8SA 4V05A 4ZTSA 5DPVA 4ITJA 2B9FA 5AIRA 5K4IA 1JKTA 3UO4A 1SNUA 3CKWA 2VWYA 2ZM3A 3H30A 4Q9ZA 1FPUA 3CQEA 4Y46A 2P55A 3CP9A 2QOCA 4FNWA 3VQHA 4E4NA 5CSXA 3KKVA 5LJJA 5DWRA 4GKHA 4BFMA 3K3IA 4GJ3A 1BL6A 3WZEA 2HYYA 3MPMA 1PMNA 1M52A 3HV6A 3VW8A 4W4XA 3E8DA 4IQ6A 4RQKA 5KMOA 3Q2MA 4LOPA 5HO6A 4G5JA 3IK3A 1W0XC 5DOSA 3PXQA 5HO8A 4JQEA 4OTFA 4A9RA 2BALA 4GT5A 4UYNA 3ZOSA 4KIKA 2HIWA 1YDRE 1KV2A 1NVQA 5L6PA 4TYEA 2YDJA 1IR3A 3SHEA 3TKHA 4ACGA 2Y4PA 3RJCA 4JBPA 4NCTC 4IWPA 4R3PA 1IEPA 4H3QA 3FMKA 5JQ8A 2NPQA 3N9XA 5HE3A 5K4JA 2RG6A 1W83A 2QOLA 3V5PA 3TNHA 3GCVA 5CZHA 4FA2A 1ZYDA 4NM5A 3NMUF 4D0WA 5FTGA 3BYMA 5BX0A 3D14A 3ZRKA 2XF0A 2R3IA 4FTQA 4YJVA 3THBA 2PVRA 3AMAA 3EQDA 4ZS0A 5EW8A 2VTOA 1MP8A 1WAKA 4QTCA 1LUFA 4D4SA 3BZ3A 3GNIB 3QWKA 4GEOA 2IW8A 4DGOA 5HD4A 4YZNA 5HNIX 2WTKB 4AZFA 4OW8A 3CEKA 1XJDA 3DZOA 3QUDA 3EQRA 1RE8A 3MJ1A 5DE2A 3R7IA 4E6AA 1J91A 4PDPA 3C4WA 3BLHA 2GHLA 1H25A 1KUTA 1SVEA 3SRVA 4FZ6A 2RL5A 3W2RA 1OUYA 3GU4A 3PY1A 4B9DA 3SKCA 5M4CA 4YMJA 4BCJA 4F7NA 2H9VA 2FH9A 5AUXA 4NL0A 4XX9A 3VN9A 4J1RA 2NRYA 3R8VA 4BDAA 5J9ZA 2UVXA 4FV6A 2CCHA 1NW1A 4DEHA 2CNUA 2G2HA 3LXKA 2I0HA 2OFVA 3FZRA 4FV8A 3R8MA 5FD2A 3QQGA 5J5SA 2J0IA 2X6DA 4JR3A 5L6OA 4M67A 4RFYA 1YHSA 3PJCA 3HUCA 3V5LA 2UZLA 3A4PA 3U6HA 5G6VA 2OI4X 4K1BA 5IISA 1W98A 1OGUA 2BZJA 4C61A 1RQQA 2XIRA 2QCSA 4M14A 2XNPA 2BUJA 3ZLWA 2QOIA 3VUDA 5H2UA 2YJSA 5IUIA 3ZM4A 2GNFA 4HVGA 2JAVA 3QKKA 4RMZA 5HIDA 4EUTA 4KSPA 4Q9SA 4EH4A 2WQOA 1JNKA 4I94A 3UVQA 5L2WA 4JG7A 4DT8A 1VYZA 3QD0A 4BTFA 4O2PA 4GG7A 5E8ZA 3TZ8A 4EC8A 3ORTA 4TYHB 4TYIA 2EXEA 2GNGA 5CALA 4FVPA 4AT5A 5K9IA 4YHFA 2HWPA 3C51A 3F3TA 3AGMA 3LFNA 4O1OA 4IB0A 4RIYA 4RFMA 4BDJA 2PPQA 4ASZA 2C1AA 2BTSA 4D1ZA 3DU8A 5FWKK 2YCFA 2UZVA 4RVKA 5FBOA 3IOPA 2I6LA 3BQCA 4U3YA 4DG3E 2JKMA 5DHJA 3NAXA 4ZSEA 3GP0A 3NUXA 4WUNA 3PWDA 3S3IA 1G3NA 5ETAA 4IMYA 4FNZA 3QL8A 2W9FB 5AJQA 3V5JA 1UWJA 2JC6A 4K33A 3KF4A 4LMNA 3D7TB 4FTCA 1KOAA 2BIYA 3ZYAA 1URWA 5AUWA 4EKLA 3WZUA 3CXWA 3DK3A 5EFQA 2EWAA 1XH8A 2RF9A 4EK4A 4F4PA 2OSCA 3UTOA 1JWHA 1TVOA 3QTRA 5CU6A 4DLIA 3UC4A 4YZMA 2OZOA 4C4JA 2R7IA 3LLAA 3SD0A 4C2WA 3RM7A 4Q2AA 5HCXA 5LMBA 4G31A 4MAOA 3E3PA 3NNUA 3QKMA 3VC4A 3DLZA 3NDMA 5E8SA 3H0YA 5AR4A 3LZBA 3KA0A 4FEXA 2ITYA 3LFQA 1U5QA 2V62A 3GU8A 3KF7A 4FMQA 4G9CA 5JQ5A 4OAVB 3GU7A 4ONAA 2R5TA 2IPXA 4I20A 5HLPA 5AR3A 4G3DA 3UIBA 4W9XA 3FKOA 2ZYBA 3AC4A 2W9ZB 3R9DA 5AA8A 2V22A 1FMKA 4BCPA 4DTBA 5I0BA 4KRDA 2PZPA 3PZHA 4TN6A 3BELA 3VF9A 3W33A 4CYIA 4JQ8A 2QU5A 4L7SA 4QMLA 5AADA 3BRBA 3MFUA 1O6KA 3MV5A 4FGBA 4FL2A 2R3KA 2WD1A 1ATPE 4N4SA 2CNVA 3MH2A 4L45A 5K0XA 4CVAA 3ENHA 5AUYA 3COKA 3F61A 4C4GA 4WNPA 4ZIMA 3UMWA 4E4MA 1XBCA 4BIEA 2GS6A 2WU7A 3D5UA 1HOWA 3PG1A 3W2PA 4DEAA 4BBEA 4YURA 4PL4A 4BYJA 2ZOQA 2YJRA 2NO3A 1J7LA 5LCKA 3TJDA 3HUBA 3CJGA 2BRGA 2UW8A 2VX3A 3QZIA 3F66A 4LFIA 4TY1A 3BBTB 3FQEA 4XG4A 3IKAA 5CQWA 3KRRA 1M7NA 2WQNA 4BVUA 4ANMA 4HW7A 4FOCA 3L8XA 2WNTA 3UP2A 3CCNA 3F3ZA 4XRJA 5AUUA 5CQUA 3JY0A 4CQGA 3R6XA 5M51A 3G6GA 2DWBA 2GSFA 2ESMA 2BPMA 3NW6A 3OTVA 4YBKA 5D41A 4UV0A 5IZFA 4ANQA 4X6QC 3T3UA 2XNOA 4U8ZA 3VVHA 3GC7A 2BRHA 2GS7A 3F6XA 3K5UA 5BMSA 2XK6A 3QLGA 5JN2A 2OKRA 5ANGA 2X1NA 2WOUA 4FV0A 4LV8A 4L9IA 4PNKA 3SW4A 3V01A 1Y8GA 1WBWA 3PRIA 2VO6A 3PJ2A 5AP3A 5EKNA 2OFUA 4DEIA 4NCTA 2IZSA 4FKTA 4BDKA 4C8BA 4HGLA 3CTJA 4BDDA 2VTIA 4ANNA 3VBVA 3Q9WA 4W9WA 1KE9A 1A06A 5E8XA 3QZHA 4ZLOA 2CJMA 3OP5A 5HE0A 3IONA 5CVHA 3MIAA 4AUAA 4RJ5A 3UZRA 3IG7A 2J4ZA 2AUHA 2OICA 4BTMA 2CMWA 4HNIA 4Z7HA 4O0SA 5JT2A 3HAVA 4FT9A 4YTHA 5ANJA 2WMVA 5B2LA 4Y5QA 4NM7A 1H01A 2BKZA 3BKBA 4ZOGA 4D55A 2XM9A 2GHMA 5E1SA 3EWHA 4QPAA 3MVHA 4TKSA 5EYDA 4ANSA 3P7CA 4WNKA 4F08A 4IANA 1OPJA 5LVPA 2GQRA 3R04A 3WE8A 3Q9XA 3PXYA 2I1MA 3FZ1A 2R3QA 4JDIA 4PPBA 3RAWA 3FBVA 4YGAA 1R0EA 4L42A 4O0WA 3VBXA 1K9AA 3R0TA 2XRUA 3D0EA 2HZNA 4U43A 3T8OA 1QL6A 3ZBXA 5A4TA 4KINA 5BPYA 3FLSA 5KO1A 3EFLA 3KREA 1TQIA 4YZCA 4I21A 2HZ0A 4BRXA 3QA0A 4IX3A 4AWIA 4MXYA 1OIYA 1SVGA 4HJOA 2Y6OA 4BGGA 3ZHPC 1QPDA 4QOXA 4WG3A 2ITPA 2UW4A 4L46A 4NTSA 5LMKC 3BV2A 4NZWB 1PHKA 4CT1A 4IJ9A 4RC2A 3KY2A 4JDJA 4XNEA 3DLSA 5K5XA 2XYUA 3BX5A 4ALUA 5AMNA 2C6DA 2XKEA 3WIGA 4ZLYA 1OL7A 1B6CB 3ROYA 3BWFA 3EFKA 5LWNA 3NYVA 4C3PA 1PMEA 3VS2A 5CAOA 4EI4A 4RG0A 4EH3A 2EUFB 4QP3A 2RIOA 3OWKA 4DFLA 3KL8A 1Q8WA 3A7GA 3BLRA 3MTLA 3RM6A 4FSTA 5JEBA 1QPJA 5BMMA 4AZSA 2HK5A 2RFNA 3N51A 3QF9A 5JFWA 2XCKA 2BHEA 3VUIA 1OITA 3PYYA 4ZTHA 3D4QA 5EI2A 3LFFA 4IAFA 1UKHA 2QO9A 5CSHA 3MDYA 2GU8A 5AR2A 4YLKA 4QMQA 4XG8A 1JLUE 3EYGA 5H8GA 4UXQA 3IW8A 2VGPA 1ZAOA 3EJ1A 2CSNA 2JAMA 4UMRA 5BYZA 3BU3A 5EHLA 2Z2WA 2R3RA 5ANKA 4RJ3A 1IASA 4O0RA 4PPCA 2ETRA 1H0VA 5CXZA 1UKIA 1Z9XA 4NUSA 5ACKA 5M4UA 2JGZA 3BYOA 4I22A 4WUAA 3TTJA 4IADA 3S95A 2P2HA 5FXSA 3DTCA 3QXOA 2Y4IB 3I5NA 3Q4UA 5C1QB 5JH6A 4YHTA 3TNPC 4IX6A 4MQ2A 3QYZA 4F09A 1J3HA 5DMZA 3ZSIA 4BDIA 2XMYA 3ZLYA 4IWOA 1H27A 4FVQA 5IEVA 3DQXA 5M08A 2C5OA 4YLJA 4BTKA 3DGKA 4KBCA 4PV0A 5ANOA 4HOKA 1JSTA 2R3PA 3DNDA 5CAVA 3W55A 5CF6A 5FDXA 3T9TA 3W1FA 4AW0A 3AMBA 4CRSA 2J2IB 3OEZA 3U87A 4BDBA 4HVSA 2VO0A 4OT6A 4BWXA 3KXNA 1OUKA 3ZS5A 2O5KA 2Z60A 3NYXA 4EH5A 2OK1A 1BL7A 3TUCA 5ANIA 3PPKA 1Y6AA 2PZ5A 4GKIA 5D7AA 5I9WA 4EZ7A 3D2IA 1JQHA 1KE7A 1XQZA 3IOKA 2PE0A 4FZFB 3DJ7A 4XP0A 5TE0A 4YJUA 2WO6A 3F82A 4DH1A 4EOIA 1V0OA 1DI9A 3FLQA 4RRVA 4EH2A 3F2RA 5CU2A 2R3MA 4LMUA 3RPYA 3QRUA 3RZBA 5HQ0A 5EDQA 2YDKA 2XA4A 1Y8YA 2FGIA 3MFTA 4FK6A 1PXJA 3FLYA 2CGUA 3FQHA 4FV2A 1YXVA 4G6OA 4OTIA 5CT0A 1ZY4A 5AP1A 2OJFE 2ITQA 4GL9A 4EOJA 4I5CA 4E8AA 3ORPA 4X3FB 2YM7A 1PMUA 4AF3A 5E8YA 3DAKA 3ITZA 4QYGA 5ETFA 4RLKA 5GJFA 5HE2A 4NM3A 4X21A 4M68A 5AR5A 4WHZA 4BCIA 2ITNA 3RALA 3QU0A 4XV3A 1TKIA 4FG7A 1CMKE 1A9UA 1JKLA 3C7QA 5H9BA 4ZY5A 5ANDA 3E92A 3FI3A 1NVSA 4UWCA 4FI1A 5LCJA 3NVMB 5CI7A 3PPZA 4TRLA 3U9CA 2BIKB 3MB6A 3FZTA 5JRSA 3W8LA 3I6UA 4RIXA 2ETMA 3S2PA 4D5KA 3L8VA 4QMOA 3UNJA 3LHJA 4QQTA 3COHA 2YEXA 4QYYA 4O7SA 3C4XA 2YAAA 4PY1A 4R7HA 2OWBA 3D94A 4ARKA 3HP2A 4K18A 4OTRA 4FV5A 5EDPA 5F4NA 3VBYA 2OXDA 4USFA 3I7BA 3LCSA 3MPAA 1LPUA 3GUBA 4DG0E 2VN9A 2PMOX 4G2FA 4BC6A 4NKAA 3GFWA 4OTGA 2O3PA 2LAVA 5AEPA 5M44A 2V7AA 4CMUA 4FL3A 4U0IA 2VUWA 4ACCA 4EONA 2BFYA 4E5WA 4JR7A 4M69B 2XK7A 3ELJA 1U54B 2YA9A 1Q8UA 3F2NA 3PVUA 4J97A 4EQCA 5IH5A 2FYSA 4EBVA 4R3CA 2JIIA 4C7TA 1MUOA 3LQ8A 4IDVA 2WGJA 4NWMA 4FV9A 3QRKA 3ZO4A 5AAEA 3S0OA 2R3NA 3NAYA 4FKPA 2GHGA 2XIKA 5LVMA 4CYJA 2A0CX 3RAIA 2BMCA 2BDFA 5JGDA 5M09A 3FE3A 4YBJA 1MQ4A 5B2MA 4GYIA 4L3JA 5FTOA 4DGLC 3IGOA 4I6FA 4IFGA 4DFZE 3BIZA 4A4LA 3NUAA 3EN7A 2I40A 4HPTE 4N0SA 1GIJA 1YRPA 3KK8A 4PNIA 4E4XA 2ZM1A 2UZUE 4J7BA 2JDTA 3QX2A 3OBJA 1T46A 3KMWA 4F6SA 4UZHA 4YJNA 3F2AA 4ALWA 5AUZA 3R28A 3MS9A 3DBQA 4F0IA 3PJ8A 5GZ8A 2J6MA 3PUPA 3LLTA 3FQSA 4M84A 3UIXA 3R1NA 1OECA 2QD9A 4O2ZA 3R7YA 1CM8A 2B7AA 3QFVA 4P7EA 4F63A 1BKXA 2Z8CA 3TKIA 4AN2A 3QTXA 2X8EA 5JKGA 3R2YA 4A9TA 5EOLA 3OXIA 4FNYA 4XJ0A 2R0UA 3MGYA 3QALE 2YZLA 2PVNA 1DI8A 2X6EA 3ZEPA 1UU8A 1REJA 2PVFA 1SYKA 4I0SA 4NIFB 4S30A 1RW8A 3JS2A 1W7HA 1H1WA 3ZRMA 3UE4A 3F3WA 2W5AA 2FSOX 2ITUA 4CTBA 4PL3A 4D4YA 2VWWA 4DCAA 2PUUA 4IHPA 4C33A 3L8SA 1XH4A 1H00A 1CKIA 3UOLA 5IQAA 5L2TA 4N70A 1Y91A 4IM2A 3C0IA 4NW5A 4RIOA 2G2FA 4DCEA 4GS6A 4BB4A 1PJKA 4FV1A 4G3FA 4P5ZA 5I3OA 5C4KA 2KULA 4JG8A 2WIHA 5HI2A 2W0JA 4GFGA 4UN0C 5GINE 2J9MA 3Q4CA 1WVWA 4F7SA 5E8TA 5ACBC 4YTFA 1XH5A 1OI9A 5HLNA 4NM0A 3QAME 5EM7A 5HU3A 4PMPA 1YDTE 2A2AA 1OKZA 4GU6A 4ENYA 3IS5A 4R1VA 2XBAA 1FBNA 4CKIA 4J95A 2XUUA 5CU4A 2X39A 4CFNA 3TDWA 5C9CA 3MY1A 3C9WA 5DGZA 5DT4A 1KV1A 2OIBA 3R30A 5AM6A 1ZOGA 3BHTA 4B0GA 3IQ7A 5LOHA 4FG9A 4BI1A 3RHXA 5CF8A 4IVCA 3NVKI 4XOYA 4XCUA 2UZBA 4CT2A 3JYAA 4TWPA 5AP7A 3PA5A 3F9NA 3MWUA 4U79A 2QOOA 3NNVA 3AD5A 2R9SA 3KCFA 2HY0A 4ID7A 4D9UA 2PWLA 2GNLA 4JNWA 3UIUA 2JKKA 3Q6WA 4DFBA 2OJGA 5G1XA 2WTWA 4JIKA 5H8EA 4BBMA 3E93A 4QQCA 5L8KA 1G5SA 5CAUA 4HNFA 4QMPA 2AYPA 3LMGA 1FINA 4MWHA 1F5QA 4MNEA 4YSMA 3HRFA 4UMQA 4EYMA 4D2RA 5BVNA 2PVKA 4QP6A 3QUEA 3NUSA 4GIHA 2UUEA 4HYSA 4FV4A 3KRLA 4BDFA 4C35A 4F0FA 2BDJA 3TACA 4QP1A 2YN8A 3RCJA 2XVDA 2QURA 2WTVA 5C8KA 3K54A 2FA2A 4IZ7A 4MD8E 2OH0E 5CX9A 2XK9A 3NUUA 4E4LA 2QODA 3VBQA 4NYEA 2WU6A 4C4IA 3RK7A 3PE2A 5IDNA 3AC8A 5A4CA 4KABA 2CGWA 5L2SA 4JI9A 4AACA 3AT2A 5ICPA 2W1FA 5FTQA 5T68A 3R2BA 3U54A 2E9OA 3Q53A 1BMKA 3HV4A 4MBLA 1R78A 3U4WA 3DQWA 3HDNA 3ZM9A 2RFSA 1JSVA 4GFMA 4ANLA 3FZSA 2FSTX 2J0KA 4L67A 3OS3A 1LP4A 4J71A 3RVGA 3FHRA 4BDHA 3ETAA 3UGCA 4LGDA 4NFNA 4RIWB 2IW9A 3SA0A 3KB7A 2BR1A 5IQIA 2GCDA 2IN6A 3GXLA 1UNLA 3AC3A 3B2WA 2HWOA 3W18A 5M07A 2WTJA 4JOAA 4NEUA 1V0BA 2C6MA 2IZRA 3ZZEA 3FEGA 2X8IA 3FY2A 3PG3A 3VIDA 2PVHA 3AG9A 4XMOA 4X2FA 2YWVA 3G0FA 3G90X 4I0TA 4A7CA 3G33A 2W1HA 4AGDA 4DAWA 3E87A 4PF4A 4E6DA 5JGAA 2W05A 1DM2A 4D2SA 4YO4A 3TUDA 1LEWA 4O81A 1H8FA 2UW5A 4FR4A 1R39A 1BI7A 3V51A 3IGGA 4IAIA 4FZAB 5HVYA 4WRSA 5M55A 5AAGA 3TUBA 3TEIA 1E1VA 5GHVA 2I0VA 3W2SA 4TXCA 4K2RA 4CCBA 3P23A 3EKNA 4F9BA 3LXNA 4Y72A 2PYWA 4FYNA 2XRWA 2ZJWA 5KMJA 3FXXA 1T45A 5TR6A 5D1JA 2BCJA 3K3JA 3RPRA 4KS7A 4AS0A 1YVJA 3F5GA 4KIKB 2OXYA 3HAMA 3GC8A 2A19B 5HIBA 2HW6A 1DAYA 3UBDA 4O22A 4B7TA 3VW6A 3DT1A 3GGFA 1U46A 1CKPA 3HX4A 3OWJA 2B52A 1ERKA 4LG4A 5E8WA 4TTHB 3IPHA 5CS6A 1QCFA 4TT7A 5CSWA 2YERA 4FTLA 3RBWA 3G2FA 4OTQA 2XEZA 5HNBA 2QC6A 1H1RA 3O2MA 3HLLA 4I0RA 3C4EA 4TL0A 5KMIA 1TQPA 4FUYA 2CKQA 3VNTA 3QC9A 4D2WA 3ZDIA 3A2CA 1MQBA 3FV8A 3QTUA 4OTDA 3L9NA 3CGFA 1K2PA 1GY3A 2OJ9A 2XK8A 1H1PA 1QPEA 2G9XA 3DAEA 3FMLA 3OC1A 3VAPA 4O7NA 2WMSA 4IX4A 4WSQA 3KRWA 2QOKA 5IQDA 4FSRA 4ZAUA 4AGCA 3Q96A 3ALOA 5J95A 5FDPA 2QI8A 4O6EA 2YHVA 4CKRA 2O8YA 2CGXA 4ZTQA 3UPZA 4DFNA 3SRVB 4S34A 3TIZA 5FM3A 3V6SA 3Q5IA 3PSCA 3SXFA 3R1YA 4C37A 2VNYA 4I3ZA 2ERZE 4FSNA 3NS9A 3PTGA 1ZYJA 2JFLA 4YNEA 4FT3A 3T3VA 2OZAB 1GZ8A 4DFXE 1LR4A 4RT7A 5IUGA 4F1OA 1PF8A 4G34A 2PSQA 3E7VA 3HMPA 3U4UA 4GK3A 1BLXA 4IAKA 4WBBB 4D4RA 4QTDA 4BCNA 2CLQA 3D5VA 1PXOA 3FMEA 4PQNA 3R7EA 2YM8A 3O8PA 2C5YA 5J87A 4W8EA 2PE2A 1NA7A 2VTMA 2WMWA 3FPMA 3T9IA 1YOJA 2X9EA 2C3JA 3G9LX 5CT7A 2BAQA 5IQCA 3FUPA 2ZV7A 2WZJA 3P86A 1UU7A
chains in the Genus database with same CATH superfamily
1YI6A 3PJ1A 3EZVA 2VGOA 4QMYA 4EOPA 3NR9A 1XKKA 5HBEA 3F3VA 3EHAA 3DOGA 4X2KA 1PXLA 3D7TA 3GB2A 3GQLA 4XV2A 4EK6A 3LCDA 1H4LA 3LAUA 3PWYA 3UDBA 1ZYSA 5BNJA 2YACA 2DYLA 2VO3A 2WQBA 2JFMA 4L7FA 3SXRA 2VTRA 1IA9A 3JR1A 5JZNA 2EXMA 4IM3A 4LQMA 1W82A 2CKPA 5TO8A 1PYXA 3ET7A 3P1AA 2PMIA 4FODA 4GVJA 4I5MA 5DR9A 3VULA 5CSVA 3NCGA 3FAAA 4C38A 1F3MC 2W1GA 4EK3A 4X2GA 3CIKA 2EB3A 2CN8A 5M53A 5HX8A 4XV9A 2XANA 4M15A 5CAPA 4L53A 4WNMA 4K77A 2GFCA 2UW7A 3JVSA 3R8ZA 5JMSA 1NVRA 5IQFA 2H6DA 3VRZA 3AKLA 4S31A 5HICA 4G6NA 4YTIA 4DGMA 5AM7A 4IC7A 3BYUA 3OWLA 2B4SB 4KNBA 3A7FA 4YJQA 3UG1A 2J0JA 2QONA 3LFCA 4E93A 4ASXA 4C58A 2PL0A 4GRBA 4FIFA 4G16A 5DG5A 4FTAA 2W4OA 1M2QA 3KVWA 3PA3A 4OBQA 2VTTA 3MIYA 3E63A 4CZYB 3BGQA 1FQ1B 2WEIA 3H0ZA 3LCOA 4QT1A 5LQFA 4WKQA 3QHRA 3R73A 4QP9A 4V01A 2WFYA 3ZSGA 3UQFA 3TZ7A 4ZMFA 2PUNA 3ZLSA 4A4XA 4B6LA 3SOAA 5KKRC 4FSQA 4E6CA 4N57A 1QMZA 3BU6A 3W0MA 3PDTA 5ITAA 2IZTA 3CY2A 3RGFA 1PYEA 2VU3A 3PVWA 5CU3A 5AWMA 3UVRA 3AOXA 4FEVA 3ORXA 1YWRA 3RAKA 2REIA 4BCQA 5IA3A 3O71A 2P33A 3Q32A 3ULZA 4HVDA 2UZNA 2VWXA 4IIRA 4K9YA 5DA3A 2JDRA 5DT3A 1B39A 5F20A 4BIDA 4EK8A 5HTCA 3MY0A 3EN4A 1XH9A 5KMNA 1ST4A 3G9NA 4GT3A 4RJ4A 1M2PA 2PULA 1PXMA 1YW2A 2YABA 4YC6A 5A54A 4XBRA 2SRCA 1H24A 2F57A 4H58A 2IVVA 4E7WA 4R77A 3QGWA 5FP5A 5IMXA 2ZAZA 4R7BA 2VWZA 4DDIA 4WBOA 1WCCA 5HHWA 4ITIA 4R78A 1OPLA 1BX6A 4QYEA 3ATSA 3TG1A 3O7LB 4TYGA 3S4QA 2XB7A 3EFWA 4P5QA 5I9ZA 5JZJA 1GZNA 4MH7A 5H3QA 4UX9A 1P5EA 5HE1A 3G15A 3E5AA 4FSWA 3TV6A 3BGZA 4TNBA 5I9VA 3GC9A 2F7XE 3ZRLA 4O0YA 5J5TA 3H9OA 2ZVAA 3RCDA 4J99A 4EC9A 4H1MA 5JFXA 3A62A 4AT4A 2VAGA 4ZJIA 4F9CA 3VO3A 3AKJA 2B53A 2R3JA 1NY3A 5GZAA 1XO2B 3FXZA 4CFFA 4U42A 4JDKA 4XG2A 3UOHA 3QQJA 4FTTA 2VTQA 4BDGA 3BV3A 3ZFXA 5CEIA 4AT3A 3TDVA 4FSUA 3FZOA 5M06A 5AP0A 5T3QA 4A4OA 2WQMA 3I6WA 3P78A 5IA5A 1YXSA 3R9NA 3CTQA 2QR8A 3M42A 3NLBA 4BZOA 3CR0A 2OBJA 4M12A 3QWJA 4RX5A 4C36A 3B2TA 3D15A 3MFSA 4ZTNA 5M4IA 2OIQA 2QHMA 4BCGA 4H1JA 5IPJA 4LUEA 5JFVA 4CGAA 2W06A 3BBWA 4YJPA 3UOJA 2P0CA 3KN6A 1RJBA 1PY5A 3EQBA 2B9JA 4ASEA 1IRKA 3IW4A 2OW3A 3K5VA 3Q4TA 4QNYA 5A46A 2X7FA 2CHLA 3TN8A 4KD1A 5IH6A 5J8IA 3IW7A 4I1ZA 4J8MA 5KHWA 2IG7A 1JKKA 4YTCA 4MHAA 1PMVA 3AT4A 4EWHA 5HIEA 2QOFA 5CENA 4RLLA 4RWKA 4FV7A 2XCHA 3R8LA 1QPCA 3OF0A 3ZXTA 3L9MA 4U44A 4F1TA 3ZSHA 4JXFA 3OG7A 1ZMWA 4AN3A 3ZZWA 2JIUA 5FEQA 3FLWA 3PFQA 4OTWA 3LIJA 1WBOA 3UYTA 2PZIA 2QO2A 3PA4A 2FVDA 2C1BA 4F99A 3O50A 3EQGA 3KK9A 3DA6A 4R6VA 4KKHA 3OUKA 4ITHA 1U59A 2HOGA 2F2CB 2X9FA 2XYNA 4MK0A 5AX3A 5A3XA 3CGOA 3VBTA 2XALA 3EN9A 3FI4A 4JLCA 5HCZA 5K3YA 5L6WL 3L1SA 3PJ3A 3DXNA 4YP8A 5IH4A 1AD5A 1URCA 4KAOA 4X7QA 4JVGA 1IAJA 4O7WA 2J0LA 4I23A 4C62A 3WBLA 3ACKA 2HW7A 4LOQA 5BUIA 4ACMA 3CD8A 3Q6UA 3ENMA 3QA8A 3MI9A 1A48A 5F94A 4ZK5A 1I09A 2PE1A 3DDQA 2RSVA 1Q8TA 4E5AX 4BDEA 1IG1A 3PXZA 1SM2A 4PTGA 2VTHA 3OTUA 4O7TA 2X2MA 4C59A 3KN5A 5I4NA 5I9YA 4I6LA 2WMAA 4Y83A 2X7OA 3P7AA 2XNNA 1YOLA 4AW2A 1PXPA 4LV5A 3BGPA 4QP7A 4AX8A 4ZTMA 4L3LA 4MXCA 3V5TA 3FYJX 4GG5A 3RINA 5IDPA 1H07A 1OZ1A 3WF5A 4JX7A 2CPKE 4HCVA 4TWCA 4LRMA 1G8KA 3NNWA 4KSQA 3B8QA 3NUPA 4PWNA 5AV2A 3A7IA 4MXXA 3V3VA 2A27A 4I4EA 2RG5A 2GNJA 2ZV2A 3DKGA 3V5WA 4Y95A 5FP6A 1YWVA 3TNIA 3ZFYA 3BHHA 3Q3BA 2E2BA 3PIXA 1WBNA 1WMKA 3MN3A 2C4GA 2P2IA 2NP8A 3NWWA 4KS8A 4MXOA 3Q04A 3RP9A 4AXEA 2YIXA 3MY5A 2IVSA 3UQGA 2GDOA 3EZRA 3LM0A 4FIHA 5HBJA 3UNKA 3AKKA 4LL5A 2A98A 2HELA 3PLAE 4M7IA 2YIWA 3NX8A 2UZOA 3PZEA 2O63A 3ZDUA 5EHOA 4KUJA 2YDIA 4FKIA 4HCTA 3NSZA 4IAAA 1WBPA 4I6QA 2C3KA 3ZCLA 2ZFYA 5EQPA 3ATTA 1H0WA 3DY7A 4ENXA 3VS3A 3RNYA 4C0TA 3F7ZA 4FZDB 1ZWSA 3GCUA 3KXGA 3OCTA 4BR3A 5FEEA 4QQJA 3QCXA 2PVJA 4FZ7A 4I93A 3QTWA 4RVTA 5FXQA 4PDOA 4U41A 4W4VA 2FB8A 4BZNA 3F5XA 4HZSA 4C34A 2OXXA 1GIHA 1UVRA 4ZTRA 4AFEA 4EBWA 3QZGA 4S32A 3GOPA 3OD6X 4WG5A 1E9HA 3A7HA 1M2RA 3FMMA 3DBFA 3OY1A 4IAYA 4A9SA 2QOQA 4CRLA 4EKKA 2QOBA 2WTIA 2W1IA 3R8UA 3BE2A 3FSFA 3UJGA 2J0MB 1YOMA 5E8VA 5HVKA 4FTNA 4O7RA 4I41A 4X3JA 5EM8A 4QTBA 2B54A 2G01A 1NXKA 4QMZA 5I9XA 4AE9A 1H26A 4GJ2A 4WA9A 2VWVA 4X3FA 2X81A 4NJ3A 2F2UA 4IEBA 3FKNA 3KU2A 3W8QA 4RJ6A 5J1VA 5CI6A 3SW7A 2GQGA 3DJ6A 4QQ5A 1SNXA 2VTPA 3VS1A 2ZV8A 3AXWA 2OGVA 3D83A 2ONLA 3ORMA 3WYXA 2DUVA 4TPTA 5DEYA 2H34A 3OY3A 4EOMA 4L8MA 4DHFA 4GCJA 4L6QA 2W17A 5C8MA 3TMOA 1JPAA 3TWJA 5AA9A 3LQ3A 2Z7LA 5KKRB 3ULIA 4USDA 1OIUA 5KMLA 3RHKA 3WF8A 3KXZA 4CSVA 1HCLA 3W2QA 3GU5A 4H3PA 4X2JA 3O8UA 2JKOA 3OWPA 1VR2A 3UO6A 5GZ9A 1KE6A 5C26A 5E9EA 5EDRA 3PP1A 1KSWA 3EIDA 2V55A 3R01A 3CE3A 4ZSGA 2WOTA 2YAKA 3DFAA 2QG7A 3SAYA 4P90A 5HD7A 3VWAA 3BLQA 4BHZA 3KQ7A 4GFOA 4GV1A 3VBWA 1OGYA 2BZKB 4ERWA 4Y85A 1H1QA 4M69A 4E1ZA 4BGQA 5IA2A 4X6RA 5GJDA 2O65A 2VTSA 5A6OA 5CVFA 2WXVA 4IE9A 2QO7A 5GIPE 3KULA 4CMOA 4DF3A 5IA4A 3DS6A 1H1SA 3EQPA 3PSDA 4C4FA 3CSVA 1Z57A 4RIXB 4JBVA 1R3CA 3M11A 3WOWA 3SX9A 5CANA 2DQ7X 2WTKC 4YZ9A 4NTTA 5HNGA 4FEUA 4XG3A 2JDVA 3CKXA 4DFYA 5HX6A 2R3FA 3TYKA 3QQLA 3OW4A 4JMQA 4GUBA 3JY9A 3DKFA 3PRFA 4Z3VA 2Y7JA 3LFDA 3KMMA 3TT0A 2X7GA 3FMHA 4PDSA 2YISA 1ZYLA 3EQIA 4FE2A 3R83A 1L3RE 5HEZA 1P2AA 4XOZA 4YC3A 3ORZA 3QHWA 4A06A 3E62A 3EYHA 4QMVA 5AAFA 1R0PA 2IZUA 3PXFA 2WQEA 2XP2A 4FTKA 3VJNA 4CFXA 3N4UA 3H10A 4P2KA 1ZMUA 5HVJA 4CLIA 4OAUC 3CY3A 2XS0A 3LFAA 2IF8A 4O7VA 3D5WA 2P3GX 3HDMA 5BVFA 3AD4A 4J52A 1H08A 5CAQA 4QNAA 2XIZA 4MBIA 2XM8A 5IQGA 2PMNX 4FOBA 4NSTA 3O7LD 5DNRA 3RMFA 3WILA 4AA4A 3Q2JA 5CEMA 1FOTA 4FYOA 3DTWA 2QLQA 3REPA 1UWHA 3NCZA 4JAIA 4QPSA 1CDKA 3FC1X 4UMPA 2ZMCA 2F9GA 1VLRA 5EK7A 2R4BA 3QX4A 5L8JA 2BVAA 4FKLA 4UB7A 5B2KA 4FTIA 4Y73A 2QOHA 4LM5A 5EKOA 3VUMA 1ZZ2A 5M56A 5BVEA 4XH6A 5L2QA 3UP7A 3KGAA 1ZY5A 3I0OA 3KC3A 4HVHA 1OKWA 1OKYA 4IVDA 3FKLA 1KWPA 2WMQA 3MA6A 1KE5A 3UODA 2BAKA 4CLJA 4DA5A 2YFXA 5CXHA 4NJDA 4ZSJA 2JITA 4U45A 4RX7A 2HXLA 4Q5EA 4BF2A 4YO6A 1WBTA 4EZ3A 5DEWA 2IJMA 1OL5A 4APCA 3CPCA 4EWQA 5ETCA 1Q8YA 3D2KA 3FPQA 4JS8A 4DH3A 4EOOA 4Z7GA 4U80A 4C02A 3CTHA 3FC2A 3LCKA 4WNOA 1YHWA 4XUFA 3JVRA 5KZIA 4PMSA 4CZUA 4DBNA 2VZ6A 3FLNC 4ZJJA 3TL8A 3ZO3A 3V8SA 4D2TA 4IM0A 4V0GB 3WI6A 4DYMA 5CF4A 2J5EA 4GT4A 3PXRA 3R02A 4OUCA 2YLEA 2FSMX 3PY3A 3N4VA 1GNGA 4FC0A 4FEWA 4WRGA 3LXPA 4F7LA 3HA6A 4EJNA 5EYKA 3DXQA 3C13A 2P4IA 3O96A 4U5JA 3NUYA 3NIEA 4QYFA 4UEUA 2G2IA 4G1WA 1Z5MA 1ZZLA 2VX0A 5E90A 4BCMA 2OF2A 3JPVA 3ZO2A 5LVLA 2VWUA 5KBQA 4Q5HA 5LWMA 4FKWA 2C0IA 3NW7A 2RKUA 3DDPA 4ZP5A 2R3LA 5F1ZA 1S9IA 3FI8A 4F9WA 1Q5KA 4KIQA 2ERKA 4FBXA 2PTKA 4UYAA 3DAJA 5DT0A 3C50A 4MNFA 5A4EA 4NW6A 4MQ1A 2QR7A 3MPTA 1OKVA 5BV3A 4EH9A 3UDTA 2C6TA 3UMXA 3UVPA 4XP3A 3GBZA 4MBJA 1JOWB 5HCYA 4ZMEA 4OT5A 4EZ5A 4AXDA 3G6HA 5EM5A 4DLJA 3U6IA 3HZTA 5KMMA 2PVMA 3EH9A 2GS2A 3I1AA 3HNGA 1I44A 3A4OX 3L9PA 2AC3A 3DK6A 3HYHA 1TQMA 4BCOA 1XMMA 4CV9A 2R64A 2XNMA 1ZOHA 4BI2A 4XG9A 2C6EA 4CMTA 2YIYA 4BJJA 2XBJA 3ORKA 3PLSA 3Q9YA 2W96B 3P5JC 3RI1A 1DS5A 3FSKA 2X4FA 2KTYA 3NIZA 3PSBA 1DAWA 3K2LA 4NK9A 3NPCA 4O38A 3NW5A 3V5QA 4RWJA 5CEQA 4BI0A 5J7BA 4O82A 4XG7A 4E26A 3VS4A 3W0NA 4TW9A 4AXAA 2G15A 4DEBA 4NT4A 3UG2A 4II5A 3QGYA 4JDHA 2WHBA 3MVJA 4IACA 2Z7QA 4WSYA 2WEVA 3HMNA 4JX3A 4O91A 3IDCA 4YZBA 5B0XA 5BVDA 3SVVA 4MNEB 4RSSA 4UY9A 3SV0A 3U51A 3AT3A 4RFZA 3DXPA 2XK3A 3R63A 3QXPA 3F5UA 4HPUE 1YKRA 4OTHA 3MH0A 4TZRA 1V1KA 3DFCB 3SC1A 4PTCA 4AW5A 4L68A 1XR1A 5LXMA 2YZAA 4IAZA 4RIWA 2C6OA 2W4KA 4QP8A 4PX6A 5KHXA 5AP5A 3TNQB 1PRYA 4BIBA 3COMA 3OCGA 2R3GA 1JSUA 1XHAA 3QQKA 1J1CA 4M97A 5EYMA 4IXPA 4FT0A 4BL1A 3ZFMA 1OL6A 1WBVA 2XIYA 3EQCA 4GIIA 5E91A 3O17A 1UNGA 2W99B 4MVFA 4ZZOA 4ORKA 1ZARA 3ERKA 5HESA 4GU9A 4XLIA 3WE4A 5IA1A 3LMIA 3ZUVA 3PPJA 3LJ0A 1OMWA 4C3FA 2W4JA 4GK2A 4L3PA 4MCVA 2C5XA 1SMHA 3ML1A 3ORLA 4BY9E 2BILB 3QQHA 4I92A 1BUHA 4N6ZA 1XMLA 4E3CA 2UVYA 2WMRA 4K6ZA 3ZC5A 3DKCA 2WIPA 5CNOA 4RA4A 4G3EA 5A4QA 4QPMA 2C5VA 1UU3A 2OIDA 3FLZA 4GK4A 1FVTA 3ODZX 4CCUA 2JDSA 3GCQA 4RPVA 3EN6A 1AQ1A 3G0EA 4UZDA 4J96A 4HVIA 3HA8A 4U81A 4V04A 4MYGA 4C4HA 4I4FA 3WZKA 1WVXA 3H9FA 4O27B 4BKYA 5BYLA 3UZTA 3LKMA 4AXFA 2ITWA 4I6BA 1RDQE 2UW0A 3PFYA 4JQ7A 2O0UA 1JBPE 2BZHB 1XBAA 4I5PA 4IVBA 4YJOA 3U9NA 4LL0A 4XYFA 1O6LA 2YCQA 4FKGA 3KEXA 3GT8A 4KA3A 4FGRA 5AP6A 3F3UA 4FX3A 4AG8A 2I0YA 2EB2A 2BRNA 3HRCA 5E92A 2CKEA 3QQFA 1X8BA 3ORIA 4BCHA 2Y6MA 3BHUA 4HYIA 2BZIB 5KX8A 2WAJA 2W1CA 1W2FA 4WOVA 4DBXA 4JAJA 4YC8A 3F5PA 3EKKA 1J1BA 3WF9A 3ID6C 3DBDA 5AR7A 5I5ZA 4FICA 3DBEA 5L4QA 3L8PA 3LMHA 3WF6A 1ZRZA 3OCBA 4FG8A 3Q5ZA 2YWPA 3P79A 4ZTLA 3R71A 2HENA 3MA3A 4UWYA 2C0TA 3SLSA 2WTDA 4PDYA 5CYIA 3BYVA 4AGWA 3NRMA 3ZU7A 3ACJA 2X4ZA 2X0OA 2Q0NA 5T6KA 2C5NA 4M3QA 3W16A 3VF8A 4FTOA 4MX9A 4WIHA 4QO9A 4BICA 2IW6A 2QU6A 4DDGA 4RWIA 4O84A 4L52A 4PP9A 3ANQA 3I5ZA 2QNJA 4D58A 1Q8ZA 3KRXA 3TTIA 4FNXA 4S33A 5DI1A 5DBXA 4FKOA 5AR8A 3R9OA 4BDCA 4RZWA 4D1XA 4D9TA 4RX9A 2PK9A 4F0GA 4H05A 3R21A 2OZAA 5JGBA 3LVPA 4DEEA 2RFDA 2CCIA 4EK5A 4QP4A 4TYHA 4F64A 2HY81 3C4ZA 4BGHA 1GJOA 4KKGA 4DFUA 4CG9A 2ITVA 3BYSA 3E88A 4RVLA 3ZONA 3C5IA 2WKMA 3E3BX 4IZYA 3RK9A 4FKRA 3LJ1A 1WBSA 4IW0A 4B8LA 3BEGA 4BHNA 2PZRA 3PE1A 4CFVA 4I6HA 4Y5HA 3VQUA 3AD6A 1E1XA 2H96A 2OH4A 4XBUA 2CKOA 1MRVA 3E8CA 5C03A 4P4CA 3CQWA 4PP7A 3HRBA 2HXQA 2EVAA 1M17A 2XKDA 3Q52A 1UNHA 1ZYCA 4BBFA 5A6NA 1G8AA 2FO0A 2F7EE 4TWNA 4MF0A 4F6UA 1YI4A 2XKCA 4OR5A 4ASDA 4CQEA 1B38A 2BAJA 1H28A 2WMUA 4Y8DA 3QRIA 3R9HA 4ACHA 4D28A 5CEPA 1VYWA 3ALNA 4IBMA 3S1HA 5J1WA 4MF1A 4G5PA 5DR6A 2JIVA 4O4FA 5EW9A 2I7QA 1S9JA 2C0OA 4BWPA 5CF5A 3KXXA 3V04A 3P9JA 2Y4IC 5FM2A 5HBHA 4EEVA 3PVBA 1VEBA 4RIYB 3ZUTA 4EJ7A 3EMGA 2ZB0A 4L44A 3NEWA 2GPHA 3BHYA 1WFCA 3C5UA 2C68A 3CLYA 2UZTA 3NYOA 4ZZNA 4GW8A 5FQDC 4O7ZA 4ZZMA 4RWLA 5J9YA 5HZNA 3C4FA 4GUEA 3A60A 2X0QA 4TNDA 3MTFA 5DRDA 2X2LA 2XKFA 5AV4A 4O0XA 5CVGA 3S00A 4RZVA 5FG8A 2ZV9A 1PW2A 5KE0A 3DBCA 2H8HA 2YM5A 4DE4A 5AUTA 1APME 1FVVA 1Q99A 4U3ZA 4E73A 3BQRA 2XH5A 2F49A 4KKEA 2GQSA 5D7VA 4F70A 1OB3A 3A61A 2WMXA 1REKA 3C1XA 3IDPA 5C27A 3R7VA 4AAAA 3UO5A 3UDSA 1U4DA 2ETKA 3EL7A 4OTPA 2B55A 3BI6A 3OOMA 4CFWA 4M13A 4YJTA 3I4BA 4MXZA 4JBQA 4FTJA 3ROCA 4W8DA 3I79A 2IVUA 4F9AA 4HYHA 5M4FA 4YZDA 4QMSA 2YLFA 1Q3WA 2O64A 2XIXA 2F4JA 3LQ5A 4D5HA 3M1SA 5IQBA 4G3CA 4EH7A 1OL1A 5EHYA 4ANOA 3P7BA 4FK3A 2R7BA 5FRIA 2WB8A 2VRXA 3QZFA 2X2KA 4QRCA 4WD5A 5C01A 3HGKA 3VS0A 4CTCA 3KCKA 5KCVA 3GI3A 4FKJA 4C2VA 5F9EA 5KBRA 4FTUA 4CEGA 3OVVA 4X3FC 4FSZA 4CD0A 4USEA 3QD4A 4O0UA 2Y8OA 3GEQA 3AQVA 3GU6A 3LE6A 3OXTA 4LRJA 4U9AA 3VUTA 3A8WA 4FKSA 3HV7A 2Y0AA 4F1MA 4M8TA 3FXWA 3QCQA 3EN5A 1P4FA 2ONLC 2V7OA 4L43A 5HGIA 2R2PA 3R9RA 1R1WA 5DVRA 1XBBA 4A9YA 4A9UA 2PVYA 3CS9A 4ZXTA 2ITTA 2J90A 4GSBA 3GCSA 4I24A 3HECA 4M0ZA 3QTZA 4WG4A 4DEDA 3BEAA 4XRLA 3ZEWA 2R3OA 3A8XA 5GNKA 3ZMMA 3OXZA 2BROA 3AC2A 4FV3A 4TYJA 5AUVA 2AC5A 3KFAA 5AV0A 5HU9A 4PPAA 3TJCA 3HV5A 3SXSA 5ANEA 4B4LA 2BDWA 2J5FA 1GZOA 3MB7A 4AFJA 1ND4A 3E64A 4E5BA 5KNJA 3SG9A 4F78A 3OHTA 2ITXA 4LYNA 4IZ5A 1Q4LA 4U6RA 2EXCX 3VJOA 5A4LA 1YDSE 4RJ8A 1CSNA 2UV2A 3F69A 3TZ9A 5AX9A 2XK4A 4XLVA 1YHVA 3OZ6A 3C0HA 4IVAA 4YJSA 2XARA 4H39A 4ZEGA 2J7TA 4G3GA 3VRYA 2Q0BA 5D11A 1PXIA 4FEQA 1P4OA 4LUDA 4Z55A 2X0GA 2PZYA 5L2IA 3OMVA 4UWBA 5CASA 2V0DA 3LXLA 4IWDA 4ZLZA 3IW5A 3FL5A 4GYGA 4D2VA 4M0YA 4ZSAA 5ETIA 3GENA 4ZY4A 3DNEA 3LFSA 3GFEA 3GCPA 4BYIA 1CKJA 4KIPA 4EOLA 2VTAA 3V8WA 4UMUA 3RPSA 4DHIB 2E9VA 4HGEA 5CU0A 5TF9A 1OBGA 3E7OA 3RPVA 4WO5A 5EW3A 3KIOC 2VWBA 2YM4A 1JVPP 4N6YA 3FMDA 1OBDA 3BCEA 3UQCA 4DH7A 5CNNA 2CNQA 3D5XA 3KXMA 4M66A 2WMBA 3PY0A 1KE8A 1FGKA 4ZS4A 2QLUA 5KZ0A 5DLSA 3SG8A 5IF1A 4IB1A 4DN5A 1HCKA 4EHZA 1CTPE 2A1AB 1GZKA 3VUKA 3MVLA 3OBGA 5BQ0A 3TV7A 3W10A 3NNXA 2Z02A 4XEYA 3W2CA 4AP7A 4IX5A 2J50A 1YWNA 3IDBA 4IB3A 5FLFA 3BL9A 4O0TA 5M57A 3FZPA 4JRVA 3CJFA 2PHKA 4EQMA 5BUEA 1Q3DA 2C6IA 3QQUA 4EQUA 4YR8A 4BCKA 4CKJA 4FIJA 3W0SA 4JL9A 4RC3A 3F7WA 2C6LA 1AGWA 5EM6A 3OEFX 3ZUUA 3MFRA 4RBLA 1IAHA 1SVHA 3WF7A 3R1SA 2UW9A 3QD3A 2ACXA 3RK5A 5I9UA 4PUZA 2RFEA 3CC6A 3C0GA 4G6LA 5KUPA 1YXXA 4O83A 3KMUA 4F9YA 3RZFA 1JKSA 3ORNA 4B8MA 4FVRA 4QP2A 4AZEA 4HGTA 3EL8A 2ZB1A 3NZ0A 4ZJVA 4LGGA 1FGIA 1ZXEA 2JEDA 1IA8A 5GJGA 5IU2A 2FSLX 2W1EA 3MH3A 5IEYA 4EOQA 3H9RA 4R3RA 1PXNA 3BHVA 3H4JA 1Y6BA 1M14A 2JBPA 3PXKA 4AOJA 4UMTA 2C3LA 4YNOA 3LM5A 3SDJA 4FKVA 3TXOA 4APPA 1OVEA 3DK7A 3MESA 2W5HA 2BFXA 2C3IB 2V5QA 4U40A 4W4YA 3ANRA 2W5BA 3L9LA 5HG5A 5LARA 2AEGA 5LMAA 2VD5A 3UYSA 2XEYA 4CZTA 2E9NA 1Q41A 4UXLA 4LOOA 3LPBA 1OIQA 4RJ7A 4YPSA 3RWPA 3TI1A 3CD3A 3FHIA 5AP2A 3ZO1A 1V0PA 4MD9E 5CLPA 4MD7E 3RKBA 3WIKA 5J7HA 2JBOA 4QMXA 5DYJA 2OU7A 4BN1A 1UV5A 3DV3A 4DINA 1LEZA 4FT5A 5HTIA 3POZA 5HOAA 4O96A 5HORA 2EU9A 2B1PA 4K8AA 5EOBA 2PUIA 3W2OA 2PU8A 4H3BA 3JXWA 3LCTA 4AA5A 2R0IA 5FBNC 4EOKA 5AP4A 1STCE 5K0KA 3WARA 4ZY6A 5LVOA 3JUHA 2W1ZA 1PXKA 3QTQA 3COIA 5IMEA 3QLFA 3KVXA 2CN5A 3FJQE 3I0QA 3QYWA 2JKQA 3VUGA 1L8TA 3UNZA 4J53A 3GC0A 3W32A 4UALA 4O7LA 5IKWA 3F88A 1YXTA 3FMNA 4FUXA 5E4HA 3FL4A 3RAHA 1J7UA 5E8UA 2ITZA 3O51A 2UZEA 4MEDA 4W4WA 1VJYA 4PMTA 3NUNA 3P4KA 2R3HA 4LI5A 5JK3A 5K5NA 2Z7RA 4FKUA 3SQQA 2BHHA 2HCKA 1Y57A 3QTIA 4O86A 4GVAA 4ERKA 1BYGA 3IW6A 4BKJA 5CSPA 3QBNA 2J51A 3R22A 4O0VA 3TNWA 2QKWB 5HG8A 5KMKA 4BZDA 2BRBA 4J8NA 2JD5A 2Z7SA 3ODYX 3LOKA 5EI8A 4XP2A 4L01A 5L8LA 2W1DA 3EQFA 4CG8A 4X0MA 5HTBA 4D1SA 4NFMA 3R7OA 3WZDA 4AGUA 5DFPA 4GH2A 5DR2A 3CPBA 1MRYA 3ZLXA 2XNEA 4KWPA 2ZM4A 4QMMA 4WT6A 4JJRA 5TT7A 2ZMDA 4I5HA 4QYHA 3EFJA 4IZAA 3TCPA 4HYUA 4AZWA 3W0RA 3BE9A 2XNBA 1J7IA 1XWSA 4Z9LA 5IQHA 2CGVA 4CV8A 1JAMA 2OLCA 4DH8A 1YQJA 2VO7A 5D12A 3FI2A 3V8TA 5EQEA 3TM0A 3I7CA 4PL5A 5DRBA 5HG7A 3ZC6A 1GIIA 1XH6A 4RC4A 4D0XA 3AC1A 4PMMA 5BVKA 4DGGA 4EHGA 4E20A 5C8NA 1NT2A 5EQYA 5L3AA 4K11A 2PY3A 5JSMA 1GAGA 4IB5A 3WYYA 4O1PA 3UIMA 5BVOA 2IO6A 5BUJA 5DH3A 2VTNA 4R5SA 1GOLA 4R7IA