3A7IA

Human mst3 kinase in complex with adenine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
287
structure length
286
Chain Sequence
b'MQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine kinase 24 (STE20 homolog, yeast)
publication title Structures of human MST3 kinase in complex with adenine, ADP and Mn2+.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3a7iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3a7iA01
3I1AA 3KRRA 5ANOA 2W4KA 4MKCA 3VS1A 5CNNA 4F0GA 3P5KA 3O2MA 3AGMA 3PY3A 1AQ1A 3AD6A 4MD8E 1OKWA 2UW7A 5TR6A 4RX8A 3GB2A 4FZFB 3AT3A 4QP6A 4QRCA 1XH8A 1U5QA 4L44A 3E8DA 2FGIA 5LMKC 4I3ZA 4R1VA 5HG7A 4E1ZA 4Z7HA 3ZRMA 5DR2A 4BCNA 4DG2E 4GIIA 3H3CA 3EN4A 5CT0A 2WEIA 4NJDA 5JFSA 3VBVA 4DH1A 2C1BA 5AM7A 4ASDA 4BDEA 5HORA 4ZTRA 5EDQA 4DFYA 3U51A 3LJ1A 4FK6A 4BI0A 4RPVA 3Q60A 4DC2A 3WE4A 4DEAA 3LCTA 1WBVA 3Q9YA 3QX2A 3SAYA 4UZHA 2QI8A 4F4PA 3FPMA 3IOPA 4NEUA 2ETKA 3V01A 2J90A 3VJOA 4FKJA 3RALA 2R5TA 1MQ4A 3ZUVA 1LUFA 3IG7A 3BGZA 2XM8A 4PDSA 3MN3A 3QL8A 4TYEA 1QMZA 4ZK5A 4C34A 1AGWA 2ITWA 3ENMA 3HV4A 4BWPA 5EM6A 4FYNA 3PRFA 3QD2B 4TPTA 3A4PA 3UJGA 1ZY5A 4F9YA 4FGRA 4JXFA 3QTQA 4F65A 3TUDA 5BVKA 3BGQA 1W82A 5KZ0A 4XBRA 3W55A 3AXWA 3ORNA 2C69A 3A4OX 5FRIA 2ITUA 3WE8A 5J7BA 2SRCA 5DI1A 1Q3DA 5CSPA 2VZ6A 1UWJA 3AC3A 5TE0A 2EU9A 3RKBA 4Y85A 1SZMA 4FI1A 3MTFA 2IN6A 3LJ2A 3BHVA 4QTAA 2F7ZE 2CGVA 5AP3A 4NIFB 4QMQA 5F20A 2BHHA 2P2HA 2CNUA 2HENA 4W8EA 1J1BA 1YI6A 4IX3A 3PXZA 3QALE 4BZDA 1V0PA 3KCFA 4CG8A 4ZOGA 3OBGA 4IVDA 5CNOA 4C02A 1MRYA 1UNGA 5HE3A 3NUNA 3S00A 3U9NA 3PPKA 4K33A 3UOHA 3BZ3A 5ETCA 2BPMA 4NCTC 2YCFA 3FKNA 3SQQA 3W2SA 1J3HA 4YSMA 4D4RA 5FTGA 3NYOA 1W98A 3F2AA 3AMAA 3O0GA 4RJ4A 5DNRA 1NW1A 3O51A 2YCRA 1PXPA 3HV3A 3KCKA 3VUTA 2QOHA 4AT4A 5A4TA 5BYYA 1A9UA 1URCA 3OW3A 4K77A 5ANDA 3CR0A 5H2UA 2YCSA 2V5QA 5JGDA 2YCQA 1OIRA 4F6WA 4UMTA 4ACHA 2PMLX 3LKMA 3LFNA 5J9LA 4TKSA 5J95A 4ZS0A 2HY0A 1HOWA 2VD5A 2X9EA 1TVOA 3BLRA 5HCZA 1OPKA 4P5QA 5L6WL 2JITA 4QP7A 1OKZA 2B52A 4BDCA 3PA3A 2C6DA 2VRXA 3BU5A 3IDCA 2PZIA 4J8NA 4EHVA 4FV3A 4H1MA 2PMOX 3C0GA 4BDHA 3MIYA 2BRNA 5TT7A 4ZTNA 4AGCA 3ZRKA 4F6SA 1H01A 1ATPE 4LV8A 4XV2A 4ZSEA 4W9XA 2QG7A 1ZMWA 2Y0AA 4S30A 5EQPA 3BKBA 3GCQA 1SNUA 4G1WA 3NLBA 2RFEA 4FSQA 5M44A 3IQ7A 1JWHA 3PJ2A 3TV4A 4EOJA 3EFLA 4ZIMA 3RWQA 3I0OA 5CVFA 1XH7A 2O5KA 3VAPA 5IZFA 1NT2A 4IQ6A 5IEYA 2J6MA 4E5BA 3NGAA 5EM5A 4YZDA 5JFWA 2OWBA 3LPBA 2ZAZA 4MVFA 3FI2A 4AA0A 2WFYA 4BYIA 4DFBA 4I5CA 4FR4A 5AJQA 2FA2A 3COKA 3TN8A 4CFVA 4Y83A 2IZUA 4Y5QA 4K0YA 4M12A 4RX5A 4C57A 4OAUC 1Q41A 2VX0A 2XCHA 3E3PA 2GPHA 3VBQA 3MH1A 1U54A 3WF7A 4AU8A 3RGFA 3ZTXA 4EUTA 3BIZA 4XS2A 5C8KA 4EOSA 5GZ8A 4YJNA 3FLWA 3HA6A 2YLFA 1APME 3PJ1A 3AD5A 4PRJA 4IADA 3LVPA 4GJ3A 4WBOA 4BI2A 2PVFA 4ENYA 3KXXA 2OXDA 3UO6A 1B6CB 1PXKA 4IC7A 5EHOA 3DA6A 4HVHA 5IMXA 5IA4A 4XG3A 5DIAA 4FSZA 2G1TA 3CY2A 3F3VA 5DEWA 3W2RA 2OIBA 3PZHA 4NKSA 4PWNA 4NM5A 1YI4A 3D83A 4YJTA 1OECA 4FV1A 5HTIA 4PX6A 4NZWB 4U81A 4I24A 4ZLYA 1XR1A 3U9CA 3V51A 1BL7A 3OCBA 5GNKA 4AACA 3HLLA 4AGDA 3KA0A 4FG9A 5LCJA 1PW2A 1WBPA 2E9NA 4NFNA 3MTLA 3PRIA 4OT5A 5ETFA 4CQEA 4L43A 4QP9A 2XUUA 5I9YA 4YO4A 2B9JA 4S32A 4IB3A 3TCPA 5KUPA 4DT9A 1H26A 1PHKA 1YWVA 3JPVA 4FKTA 5K5XA 3EOCA 2Y4IC 3O50A 4FTIA 2QLUA 2QURA 1JSTA 3CIKA 3OCTA 4QP3A 1J7LA 5DYJA 5CEOA 4PNIA 3HRBA 5HE0A 1ZOHA 4GT4A 3LJ0A 2XB7A 5AP1A 1M2PA 4F1TA 2CMWA 4ITIA 3QUPA 3R1NA 4I94A 3R9DA 3GQLA 2C47A 5L6OA 4FT3A 5HVJA 3S1HA 3DDPA 3DXNA 4WO5A 4ZSAA 4DH5A 4XHKB 2QHNA 4WT6A 3EQBA 4B0GA 1YVJA 4XBUA 4AOJA 4CFNA 4ANMA 2YJRA 5CF8A 5K4JA 4RC2A 2JIIA 4C38A 4KABA 4EK4A 4RIXA 3V5TA 3VS7A 2ERZE 4FKOA 2KULA 2WEVA 4FSYA 4PF4A 3IDPA 2PPQA 1G3NA 1UU9A 2JEDA 3ZM4A 1CTPE 2ZB0A 1K2PA 3PZEA 5AV0A 4BDDA 4O1OA 4EWQA 5I9UA 3R8ZA 4YR8A 4RVTA 4C4IA 3MA3A 5B2KA 4JAJA 1Z9XA 3QXOA 4U41A 1VYWA 3KXMA 4O7SA 3BHYA 1R78A 4W8DA 3HP5A 4NK9A 5I9ZA 3R7VA 5KKRC 4DGGA 3V5QA 4F9WA 5EG3A 4OTHA 3DV3A 5JGAA 4N57A 2R3IA 4NW6A 2GS7A 3HZTA 3M11A 3Q5ZA 4F1MA 4LRKA 1ZARA 3RTPA 5JZNA 3MPAA 5HTBA 4USFA 1FVVA 2WTKB 3Q96A 4N4SA 4FKPA 5CASA 3ZUUA 5CAQA 2FB8A 3PLSA 4YLLA 5FD2A 3DZOA 3BLQA 2R3OA 2X8IA 1UWHA 3BU3A 3F5UA 3QZGA 4JG7A 4PNKA 4O7TA 4LQMA 5DA3A 5L8JA 4IX6A 5H8BA 5ANGA 2ZV2A 3C0IA 1H1WA 4C4EA 5FDPA 4A9YA 3A62A 3VWAA 4BB4A 2E9VA 4ZAUA 3EQIA 4PPCA 1XO2B 2WIHA 4I5MA 3ANQA 3F5PA 5ETIA 3W32A 3PSBA 1UKIA 4TTHB 1DAYA 3NUSA 4U40A 4WSYA 4FT7A 5F94A 4BN1A 4CXAA 2I0EA 3FL4A 3PG1A 3QTUA 4LMNA 2C6EA 1H4LA 4NTSA 4S31A 4O0SA 4RC4A 3ZO4A 3MVLA 3CJFA 1WMKA 3DS6A 3PVUA 4IAYA 5CTPA 4C3FA 4KSQA 1J1CA 2GSFA 4EK3A 4KNBA 2QLQA 3QLFA 4JG8A 4B8MA 4LRJA 1NVQA 3SRVB 3E8NA 3NUPA 2ITXA 4AP7A 4DHFA 2C6KA 3BRBA 5IQAA 4CFXA 3R1YA 1P4OA 5AAFA 1OZ1A 2W96B 3DFCB 3CPBA 5HGIA 1G5SA 3MY0A 3O17A 4B9DA 2QC6A 3QU0A 3ZLSA 5CY3A 3FZRA 2VTIA 2X39A 4XLIA 4AF3A 2UUEA 4CFFA 5A46A 4R8QA 3QUEA 3R2YA 3ZBFA 2F4JA 3KRXA 5ACKA 3EN7A 4ANNA 3C4WA 3KRWA 3PY1A 3FLQA 3N4VA 3KFAA 2OJJA 4LOOA 5D41A 3A61A 4FGBA 5JH6A 4L7SA 2VGPA 5CEPA 2AYPA 4KBKA 3WI6A 3N4UA 1XWSA 3D15A 1P5EA 3NCZA 3RHKA 2Y9QA 3F9NA 2QD9A 4OBQA 4M69B 4CMOA 4CZTA 5EFQA 5HE2A 5EOLA 2Y6MA 3BYOA 3ZOSA 4YHFA 3UTOA 4L9IA 3LFSA 4FV9A 3BHUA 3FSFA 1PKGA 5FP5A 3MWUA 3SW4A 2J51A 3A60A 3G0FA 3EQHA 4FEQA 4MX9A 5KMKA 4LG4A 5AMNA 3NWWA 4XRJA 4IAIA 2HY81 3MGYA 4BDJA 3PXQA 3SVVA 2C6LA 5L4QA 3BI6A 3N4TA 3HGKA 1BYGA 2PMIA 5AEPA 2I1MA 4J96A 3CD8A 2ONLC 2ITZA 4BIEA 4FTAA 3QKMA 4G3EA 4YZMA 1LPUA 1FQ1B 3VUMA 3GVUA 1DAWA 2OH0E 3KN5A 3FBVA 4L45A 4UWBA 5IDPA 2X2MA 3TM0A 4AOIA 2ZYBA 3OT3A 3GU7A 2C0IA 5TKDA 3BBTB 3IW5A 3R63A 5FXSA 3RK5A 5EYCA 4BWKA 4G3FA 3CGOA 3D5UA 4I0TA 4O2ZA 4FEXA 4XP0A 1PJKA 4C36A 4NIFA 3S95A 2YN8A 4O1PA 3VS6A 1UNLA 4CKIA 4J53A 2C6MA 3AD4A 3WF6A 4P2KA 4XMOA 4D2VA 4EKLA 5HESA 5IMEA 3ZCLA 2UW8A 3U55A 4FKRA 1GZKA 3DBEA 3BV2A 3H9FA 3M42A 5KBRA 4U79A 2A4LA 3UPXA 5GJDA 4EZ5A 5IQEA 3EHAA 4HZSA 4L67A 2EVAA 2RSVA 3FZSA 4YNOA 5IUHA 2ZMDA 4KBAA 3W18A 3OBJA 4Y72A 3AC4A 3PIXA 4FTJA 4G3GA 5IQDA 3KN6A 4UYNA 4O0XA 5FM2A 2YM3A 5HVYA 5AM6A 4Q2AA 3BWFA 5CEIA 2WMSA 3FV8A 3H9OA 3PYYA 4RFMA 4CFWA 4DFZE 4E6QA 2JIUA 5K3YA 5EYDA 3TNIA 3EYHA 3QRUA 4FTKA 1OBDA 3Q4CA 1QCFA 2J0JA 2GNFA 4QMZA 3EFJA 4S33A 4V0GB 5HIDA 1QPEA 2R3RA 4FT9A 3F88A 4G17A 1PMNA 3Q4UA 4DA5A 3ACKA 3BHHA 3C4FA 4OTPA 5AAEA 3TTJA 3EL8A 3VBTA 3FMLA 3RAHA 1X8BA 3DY7A 4OTDA 5AV2A 3ACJA 4MBJA 2WQBA 2WO6A 4QD6A 2C5YA 4RMZA 3ZC5A 2I40A 1OL6A 2PVLA 3F7ZA 3HVCA 3MIAA 3C5UA 3C4XA 4HPTE 4ZP5A 4ZXTA 3R83A 4D2WA 4DG3E 5JN2A 1NVRA 1OMWA 2E2BA 3ERKA 2NPQA 4BKZA 2XK7A 4O0UA 3ZONA 4JOAA 4QPSA 3CS9A 3VS4A 4DEDA 4AA5A 4AE6A 3MY5A 2X8EA 5FEDA 3R9RA 2J0LA 3TZ7A 2XP2A 5CU0A 1QPCA 3CXWA 3QQFA 3RAKA 3W10A 3ZFYA 1OUYA 4YUQA 5IH6A 4M97A 4NM3A 5CSWA 4PY1A 2B7AA 3RNIA 4W9WA 4D1SA 2UZEA 5DVRA 5M4IA 4F1OA 4UMUA 5T68A 4CTCA 3F66A 4FUXA 4FL3A 3MV5A 3GCPA 2BDFA 5GZ9A 4DN5A 5HIEA 2C0TA 4FIHA 4IE9A 4Y46A 2IZRA 4BGHA 4B7TA 5E8VA 4QMYA 3TKHA 3D2IA 3QCQA 4QNAA 4JRVA 2IVTA 2DS1A 2UW0A 4IAKA 4JBOA 5CSXA 3LFCA 4C37A 5BUIA 2J2IB 3TWJA 3D4QA 4UX9A 2WU7A 5EM8A 3LMIA 2Z2WA 3DK3A 1JPAA 3KULB 4YO6A 5A4QA 1F3MC 1OIUA 5BPYA 2VUWA 4QQJA 3JXWA 2IG7A 3CQUA 4C35A 1VZOA 2ETRA 4NL0A 1WBSA 4FNWA 4O0VA 1CKIA 5CX9A 4EH3A 4CD0A 3COHA 2JFMA 3GBZA 2J0MB 4WG4A 4UMRA 2FSOX 2ZMCA 2PUPA 5L2IA 3CE3A 4R5YA 3LFAA 4LGGA 2W1HA 3IKAA 4JAIA 4IM0A 2GNGA 3FZ1A 4QMLA 5L3AA 1R3CA 2G2FA 2P55A 3WILA 4YC3A 2ZV7A 4ALVA 1FPUA 2XYUA 4JI9A 4J52A 5DR6A 2VV9A 3ZBXA 4BCQA 3BYMA 4L53A 4QP1A 3TI1A 4U0IA 4CZUA 3UZTA 4MK0A 3U6IA 1BLXA 1R0PA 4IX4A 3RPSA 2GTMA 5LWMA 4ZJJA 1O6LA 2VNWA 3COIA 5M51A 3KF4A 4EOPA 3F2RA 2ITYA 2OZAB 4HNFA 5CS6A 5HHWA 4MXYA 3GOKA 5CWZA 1ZY4A 2HZNA 1OPJA 4EK5A 5DT0A 4BZNA 1YW2A 3NX8A 4O7LA 5CZHA 2BILB 2VTAA 4X3JA 1RW8A 2ZM4A 3BELA 4FSNA 4FZAB 4MQ1A 3W2QA 2GS6A 2VX1A 2QU6A 2RIOA 3ODYX 4JJRA 3OOMA 5CSVA 4O0WA 5CAOA 2Z7RA 1P2AA 2HAKA 5DRBA 4A4OA 4F7NA 2UW4A 3ZO1A 1URWA 2R3GA 5AV1A 2BALA 3EYGA 4KSPA 4M15A 3U4UA 4QMMA 4IWDA 2FO0A 3TJDA 2CJMA 2CPKE 2Z60A 4BDKA 3I79A 3GGFA 3DXPA 4QYHA 2WELA 4GVAA 3CJGA 3F3WA 2OF2A 4QP4A 4M7IA 5CAUA 1MUOA 2R3FA 3QTRA 1SNXA 3HV7A 3UO5A 5IQGA 4CYJA 3JYAA 1XQZA 4E5AX 5EM7A 2FYSA 4KRCA 3IONA 2XBAA 4BCPA 3NW7A 3FMJA 1WVWA 3Q2JA 4GVJA 3PJ3A 2XNBA 3NAYA 5A14A 3UIUA 4AT5A 4BKYA 4I92A 4O0YA 4PMSA 3OVVA 2B9IA 3PSDA 4BCMA 4TZRA 2DQ7X 2UZNA 2XKCA 4L3JA 4YJUA 1HCKA 4YLKA 4H3QA 4UZDA 3FQHA 3E63A 2BKZA 5LWNA 1YOMA 4RWJA 3HNGA 5I0BA 1U5RA 2REIA 4RC3A 4X2GA 4OUCA 2V0DA 3NAXA 3NVKI 2XK9A 3DBQA 4U3YA 3FWQA 4AXAA 3COMA 4NKAA 4UEUA 3FYJX 2PVRA 4AZVA 4Z9LA 3ZH8A 3U54A 5C03A 3QCXA 4O7RA 3HMPA 2XJ2A 2Y4IB 3ORPA 1ZYLA 4IWQA 3R21A 2HOGA 3ANRA 4FTLA 5GZAA 4EBVA 4I6BA 3U87A 3OCGA 4AN9A 5EQEA 5EK7A 3R7OA 5AP7A 3QQLA 4B6LA 3F69A 5A4EA 3KF7A 4XG4A 4OT6A 4D2RA 3Q6WA 4HOKA 2W5BA 2I0VA 2W1FA 5JRQA 2YM5A 3GU8A 3LXNA 3B2TA 3OEFX 5GHVA 1SYKA 4GFMA 4FSUA 2WMRA 5FEQA 4EJ7A 3IGOA 3VVHA 4XG8A 4BGQA 5IQFA 1ZYJA 4RWLA 3R8PA 3UZRA 5KZIA 4F7LA 4L6QA 1TQMA 1XBAA 4M66A 1F0QA 5TO8A 3MPTA 3WZJA 2X0GA 2CLQA 1R39A 3SRVA 5IQIA 2UZBA 5IUGA 4F9CA 4U45A 1OKVA 4FSMA 4NU1A 3OZ6A 4FKVA 3G5DA 4OBPA 5CU3A 5E8XA 3ALNA 4YJSA 3R8UA 1G8AA 4E8AA 5AR3A 3R8VA 2A27A 3PXKA 1YXXA 1YHWA 2CGUA 2ITVA 3GU6A 4LM5A 5HU3A 4R77A 2FSMX 2R64A 3GT8A 5BVWA 5KKRB 2GNIA 3NRMA 4D4VA 3BE9A 4DCEA 2UW9A 1JBPE 5HICA 4X2KA 3QHWA 4IXPA 5CU4A 3CLYA 3D9VA 3PG3A 5A6OA 3NNUA 4DTKA 2J50A 4IVAA 5JRSA 3NMUF 4RT7A 2XVDA 3M2WA 2GQSA 5GINE 4BDAA 3PSCA 3LZBA 4FTCA 4M69A 3E7OA 4MD7E 4NUSA 2CLXA 4RX9A 3QTWA 4I4FA 1XH9A 2KTYA 4RVKA 3D5XA 4IANA 4ASEA 5AR7A 2BRBA 5M06A 2VTLA 1SVEA 3W1FA 2E9PA 2WMTA 3CP9A 3H9RA 2VTJA 3KB7A 4GW8A 5J5TA 4FTMA 4FT5A 1KV1A 4UWYA 4Y8DA 4UBAA 4E26A 3I81A 3KQ7A 4ANOA 4DEIA 2YDJA 5E1EA 4CKRA 3RWPA 2OSCA 4FC0A 2PHKA 4APPA 4ZS4A 3FC2A 4NH1A 3O71A 3V5WA 4MXCA 4PV0A 5KCVA 3QCYA 3RINA 4NYEA 2NP8A 5AUWA 2XNOA 2QOKA 3MA6A 3MFUA 3QQHA 4CMUA 3DK6A 4HGSA 5E8SA 3LM0A 2BZHB 2R3KA 3TACA 3IDBA 3ODZX 3EFKA 4PTGA 5DE2A 3UOLA 4U8ZA 2VX3A 3POZA 2ITOA 4F64A 4AWIA 4ERWA 2HZ4A 3FMDA 5CSHA 1BMKA 3RM6A 4NJ3A 3R02A 2VGOA 4G5JA 4C59A 2J9MA 2PVKA 5L2SA 5LMKA 2QNJA 5BNJA 4KS7A 5BYZA 3HYHA 2R7IA 3QD3A 5GJFA 3PIYA 2JDTA 4YU2A 5E9EA 5D11A 5AR8A 4S34A 4KS8A 4LUDA 1L8TA 2R3PA 4BIDA 4I6QA 3QGWA 2EB3A 3KK9A 1YHVA 5C8MA 4KD1A 4Q9SA 4FT0A 4R7HA 3KMMA 5CXHA 3KXZA 2XRWA 4UALA 1R0EA 1SM2A 3QZHA 1J7UA 2JIVA 2HK5A 3DFAA 3O8TA 4DEEA 3SG8A 3DKFA 3R0TA 4V0GA 4CG9A 3FSKA 4PL4A 4Y5HA 5C4KA 2BCJA 1KE5A 2R0IA 2ZM1A 4JR7A 2VO7A 1B39A 5KE0A 5CT7A 4JBPA 1ZYSA 4IZ5A 1DI9A 3TV7A 4O82A 1UV5A 3QLGA 5H3QA 2IWIA 2Z02A 5CZIA 2QQ7A 3TNHA 3OWLA 4JG6A 2W5HA 4WNPA 2JKQA 2VTMA 4WIHA 4EH6A 2EB2A 4GMYA 2UZTA 5IPJA 4QP2A 5AP5A 2B4SB 4XG7A 4DEBA 4CQGA 3LIJA 3UP2A 3C0HA 4IEBA 3PWYA 2ZVAA 3NIZA 1KWPA 4RZWA 3GOPA 4FKGA 4IZYA 4QQCA 2OBJA 4TYGA 4EYJA 4MF1A 5K4IA 3UQFA 3JR1A 4XV9A 1I09A 2QG5A 4K8AA 2QKRA 4WOVA 5FG8A 4E4LA 3AG9A 4FUYA 5ANEA 4QYYA 2UZDA 4YZBA 3EN6A 5AIKA 1UKHA 3IGGA 2WTCA 3ZEPA 4F9BA 4TYJA 4X3FB 1RDQE 4X0MA 2BAJA 5E8TA 3CBLA 3PFQA 3QKKA 3UBDA 3NDMA 3WZKA 5CAPA 5AWMA 5HBJA 4FVPA 3LXKA 1BI8A 3L8PA 3NR9A 4L01A 4OTFA 2OJGA 3G9LX 5KBQA 3ATSA 1O9UA 4MEDA 4MXAA 4O2PA 4A7CA 3T3VA 1E1XA 2JDSA 3JVSA 1Q24A 4YSJA 4Q5EA 3HEGA 1V0OA 3W8LA 5KMMA 3PA5A 4AE9A 2J7TA 2JDRA 4I4EA 4FG8A 4FZ7A 4FEVA 1O6KA 4JR3A 4XG6A 4I0SA 4BVUA 4D9TA 2WMQA 5AX3A 1YOJA 1VR2A 4QT1A 1KOBA 4XCUA 4ACGA 3K54A 1G8SA 1GNGA 3P79A 4LOPA 3UNKA 4WD5A 4BL1A 1KE9A 2PVHA 2V7OA 3ZHPC 4X6RA 1GZNA 4CT1A 1O6YA 2G2HA 2YM8A 3KULA 4TNBA 5AUTA 2OJFE 3HMIA 3QQKA 4EH9A 4Q9ZA 2B1PA 2W1CA 2Q83A 3LM5A 3R8MA 2XIZA 4J99A 3TNPC 1BUHA 3VQUA 5AAGA 2JDVA 5EHLA 5D9HA 2QO9A 3RAIA 3KREA 3QQUA 2PVJA 3KVWA 5HX8A 2PZPA 5HG5A 2JKOA 3BQCA 5J5SA 3GC8A 4TL0A 4YC8A 3GEQA 4HGTA 2RFDA 4WNKA 4EC9A 4EONA 1NA7A 2CNVA 2YLEA 4JDKA 4F7JA 2WD1A 2PSQA 3OP5A 4OTQA 3OMVA 3TNWA 3I0QA 5IA1A 5HO6A 4BBEA 3ZO2A 3G33A 4BTMA 1BI7A 2YZAA 5FQDC 2UZUE 4KIQA 4E6CA 2JLDA 4I6FA 2A1AB 4JDIA 4TXCA 5CI7A 4YGAA 4BDGA 2W17A 2OZAA 3GC0A 2XNPA 5AR4A 2IW8A 2UZWE 3SXSA 4E5WA 5B2LA 4GG5A 3JS2A 4AQCA 1RE8A 4ZSLA 3IO7A 4O96A 4I22A 2WQMA 2C3JA 5AV3A 4GS6A 5KO1A 3ATTA 2FH9A 3E93A 4FV6A 4CZYB 4QQTA 4R3RA 4WBBB 5E8WA 4ANBA 3TKIA 4O6LA 3RPYA 4KIOA 3ZC6A 4RSSA 4A9SA 4MBLA 4ZMEA 4GJ2A 1Q8WA 3QQJA 3BV3A 4U9AA 4FTQA 3M1SA 4KA3A 2ERKA 3G6HA 4QOXA 3ZEWA 4E3CA 2OIDA 3MH0A 2P2IA 3RNYA 3LCKA 1YRPA 3BLHA 1JLUE 4QMWA 4L00A 4K9YA 5I5ZA 3GP0A 5AADA 2ACXA 4WG3A 2PUIA 3NW5A 5KHWA 3FC1X 3VHEA 4LL5A 4YTFA 4JQ7A 2H96A 3R7IA 3D5VA 1JVPP 1W84A 1JKKA 1XBCA 4G3CA 4L42A 1PYEA 3FY0A 4IWPA 5LMBA 3F3UA 2X4ZA 3Q3BA 2HW6A 4MBIA 1MQBA 2PK9A 2QHMA 3D0EA 5EI8A 4BCGA 4EC8A 3JY0A 3LFEA 3ZFMA 3Q2MA 3O96A 3SOAA 3F3ZA 3CKWA 1MRVA 4KKEA 3K3IA 4RJ6A 1BX6A 4ZJVA 5IG1A 4RX7A 4AFEA 4O7YA 5KX8A 2OICA 4OBOA 4WSQA 3CQEA 3LFFA 4A06A 4KKHA 2CN8A 3GU5A 4KAOA 2CSNA 5M53A 4JNWA 3QUDA 4FV8A 2I0YA 3UOJA 5KMIA 1VJYA 2GCDA 2ZV8A 2QOCA 4O21A 2I6LA 4HCVA 4P90A 4E4NA 3QYWA 4ITHA 4U6RA 5L2QA 4D0WA 4TNDA 4YTIA 4FIEA 4EHGA 2IW6A 4W4WA 3W16A 1W0XC 2NNWB 5EKOA 4F0FA 4EBWA 4D1ZA 3QBNA 2Z7SA 4YZNA 1K9AA 3I60A 3VJNA 3TNQB 3PPJA 2BRHA 3BWJA 3I5NA 3II5A 4ARKA 5IU2A 3PTGA 3R30A 2WTWA 5H8EA 3F5XA 2VN9A 4WRGA 3PVGA 2F2CB 4TWNA 4X2FA 4B99A 3DKGA 4BTFA 4C58A 4O91A 1LP4A 5BVDA 2XIXA 4BRXA 3ORMA 3FDNA 3QAME 4DAWA 4ZZMA 2XJ0A 4ASZA 2UVYA 4QTBA 4FTNA 3EQRA 3R8LA 4DFLA 3R01A 2JD5A 4ACCA 4Q5HA 3LHJA 3BBWA 3A8WA 2WTJA 2FSLX 4FODA 2QODA 3S3IA 4D4YA 4IMYA 5ACBC 2HELA 2CKOA 2GHMA 1ZMVA 3MB7A 3BX5A 2X81A 2GHGA 1PXOA 3BGPA 3I6WA 2BKKA 3QRJA 4FNXA 3UIMA 2XNEA 3VC4A 3ZDIA 4PL3A 3D14A 4BICA 3EQCA 3Q9ZA 3IOKA 3OD6X 4QNYA 3DAKA 1WZYA 2C5VA 5BMMA 2HW7A 4WRSA 1Q8ZA 3ITZA 3ELJA 3P4KA 4UWCA 4AW5A 1S9JA 3CQWA 2YWPA 3E8EA 4C4JA 4LFIA 4I0RA 3OXZA 2AC5A 4YTHA 3FEGA 2GQRA 2V62A 2VWYA 4ORKA 1SVHA 3W8QA 4QMSA 4RIWB 2PULA 2DWBA 2W5AA 3L9LA 3VS2A 3UC4A 3HRCA 3L1SA 3NNWA 3P0MA 4XYFA 4TWCA 4IAFA 5CF6A 5HU9A 4XX9A 4F99A 2ZM3A 3NUAA 4RBLA 5F1ZA 5FGKA 3I4BA 2R3MA 4O27B 4FTTA 4FZDB 5JT2A 1ZXEA 4M8TA 4NTTA 4CCUA 2O65A 4QO9A 4C4FA 1QPDA 1NXKA 5D1JA 4JRNA 4D2SA 5CEKA 4E4MA 5M09A 2XJ1A 3DXQA 3AGLA 4EH7A 2X7OA 3ET7A 5GJGA 1GZ8A 4IH8A 3BYUA 2J4ZA 4XOYA 4UV0A 4YJPA 4MD9E 3NEWA 4KRDA 3ZZEA 3BEAA 3QRTA 4GV1A 5JSMA 3AC2A 3POOA 4FTRA 3RZFA 1Q61A 3HMNA 5CVHA 3F3TA 4GSBA 5EW9A 3CCNA 3V6RA 4EJNA 5IH5A 2JGZA 3DZQA 1B38A 1W83A 3KMWA 2VWXA 2X8DA 3B8QA 3UOKA 5JFXA 1TKIA 2IJMA 3LXPA 4D4SA 3G15A 3MFSA 4BCFA 4D5KA 5HIBA 4DGNA 5BQ0A 5AFVA 2C3LA 2VNYA 5GIOE 2H8HA 5CU2A 4GCJA 2W4OA 2W9FB 4KBCA 4FX3A 3R7YA 5I3OA 4O6EA 3DBDA 2C30A 2BZKB 3NYXA 2HWOA 4GK2A 4EOMA 3C4ZA 3LFDA 5A9UA 4AG8A 3H4JA 4FKWA 2BRMA 2QR7A 1Y6AA 2OIQA 2WQOA 5A4CA 3DT1A 4KINA 3RAWA 4NWMA 4IDVA 5HVKA 4R1YA 2JBPA 4BYJA 2V7AA 2YM7A 4FNYA 4BI1A 3QA0A 3QRKA 2BMCA 3G6GA 4RQKA 3TV6A 5I9VA 3DAJA 4AFJA 3O7LD 4P7EA 4EEVA 2H34A 3BCEA 4D5HA 5HBHA 3CEKA 2A0CX 2OO8X 4M3QA 3R2BA 3WIKA 4A9UA 1WVYA 3MBLA 4APCA 4U42A 4WHZA 5CU6A 5HO8A 5L2WA 4TW9A 4IBMA 4RJ5A 1ZZLA 2XMYA 5EW8A 2WMWA 4FV7A 4X6QC 4ZZNA 1KUTA 2QCSA 5T6KA 5LARA 3WARA 2ZJWA 2C3KA 3VS0A 2ONLA 3V8SA 3LCDA 4YPDA 3MESA 2F49A 2YIQA 4R3CA 3ZLXA 4NM7A 4G2FA 2BHEA 3DTCA 2QOFA 4QP8A 3TJCA 2PY3A 2CKEA 3CY3A 4RLLA 1Q62A 3PA4A 4LV5A 3WYYA 5DG5A 4RIOA 5FBOA 4FSWA 2UW5A 5J9ZA 4U44A 3BPRA 2QOLA 4M67A 4QPAA 4X3FA 4A4XA 1WBOA 4CRSA 1YXUA 1HCLA 3HDNA 3DU8A 4TT7A 4GH2A 3W33A 2RF9A 3FZTA 4EK6A 4FIGA 4YURA 2E9UA 5IEXA 4ZEGA 3I7CA 3MVMA 4JIKA 4PPAA 4ANQA 4CNHA 2B55A 4RWIA 3NUXA 1GIJA 2VWZA 4JDHA 2IVSA 2WMAA 4GK3A 4O83A 4ZMFA 2O3PA 1L3RE 4NFMA 3UVPA 4JBQA 3UG2A 3QD0A 4OAVB 3L8VA 4UN0C 4BTKA 4AGUA 4AZFA 3L8XA 3MH3A 2WOUA 4LOQA 5JK3A 3K5VA 2CHLA 3DBCA 3QC9A 4IZAA 1LR4A 2R3JA 3Q6UA 4GT5A 4FICA 3HV5A 4J95A 4BCJA 3OCSA 4BDFA 3DBFA 2C5NA 4P5ZA 2R4BA 4JBVA 2CKPA 4XEYA 3DAEA 4GT3A 3FZOA 1WBWA 4GUBA 5BMSA 4BCIA 3BE2A 4ZY6A 4TYIA 4AX8A 3K3JA 1UU8A 2UVXA 4FTOA 2ETMA 5E91A 5DT3A 4QMNA 1T46A 3CD3A 3CTQA 3TZ9A 4AZWA 4IB1A 5HE1A 5J87A 3HV6A 4DFUA 4Y73A 5EI2A 5LMAA 3S4QA 2G2IA 4EWHA 2RGPA 2XKEA 5CAVA 2PVNA 2P3GX 3ZRLA 2YFXA 4FZ6A 3DTWA 4HYSA 3NW6A 4PDPA 3EKKA 4QTCA 1W7HA 4G9RA 4OLIA 2PZ5A 2UZLA 4WNMA 4FSTA 2LGCA 3FQSA 2XEZA 2R3NA 4FKLA 3HUBA 2B54A 2HZ0A 2WMBA 5IH4A 1ERKA 4HW7A 2OF4A 2O63A 3MVJA 2X1NA 1T45A 3BYVA 2JAVA 5ITAA 4EOLA 4AZSA 3ULIA 1DS5A 4G6OA 4C8BA 2IZSA 3NNXA 2RFNA 1MP8A 3PIZA 2HCKA 3RPVA 4AW2A 4ERKA 2YDIA 1KE6A 4Y95A 3EMGA 2WB8A 3PUPA 3RJCA 1FOTA 4QMXA 3KL8A 1GIHA 4FEWA 5AP2A 3ZSGA 4MQ2A 1YWRA 4K11A 5HG8A 5JMSA 5LOHA 3FAAA 3UO4A 2BFXA 3HECA 4RJ3A 5DN3A 2W1IA 3R04A 5I9XA 3PXFA 4MH7A 1FGIA 3HUCA 4WUAA 3VW8A 5L2TA 3R9HA 3F61A 3UGCA 5BYLA 5HO7A 2PUNA 5FXRA 2XKFA 1IG1A 4KIKB 2IO6A 3QHRA 5DHJA 3PP0A 4B4LA 3FLZA 1ZYDA 1Z5MA 4O38A 4OTRA 3VUGA 3OUKA 5HEZA 5J1VA 2BUJA 4O7NA 1U4DA 3OXIA 1FVRA 4FVQA 1M17A 4BDIA 4EOOA 2ITNA 2PYWA 1M14A 3FXWA 4LGDA 3P23A 3Q5IA 2XYNA 2C68A 2W1GA 1KOAA 2W0JA 2Z8CA 4JIAA 3TL8A 3ZS5A 3KU2A 4FTUA 4OW8A 5AR5A 3ENHA 4DEHA 3KGAA 2W4JA 4KWPA 5I3RA 5EOBA 1YKRA 2XK3A 1CM8A 3EN5A 3IW8A 1Y8GA 2C3IB 2I0HA 2J5FA 2VTPA 4M0ZA 4I21A 4ONAA 3V5PA 4J71A 3LFBA 1Q97A 3NZ0A 5AA9A 3ORXA 3C9WA 3ZXTA 3MYGA 4NSTA 1FGKA 3A7FA 3A7GA 3FL5A 5C27A 1JNKA 3FMNA 4DF3A 2VTRA 3DDQA 2QOIA 2RFSA 3IK3A 3TDWA 1WCCA 4ENXA 1P14A 4EQMA 3ZM9A 1KV2A 3KEXA 3QYZA 5H8GA 5HCXA 1KE8A 1REJA 2OLCA 3RZBA 3TUBA 4BCOA 2JKKA 2C0OA 4N6YA 5CALA 4F0IA 3HKOA 3MH2A 4QMVA 5IQHA 3Q04A 5HCYA 1OVEA 1UU3A 4EH2A 2Z7QA 5FBNC 3EKNA 3R9OA 4XJ0A 5C9CA 2B53A 5E7RA 4F7SA 4FEUA 1Q8TA 3FHIA 2XS0A 4FL2A 4NT4A 3Q4ZA 3UP7A 4IFGA 4K1BA 4RLKA 3C50A 2JAMA 1CMKE 1OBGA 3OWJA 4J98A 4OTWA 4PPBA 4AUAA 2Y6OA 4RA5A 4IM3A 4BIBA 5C26A 3VS5A 3CSVA 4QMOA 2PWLA 3ZYAA 2VWUA 5EDRA 3DK7A 1REKA 1WBTA 3ZMMA 4LYNA 4G5PA 3MPMA 1IRKA 4AW1A 3OOGA 4O81A 2VTHA 4ZY4A 5L8LA 3ZU7A 3TXOA 5BVNA 2P33A 2PZYA 4ALWA 3NS9A 3DNEA 4XG2A 4RIWA 4AN2A 2XEYA 4CRLA 3HMMA 2Y8OA 5EKNA 3CTJA 2XK4A 4FIFA 1M2RA 3A2CA 3UVRA 3TDVA 4AT3A 4CFUA 5HQ0A 2X7GA 2QVSE 2W7XA 3QRIA 3HDMA 4YBKA 3LW0A 2E9OA 4H05A 2BR1A 2GFSA 5HLWA 3GCVA 3EQPA 3ORTA 2WMUA 4IW0A 1YHSA 1TQPA 1AD5A 2F2UA 2YAAA 3C7QA 5M08A 1FINA 4CEGA 3QXPA 2XNMA 3OWPA 3MS9A 3TTIA 5G6VA 5BVOA 4ZTQA 2GQGA 2X7FA 3OWKA 4C3RA 4AOTA 3R6XA 4ZTLA 1FBNA 2OKRA 3H0ZA 5LVNA 1OIYA 1WBNA 2FVDA 3DJ6A 2BIYA 3H10A 3PE1A 4JS8A 1QPJA 2DYLA 3ZFXA 5K0XA 5EYKA 5JGBA 3GC9A 4BTJA 2W99B 2W9ZB 2OW3A 2QKWB 3Q4TA 4NW5A 4QYFA 3VQHA 1ZAOA 4QMUA 4FV2A 4USEA 2ZB1A 2R3LA 1IEPA 3Q9XA 4RWKA 3G9NA 4M13A 4C0TA 5ANKA 2XM9A 4WKQA 3PLAE 3OF0A 4YHTA 2C6IA 5AUVA 4G31A 4LUEA 2YJSA 3KXGA 1DM2A 4W4VA 1YDTE 2R9SA 5DRDA 3AC5A 3V8WA 2XNNA 3PJ8A 3W2PA 4XG9A 1U59A 3EWHA 4OR5A 1H0VA 2HYYA 4R5SA 4UY9A 3ZLYA 5M07A 4AN3A 3VN9A 2O64A 2BFYA 3AC1A 4M68A 3V5JA 4R3PA 4TWPA 4JLCA 4BKJA 5ANJA 4DTAA 3P08A 3VRZA 4CMTA 1YOLA 3EJ1A 3OS3A 3R7UA 3SXFA 4XOZA 5HNIX 4DINA 2ITTA 3GENA 2W1ZA 4M84A 5G1XA 4R78A 3LMHA 4GK4A 4O84A 4UYAA 4ZLOA 3VO3A 1STCE 5AIRA 1EH4A 2VWIA 2VU3A 4O7WA 3NVMB 1ZOEA 4CLJA 2GHLA 4U43A 3QTXA 2UVZA 5FUTA 5EI6A 2YZLA 2VAGA 5K5NA 5D7VA 2VO0A 4C4HA 4YJOA 4KKGA 3VF8A 5LXMA 4O86A 2XBJA 3H0YA 1W8CA 4A07A 5HBEA 5FDXA 3UYSA 3SV0A 5BX0A 3OY3A 3R28A 4G34A 4TWOA 3KRJA 4Z7GA 5HLNA 3VUKA 4I5HA 2H6DA 3E88A 3MFRA 3P7CA 5DEYA 4C62A 3HRFA 3DB8A 4A9RA 1UU7A 2XIRA 4GU6A 1VEBA 2CGXA 5JQ5A 3P78A 4MNEB 5IA5A 4BC6A 3G2FA 1FMKA 3E62A 3JY9A 5C1QB 4JL9A 4DLJA 4EOQA 4EI4A 2F7XE 4TN6A 1QL6A 3DB6A 3UPZA 4K18A 4ZJIA 4RG0A 2V55A 3LLAA 4XV1A 2V22A 1M52A 4U3ZA 4ZTMA 1OI9A 5B7VA 1PXJA 1YI3A 3MW1A 4YJRA 4AA4A 4EHEA 3ORKA 2X4FA 3K2LA 3VULA 3UQCA 4EH8A 3BU6A 5IDNA 3VBWA 2WMVA 1PRYA 3EH9A 2HXLA 4WNOA 4G3DA 3VUDA 1BKXA 4WA9A 3BEGA 3HAMA 2PUUA 2UW6A 1PXMA 2VO6A 2VTNA 2YIWA 5K0KA 1Q8UA 2IPXA 1ZZ2A 4DLIA 4DG0E 1ZOGA 4R7IA 3DQWA 4FL1A 4U7ZA 4YJQA 5FTOA 3UMWA 1E9HA 3FI3A 5IKWA 5HOAA 2YA9A 5FP6A 4QTEA 3PVBA 2EWAA 5B0XA 1KE7A 4DGMA 2VTQA 2R7BA 3UODA 4BHNA 2WGJA 2WZJA 3DGKA 4M0YA 2OFUA 4FKUA 4FV0A 1WFCA 4R6VA 3THBA 3PJCA 5K9IA 3R1SA 2QO2A 4EH4A 5IQBA 3HAVA 3L9NA 3L9PA 4NCTA 4MNFA 3E92A 3BYSA 5F95A 2CGWA 3EQDA 5IF1A 1S9IA 4C2VA 3EIDA 4RJ7A 4PDOA 4C33A 3MB6A 3UC3A 2J0IA 1RQQA 3DKCA 3FPQA 4EL9A 5KHXA 3C5IA 5LQFA 3GXLA 2BAKA 2YEXA 3LCOA 5E8YA 5M4UA 4CSVA 1SVGA 1Q5KA 4Z55A 3RHXA 4DFXE 1OB3A 2YACA 5TF9A 5LVMA 4TRLA 1H1SA 2FUMA 5CXZA 5D7AA 4YC6A 3OTVA 3QGYA 3S2PA 1PY5A 4PQNA 4WG5A 4ID7A 4C61A 4D2TA 1Y6BA 1J91A 1H00A 5B2MA 1ZLTA 2C6OA 4HYHA 2CNQA 3D7TB 4O0TA 3SG9A 2UZOA 1V1KA 1CKJA 2ITPA 4BF2A 2RKUA 4UMPA 5FLFA 1H8FA 4X2JA 2W06A 3VUIA 2B9FA 4W4YA 4OGRA 3UIBA 3WOWA 3SKCA 1OITA 3GCSA 1U46A 3RK9A 5AUZA 3MJ1A 3FLNC 4ACDA 3ZSHA 4CTBA 5J8IA 3UNJA 1WVXA 3DLZA 2BDJA 2PL0A 1MRUA 4IB0A 4J8MA 5DBXA 2GNHA 2WTDA 1OL1A 4DITA 3DNDA 4QMPA 2XH5A 4CFMA 5LJJA 4AAAA 1GAGA 4D28A 3E64A 4GIHA 4KIKA 3REPA 4RQVA 3KMUA 4JX3A 2YITA 3C4EA 1Y91A 4FK3A 4MCVA 3OEZA 5L8KA 1M7QA 3K5UA 3UMXA 3D94A 3VIDA 4ZY5A 2XKDA 3QC4A 2YIXA 4K6ZA 5E1SA 1PXIA 5M56A 2OJIA 3QZFA 4GFOA 2WQNA 5D10A 2VWWA 4L8MA 1GZOA 4IB5A 4KB8A 3R9NA 5M55A 2RG6A 1OL5A 1YDRE 3LLTA 3MFTA 3Q32A 4MXOA 3T9TA 3V5LA 3ZUTA 4FF8A 4H36A 3DPKA 1IASA 2BROA 3A7IA 5M4FA 2IW9A 2XF0A 1JSVA 3LQ8A 3QWJA 2DUVA 3SW7A 3FYKX 3RBWA 4CV9A 3C1XA 2OI4X 3UE4A 4C7TA 3R22A 3NPCA 2PE2A 4IDTA 4NM0A 3WYXA 4O22A 4OTIA 2BTSA 3RK7A 4YLJA 3UG1A 4YTCA 5LCKA 1PXNA 3RP9A 2PTKA 2CCHA 2XIKA 2YIYA 3PXYA 2XIYA 3FMKA 4X21A 3VUHA 1OL7A 2NRYA 3O23A 2OJ9A 2NO3A 3V3VA 5HG9A 4IIRA 4E4XA 3KK8A 3VF9A 1CKPA 2YIRA 5LVPA 5T3QA 3NYNA 2EXMA 4IAZA 3OY1A 1Q8YA 4HZRA 2A19B 2X9FA 3KY2A 4HYUA 3UIXA 5DR9A 4EYMA 4RA4A 5IA3A 1JOWB 3ID6C 4H1JA 3FKLA 4G9CA 3AC8A 4TYHB 4FV4A 2Y4PA 4FKQA 3RPOA 3ULZA 3OHTA 4XV3A 3OUNB 4BBFA 1YWNA 3D7ZA 2OK1A 3R00A 4H39A 4DTBA 4EQUA 3ETAA 2X6DA 3WF5A 3Q53A 2GFCA 4QTDA 3GC7A 4FIIA 3AT4A 2C5OA 4HCTA 1NY3A 2BAQA 3FXXA 4FKIA 4ZSJA 3UVQA 1VYZA 2ZOQA 1I44A 4I1ZA 2XK8A 4FG7A 4YMJA 5D12A 5C4LA 1YXTA 5CF4A 1PYXA 1CSNA 1XH4A 2PE0A 5I4NA 5FEEA 5KMJA 4HVIA 2AUHA 2BVAA 3ROCA 1IAJA 3F6XA 3LQ3A 3N51A 5CF5A 1PF8A 4BZOA 3TIYA 4CGAA 4IJPA 2GNJA 3EL7A 5JQ8A 4IZ7A 2QO7A 3FMMA 4XNEA 2WPAA 1Y8YA 3PPZA 2Q0BA 1YXVA 5AX9A 3LCSA 3G90X 1Y57A 5IQCA 4XP2A 3NUUA 4N70A 3RMFA 2O2UA 2PVYA 4GEOA 3CPCA 3ROYA 4Z16A 2YWVA 3QTSA 3T8OA 4X2NA 4S2ZA 3SHEA 2NRUA 3IW7A 2XK6A 5FWKK 4BCHA 1H1RA 4HGEA 5HTCA 5IA2A 3B2WA 5J1WA 4MAOA 2J0KA 3A7JA 4HJOA 2ITQA 2HXQA 1H1PA 2GNLA 4CV8A 1JAMA 3DJ7A 2X6EA 4ITJA 5M4CA 3EZRA 4EOIA 4O7ZA 4MYGA 1H28A 3SXRA 3DOGA 4PTEA 1Q4LA 2G01A 4HGLA 4GL9A 2WQEA 3NIEA 4E6AA 5C8NA 4BDBA 3EFWA 5AP0A 2EUFB 2JDOA 5CQUA 4AGWA 2YISA 5IUIA 4XH6A 1Q3WA 1ND4A 3IECA 4V05A 2R2PA 3LFQA 5EDPA 1H25A 4M14A 4U5JA 4IHPA 5AUXA 2VO3A 5CLPA 3DJ5A 4E7WA 3FLSA 3P9JA 2OGVA 4DBXA 5E90A 4H3BA 4L7FA 4Z3VA 2W1EA 3HL7A 2FSTX 2QOOA 5KMLA 3TG1A 3RI1A 5AV4A 3U8WA 1OM1A 3SGCA 1XHAA 2OFVA 5M57A 3QTZA 4V01A 3NUYA 1GOLA 4FV5A 4CYIA 3TZMA 3W2OA 3E5AA 4YHJA 5GIPE 2YERA 2I7QA 4DGLC 3TUCA 3D5WA 3FMEA 4HPUE 4YP8A 3CGFA 1JKTA 3PDTA 2P4IA 3UQGA 4C3PA 4FE2A 1PMEA 5JFVA 3GFEA 4EQCA 3RCJA 3PY0A 3VHKA 4L46A 4RIYB 4IM2A 2YDKA 2PE1A 2WMXA 4IWOA 1A06A 2PVMA 3SX9A 3TIZA 4YPSA 4RVMA 3VBXA 3MVHA 4IX5A 2ZV9A 4AW0A 5E92A 3SD0A 5ICPA 4U97A 3E7VA 4MXZA 4USDA 4JVGA 2CN5A 2X2KA 3SOCA 5HZNA 4F08A 2WOTA 1OL2A 5EYMA 3ORIA 4AZTA 1A48A 2YHVA 2EXCX 1YXSA 3A8XA 5J7HA 3P86A 1ZMUA 3RVGA 4UMQA 2QOBA 4GU9A 4D1XA 4I93A 2G15A 5DOSA 3FKOA 4I41A 4J97A 4A9TA 4MF0A 3E3BX 4DH8A 3P7AA 4MNEA 1PMVA 5TOZA 3MSSA 5ETAA 3UZPA 4LL0A 5DMZA 1P4FA 4O0RA 4EUUA 4GYGA 4II5A 4RFZA 5LVLA 3VRYA 2B0QA 3C51A 1ZYCA 2VTSA 4FVRA 4QYEA 4FYOA 3LAUA 4EK8A 4DFNA 1M2QA 4YJVA 2QU5A 3CC6A 5IISA 4JQ8A 2XNGA 4YBJA 2JFLA 3NSZA 2H9VA 4N0SA 4PTCA 4FNZA 1H24A 4I20A 3EN9A 1IA8A 2XRUA 4X3FC 2WNTA 3HP2A 1SMHA 4BGGA 5A54A 1JQHA 1TQIA 4MWHA 3EB0A 4GFGA 4YZ9A 4ZSGA 5CQWA 3WIGA 3V04A 5C01A 4CKJA 2PMNX 3P1AA 3O8UA 4I6HA 1GY3A 4MXXA 3AMYA 3PP1A 3C4CA 3R71A 4N6ZA 5FTQA 1NVSA 1R1WA 4K2RA 1RJBA 3QX4A 2X2LA 1JKSA 2W05A 2GU8A 2Z7LA 3CTHA 3H30A 5E8ZA 1XH6A 1LEZA 5CANA 4FMQA 5BUEA 4PMPA 2XZSA 5FM3A 4HVDA 4GYIA 2QONA 2HWPA 3LMGA 3N9XA 4L52A 3RPRA 4F63A 5AA8A 3B8RA 3DQXA 3OT8A 3NYVA 1WAKA 2F57A 3G51A 4GUEA 4BCKA 3E8CA 4CVAA 4R7BA 2GDOA 4WUNA 3TT0A 3HA8A 3JVRA 2OH4A 2WU6A 3IPHA 3NCGA 5LVOA 3S0OA 5EW3A 3WF9A 4QPMA 3QKLA 3V6SA 4DBNA 3SA0A 2UZVA 2VWBA 1XBBA 3SC1A 4F70A 2A2AA 4L68A 5L6PA 3U6HA 1M7NA 5AP4A 3L8SA 2PU8A 4AZEA 3GUBA 3KC3A 2Y7JA 3QWKA 2WTVA 3Q52A 4EHZA 1PKDA 2VWVA 3WZEA 4EZ7A 4LI5A 3LQ5A 4G6NA 1IR3A 3D7TA 4HNIA 4XRLA 5JKGA 1F5QA 3GQIA 1IAHA 3QCSA 4FKSA 3WZDA 3E87A 3QFVA 4IFCA 1UA2A 2OZOA 4C2WA 3DLSA 4DGOA 5JEBA 2UW3A 3Q9WA 5CYIA 2YM4A 3FJQE 4F09A 4YZCA 4X7QA 4PMTA 4H58A 4PP9A 4DT8A 2G9XA 4JQEA 4U80A 4V04A 2WAJA 2OU7A 5F9EA 4ZLZA 2QR8A 2YAKA 4L3LA 4E73A 5EH0A 4D55A 5IEVA 4IACA 3AQVA 3SDJA 4QYGA 4ALUA 4IVCA 4BFMA 4L3PA 4IVBA 5A3XA 4BWXA 1JSUA 5AR2A 5HNBA 5A4LA 1K3AA 2WXVA 3FI8A 3LE6A 5HX6A 3GNIB 3LOKA 2F7EE 5AUUA 3D2KA 2WHBA 2P0CA 4D9UA 3UNZA 1J7IA 4DEGA 1BL6A 3JUHA 4JDJA 4UXLA 5FXQA 5BVEA 4CLIA 4KUJA 2IZTA 3WF8A 3FMHA 3RM7A 5CI6A 3NNVA 1H08A 3UYTA 1XH5A 3KXNA 4JX7A 4MWIA 3AT2A 3G0EA 5CEMA 3MDYA 2OXYA 4H3PA 1ZWSA 2C1AA 2ZDUA 4RVLA 4YNEA 3ZDUA 1DI8A 4OTGA 3FZPA 4GKHA 4FBXA 4B8LA 3GI3A 1IA9A 5ANIA 4GRBA 5I9WA 2HIWA 3PXRA 5EHYA 4FOBA 2F9GA 4KIPA 3OFMA 1U54B 1OIQA 1UNHA 3FHRA 3R1QA 1H27A 2OXXA 3IW6A 2CDZA 1E1VA 4RGJA 3WBLA 3VBYA 3F2NA 5HKMA 4FIJA 4PUZA 2LAVA 4F9AA 2O8YA 4JT3A 2GTNA 3FE3A 1OKYA 3EQGA 3VNTA 4BR3A 4BY9E 3P7BA 3QTIA 3LXLA 2HZIA 3A99A 4MTAA 3F82A 1Z57A 3QA8A 2AC3A 3HMOA 3R7EA 4F6UA 4MHAA 4W4XA 4LGHA 1GIIA 4A4LA 3MI9A 4EH5A 1XJDA 1JKLA 3GFWA 3ZO3A 3O7LB 3O8PA 1YQJA 4I5PA 3IW4A 3EZVA 4ASXA 3OW4A 3OC1A 4RZVA 4TYHA 4CCBA 4O7VA 2B9HA 3TKUA 3A7HA 1GJOA 3PVWA 4HYIA 5IA0A 5E8UA 3QQGA 2R0UA 3FUPA 3ZZWA 2VTTA 4D2PA 3F7WA 3OROA 2CKQA 2XCKA 4DE4A 2WTKC 3GCUA 4FSRA 3OTUA 3PWDA 4IC8A 3WZUA 2BZJA 3ZXZA 3CKXA 4AS0A 2RG5A 2BZIB 1PMUA 2WKMA 2C4GA 3MJ2A 4RJ8A 4DH7A 3QZIA 5BUJA 4TY1A 3FQEA 5EQYA 2R3HA 3T9IA 4ZZOA 5HD7A 2C5XA 4CT2A 3U4WA 3OXTA 1FVTA 1H07A 4ZTSA 4HVGA 2ESMA 4E6DA 5DGZA 1UVRA 4G6LA 2QOQA 4IAAA 4RRVA 4ANSA 3EQFA 4PDYA 1OUKA 2YM6A 4P4CA 2O0UA 2WIPA 3BHTA 3L9MA 4D58A 3DKOA 4E93A 3U6JA 3IS5A 3KXHA 1H1QA 3I6UA 1OPLA 3SLSA 5DT4A 3C13A 4RIXB 3TEIA 4PL5A 4PP7A 5BVFA 4ZTHA 5CVGA 2JBOA 1KSWA 2RL5A 2VTOA 4FOCA 4QQ5A 4XLVA 4UXQA 3W2CA 2R3QA 3ORZA 3HX4A 3QD4A 4C4GA 4DYMA 4LRMA 5AP6A 4EORA 5JZJA 2BRGA 5DH3A 3I5ZA 3F5GA 5J79A 3RCDA 5KMNA 1YDSE 2JKMA 5HNGA 5CENA 3AMBA 4GKIA 2BIKB 5DPVA 4EZ3A 5DFPA 4EKKA 3KKVA 4LMUA 3GU4A 4J1RA 2YABA 3OG7A 3DCVA 3FY2A 4J7BA 4RFYA 5E4HA 4FA2A 2PZRA 5AUYA 4I23A 2EXEA 2JC6A 4GG7A 4BHZA 3UDBA 3QF9A 3V8TA 3VS3A 5KNJA 1H0WA 2WTIA 2UV2A 3ALOA 1FMOE 5H9BA 4D0XA 1Q99A 1OGUA 3KRLA 1ZRZA 3BQRA 4DH3A 5A6NA 4XUFA 3TZ8A 2W1DA 4G16A 3T3UA 5HD4A 2ZDTA 5KMOA 5J9YA 3KVXA 4XP3A 3FXZA 4ANLA 1PXLA 3R7GA 2OG8A 5DLSA 5F4NA 5CEQA 2GMXA 2XA4A 4HCUA 4E20A 3AOXA 3ZSIA 3FI4A 2IVVA 5HI2A 4HVSA 3I7BA 4BBMA 2IVUA 1CDKA 3FLYA 4UB7A 2J5EA 2BTRA 2CCIA 1XKKA 2BDWA 2C6TA 2Q0NA 4DCAA 3PE2A 3R73A 4IJ9A 1V0BA 4QMTA 3MY1A 4PMMA 3ORLA 5HLPA 5DWRA 4RIYA 4EOKA 3ZLWA 4ACMA 1LEWA 2GS2A 3VW6A
chains in the Genus database with same CATH superfamily
3I1AA 3KRRA 5ANOA 2W4KA 4MKCA 3VS1A 5CNNA 4F0GA 3W0SA 3P5KA 3O2MA 3AGMA 3PY3A 1AQ1A 3AD6A 4MD8E 4O4EA 1OKWA 2UW7A 3LLAA 5TR6A 4RX8A 3GB2A 4FZFB 3AT3A 4QP6A 4QRCA 1XH8A 1U5QA 4L44A 3E8DA 2FGIA 5LMKC 4I3ZA 4R1VA 5HG7A 4E1ZA 4Z7HA 3ZRMA 5DR2A 4BCNA 4DG2E 4GIIA 3H3CA 3EN4A 5CT0A 2WEIA 4NJDA 5JFSA 3VBVA 4DH1A 2C1BA 5AM7A 4ASDA 4BDEA 5HORA 4ZTRA 5EDQA 4DFYA 3U51A 3LJ1A 4FK6A 4BI0A 4RPVA 3Q60A 4DC2A 3WE4A 4DEAA 3LCTA 1WBVA 3Q9YA 3QX2A 3SAYA 4UZHA 2QI8A 4F4PA 3FPMA 3IOPA 4NEUA 2ETKA 3V01A 2J90A 3VJOA 4FKJA 3RALA 2R5TA 1MQ4A 3ZUVA 1LUFA 3IG7A 3BGZA 2XM8A 4PDSA 3MN3A 3QL8A 4TYEA 1QMZA 4ZK5A 4C34A 1AGWA 2ITWA 3ENMA 3HV4A 4BWPA 5EM6A 3W0PA 4FYNA 3PRFA 3QD2B 4TPTA 3A4PA 3UJGA 1ZY5A 4F9YA 4FGRA 4JXFA 3QTQA 4F65A 3TUDA 5BVKA 3BGQA 1W82A 5KZ0A 4XBRA 3W55A 3AXWA 3ORNA 2C69A 3A4OX 5FRIA 2ITUA 3WE8A 5J7BA 2SRCA 5DI1A 1Q3DA 5CSPA 2VZ6A 1UWJA 3AC3A 5TE0A 2EU9A 3RKBA 4Y85A 1SZMA 4FI1A 3MTFA 2IN6A 3LJ2A 3BHVA 4QTAA 2F7ZE 2CGVA 5AP3A 2A98A 4NIFB 4QMQA 5F20A 2BHHA 2P2HA 2CNUA 2HENA 4W8EA 1J1BA 1YI6A 4IX3A 3PXZA 3QALE 4BZDA 1V0PA 3KCFA 4CG8A 4ZOGA 3OBGA 4IVDA 5CNOA 4C02A 2XAOA 1MRYA 1UNGA 5HE3A 3NUNA 3S00A 3U9NA 3PPKA 4K33A 3UOHA 3BZ3A 5ETCA 2BPMA 4NCTC 2YCFA 3FKNA 3SQQA 3W2SA 1J3HA 4YSMA 4D4RA 5FTGA 3NYOA 1W98A 3F2AA 3AMAA 3O0GA 4RJ4A 5DNRA 1NW1A 3O51A 2YCRA 1PXPA 3HV3A 3KCKA 3VUTA 2QOHA 4AT4A 5A4TA 5BYYA 1A9UA 1URCA 3OW3A 4K77A 5ANDA 3CR0A 5H2UA 2YCSA 2V5QA 5JGDA 2YCQA 1OIRA 4F6WA 4UMTA 4ACHA 2PMLX 3LKMA 3LFNA 5J9LA 4TKSA 4I6LA 5J95A 4ZS0A 2HY0A 1HOWA 2VD5A 2X9EA 1TVOA 3BLRA 5HCZA 4DHJA 1OPKA 4P5QA 5L6WL 2JITA 4QP7A 1OKZA 2B52A 4BDCA 3PA3A 2C6DA 2VRXA 3BU5A 2ZFYA 3IDCA 2PZIA 4J8NA 4EHVA 4FV3A 4H1MA 2PMOX 3C0GA 4BDHA 3MIYA 2BRNA 5TT7A 4ZTNA 4AGCA 3ZRKA 4F6SA 1H01A 1ATPE 4LV8A 4XV2A 4ZSEA 4W9XA 2QG7A 1ZMWA 2Y0AA 4S30A 5EQPA 3BKBA 3GCQA 1SNUA 4G1WA 3NLBA 2RFEA 4FSQA 5M44A 3IQ7A 1JWHA 3PJ2A 3TV4A 4EOJA 3EFLA 4ZIMA 3RWQA 3I0OA 5CVFA 1XH7A 2IF8A 2O5KA 3VAPA 5IZFA 1NT2A 4IQ6A 5IEYA 2J6MA 4E5BA 3NGAA 5EM5A 4YZDA 5JFWA 2OWBA 3LPBA 2ZAZA 4MVFA 3FI2A 4AA0A 2WFYA 4BYIA 4DFBA 4I5CA 4FR4A 5AJQA 2FA2A 3COKA 3TN8A 4CFVA 4Y83A 2IZUA 4Y5QA 4K0YA 4M12A 4RX5A 4C57A 4OAUC 1Q41A 2VX0A 2XCHA 3E3PA 2GPHA 3VBQA 3MH1A 1U54A 3WF7A 4AU8A 3RGFA 2XALA 3ZTXA 4EUTA 3BIZA 4LV7A 4XS2A 5C8KA 4EOSA 5GZ8A 4YJNA 3FLWA 3HA6A 2YLFA 1APME 3PJ1A 3AD5A 4PRJA 4IADA 3LVPA 4GJ3A 4WBOA 4BI2A 2PVFA 4ENYA 3KXXA 2OXDA 3UO6A 1B6CB 1PXKA 4IC7A 5EHOA 3DA6A 4HVHA 5IMXA 5IA4A 4XG3A 5DIAA 4FSZA 2G1TA 3CY2A 3F3VA 5DEWA 3W2RA 2OIBA 3PZHA 4NKSA 4PWNA 4NM5A 1YI4A 3D83A 4YJTA 1OECA 4FV1A 5HTIA 4PX6A 4NZWB 4U81A 4I24A 4ZLYA 1XR1A 3U9CA 3V51A 1BL7A 3OCBA 5GNKA 4AACA 3HLLA 4AGDA 3KA0A 4FG9A 5LCJA 1PW2A 1WBPA 2E9NA 4NFNA 3MTLA 3PRIA 4OT5A 5ETFA 4CQEA 4L43A 4QP9A 2XUUA 5I9YA 4YO4A 2B9JA 4S32A 4IB3A 3TCPA 5KUPA 4DT9A 1H26A 1PHKA 1YWVA 3JPVA 4FKTA 5K5XA 3EOCA 2Y4IC 3O50A 4FTIA 2QLUA 2QURA 1JSTA 3CIKA 3OCTA 4QP3A 1J7LA 5DYJA 5CEOA 4PNIA 3HRBA 5HE0A 1ZOHA 4GT4A 3LJ0A 2XB7A 5AP1A 1M2PA 4F1TA 2CMWA 4ITIA 3QUPA 3R1NA 4I94A 3R9DA 3GQLA 2C47A 5L6OA 4FT3A 5HVJA 3S1HA 3DDPA 3DXNA 4WO5A 4ZSAA 4DH5A 4XHKB 2QHNA 4WT6A 3EQBA 4B0GA 1YVJA 4XBUA 4AOJA 4CFNA 4ANMA 2YJRA 5CF8A 5K4JA 4RC2A 2JIIA 4C38A 4KABA 4EK4A 4RIXA 3V5TA 3VS7A 2ERZE 4FKOA 2KULA 2WEVA 4FSYA 4PF4A 3IDPA 2PPQA 1G3NA 1UU9A 2JEDA 3ZM4A 1CTPE 2ZB0A 1K2PA 3PZEA 5AV0A 4BDDA 4O1OA 4EWQA 5I9UA 3R8ZA 4YR8A 4RVTA 4C4IA 3MA3A 5B2KA 4JAJA 1Z9XA 3QXOA 4U41A 1VYWA 3NFFB 3KXMA 4O7SA 3BHYA 1R78A 4W8DA 3HP5A 4NK9A 5I9ZA 3R7VA 5KKRC 4DGGA 3V5QA 4F9WA 4MUQA 5EG3A 4OTHA 3DV3A 5JGAA 4N57A 2R3IA 4NW6A 2GS7A 3HZTA 3M11A 3Q5ZA 4F1MA 4LRKA 1ZARA 3RTPA 5JZNA 3MPAA 5HTBA 4USFA 1FVVA 2WTKB 3Q96A 4N4SA 4FKPA 5CASA 3ZUUA 5CAQA 2FB8A 3PLSA 4YLLA 5FD2A 3DZOA 3BLQA 2R3OA 2X8IA 1UWHA 3BU3A 3F5UA 3QZGA 4JG7A 4PNKA 4O7TA 4LQMA 5DA3A 5L8JA 4IX6A 5H8BA 5ANGA 2ZV2A 3C0IA 1H1WA 4C4EA 5FDPA 4A9YA 3A62A 3VWAA 4BB4A 2E9VA 4ZAUA 3EQIA 4PPCA 1XO2B 2WIHA 4I5MA 3ANQA 3F5PA 5ETIA 3W32A 3PSBA 1UKIA 4TTHB 1DAYA 3NUSA 4U40A 4WSYA 4FT7A 5F94A 4BN1A 4CXAA 2I0EA 3FL4A 3PG1A 3QTUA 4LMNA 2C6EA 1H4LA 4NTSA 3UDSA 4S31A 4O0SA 4RC4A 3ZO4A 3MVLA 3CJFA 1WMKA 3DS6A 3PVUA 4IAYA 5CTPA 4C3FA 4KSQA 1J1CA 2GSFA 4EK3A 4KNBA 2X0OA 2QLQA 3QLFA 4JG8A 4B8MA 4LRJA 1NVQA 3SRVB 3E8NA 3NUPA 2ITXA 4AP7A 4DHFA 2C6KA 3BRBA 5IQAA 4CFXA 3R1YA 1P4OA 5AAFA 1G8JA 1OZ1A 2W96B 3DFCB 3CPBA 5HGIA 1G5SA 1W2FA 3MY0A 3O17A 4B9DA 2QC6A 3QU0A 3ZLSA 5CY3A 3FZRA 2VTIA 2X39A 4XLIA 4AF3A 2UUEA 4CFFA 5A46A 4R8QA 3QUEA 3R2YA 3ZBFA 2F4JA 3KRXA 5ACKA 3EN7A 4ANNA 3C4WA 3KRWA 3PY1A 3FLQA 3N4VA 3KFAA 2OJJA 4LOOA 5D41A 3A61A 4FGBA 5JH6A 4L7SA 2VGPA 5CEPA 2AYPA 4KBKA 3WI6A 3N4UA 1XWSA 3D15A 1P5EA 3NCZA 3RHKA 2Y9QA 3F9NA 2QD9A 4OBQA 4M69B 4CMOA 4CZTA 5EFQA 5HE2A 5EOLA 2Y6MA 3BYOA 3ZOSA 4QDVA 4YHFA 3UTOA 4L9IA 3LFSA 4FV9A 3BHUA 3FSFA 1PKGA 5FP5A 3MWUA 3SW4A 2J51A 3A60A 3G0FA 3EQHA 4FEQA 4MX9A 5KMKA 4LG4A 5AMNA 3NWWA 4XRJA 4IAIA 2HY81 3MGYA 4BDJA 3PXQA 3SVVA 2C6LA 5L4QA 3BI6A 4O4FA 3N4TA 3HGKA 1BYGA 2PMIA 5AEPA 2I1MA 4J96A 3CD8A 2ONLC 2ITZA 4BIEA 4FTAA 3QKMA 4G3EA 4YZMA 1LPUA 1FQ1B 3VUMA 3GVUA 1DAWA 2OH0E 3KN5A 3FBVA 4L45A 4UWBA 5IDPA 2X2MA 3TM0A 4AOIA 2ZYBA 3OT3A 3GU7A 2C0IA 5TKDA 3BBTB 3IW5A 3R63A 5FXSA 3RK5A 5EYCA 4BWKA 4G3FA 3CGOA 3D5UA 4I0TA 4O2ZA 4FEXA 4XP0A 1PJKA 4C36A 4NIFA 3S95A 2YN8A 4O1PA 3VS6A 1UNLA 4CKIA 4J53A 2C6MA 3AD4A 3WF6A 4P2KA 4XMOA 4D2VA 4EKLA 5HESA 5IMEA 3ZCLA 2UW8A 3U55A 4FKRA 1GZKA 3DBEA 3BV2A 3H9FA 3M42A 5KBRA 4U79A 2A4LA 3UPXA 5GJDA 4EZ5A 5IQEA 3EHAA 4HZSA 4L67A 2EVAA 2RSVA 3FZSA 4YNOA 5IUHA 2ZMDA 4KBAA 3W18A 3OBJA 4Y72A 3AC4A 3PIXA 4FTJA 4G3GA 5IQDA 3KN6A 4UYNA 3PUFC 4O0XA 5FM2A 2YM3A 5HVYA 5AM6A 4Q2AA 3BWFA 5CEIA 2WMSA 3FV8A 3H9OA 3PYYA 4O4CA 4RFMA 4CFWA 4DFZE 2JIUA 5K3YA 4E6QA 5EYDA 3TNIA 3EYHA 3QRUA 4FTKA 1OBDA 3Q4CA 1QCFA 2J0JA 2GNFA 4QMZA 3EFJA 4S33A 4V0GB 5HIDA 1QPEA 2R3RA 4FT9A 3F88A 4G17A 1PMNA 3Q4UA 4DA5A 3ACKA 3BHHA 3C4FA 4OTPA 5AAEA 3TTJA 3EL8A 3VBTA 3FMLA 3RAHA 1X8BA 3DY7A 4OTDA 5AV2A 3ACJA 4MBJA 2WQBA 2WO6A 4QD6A 2C5YA 4RMZA 3ZC5A 2I40A 1OL6A 2PVLA 3F7ZA 3HVCA 3MIAA 3C5UA 3C4XA 4HPTE 4ZP5A 4ZXTA 3R83A 4D2WA 4DG3E 5JN2A 1NVRA 1OMWA 2E2BA 3ERKA 2NPQA 4BKZA 2XK7A 4O0UA 3ZONA 4JOAA 4QPSA 3CS9A 3VS4A 4DEDA 4AA5A 4AE6A 3MY5A 2X8EA 5FEDA 3R9RA 2J0LA 3TZ7A 2XP2A 5CU0A 1QPCA 3CXWA 3QQFA 3RAKA 3W10A 3ZFYA 1OUYA 4YUQA 5IH6A 4M97A 4NM3A 5CSWA 4PY1A 2B7AA 3RNIA 1ST0A 4W9WA 4D1SA 2UZEA 5DVRA 5M4IA 4F1OA 4UMUA 5T68A 4CTCA 3F66A 4FUXA 4FL3A 3MV5A 3GCPA 2BDFA 5GZ9A 4DN5A 5HIEA 2C0TA 4FIHA 4IE9A 4Y46A 2IZRA 4BGHA 4B7TA 5E8VA 4QMYA 3TKHA 3D2IA 3QCQA 4QNAA 4JRVA 2IVTA 2DS1A 2UW0A 4IAKA 4JBOA 5CSXA 3LFCA 4C37A 5BV3A 5BUIA 2J2IB 3TWJA 3D4QA 4UX9A 2WU7A 5EM8A 3LMIA 2Z2WA 3DK3A 1JPAA 3KULB 4YO6A 5A4QA 1F3MC 1OIUA 5BPYA 2VUWA 4QQJA 3JXWA 2IG7A 3CQUA 4C35A 1VZOA 2ETRA 4NL0A 1WBSA 4FNWA 4O0VA 1CKIA 5CX9A 4EH3A 4AXFA 4CD0A 3COHA 2JFMA 3GBZA 2J0MB 4WG4A 4UMRA 2FSOX 2ZMCA 2PUPA 5L2IA 3BLAA 3CE3A 4R5YA 3LFAA 4LGGA 2W1HA 3IKAA 4JAIA 4IM0A 2GNGA 3FZ1A 4QMLA 5L3AA 1R3CA 2G2FA 2P55A 3WILA 4YC3A 2ZV7A 4ALVA 1FPUA 2XYUA 4JI9A 4J52A 5DR6A 2VV9A 3ZBXA 4BCQA 3BYMA 4L53A 4QP1A 3TI1A 4U0IA 4CZUA 3UZTA 4MK0A 3U6IA 1BLXA 1R0PA 4IX4A 3RPSA 2GTMA 5LWMA 4DDGA 4ZJJA 1O6LA 2VNWA 3COIA 5M51A 3KF4A 4EOPA 3F2RA 2ITYA 2OZAB 4HNFA 5CS6A 5HHWA 4MXYA 3GOKA 5CWZA 1ZY4A 2HZNA 1OPJA 4EK5A 5DT0A 4BZNA 1YW2A 3NX8A 4O7LA 5CZHA 2BILB 2VTAA 4X3JA 1RW8A 2ZM4A 3BELA 4FSNA 4FZAB 4MQ1A 3W2QA 2GS6A 2VX1A 2QU6A 2RIOA 3ODYX 4JJRA 3OOMA 5CSVA 4O0WA 5CAOA 2Z7RA 1P2AA 2HAKA 5DRBA 4A4OA 4F7NA 2UW4A 3ZO1A 1URWA 2R3GA 5AV1A 2BALA 3EYGA 4KSPA 4M15A 3U4UA 4QMMA 4IWDA 2FO0A 3TJDA 2CJMA 2CPKE 2Z60A 4BDKA 3I79A 3GGFA 3DXPA 4QYHA 2WELA 4GVAA 3CJGA 3F3WA 2OF2A 4QP4A 4M7IA 5CAUA 1MUOA 2R3FA 3QTRA 1SNXA 3HV7A 3UO5A 5IQGA 4CYJA 3JYAA 1XQZA 4E5AX 5EM7A 2FYSA 4KRCA 3IONA 2XBAA 4BCPA 3NW7A 3FMJA 1WVWA 3Q2JA 4GVJA 3PJ3A 2XNBA 3NAYA 5A14A 3UIUA 4AT5A 4BKYA 4I92A 4O0YA 4PMSA 3OVVA 2B9IA 3PSDA 4BCMA 4TZRA 2DQ7X 2UZNA 2XKCA 4L3JA 4YJUA 1HCKA 4YLKA 4H3QA 4UZDA 3FQHA 3E63A 2BKZA 5LWNA 3AKKA 1YOMA 4RWJA 3HNGA 5I0BA 1U5RA 2REIA 4RC3A 4X2GA 4OUCA 2V0DA 3NAXA 3NVKI 2XK9A 3DBQA 4U3YA 3FWQA 4AXAA 3COMA 4NKAA 4UEUA 3FYJX 2PVRA 4AZVA 4Z9LA 3ZH8A 3U54A 5C03A 3QCXA 4O7RA 3HMPA 2XJ2A 2Y4IB 3ORPA 1ZYLA 1VLRA 4IWQA 3R21A 2HOGA 3ANRA 4FTLA 5GZAA 4EBVA 4I6BA 3U87A 3OCGA 4AN9A 5EQEA 5EK7A 3R7OA 5AP7A 3QQLA 4B6LA 3F69A 5A4EA 3KF7A 4XG4A 4OT6A 4D2RA 3Q6WA 4HOKA 2W5BA 2I0VA 2W1FA 5JRQA 2YM5A 3GU8A 3LXNA 3B2TA 3OEFX 5GHVA 1SYKA 4GFMA 4FSUA 2WMRA 5FEQA 4EJ7A 3IGOA 3VVHA 4XG8A 4BGQA 4LDTA 1ZYJA 5IQFA 4RWLA 3R8PA 3UZRA 3BL9A 5KZIA 4F7LA 4L6QA 1TQMA 1XBAA 4M66A 1F0QA 5TO8A 3MPTA 3WZJA 2X0GA 2CLQA 1R39A 3SRVA 5IQIA 2UZBA 5IUGA 4F9CA 4U45A 1OKVA 4FSMA 4NU1A 3OZ6A 4FKVA 3G5DA 4OBPA 5CU3A 5E8XA 3ALNA 4YJSA 3R8UA 1G8AA 4E8AA 5AR3A 3R8VA 2A27A 3PXKA 1YXXA 1YHWA 2CGUA 2ITVA 3GU6A 4LM5A 5HU3A 4R77A 2FSMX 2R64A 3GT8A 5BVWA 5KKRB 2GNIA 3NRMA 4D4VA 3BE9A 4DCEA 2UW9A 1JBPE 5HICA 3BL7A 4X2KA 3QHWA 4IXPA 5CU4A 3CLYA 3D9VA 3PG3A 5A6OA 3NNUA 4DTKA 2J50A 4IVAA 5JRSA 3NMUF 4RT7A 2XVDA 3M2WA 2GQSA 5GINE 4BDAA 4O4DA 3PSCA 3LZBA 4FTCA 4M69A 3E7OA 4MD7E 4NUSA 2CLXA 4RX9A 3QTWA 4I4FA 1XH9A 2KTYA 4RVKA 3D5XA 4IANA 4ASEA 5AR7A 2BRBA 5M06A 2VTLA 1SVEA 3W1FA 2E9PA 2WMTA 3CP9A 3H9RA 2VTJA 3KB7A 4GW8A 5J5TA 4FTMA 4FT5A 1KV1A 4UWYA 4Y8DA 4UBAA 4E26A 3I81A 3KQ7A 4ANOA 4DEIA 2YDJA 5E1EA 4CKRA 3RWPA 2OSCA 4FC0A 2PHKA 4APPA 4ZS4A 3FC2A 4NH1A 3O71A 3V5WA 4MXCA 4PV0A 5KCVA 3QCYA 3RINA 4NYEA 2NP8A 5AUWA 2XNOA 2QOKA 3MA6A 3MFUA 3QQHA 4CMUA 3DK6A 4HGSA 5E8SA 3LM0A 2BZHB 2R3KA 3TACA 3IDBA 3ODZX 3EFKA 4PTGA 5DE2A 3UOLA 4U8ZA 2VX3A 3POZA 2ITOA 4F64A 4AWIA 4ERWA 2HZ4A 3FMDA 5CSHA 1BMKA 3RM6A 4NJ3A 3R02A 2VGOA 4G5JA 4C59A 2J9MA 2PVKA 5L2SA 5LMKA 2QNJA 5BNJA 4KS7A 5BYZA 3HYHA 2R7IA 3QD3A 5GJFA 3PIYA 2JDTA 4YU2A 5E9EA 5D11A 5AR8A 4S34A 4KS8A 4LUDA 1L8TA 2R3PA 4BIDA 4I6QA 3QGWA 2EB3A 3KK9A 1YHVA 5C8MA 4KD1A 4Q9SA 4FT0A 4R7HA 3KMMA 5CXHA 3KXZA 2XRWA 4UALA 1R0EA 1SM2A 3QZHA 1J7UA 2JIVA 2HK5A 3DFAA 3O8TA 4DEEA 3SG8A 3DKFA 3R0TA 4V0GA 4CG9A 3FSKA 4PL4A 4Y5HA 5C4KA 2BCJA 1KE5A 2R0IA 2ZM1A 4JR7A 2VO7A 1B39A 5KE0A 5CT7A 4JBPA 1ZYSA 4IZ5A 1DI9A 3TV7A 4O82A 1UV5A 3QLGA 5H3QA 2IWIA 2Z02A 5CZIA 2QQ7A 3TNHA 3OWLA 4JG6A 2W5HA 4WNPA 2JKQA 2VTMA 4WIHA 4EH6A 1OGYA 2EB2A 4GMYA 2UZTA 5IPJA 4QP2A 5AP5A 2B4SB 4XG7A 4DEBA 4CQGA 3LIJA 3UP2A 3C0HA 2X0PA 4IEBA 3PWYA 2ZVAA 3NIZA 1KWPA 4RZWA 3GOPA 4FKGA 4IZYA 4QQCA 2OBJA 4TYGA 4EYJA 4MF1A 5K4IA 3UQFA 3JR1A 4XV9A 1I09A 2QG5A 4K8AA 2QKRA 4WOVA 5FG8A 4E4LA 3AG9A 4FUYA 5ANEA 4QYYA 2UZDA 4AXDA 4YZBA 3EN6A 5AIKA 1UKHA 3IGGA 2WTCA 3ZEPA 4F9BA 4TYJA 4X3FB 1RDQE 4X0MA 2BAJA 5E8TA 3CBLA 3PFQA 3QKKA 3UBDA 3NDMA 3WZKA 5CAPA 5AWMA 5HBJA 4FVPA 3LXKA 1BI8A 3L8PA 3NR9A 4L01A 4OTFA 2OJGA 3G9LX 5KBQA 3ATSA 1O9UA 4MEDA 4MXAA 4O2PA 4A7CA 3T3VA 1E1XA 2JDSA 3JVSA 1Q24A 4YSJA 4Q5EA 3HEGA 1V0OA 3W8LA 5KMMA 3PA5A 4AE9A 2J7TA 2JDRA 4I4EA 4FG8A 4FZ7A 4FEVA 1O6KA 4JR3A 4XG6A 4I0SA 4BVUA 4D9TA 2WMQA 5AX3A 1YOJA 1VR2A 4QT1A 1KOBA 4XCUA 4ACGA 3K54A 1G8SA 1GNGA 3P79A 4LOPA 3UNKA 4WD5A 4BL1A 1KE9A 2PVHA 2V7OA 3ZHPC 4X6RA 1GZNA 4CT1A 1O6YA 2G2HA 2YM8A 3KULA 4TNBA 5AUTA 2OJFE 3HMIA 3QQKA 4EH9A 4Q9ZA 2B1PA 2W1CA 2Q83A 3LM5A 3R8MA 2XIZA 4J99A 3TNPC 1BUHA 3VQUA 5AAGA 2JDVA 5EHLA 5D9HA 2QO9A 3RAIA 3KREA 3QQUA 2PVJA 3KVWA 5HX8A 2PZPA 5HG5A 2JKOA 2IEWA 3BQCA 5J5SA 3GC8A 4TL0A 4YC8A 3GEQA 4HGTA 2RFDA 4WNKA 4EC9A 4EONA 1NA7A 2CNVA 2YLEA 4JDKA 4F7JA 2WD1A 2PSQA 3OP5A 4OTQA 3OMVA 3TNWA 4FJVA 3I0QA 5IA1A 5HO6A 4BBEA 3ZO2A 3G33A 4BTMA 1BI7A 2YZAA 5FQDC 2UZUE 4KIQA 4E6CA 2JLDA 4I6FA 2A1AB 4JDIA 4TXCA 5CI7A 4YGAA 4BDGA 2W17A 2OZAA 3GC0A 2XNPA 5AR4A 2IW8A 2UZWE 3SXSA 4E5WA 5B2LA 4GG5A 3JS2A 4AQCA 1RE8A 4ZSLA 3IO7A 4O96A 4I22A 2WQMA 2C3JA 5AV3A 4GS6A 5KO1A 3ATTA 2FH9A 3E93A 4FV6A 4CZYB 4QQTA 4R3RA 4WBBB 5E8WA 4ANBA 3TKIA 4O6LA 3RPYA 4KIOA 3ZC6A 4RSSA 4A9SA 2AEGA 4MBLA 4ZMEA 4GJ2A 1Q8WA 3QQJA 3BV3A 4U9AA 4FTQA 3M1SA 4KA3A 2ERKA 3G6HA 4QOXA 3ZEWA 4E3CA 2OIDA 3MH0A 2P2IA 3RNYA 3LCKA 1YRPA 3BLHA 1JLUE 4QMWA 4L00A 4K9YA 5I5ZA 3GP0A 5AADA 2ACXA 4WG3A 2PUIA 3NW5A 4FRFA 5KHWA 3FC1X 3VHEA 4LL5A 4YTFA 4JQ7A 2H96A 3R7IA 3D5VA 1JVPP 1W84A 1JKKA 1XBCA 4G3CA 4L42A 1PYEA 3FY0A 4IWPA 5LMBA 3F3UA 2X4ZA 3Q3BA 2HW6A 4MBIA 1MQBA 2PK9A 2QHMA 3D0EA 5EI8A 4BCGA 4EC8A 4AXCA 3JY0A 3LFEA 3ZFMA 3Q2MA 3O96A 3SOAA 3F3ZA 3CKWA 1MRVA 4KKEA 3K3IA 4RJ6A 1BX6A 4ZJVA 5IG1A 4RX7A 4AFEA 4O7YA 5KX8A 2OICA 4OBOA 4WSQA 3CQEA 3LFFA 4A06A 4KKHA 2CN8A 3GU5A 4KAOA 2CSNA 5M53A 4JNWA 3QUDA 4FV8A 2I0YA 3UOJA 3W0QA 5KMIA 1VJYA 2GCDA 2ZV8A 2QOCA 4O21A 2I6LA 4HCVA 4P90A 4E4NA 3QYWA 4ITHA 4U6RA 5L2QA 4D0WA 4TNDA 4YTIA 4FIEA 4EHGA 2IW6A 4W4WA 3W16A 1W0XC 2NNWB 5EKOA 4F0FA 4EBWA 4D1ZA 3QBNA 2Z7SA 4YZNA 1K9AA 3I60A 3VJNA 3TNQB 3PPJA 2BRHA 3BWJA 3I5NA 3II5A 4ARKA 5IU2A 3PTGA 3R30A 2WTWA 5H8EA 3F5XA 2VN9A 4WRGA 3PVGA 2F2CB 4TWNA 4X2FA 4B99A 3DKGA 4BTFA 4C58A 4O91A 1LP4A 5BVDA 2XIXA 4BRXA 3ORMA 3FDNA 3QAME 4DAWA 4ZZMA 2XJ0A 4ASZA 2UVYA 4QTBA 4FTNA 3EQRA 3R8LA 4DFLA 3R01A 2JD5A 4ACCA 4Q5HA 3LHJA 3BBWA 3A8WA 2WTJA 2FSLX 4FODA 2QODA 3S3IA 4D4YA 4IMYA 5ACBC 2HELA 2CKOA 2GHMA 3P5JC 1ZMVA 3MB7A 3BX5A 2X81A 2GHGA 1PXOA 3BGPA 3I6WA 2BKKA 3QRJA 4FNXA 3UIMA 2XNEA 3VC4A 3ZDIA 4PL3A 3D14A 4BICA 3EQCA 3Q9ZA 3IOKA 3OD6X 4QNYA 3DAKA 1WZYA 2C5VA 5BMMA 2HW7A 4WRSA 1Q8ZA 3ITZA 3ELJA 3P4KA 4UWCA 4AW5A 1S9JA 3CQWA 2YWPA 3E8EA 4C4JA 4LFIA 4I0RA 3OXZA 2AC5A 4YTHA 3FEGA 2GQRA 4AXEA 2V62A 2VWYA 4ORKA 1SVHA 3W8QA 4QMSA 4RIWB 2PULA 2DWBA 2W5AA 3L9LA 3VS2A 3UC4A 3HRCA 3L1SA 3NNWA 3P0MA 4XYFA 4TWCA 2X0QA 4IAFA 5CF6A 5HU9A 4XX9A 4F99A 2ZM3A 3NUAA 4RBLA 5F1ZA 5FGKA 3I4BA 2R3MA 4O27B 4FTTA 4FZDB