3A7IA

Human mst3 kinase in complex with adenine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
287
structure length
286
Chain Sequence
MQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine kinase 24 (STE20 homolog, yeast)
publication title Structures of human MST3 kinase in complex with adenine, ADP and Mn2+.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3a7iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3a7iA01
1XBAA 2NP8A 4AS0A 5LVNA 3I6WA 1PXOA 3RAWA 3TTJA 3NGAA 5EI8A 5CASA 5GZ8A 3UNKA 3SGCA 1OGUA 2F2UA 3FE3A 4CD0A 2IG7A 1KWPA 5CY3A 3KVWA 4QMWA 2UZWE 2PK9A 5CZIA 1U46A 1QPCA 2GQGA 3P7AA 4QP6A 1WBPA 3Q4ZA 4FTUA 5CENA 4C4FA 2OIQA 5B7VA 5ITAA 3EQGA 2UW0A 3R1NA 4XG4A 3O8TA 3TZMA 3AD5A 4FV2A 4JR3A 2QD9A 3DTWA 3HKOA 2F7ZE 4N0SA 4YZBA 4ARKA 1IASA 3AT2A 3PA5A 3CY3A 3OTUA 4FT9A 4FA2A 3P0MA 5E8VA 2RFDA 2VWVA 1M52A 3LXPA 2YM3A 1KE5A 4FI1A 2YZLA 4IWPA 3LFSA 3HV5A 2JBOA 2VTPA 3P86A 4RLKA 5HIDA 4CLJA 2ZM3A 4LG4A 4M97A 1CDKA 3OUKA 4RX8A 4U44A 3RK7A 4C3RA 4ZTQA 5L2SA 3Q6UA 4E3CA 5JEBA 3RBWA 1ZWSA 4TYIA 2X8EA 4FMQA 2VTOA 4U3YA 4ANOA 1Q8TA 2VTHA 1DAYA 2X4ZA 4IVAA 4B6LA 1NVRA 4CFXA 4L42A 4PMTA 1T46A 3TV6A 2ZYBA 4J99A 5GIOE 3CKWA 4FKTA 4G5JA 1WCCA 4TYJA 4RFYA 4FODA 2QR7A 4WA9A 4LV5A 3NLBA 4OTWA 3A62A 3MFTA 4WOVA 3E87A 4ZS0A 5TT7A 3I5NA 3EJ1A 4F7LA 3M11A 4U43A 4EOOA 5L2IA 4AUAA 3V01A 5M53A 4P5QA 4BBFA 1S9JA 2O8YA 2X2MA 2LGCA 3E88A 3N4TA 4G6LA 4J95A 4EEVA 3ROYA 3IGOA 5A4LA 2JEDA 3QCYA 5CSXA 3AT3A 4A07A 3TTIA 2O63A 3IONA 1WMKA 4MVFA 1JLUE 4ALVA 4YSJA 3TV7A 2JIIA 3PPZA 4CZTA 5CS6A 4FIFA 4F4PA 4WG3A 4ASZA 4HYHA 4UEUA 2WOTA 2GNLA 2BAKA 2J5FA 2R3LA 5HLPA 3BWFA 1Q8YA 3HV6A 4JLCA 2CMWA 1GZKA 4U40A 4OTPA 2VGOA 5EKOA 3IQ7A 3R7EA 3BGQA 5HG9A 2ZB0A 3QTQA 3ZRLA 5CU0A 4DF3A 3KULA 4DCEA 2V62A 4GT3A 4M84A 4EOMA 1IRKA 2XK3A 3C13A 4FYNA 2C5NA 2R3MA 2VNWA 3LJ1A 1CKPA 3PSCA 1XH9A 3FXZA 4LV8A 3UIXA 3CKXA 3BZ3A 1CTPE 3NW6A 4P5ZA 1V0BA 3W10A 1K2PA 4DFZE 2A4LA 1XO2B 3BE2A 4MF1A 3RNIA 4DGNA 3ALNA 3BCEA 2PZRA 2HW6A 3WBLA 3QQHA 4I0TA 4FOBA 5DNRA 5GINE 2V5QA 3SC1A 3OD6X 1G8AA 4EQCA 2CGXA 3AT4A 2ITPA 4JOAA 4MEDA 4O86A 5KKRB 3LFEA 1Q99A 2QOOA 2Y6MA 2Z8CA 4ERWA 5JFSA 2W1DA 4DGGA 4E73A 2QOBA 5CT7A 3PJ8A 3ZH8A 4ZLYA 4O7VA 2OKRA 4IZ5A 5FWKK 3RZFA 4B0GA 3UO5A 3GC8A 2WMBA 4H3BA 3V5WA 5E8WA 2W1GA 4XG7A 4J1RA 4TYEA 4EH6A 1H28A 3OW3A 3A8XA 5DR2A 4L3JA 4XP2A 3EL7A 5HESA 2WD1A 3RM7A 1U54B 2ITNA 3SOCA 5K5NA 4E4NA 4YO4A 3FHIA 3POOA 4M69B 5HG5A 5LMKA 4FSRA 4L7SA 4IADA 4QMUA 5KNJA 3SAYA 3COKA 4MHAA 2PZIA 3EL8A 4IVDA 1PXPA 5CYIA 5A46A 3CQWA 4CFNA 5DRDA 3FDNA 2XK4A 5BUJA 4D4VA 4ZZNA 3FBVA 2X7GA 3HECA 4OTGA 2B54A 4EZ7A 3Q9WA 4NTTA 3GU7A 4O0YA 2QOIA 3C7QA 5ANKA 4F9BA 4W8DA 5G6VA 4ERKA 3HAVA 3DV3A 3F3ZA 2J90A 3H9RA 3I5ZA 4KRDA 4YJNA 4ZTRA 2CNQA 4A4LA 4FTAA 4R8QA 4RZVA 4DAWA 4BDIA 1Y6BA 3LM5A 3QTIA 3KMWA 2X9EA 4ITIA 4XG2A 4BDCA 4QMOA 1PXLA 5DEYA 1SMHA 4U81A 3ZBFA 4CFMA 4FE2A 4DLJA 5M56A 3G90X 3CIKA 3O2MA 3QF9A 3OWJA 2B9FA 1O6YA 3WYXA 1FGKA 3SV0A 4C61A 3PG1A 4GFOA 2PTKA 5C01A 3PG3A 1ZXEA 4YC6A 5I4NA 4GIIA 3CE3A 1QPJA 5KBQA 4HNFA 3PJ1A 4MQ2A 3SA0A 4Y8DA 4FEUA 3LMHA 5A4TA 3K2LA 4TXCA 4NJ3A 4ANNA 3IK3A 3UG2A 4DC2A 4FTLA 2PE1A 3EQCA 3AGMA 2R7IA 3GCQA 2QOQA 5D7AA 5L3AA 4O7TA 1KOAA 2EXEA 4LGGA 5AAEA 2C30A 4XNEA 1K9AA 3N4VA 5M55A 3NIEA 4IW0A 1RJBA 3HMNA 2CSNA 4GT5A 4RQVA 3MFSA 1DAWA 3QTRA 4BN1A 4CTBA 1U54A 4AG8A 3LJ0A 4FT5A 4G9CA 5BVOA 4HYSA 3P08A 4KAOA 4QMSA 2XIYA 2C6KA 2R0IA 4XRLA 4BBMA 4U0IA 4W4VA 3C4CA 4O38A 3VS4A 3U4UA 4DYMA 3S00A 4BCPA 4UXLA 4PF4A 4FV8A 1J91A 3HP5A 4O0RA 4X2GA 4ZAUA 2JDTA 1UNHA 3ZSIA 1Q8UA 5IEXA 3ID6C 2RFSA 4CTCA 5HG8A 1M7QA 2OFVA 2V22A 3ZRMA 3R2YA 4IQ6A 3ZEPA 3FC1X 5C4LA 4ZLOA 4BCKA 4EZ5A 2YLFA 2W99B 3RP9A 5K0KA 3AC3A 3ZHPC 3ZOSA 2C0TA 2QHMA 4K8AA 5KMIA 2B52A 3HMIA 2G2IA 2GNFA 2WQMA 3NUUA 3SQQA 2XP2A 3JR1A 4FTKA 3DNEA 3EQPA 4MD9E 4D9TA 4FV4A 1GIJA 3ORZA 4V0GA 5EYKA 2BRMA 2VWZA 5I3OA 2ETMA 4ZP5A 4D4RA 5M57A 3VS6A 3QHRA 2XNMA 2GU8A 1PY5A 3OWLA 3LQ3A 3L9NA 3WF6A 2WOUA 2PY3A 3CQUA 2ETKA 3N9XA 5AUYA 3RHXA 2XJ1A 4DA5A 3NX8A 3UMWA 4YUQA 1OIRA 1U59A 3TDWA 2O5KA 2UW6A 4DG3E 5A6OA 2GPHA 3E8DA 3DQWA 5AV3A 4QMYA 2GNHA 5C9CA 4FTCA 2QOFA 3RPSA 3A99A 4IX6A 4AU8A 5J79A 3TJDA 5AIKA 3G15A 4C36A 3KY2A 4AOIA 1UWJA 4LRJA 4I20A 4DEBA 5IZFA 5C1QB 4O2ZA 2I1MA 2OSCA 4NM5A 3VAPA 5KX8A 3A7JA 3QXPA 2OWBA 4QTDA 3PJ3A 5DPVA 1ZOEA 2GNJA 4K2RA 4L67A 2A0CX 1PMUA 2YLEA 3WF8A 3NYNA 4CG9A 5IUIA 3UQGA 4FSMA 4RVKA 3QYWA 4UZDA 3EH9A 1OL7A 3FQHA 4GK3A 4O21A 3NUPA 2OGVA 3R8VA 3C0HA 4K18A 3NNUA 3H10A 3UJGA 4OTDA 3FI4A 4FTQA 4DINA 1OKWA 5JMSA 2ZV9A 1JSTA 2PMIA 4MXZA 2F57A 3PA3A 5JGAA 3R9HA 1BI8A 5KZIA 3G2FA 4M13A 2VD5A 4TYHA 4FSNA 3T3UA 4YHFA 3O50A 3L8PA 4AZTA 5LWNA 4E93A 3OP5A 4FV9A 4JL9A 4P2KA 2PUUA 2QC6A 4CFUA 3E7VA 1H0VA 3A60A 3PTGA 4NM7A 2PUIA 4AAAA 5AR4A 2CHLA 3BU3A 4ZTSA 4EH5A 1OITA 3EQHA 5HTBA 4YC8A 3D5WA 2QG5A 4MWHA 3TNWA 4I5HA 3G51A 5BVFA 5FEEA 2OU7A 1H01A 2B9HA 4IH8A 4S34A 3VIDA 3JY9A 2WEVA 3LQ8A 2BMCA 4IZAA 4OLIA 2WMXA 4TT7A 4EBVA 4JX3A 4FGBA 2X8IA 4H36A 3UYTA 4RWLA 2UZDA 4PMPA 3R1SA 1SNXA 4O1PA 4TL0A 4RJ7A 4NCTA 1OUKA 4MD8E 4NZWB 1L8TA 4OAUC 2IPXA 2X7OA 3SHEA 5TOZA 3TNHA 4FVQA 3DDPA 2PVLA 4E20A 1DM2A 3QRKA 3B8RA 4AWIA 4ZY5A 4RPVA 3ZO4A 2C0OA 2PWLA 2JDVA 2ZMCA 4QPAA 5CAPA 3PVGA 4NUSA 2BUJA 4Q5EA 1XJDA 4CRSA 2B0QA 2DWBA 4C38A 3EQFA 2WQEA 1MRUA 3QHWA 4GH2A 4L68A 3TCPA 2BHHA 1Z5MA 3UOHA 4BZDA 4NFNA 3QGWA 4HGLA 3FI8A 3D0EA 4O7YA 4ZIMA 4N57A 2A1AB 4FKWA 2R64A 4FBXA 4Z7GA 5AA9A 4G6OA 2BTRA 2XKDA 3MFRA 3G9LX 4KKEA 4L52A 4GW8A 4IBMA 3TIZA 4HVDA 1J7IA 1ZYLA 3SVVA 3FZTA 2V0DA 3C51A 2OIBA 4PY1A 3QZFA 3FLQA 3V8SA 5BMMA 5BVEA 4FG7A 2B9IA 2UVXA 4D4YA 3KCFA 2IVUA 4YZDA 4J7BA 2J50A 5EI2A 3WZJA 5HO6A 1O6LA 3M2WA 3SG8A 4FIIA 5CAVA 3EIDA 3R8MA 5I5ZA 2DQ7X 1Y91A 2F49A 4EYJA 2GQSA 3QCXA 5D10A 2PVFA 3ENMA 1FMKA 4RRVA 4U8ZA 4MKCA 1W83A 4IHPA 1ZZ2A 4HVIA 3TN8A 3W16A 5JFXA 3HL7A 4AGCA 5ETCA 4RX5A 2XNBA 3D5UA 5FBOA 4JAJA 3MVHA 5L8JA 3LW0A 3QXOA 5L8LA 3CP9A 2V55A 3QQKA 3QU0A 4WNKA 5T6KA 1R1WA 3GNIB 1REKA 2ZV2A 1JVPP 1LR4A 4KBKA 3QTSA 4OTFA 4X3FA 4CCBA 4QP4A 3AG9A 2H6DA 4RJ3A 4C57A 4ZTMA 3IW6A 3E63A 4JAIA 3UZTA 2C3LA 3QUPA 5EOBA 4D2WA 5ACBC 5T3QA 3GCVA 1UKHA 2X1NA 3OHTA 5CAOA 1OL2A 4GYIA 3WF7A 2W17A 3QQFA 2HENA 4FC0A 4W4YA 3QC9A 3DLSA 4NH1A 3RMFA 1ZOGA 4TN6A 4FTIA 4OAVB 3OF0A 4J8NA 3HA8A 3A8WA 1ZYDA 5L2WA 2GCDA 5AUVA 4HYIA 2X39A 1ZYSA 3CC6A 4QO9A 3JUHA 2RFEA 4LOPA 1UU7A 1F5QA 1KE9A 4P90A 2EB3A 5EYMA 3VULA 4BI2A 1WBWA 4XJ0A 3QZHA 4GMYA 4TPTA 3NRMA 2R3FA 3ZS5A 5DVRA 5GNKA 3QGYA 3SD0A 4BGQA 4X2JA 3VUIA 3BGZA 5CZHA 4EOPA 2CGVA 1OZ1A 4YHJA 4GVAA 4XV1A 4ZOGA 2R7BA 3ZTXA 1P14A 1BYGA 1Q62A 3PP0A 5ANOA 3FMEA 4V04A 5EW8A 3U9CA 4XMOA 2CNUA 3JPVA 5KMNA 2NNWB 2HZNA 2ITYA 1OECA 4BDAA 3SXFA 2W05A 2ZM4A 4U7ZA 3HMMA 4G3EA 4F6UA 4ZZMA 3MVLA 5CT0A 5EQYA 4GVJA 4RJ4A 4F70A 4DG0E 2ZOQA 2HCKA 3VBVA 2PVRA 3GC0A 5ETFA 5EH0A 4YJQA 3SW4A 3SX9A 2W1ZA 3W2QA 2XNGA 3PIXA 3QQGA 5CU6A 4YP8A 2VX0A 3ZCLA 3D5XA 3R7OA 1R39A 4IB5A 2HY81 4C02A 3HX4A 4C4JA 4YZMA 4EOKA 1KSWA 4Y5QA 3CEKA 3U4WA 2ZB1A 3GOPA 5AX9A 2YM5A 3G9NA 3BKBA 3Q4TA 4BDFA 3ATTA 4WRGA 4USDA 3DKFA 4XBRA 5EQPA 5E90A 3ALOA 3TKIA 4BI0A 3W2PA 4AGUA 2OBJA 3VBWA 4YTCA 5ANDA 3RCJA 4IB3A 2CJMA 1AGWA 2PVMA 3QYZA 4BTKA 5HQ0A 3CJGA 5DI1A 1PXNA 4PL5A 4RJ6A 3ZZEA 1FMOE 4BCGA 2BDWA 4FT3A 5J1WA 3PP1A 4WNPA 3OWKA 3PXQA 2VO7A 4KS7A 2X7FA 3LLAA 3BHHA 3R02A 2VO6A 3BYOA 3ZRKA 5HU3A 4BVUA 4KSPA 4FKSA 4R5SA 5IMEA 4CXAA 3OROA 4L9IA 4G1WA 3QUEA 4QQJA 4AGWA 4FNYA 1X8BA 3DAJA 3Q5ZA 3QL8A 4CSVA 2JKMA 4EK8A 4RC4A 3GENA 4IMYA 5E8TA 3THBA 1Q3DA 3GP0A 4NFMA 4QMZA 5JRQA 5BUIA 2JDRA 3DLZA 1PW2A 4EK6A 3I7CA 3MA6A 2XIXA 4IM3A 4OTIA 3MTLA 3ZLXA 2C6EA 3S4QA 1XH7A 1SZMA 5CSVA 4QD6A 3L9MA 4E26A 5E7RA 3R9RA 3R28A 3AMBA 4MH7A 4G16A 3DB8A 3KMMA 1OL6A 4WUAA 5TR6A 4MBLA 2RG5A 3OW4A 3ODZX 3HRBA 1KOBA 2XK6A 4DE4A 3A7HA 5C8MA 4XCUA 4BDBA 4IFGA 1ZYCA 3CXWA 4QYFA 3QX2A 2FH9A 3F6XA 4ASEA 3VBQA 1MP8A 4AT4A 3UIMA 2C4GA 4A4OA 4EORA 5DRBA 2HWOA 3MB6A 3NUAA 2REIA 3UIBA 2VWWA 5CQWA 3QD0A 3DU8A 4FKQA 4IZYA 4M3QA 2WTKB 4AXAA 3P7CA 4N6YA 3VRZA 4CRLA 4DEEA 3CPBA 5FM2A 3HAMA 3ZLYA 2RIOA 1YOLA 4GK2A 4GK4A 5J7BA 4PQNA 2W7XA 4BIBA 4HVHA 4ENXA 4RA5A 5EYDA 2OK1A 4QTCA 4CMTA 3R8UA 2FB8A 3NUYA 4HW7A 5M44A 4W9XA 4FKRA 4JQ8A 3V04A 3UYSA 1TKIA 2IJMA 3U6HA 4BIEA 3EN7A 2SRCA 3DKCA 1YWRA 2YAAA 4XG6A 4DEAA 2WMTA 3DBQA 4NM3A 5DIAA 5HEZA 5ANJA 4FTNA 4Z16A 4BICA 4FSWA 5DFPA 4GL9A 4FKGA 4MAOA 1REJA 2J51A 2QONA 5CVHA 4C2VA 3ORLA 2YN8A 3IDCA 4ZJIA 5CI6A 3IOKA 3L8VA 2IVTA 5HI2A 2IVSA 3L9LA 5CSPA 4DH1A 4EHEA 2RSVA 1JKLA 3KQ7A 5AR7A 3ZSHA 4AP7A 1PMVA 1UU8A 3QWKA 4EOLA 2PVHA 5DT4A 3ANRA 4UB7A 3BLRA 5JH6A 4EWHA 1R0PA 4KIOA 1IG1A 4R6VA 4BCJA 2J0KA 3IW5A 3AGLA 3MIYA 4FKLA 2ZMDA 3EQIA 3BEAA 4LFIA 3DJ7A 5HNBA 3ULZA 4ASDA 3UPZA 5EM8A 2GNIA 4UWBA 4QYGA 4TNDA 3OMVA 3VF9A 5HBJA 3PY1A 3FEGA 4FT7A 4M8TA 4F08A 5HX8A 1E1XA 4YSMA 4UYAA 3HA6A 3UG1A 5CVFA 3U6IA 2I7QA 3ATSA 2XNNA 4KBCA 3TUCA 2ZDTA 3I6UA 3D4QA 3LXNA 3QCQA 1APME 4MCVA 2X81A 4A9YA 3MA3A 4QYHA 2C0IA 3NS9A 3WI6A 3QX4A 3HZTA 4OBOA 1XKKA 3EKKA 3NW5A 3EZVA 4MD7E 2AUHA 2XH5A 4USFA 5KHXA 2Y4IB 2HZIA 3GU6A 4RMZA 3C1XA 3PA4A 5L2TA 3QZIA 3M42A 2ITTA 4QPSA 4TWNA 1CKJA 2BCJA 2W1CA 4K1BA 4TYGA 3C50A 3TI1A 2GHMA 2I0EA 2XVDA 4AACA 5CTPA 4EQUA 2UW3A 4LRKA 3CSVA 5CI7A 3TNIA 1ZARA 4L00A 4NYEA 5CNNA 4KB8A 5A4CA 3UOKA 3KULB 2HELA 3HMOA 4IDTA 2OXXA 3TL8A 3WIGA 3F3WA 2QG7A 3UC4A 5IF1A 3BLQA 3NWWA 4EQMA 4XP3A 4IWDA 3TUBA 2H96A 2RKUA 4DN5A 4LOOA 4FOCA 3MWUA 3PY3A 4J71A 5D9HA 3ZZWA 3LCSA 4FIEA 3CGFA 1CKIA 4IAZA 1YI4A 2VWIA 3F3UA 3GCPA 1JQHA 3Q60A 2YITA 4E4MA 2G15A 2VWUA 3VBYA 4QTAA 4AZFA 3NUSA 4EOQA 2OI4X 4XG8A 5TO8A 3LCTA 1WZYA 2PVNA 4L7FA 3S2PA 4AQCA 5HBEA 5H8BA 4PDOA 3BE9A 5J8IA 2JDOA 4GUBA 3MJ2A 3QRUA 2CLXA 3COMA 3BBWA 3RM6A 4F99A 4FSYA 3DPKA 4FSTA 4MXAA 2C3JA 4BY9E 4NKAA 4IE9A 4EI4A 3G0FA 4CZYB 4YURA 3UO6A 2WPAA 1JKKA 3MPMA 1O9UA 2X0GA 3FLYA 4I4EA 3OWPA 1PMEA 3FUPA 4RWIA 4X0MA 2JLDA 5AAFA 4AW1A 1JKTA 4UWCA 5LVPA 4KA3A 4AZEA 4S30A 2YIRA 4Y95A 3UE4A 4Q9ZA 1YXSA 4N6ZA 2VX1A 3ZDIA 4H3PA 4IVCA 4YZ9A 3ZU7A 1YXXA 3RWPA 3I1AA 5IQDA 2BRGA 4FG9A 4O22A 3UO4A 1LEWA 2ONLA 3ZDUA 4CKRA 2W0JA 5J7HA 4AE9A 2UVYA 4RJ8A 5BVNA 2ITUA 5BVKA 4ZTHA 4FR4A 4EOSA 4XEYA 2J0LA 5DG5A 5AA8A 3Q5IA 5BQ0A 2BTSA 3OC1A 4E6DA 1O6KA 1ZOHA 4LL5A 1GOLA 3KU2A 4R7HA 3NUXA 1YRPA 5ANGA 3T9TA 2UZTA 1UWHA 4IJPA 5AP4A 4OT5A 4B7TA 2J0IA 3OY1A 5AP5A 1UA2A 1BKXA 2YIWA 2IN6A 3NYOA 4RVLA 3OVVA 3UP2A 3KXGA 3MI9A 2J7TA 4RT7A 4MNFA 2QURA 4BWXA 5IPJA 3W2RA 3MN3A 2WIPA 3PY0A 4CG8A 2WTVA 3BX5A 5KMKA 1ZMVA 2HXQA 2XM9A 3HV7A 5HE3A 2VO0A 4F9YA 4UX9A 1I09A 2PE0A 4LI5A 2WTWA 1JSVA 2FSLX 3DZQA 3FJQE 4B8LA 3RK5A 4EH8A 1UU9A 2RL5A 5J5SA 2OF2A 5DHJA 5KCVA 3BIZA 3R8LA 3RALA 5I9ZA 3NNVA 2X6EA 3FYJX 5KHWA 4LMNA 4EHZA 1PJKA 3S95A 4JDJA 2BRHA 1J3HA 1UNGA 5K9IA 3UP7A 2YEXA 1WAKA 1PYEA 2HY0A 2WQBA 3DKGA 5DR6A 2CKPA 4RC3A 4NTSA 4XLIA 4IDVA 2PVKA 3OTVA 3C0IA 5CWZA 4DCAA 1SM2A 2R3GA 4CFVA 5HCXA 4DH3A 3RWQA 4EK5A 4JRVA 3G6HA 2WMUA 3PLSA 2PULA 1YDSE 1OPKA 2WFYA 3BHVA 5KZ0A 3OFMA 3OT8A 4FX3A 2OJIA 2W96B 5JKGA 2E9NA 2Z7RA 3BYMA 4IAFA 4LM5A 5DH3A 4XOYA 1U5RA 3R63A 2GS6A 5AEPA 4DHFA 5FDXA 5HORA 2BALA 3KF4A 2CCIA 4F09A 5T68A 2WGJA 2QOKA 4X21A 2W1EA 4WT6A 1JWHA 2UZVA 5IQCA 1BMKA 4BCHA 4WKQA 4FEVA 2BDJA 2WU6A 3JVRA 4FNWA 4H58A 4WG4A 4D1ZA 3K5VA 3R30A 4II5A 2XKFA 3MY0A 2J4ZA 4V0GB 5C27A 4UXQA 2Q83A 5KE0A 3COHA 3D83A 3MVMA 4KIQA 5FP5A 5HE0A 3IPHA 4ASXA 5AJQA 2HAKA 5E1SA 4U45A 4OBQA 1SYKA 3IW7A 4QOXA 4AZWA 2BPMA 3QZGA 2YAKA 1H25A 5E8ZA 2XK8A 5E9EA 3EN5A 3E64A 3F88A 1MUOA 1VR2A 4YTIA 4FUXA 3TJCA 1J1CA 4F63A 3A4OX 5JFVA 1DS5A 5FQDC 3I81A 4TW9A 4EK3A 2EB2A 4BDEA 4BFMA 4G6NA 4M14A 4EL9A 5LQFA 2BKZA 4ANSA 3OT3A 5G1XA 4YJPA 4HOKA 1LP4A 2XJ0A 3F5PA 4YMJA 3VUGA 1BX6A 3ULIA 4UBAA 4RG0A 3D5VA 2PZYA 5AUZA 2J6MA 2VGPA 2C6DA 3HRFA 4NJDA 3VQHA 2ITOA 2G01A 4BB4A 1BL6A 5AR8A 4KKHA 4RSSA 4AN3A 3KB7A 3ORPA 5GZ9A 3WZEA 5IDNA 3P4KA 1NT2A 1I44A 1VEBA 4BDHA 2BROA 4BZOA 2PSQA 4PPBA 3L8SA 1WBVA 3A7FA 3KCKA 2Z7LA 5HCYA 3TT0A 3D7ZA 2RF9A 1Q97A 2F4JA 4AFJA 4HCTA 5M4CA 5CF4A 5ETAA 2A27A 4JT3A 3QA8A 4ACMA 3TNPC 4KIPA 4QNAA 1IR3A 2VWBA 3Q2MA 3U51A 4RGJA 2ZAZA 3QKKA 4TYHB 4BCQA 5FXSA 3HRCA 4BKZA 2YIYA 4YJRA 2QHNA 4ALUA 2JAVA 3ODYX 4AA5A 4EHGA 4PRJA 5IQGA 2XRUA 4QNYA 2J0JA 3FPQA 2Z2WA 5CALA 2P4IA 3II5A 3CY2A 2BAJA 2E9OA 4ZSEA 2PZPA 4ENYA 2VNYA 1M14A 2IW9A 3OCTA 3GOKA 1H1WA 3Q52A 5E4HA 2FSMX 3E5AA 2RGPA 4NM0A 3ETAA 3RPYA 1Q5KA 3ITZA 5M4FA 5M06A 4DFXE 3K54A 3PWDA 4FSZA 2CN5A 4JG7A 3R21A 4O2PA 4PP7A 4D58A 4G3GA 3CS9A 3LFDA 3HGKA 3ZC5A 2BZHB 2CKOA 2BZIB 4H05A 4Z3VA 2CCHA 2J5EA 2XKCA 3UZPA 2B55A 3BU5A 3VO3A 1GNGA 2YERA 4NT4A 4DEDA 5LVOA 1R3CA 4L3LA 3QA0A 2VTJA 4L53A 2XNPA 4AW2A 5CAUA 4NU1A 4D2PA 4GFGA 2GQRA 2XB7A 1ZYJA 3TKUA 5IH6A 4JDHA 5E92A 2G1TA 2GMXA 1H0WA 3MH0A 3BU6A 4E4LA 3R7IA 3R7UA 3FMDA 4WRSA 4FZ7A 2WU7A 2Y0AA 4PMMA 4MF0A 4F7SA 5H2UA 5TE0A 2YZAA 5IA2A 1OIYA 5HKMA 5HTCA 3K5UA 2AC5A 4O91A 5IKWA 2WMAA 2WMWA 3ELJA 3QKMA 1ATPE 1JKSA 2OICA 4PP9A 4D2VA 5E8UA 3FL5A 4XV9A 4D2SA 3NAYA 2QOLA 3N51A 3OXIA 2KTYA 5C03A 4R78A 5CF6A 2PMNX 2IZSA 2XYUA 3CTHA 4W9WA 2B53A 4Y46A 5H3QA 4D0WA 4AZSA 4O7ZA 2IWIA 3E3BX 4FK6A 3UMXA 4JJRA 3BLHA 3TG1A 3E92A 5IDPA 2BFYA 3WF5A 4ACGA 2UZLA 3DXQA 3FLZA 4YO6A 4PUZA 4G3CA 4U6RA 3V5JA 3PVBA 3CQEA 4XOZA 3FI2A 3KRWA 3RINA 1LUFA 4GU6A 3W8QA 3Q96A 4YLKA 2R4BA 2EXMA 2OJGA 4TWPA 2BHEA 3KXMA 2B4SB 2PHKA 2W5HA 2YCQA 1H8FA 5AUTA 3L1SA 1JPAA 4C58A 4CKJA 4X3FB 5FEDA 4ZSJA 3W32A 5BUEA 4D28A 3MPTA 4I5MA 4QP8A 1UKIA 5BYZA 2GTNA 2YISA 5AX3A 4TZRA 2PU8A 2BDFA 3F5GA 5EYCA 2UUEA 3UODA 2HOGA 3LCDA 3IGGA 3B2WA 3HEGA 3VUMA 5GZAA 4H39A 4NW5A 1GZ8A 4GEOA 3V8WA 2Z02A 4E8AA 3MPAA 4G2FA 1HCLA 1MRVA 3P7BA 1GIHA 4DH7A 1XHAA 2GSFA 4ZY4A 5EKNA 4NIFA 3VUDA 3BRBA 4J96A 5A9UA 1NVSA 5ACKA 4DTAA 5E91A 1YKRA 3BHYA 2LAVA 1Q8WA 2QU5A 2OIDA 1FGIA 4F64A 3BBTB 3DNDA 3SOAA 4AZVA 5KMMA 2ITVA 4MXYA 2F9GA 2R3OA 2OF4A 5IA5A 3VHKA 5F4NA 2VTLA 4KIKA 4PPCA 5ETIA 5IA3A 2GTMA 1RQQA 3GBZA 2VWXA 2CKQA 3UQFA 4DTBA 4PL4A 3HDMA 1R78A 4FIHA 4JBOA 2UW8A 2YCFA 4QRCA 4Z55A 2FSTX 3QRIA 2VTTA 4JG8A 3HLLA 4AN9A 4ITJA 1YQJA 3NCGA 5A3XA 2IW8A 3LFNA 3CTQA 4FNZA 3FLSA 5AP2A 5FG8A 5IQIA 3LMGA 3GC9A 3FZRA 3MY5A 4FG8A 3EZRA 3FXXA 3IDPA 4I92A 4CMOA 4FVPA 4KD1A 2CGWA 4L3PA 5IA1A 3U55A 4MWIA 5C4KA 5FGKA 4CT2A 3G5DA 3GCSA 4YC3A 1JSUA 3MVJA 1F3MC 4ZSGA 5E8SA 4KSQA 5M07A 1YI6A 3GCUA 5I9VA 2C69A 4MYGA 5J9LA 3SXSA 4FF8A 2R3NA 3G0EA 4I93A 4XH6A 4A9UA 3LFAA 4J97A 3DBEA 4JX7A 4BDJA 4DEIA 2VTRA 5CNOA 5L4QA 4JQ7A 4YNOA 4G3DA 3H9FA 1G3NA 4X6RA 4C62A 2JKQA 1M2QA 1YW2A 4L46A 4XBUA 3C4ZA 4ANQA 4XUFA 4QP2A 4D2RA 1Z57A 4RQKA 2YFXA 1OKVA 3R7YA 1LEZA 4U3ZA 4O27B 1RE8A 1YHSA 2YJRA 4YU2A 2ETRA 3C4WA 2O2UA 3Q4CA 3FPMA 1ZRZA 2C6TA 4F0IA 4I1ZA 1OPJA 3Q04A 3D7TB 4FKPA 5BVDA 4O6LA 4K33A 1J7UA 4TRLA 3PE1A 4RFZA 3FYKX 1YXTA 3R1QA 4BKJA 3ZFXA 5KMLA 5BPYA 3HMPA 5AWMA 2FA2A 4I0SA 3AC5A 3GU8A 2JFLA 4C2WA 4WBOA 1H26A 3QRJA 4CKIA 2YDIA 3AC8A 4M7IA 2YWVA 1G5SA 3VS5A 2JFMA 4EJ7A 3TV4A 2XS0A 2F2CB 2V7AA 5AV0A 2QKWB 3PZEA 4WIHA 4BTJA 3WZDA 4F0GA 3KXXA 4DBNA 2X2LA 2R3PA 5K4JA 2FGIA 3MYGA 3KA0A 3PYYA 4WSYA 4XV3A 2XJ2A 3PXRA 3GI3A 4TWOA 5LCKA 3DA6A 1P4FA 4FTTA 3ZC6A 4JQEA 2WMRA 5CEOA 2P2IA 4BHZA 4QQTA 4O0UA 1MQ4A 3WARA 2EWAA 4L45A 3GT8A 3Q4UA 5HHWA 5HVJA 1ZZLA 2Y4IC 3QCSA 2P0CA 4YJSA 4R3RA 3E3PA 3JY0A 3HV4A 4M0ZA 5LMAA 5HNIX 4O7LA 4YJVA 4IANA 3O23A 4WSQA 5DEWA 5HVYA 3VBTA 4BCNA 3NVMB 5E8XA 2VTMA 5DR9A 3WF9A 1H1QA 4IAKA 5IQHA 3PDTA 4C37A 5J9ZA 3L9PA 3Q9ZA 3PLAE 4RX7A 2QNJA 4GKIA 4C35A 4KNBA 4OUCA 1YHVA 3MH3A 4JBQA 3W2OA 2YACA 1BLXA 1PXMA 3E7OA 4X2FA 1ND4A 3QD3A 4YHTA 3DTCA 5K3YA 4RFMA 5LMBA 2OW3A 1U4DA 3I7BA 2GHGA 3D2KA 3JS2A 1PF8A 3KXNA 1FVRA 3F3VA 4ZY6A 5LARA 3LHJA 1Q4LA 2GDOA 2AYPA 4F65A 2XIZA 2XIRA 4FZFB 3D14A 2QLQA 3D7TA 5EHLA 2XMYA 2YM7A 1YVJA 3QTUA 5LXMA 4X2NA 5AUWA 2PL0A 4XP0A 4JVGA 4GUEA 3L8XA 5AMNA 4GYGA 5I0BA 1P4OA 3BQCA 4HVGA 3BYSA 3QD2B 3R7GA 3FWQA 4G17A 5CX9A 1NVQA 3TACA 3NIZA 4FV0A 4APCA 5L6PA 4FIJA 1UU3A 3KFAA 3I4BA 1K3AA 5F20A 1L3RE 4DTKA 1NW1A 5BYLA 3F9NA 3BHTA 3GGFA 1CM8A 3GU5A 4G5PA 5CF5A 2IZTA 3UQCA 3P78A 3CD3A 3C4EA 3IO7A 2R3HA 2QO2A 3TEIA 3VQUA 4AF3A 4QP7A 3UOJA 4D4SA 3UIUA 3PE2A 3E8CA 2PUNA 2C5XA 3W2CA 3C4FA 4GIHA 4ZLZA 4YNEA 3NPCA 4ANBA 2P33A 4WD5A 4J52A 4B8MA 3BHUA 1B6CB 3MV5A 1JOWB 4A4XA 3TUDA 3EN6A 4GCJA 2WQOA 3ZFYA 3GC7A 5CEMA 4LRMA 3VHEA 5JQ5A 1GAGA 2YM6A 5EDRA 4ANLA 5LMKC 4I0RA 4AN2A 4AOTA 3WOWA 1AD5A 4H1MA 5EG3A 2R9SA 3ZBXA 4C4EA 3ZO1A 4FV6A 4WUNA 4BF2A 2C68A 1M2PA 3MY1A 1CMKE 3O7LB 5EHOA 5IMXA 4JS8A 3AOXA 4R5YA 3PWYA 1OBDA 2C6OA 2WZJA 5CVGA 2O0UA 2R3KA 3O0GA 3NCZA 4OTHA 4LUDA 2DUVA 1JAMA 3BYVA 3F61A 1XH4A 4EC8A 3PSDA 4D0XA 4QQCA 4QP9A 3FAAA 2XEYA 4X3JA 1WBOA 2YDKA 4EC9A 4GJ2A 3ZEWA 4HZSA 4ITHA 5HNGA 2GFCA 3COIA 3Q3BA 3EHAA 3CJFA 4QYYA 3DBDA 3PIZA 5AUXA 5JRSA 2WKMA 3KEXA 4HJOA 4FEWA 1PXJA 2G2HA 4G9RA 4IVBA 5KKRC 4YLLA 4EZ3A 4UY9A 3F3TA 3DK7A 3H30A 1OVEA 3C4XA 3QQLA 4WO5A 2YA9A 4BKYA 4WBBB 3O7LD 4G34A 4DEGA 4EJNA 2OLCA 5IQBA 1NXKA 4JRNA 2X6DA 4U97A 5A6NA 5JQ8A 4JR7A 1A06A 2W5BA 3WZUA 1QL6A 2H8HA 1H1PA 3CLYA 2ITZA 3DZOA 3U6JA 4R7IA 4EH7A 2KULA 5ANIA 3S0OA 4FZ6A 3EYGA 4EH2A 2VUWA 1H24A 2B1PA 3NVKI 5I9YA 4I6QA 2VAGA 4F1MA 3IOPA 5EQEA 5CLPA 2QOHA 4FICA 4PV0A 4IEBA 4M68A 4UWYA 1YXVA 4C33A 3FY2A 3R00A 3DXNA 5AADA 1FQ1B 1FVVA 3FLWA 4QPMA 4ZSAA 5DT0A 4ZZOA 3SDJA 5EW3A 4CYJA 3TNQB 4QMQA 3AXWA 3IS5A 3OY3A 3IDBA 4RWKA 3T9IA 4D9UA 5D12A 3FI3A 3OEZA 4M12A 1E1VA 4X7QA 4Y85A 3LIJA 2W9FB 3SRVB 3PSBA 3N4UA 4OTRA 5AR3A 3U87A 3A61A 1FINA 2VWYA 2GNGA 3EQBA 5E1EA 3UNJA 3LKMA 5IU2A 4FVRA 4ZXTA 1BUHA 4HCUA 3QWJA 1H07A 4HGTA 4ZTNA 2IVVA 4D2TA 5IUGA 3Q32A 1OL5A 3HYHA 3PXKA 4PMSA 5DGZA 4EYMA 5CEKA 4GKHA 2W4JA 4MK0A 2VTQA 3RGFA 4KUJA 4LGHA 5JGBA 2WAJA 2XNEA 5GIPE 4ACHA 3FMLA 1E9HA 3O8UA 4IX3A 5CXHA 5EDPA 4ID7A 3UDBA 3V6RA 4MXCA 1BI7A 4U9AA 4BGHA 4BBEA 4ZJJA 1Y57A 4Z7HA 4EONA 2W5AA 3QAME 3D15A 4YTHA 3ZM4A 3EOCA 3REPA 3OCGA 3GU4A 2CNVA 3I79A 3V51A 2R3QA 2PYWA 2C5YA 5B2KA 3ZM9A 2YDJA 3DJ6A 4QTEA 3SG9A 1SVHA 1W0XC 2JITA 3LFCA 3A2CA 5AP6A 3FKNA 4OT6A 3VF8A 4TY1A 3I60A 4UMRA 5HTIA 3KGAA 5AP7A 1KE7A 3B8QA 4ZSLA 2F7EE 2VZ6A 2CKEA 3AD6A 4O0VA 4F6SA 4RIWA 5AV1A 2QO9A 3LFQA 4I6FA 3P23A 5BVWA 5FUTA 3D9VA 3FZ1A 1H00A 2ERZE 3KRXA 1ZMWA 5HE1A 5TKDA 4E5WA 4IWOA 1XBCA 4GFMA 2X8DA 5HIEA 1NY3A 5L8KA 2A2AA 5JK3A 4IM2A 4C3PA 2ITQA 1H08A 2C1AA 4FIGA 3TIYA 4Q5HA 4XG3A 4ZTLA 3RPOA 5IH5A 2XYNA 4USEA 3FMHA 3SRVA 1W98A 3OEFX 4Q9SA 1UVRA 4BRXA 4E5AX 3LMIA 3TZ8A 2ITWA 1IAJA 2NRYA 5AR5A 3VS7A 4GG5A 4A9RA 2ITXA 1PHKA 3ACKA 5FXQA 5AV4A 4O82A 4A9TA 4E6QA 3KXHA 3V5QA 4LYNA 3VUTA 4C4GA 4QMTA 4F9CA 3LZBA 5A4EA 2XEZA 3MGYA 1P2AA 1YOMA 2ZV7A 3EYHA 4CNHA 1TQIA 2W4KA 5CEIA 3FLNC 3B2TA 2RG6A 2WELA 1M17A 2QU6A 5EM7A 4AW5A 2ZM1A 2OZOA 1ZMUA 3ROCA 1XQZA 5IQFA 5I9XA 4O7SA 5J87A 3NR9A 2IW6A 4I23A 2VV9A 2YCSA 4BI1A 3BEGA 2HZ4A 4FV5A 3G33A 4FL1A 3Q6WA 4WG5A 3UVQA 5EM6A 4IZ7A 4LL0A 2C6MA 4BIDA 4G31A 4CLIA 4F0FA 4FZAB 2Y4PA 1PXKA 1H27A 3VWAA 4C0TA 2W1HA 3QTZA 4RJ5A 2EXCX 5EHYA 4FTMA 1W7HA 4V01A 1M7NA 3UOLA 3PPKA 5D7VA 4J98A 2YWPA 5HU9A 2EVAA 3OCBA 4MX9A 4RA4A 4IAYA 2VRXA 4NCTC 3TZ9A 3UVRA 3GXLA 3W33A 4GT4A 5IG1A 3BWJA 4KRCA 4O96A 3SW7A 5EW9A 4FL3A 2HIWA 4W8EA 1IAHA 3ZMMA 3R8ZA 3R73A 4IB0A 3KN6A 3DY7A 3VNTA 3O17A 1PKDA 3HP2A 3LCOA 4Y5HA 3AC2A 4CQEA 4E4XA 4EKKA 2UZOA 3LAUA 3PVUA 4AOJA 4ZEGA 2OJJA 3ZO2A 1Q8ZA 3HDNA 3HUBA 3QQUA 5JZNA 4CYIA 4QP1A 4HGSA 3R9DA 3Q53A 2QO7A 3LPBA 4YZNA 5M08A 3IW8A 5FXRA 4JI9A 5FTGA 1PKGA 4FV7A 1ZY5A 4JNWA 4O7RA 3ZXZA 2R5TA 1YXUA 4JIKA 2C6IA 3QLFA 4H1JA 2I0HA 3F82A 3V5LA 4B4LA 4YTFA 3KREA 3RAHA 2IZRA 5IH4A 5IQAA 2WIHA 3H3CA 3S1HA 4FEXA 5LVMA 1UNLA 3VBXA 4BCOA 2GS2A 2YCRA 1HOWA 4TTHB 2WMVA 4BDKA 5K0XA 3U54A 4AA0A 2CDZA 1YDRE 2WO6A 3WILA 5LCJA 3WZKA 3OBGA 4UN0C 4FSQA 4HZRA 3GFWA 3OXZA 4C59A 4F9WA 2HZ0A 3GQLA 4UYNA 3RPVA 3DS6A 4S32A 3VS1A 1B39A 3AQVA 3F5XA 5HD7A 4D55A 1XWSA 4FV1A 3R04A 4PTEA 5AP0A 3PRIA 2QI8A 4A06A 5DLSA 4GS6A 5KMJA 1Y6AA 4GSBA 3RI1A 2V7OA 3QBNA 4X3FC 3CPCA 3TM0A 2W1IA 2ZV8A 2BFXA 4ANMA 4EK4A 4TNBA 1U5QA 3KL8A 2PMLX 4KINA 3VS0A 4AE6A 4BYJA 2QCSA 5D41A 2DYLA 3V8TA 3DB6A 4BZNA 3FXWA 2RFNA 3MDYA 5JT2A 1TQMA 4ALWA 3WE8A 1XBBA 1W82A 5EFQA 4HVSA 1FOTA 3EWHA 4O7NA 3VUHA 5DOSA 3DCVA 4N4SA 4CV9A 4IC7A 2HXLA 2UZEA 1B38A 2VU3A 3UPXA 4Y83A 4L43A 3VS3A 4O1OA 3ZXTA 3Q9XA 3DGKA 3EKNA 4E6CA 1TVOA 4EKLA 2PVYA 3DXPA 2BIYA 4ONAA 4O83A 3FZPA 3QLGA 4I6BA 4PL3A 1KUTA 4QMLA 4YJOA 1OUYA 2UZBA 3EQDA 1YWVA 3E8EA 2WHBA 3I0QA 3NDMA 3NYXA 4FTOA 2XK9A 5EK7A 4YPDA 3RPRA 5DYJA 2BKKA 4F7NA 2HYYA 4LGDA 2E9VA 3LM0A 3KRJA 5J1VA 4K77A 4WHZA 2UW5A 3SXRA 2ACXA 3JVSA 3NW7A 3UTOA 1WBSA 1SVEA 2UVZA 2JD5A 3NAXA 3U8WA 4EUUA 4ZJVA 3PRFA 3NSZA 5L2QA 4E5BA 4RZWA 1GZNA 3V6SA 5KUPA 3RJCA 4OTQA 2W9ZB 3GEQA 5CAQA 5CXZA 2OZAB 4GV1A 5HZNA 4BCFA 4DBXA 3ERKA 4FUYA 4PX6A 2YM8A 4V05A 2XIKA 3ZUVA 5GJFA 1OMWA 3QUDA 3V3VA 2O3PA 2WNTA 4BTFA 3RKBA 3ORXA 3UBDA 2JDSA 2UW7A 4GJ3A 4EBWA 5BNJA 5KMOA 4M69A 4RIYB 3LE6A 4QTBA 1AQ1A 1WVYA 5DE2A 2I40A 3ZLSA 2C3IB 4PWNA 2IZUA 5CSHA 5LOHA 3PXFA 2WMSA 2PPQA 4R7BA 1JNKA 2EUFB 5D1JA 3VC4A 2XZSA 3WE4A 2F7XE 3UC3A 2E9UA 1RW8A 1H1SA 3FMKA 2FUMA 4D1SA 3HNGA 3ZO3A 3T3VA 3F2NA 2CGUA 3UVPA 4M15A 3IECA 4WNOA 3ZSGA 4CV8A 2X9FA 5J95A 2P55A 4O0XA 2JAMA 3C5UA 5M09A 2NO3A 5CU3A 2I0YA 4YGAA 4O7WA 3RTPA 3D2IA 4IX4A 5AP3A 2BILB 3I0OA 3RCDA 3F7ZA 2OJFE 3R71A 4LOQA 3EFWA 4ACDA 3MSSA 4I94A 3EB0A 4BTMA 2UW4A 2UW9A 3DBCA 4JBVA 3V5TA 2PVJA 4IAAA 2YABA 3ORNA 4M66A 1A48A 4L8MA 4FGRA 3DKOA 4XYFA 4C3FA 2B9JA 1Y8YA 2WXVA 2XF0A 4IC8A 4P4CA 3E8NA 4I24A 5GHVA 3NZ0A 3C0GA 3FQSA 4G3FA 3VW6A 4CFWA 4EWQA 2W4OA 5JZJA 3PVWA 3LOKA 4XRJA 1QMZA 1GJOA 2XA4A 4L6QA 2GS7A 1OL1A 4IJ9A 4EOJA 4PDYA 2XM8A 1VYWA 4NIFB 4R1YA 4KWPA 1IA9A 2O64A 1Q41A 1ZY4A 3LCKA 4NWMA 4XLVA 4DH8A 1URCA 2OZAA 4S31A 4EH3A 1BL7A 3R83A 5HLNA 4R1VA 4ACCA 3ACJA 2C5OA 4QMXA 2B7AA 3NMUF 1SVGA 4RIXB 3TDVA 1H4LA 2R3IA 3MESA 4KIKB 4QMNA 1T45A 4RIYA 1CSNA 5IUHA 3UZRA 4GRBA 2BIKB 5I9WA 2XCHA 4QYEA 3HVCA 3ORKA 4C8BA 3EQRA 4K6ZA 1YHWA 3BPRA 3MH2A 4Z9LA 3MW1A 1OIUA 3W1FA 2G9XA 2OH4A 2XCKA 1S9IA 1FPUA 2HW7A 3R01A 4DEHA 4HCVA 1KV2A 1FVTA 1DI8A 2C1BA 3NUNA 2C47A 2WTCA 3JYAA 3OS3A 2Y9QA 3ZLWA 4JXFA 4EH9A 3FKLA 4PPAA 4FV3A 5FM3A 1OBGA 4A9SA 3KF7A 5F94A 1Y8GA 4BDDA 4BCMA 5LWMA 3FQEA 4GG7A 3OCSA 2ZVAA 4JDIA 4MNEB 4BCIA 1RDQE 3F69A 4UMUA 4PTGA 3HV3A 4HYUA 1GY3A 2VO3A 3BYUA 3DAEA 3LVPA 4I3ZA 5GJGA 2CPKE 2QR8A 4MTAA 4C4HA 1MQBA 1XH6A 4QP3A 5BYYA 3R2BA 1OIQA 3LFFA 5AV2A 1IEPA 4FSUA 5A14A 3C9WA 2JKKA 3R7VA 3FMJA 2UZNA 5KBRA 3RAIA 2BAQA 2QOCA 2JGZA 5GJDA 3VS2A 3W2SA 1STCE 3DJ5A 3KN5A 4FEQA 4UZHA 4AA4A 4DT9A 3NNWA 4FKVA 3DBFA 4UMPA 1PRYA 2J9MA 4APPA 5FTOA 3KRRA 5BX0A 4MBJA 4RIXA 4ZMEA 5FD2A 3P9JA 4IIRA 4CCUA 5JGDA 2WMQA 3R1YA 2E9PA 5JN2A 4IM0A 3PPJA 5L6WL 4DFNA 4Y72A 2BZKB 4A7CA 4E7WA 2JBPA 2C5VA 2UV2A 5HLWA 2JIUA 4I5PA 3QALE 3H0ZA 3WYYA 5FDPA 4IWQA 3ENHA 5C8KA 1OI9A 3K3IA 2OXDA 3VUKA 3QD4A 4F9AA 4FYOA 4DT8A 4BL1A 3BV2A 3EFLA 3PZHA 4X2KA 4HPUE 3SKCA 2FSOX 5CU2A 2Y6OA 2XRWA 5HO7A 2Z60A 4FKOA 1XR1A 1EH4A 3D94A 2QLUA 3MBLA 4S2ZA 4C7TA 3ZYAA 3NNXA 2DS1A 4K0YA 4YJTA 1QPEA 5CSWA 5CEQA 5EOLA 2X4FA 4YPSA 3RAKA 2Q0BA 2JIVA 3NEWA 3F2RA 2BZJA 2OO8X 2WTKC 4JG6A 3G6GA 3R9NA 5A54A 5ICPA 2WQNA 4AX8A 1NA7A 2NRUA 3DT1A 4X6QC 5HGIA 2YJSA 4KBAA 2A19B 2VTSA 3DK3A 4KS8A 4O0TA 3VVHA 3TXOA 5J9YA 3GB2A 2ZDUA 4MNEA 4H3QA 2OJ9A 3CGOA 5B0XA 1OPLA 3ZFMA 4UMTA 5HVKA 2H34A 5JSMA 2OH0E 1YOJA 1TQPA 3R22A 2BR1A 4YJUA 4BWKA 4FKJA 3FHRA 4L44A 5FRIA 4D5KA 3BV3A 4DFBA 2FVDA 3DDQA 2QQ7A 3UGCA 4RVMA 4YBJA 4PTCA 3P5KA 2R3JA 3DAKA 5IEVA 4UV0A 4FNXA 5C26A 2WB8A 3A4PA 1JBPE 1IA8A 4HGEA 3AMAA 3DOGA 2UZUE 4LMUA 4AGDA 1VZOA 3LXKA 4K11A 4NL0A 5M4UA 3W8LA 4F7JA 2G2FA 3HUCA 5HCZA 3KXZA 1YDTE 4DGMA 3GFEA 3PJ2A 5FP6A 3RNYA 3VW8A 1ZAOA 2VTNA 4MXXA 4OR5A 3RHKA 3A7IA 3NYVA 1QPDA 2YIQA 3EFJA 4JDKA 2PZ5A 3R0TA 2P2HA 3FSKA 1WBTA 3QC4A 1XH8A 2GFSA 5EM5A 5F95A 4RBLA 5EDQA 2C3KA 4C34A 3DQXA 2EU9A 3KC3A 1YI3A 3MJ1A 4FKIA 4L01A 4R3CA 3FY0A 4FKUA 4M67A 5ANEA 4ZMFA 3EN9A 2R2PA 3F66A 2BVAA 1WBNA 2W1FA 4EHVA 2GHLA 3C5IA 3KK9A 5IQEA 1W8CA 3R6XA 4EH4A 1LPUA 3QQJA 5FTQA 4HPTE 4JBPA 4DITA 4ORKA 1VYZA 2WTIA 3POZA 2OFUA 1UV5A 5L6OA 2OXYA 2JC6A 3P1AA 5AM6A 3EFKA 4DGLC 5JFWA 5DWRA 3AC4A 1DI9A 2YIXA 3FMMA 4UALA 4RLLA 2CLQA 3PIYA 4B9DA 2VX3A 3H4JA 5HO8A 3ORIA 4J53A 3F5UA 2ONLC 2QVSE 2X2KA 2ZJWA 3OZ6A 4JIAA 4BHNA 5I9UA 3EN4A 3E93A 4LQMA 2PUPA 5F1ZA 1H1RA 4CMUA 4R77A 3IKAA 2XKEA 3JXWA 3P79A 4YR8A 5B2MA 1F0QA 3QFVA 4RVTA 4FTJA 3UNZA 4MQ1A 4CGAA 4N70A 2P3GX 2XBJA 4I21A 5AIRA 4XX9A 5EI6A 3MB7A 5LVLA 5BMSA 3K3JA 5AUUA 3DFCB 3FZOA 4TKSA 4WNMA 3H9OA 5CEPA 2ERKA 3BQRA 5M51A 1XH5A 4YZCA 5CQUA 3VJOA 1R0EA 4IAIA 1OKZA 1OB3A 3FKOA 1ZLTA 4MBIA 3KKVA 4NKSA 4BWPA 4DFLA 5HE2A 4B99A 4IACA 4ZS4A 1KE8A 1ERKA 2JKOA 2QKRA 4PNKA 4AFEA 2C6LA 5M4IA 2VTAA 4U79A 4F6WA 3LFBA 4FL2A 4C4IA 4PNIA 4O84A 4I4FA 4U80A 4FK3A 3CBLA 3LQ5A 5DMZA 4MXOA 4QMMA 3LJ2A 4Y73A 4E1ZA 4DFUA 5AP1A 3ORTA 5HG7A 4RX9A 4OGRA 3OG7A 1G8SA 3EMGA 2YM4A 3LXLA 4QQ5A 4PDSA 1GIIA 4DGOA 2VTIA 3SLSA 1MRYA 2CN8A 1A9UA 1OM1A 2W06A 4I41A 4O0SA 4XV2A 3S3IA 4CQGA 4EUTA 5A4QA 1V1KA 3DK6A 3OOMA 3BGPA 3CD8A 2XBAA 2PE2A 3FZSA 2FO0A 3FV8A 1URWA 2Z7SA 3RK9A 3OBJA 4KABA 4J8MA 3R9OA 5CANA 4S33A 3GQIA 5HOAA 3AMYA 3RZBA 5DBXA 3ZUUA 5HD4A 5J5TA 3VRYA 4CZUA 2R0UA 1Q61A 4IXPA 4U5JA 3LLTA 2HK5A 3MTFA 3TZ7A 5FBNC 1PXIA 3BELA 5DT3A 5K4IA 3DFAA 3OXTA 3ET7A 3U9NA 4RWJA 2Z7QA 5FLFA 4CVAA 4FTRA 4AW0A 3OOGA 2WTJA 2OG8A 2XK7A 4NSTA 4FZDB 2PMOX 5K5XA 1Z9XA 3ANQA 3QRTA 4QMPA 3R8PA 5AAGA 5IEYA 5IISA 4O81A 1W84A 4BR3A 4BGGA 4BC6A 1SNUA 1PYXA 4NEUA 4O6EA 5H8EA 4CEGA 5HBHA 4K9YA 1WFCA 1KV1A 1KE6A 3AD4A 3KK8A 3ORMA 3QTXA 3MFUA 5LJJA 4AT5A 5IA4A 1HCKA 5DN3A 4LUEA 4P7EA 3V5PA 5B2LA 2H9VA 2FYSA 5DA3A 4W4WA 3MIAA 3GUBA 4DG2E 1Q24A 1FBNA 3FC2A 3VJNA 3QTWA 4RC2A 3PUPA 3O96A 3WIKA 2QODA 5KO1A 1VJYA 4W4XA 5AM7A 2I6LA 3CR0A 5FEQA 2YHVA 2J2IB 3BI6A 4F1OA 5HIBA 3H0YA 4TWCA 3KMUA 1GZOA 2NPQA 3KVXA 4IX5A 4R3PA 5F9EA 3MS9A 3O8PA 4KKGA 5D11A 3CTJA 2WEIA 5H9BA 4FT0A 4NK9A 1J1BA 1V0PA 2BRBA 2VN9A 3ZONA 3Q2JA 4QMVA 4RIWB 5C8NA 4GU9A 4E6AA 3Q9YA 4D5HA 4PDPA 3PXYA 3KRLA 4AT3A 4BDGA 2Y8OA 4XS2A 5HICA 5CF8A 4XG9A 2ESMA 2J0MB 4YLJA 5AR2A 4ZK5A 1J7LA 3TKHA 4DFYA 3A7GA 2WTDA 4IB1A 3RVGA 3T8OA 4XHKB 5HX6A 3MH1A 4CFFA 3PFQA 1M2RA 1V0OA 2R3RA 4I6HA 5CU4A 4D1XA 3AC1A 2XNOA 3FSFA 3VN9A 3CCNA 4OBPA 3TWJA 4Q2AA 4I22A 3ZUTA 1YWNA 3OUNB 3IG7A 4DH5A 2AC3A 4CT1A 2HWPA 4HNIA 3E62A 4YBKA 3W18A 3QKLA 2XUUA 4O0WA 4OW8A 2IO6A 4U41A 1WVWA 2Y7JA 1WVXA 2E2BA 4IFCA 3FMNA 1PMNA 4I5CA 2O65A 5E8YA 4DLIA 5IA0A 3IW4A 1P5EA 3GVUA 3PJCA 2I0VA 1OKYA 4U42A 5TF9A 3M1SA 5AFVA 2BRNA 4NW6A 5H8GA 3O71A 3PXZA 2Q0NA 4RIOA 3F2AA 4BYIA 4EOIA 4M0YA 3F7WA 4UMQA 4F1TA 1Q3WA 4QT1A 5I3RA 1QCFA 3FL4A 3O51A 3W55A
chains in the Genus database with same CATH superfamily
1XBAA 3UDSA 2NP8A 4AS0A 5LVNA 3I6WA 1PXOA 3RAWA 3TTJA 3NGAA 5EI8A 5CASA 5GZ8A 3UNKA 3SGCA 1OGUA 2F2UA 3FE3A 4CD0A 2IG7A 1KWPA 5CY3A 3KVWA 4QMWA 2UZWE 2PK9A 5CZIA 1U46A 1QPCA 2GQGA 3P7AA 4QP6A 1WBPA 3Q4ZA 4FTUA 5CENA 4C4FA 2OIQA 5B7VA 5ITAA 3EQGA 2UW0A 3R1NA 4XG4A 3O8TA 3TZMA 3AD5A 4FV2A 4JR3A 2QD9A 3DTWA 3HKOA 2F7ZE 4N0SA 4YZBA 4ARKA 1IASA 3AT2A 3PA5A 3CY3A 3OTUA 4FT9A 4FA2A 3P0MA 5E8VA 2RFDA 2VWVA 1M52A 3LXPA 2YM3A 1KE5A 4FI1A 2YZLA 4IWPA 3LFSA 3HV5A 2JBOA 2VTPA 3P86A 4RLKA 5HIDA 4CLJA 2ZM3A 4LG4A 4M97A 1CDKA 3OUKA 4RX8A 4U44A 3RK7A 4C3RA 4ZTQA 5L2SA 3Q6UA 4E3CA 5JEBA 3RBWA 1ZWSA 4TYIA 2X8EA 4FMQA 2VTOA 4U3YA 4ANOA 1Q8TA 2VTHA 1DAYA 2X4ZA 4IVAA 4B6LA 1NVRA 1ST0A 4CFXA 4L42A 4PMTA 1T46A 3W0NA 3TV6A 2ZYBA 4J99A 5GIOE 3CKWA 4FKTA 4G5JA 1WCCA 4TYJA 4RFYA 4FODA 2QR7A 4WA9A 4LV5A 3NLBA 4OTWA 3A62A 3MFTA 4WOVA 3E87A 4ZS0A 5TT7A 3I5NA 3EJ1A 4F7LA 3M11A 4U43A 4EOOA 5L2IA 4AUAA 3V01A 5M53A 3KIOC 4P5QA 4BBFA 1S9JA 2O8YA 2X2MA 2LGCA 3E88A 3N4TA 4G6LA 4J95A 4EEVA 3ROYA 3IGOA 5A4LA 2JEDA 3QCYA 5CSXA 3AT3A 4A07A 3TTIA 2O63A 3IONA 1WMKA 4MVFA 1JLUE 4ALVA 4YSJA 3TV7A 2JIIA 3PPZA 4CZTA 5CS6A 4FIFA 4F4PA 4WG3A 4ASZA 4HYHA 4UEUA 2WOTA 2GNLA 2BAKA 2J5FA 2R3LA 5HLPA 3BWFA 1Q8YA 3HV6A 4JLCA 2CMWA 1GZKA 4U40A 4OTPA 2VGOA 5EKOA 3IQ7A 3R7EA 3BGQA 5HG9A 2ZB0A 3QTQA 3ZRLA 5CU0A 4DF3A 3KULA 4DCEA 2V62A 4GT3A 4M84A 4EOMA 1IRKA 2XK3A 3C13A 4FYNA 2C5NA 2R3MA 2VNWA 3LJ1A 1CKPA 3PSCA 1XH9A 3FXZA 4LV8A 3UIXA 3CKXA 3BZ3A 1CTPE 3NW6A 4P5ZA 1V0BA 3W10A 1K2PA 4DFZE 2A4LA 1XO2B 3BE2A 4MF1A 3RNIA 4DGNA 3ALNA 3BCEA 2PZRA 2HW6A 3WBLA 3QQHA 4I0TA 4FOBA 5DNRA 5GINE 2V5QA 3SC1A 3OD6X 1G8AA 4EQCA 2CGXA 3AT4A 2ITPA 4JOAA 4MEDA 4O86A 5KKRB 4AXFA 3LFEA 1Q99A 2QOOA 2Y6MA 2Z8CA 4ERWA 5JFSA 2W1DA 4DGGA 4E73A 2QOBA 5CT7A 3PJ8A 3ZH8A 4ZLYA 4O7VA 2OKRA 4IZ5A 5FWKK 3RZFA 4B0GA 3UO5A 3GC8A 2WMBA 4H3BA 3V5WA 5E8WA 2W1GA 4XG7A 4J1RA 4TYEA 4EH6A 1H28A 3OW3A 3A8XA 5DR2A 4L3JA 4XP2A 3EL7A 5HESA 2WD1A 3RM7A 1U54B 2ITNA 3SOCA 5K5NA 4E4NA 4YO4A 3FHIA 3POOA 4M69B 5HG5A 5LMKA 4FSRA 4L7SA 4IADA 4QMUA 5KNJA 3SAYA 3P5JC 3COKA 4MHAA 2PZIA 3EL8A 4IVDA 1PXPA 5CYIA 5A46A 3CQWA 4CFNA 5DRDA 3FDNA 2XK4A 5BUJA 4D4VA 4ZZNA 3FBVA 2X7GA 3HECA 4OTGA 2B54A 4EZ7A 3Q9WA 4NTTA 3GU7A 4O0YA 2QOIA 3C7QA 5ANKA 4F9BA 4W8DA 5G6VA 4ERKA 3HAVA 3DV3A 3F3ZA 2J90A 3H9RA 3I5ZA 4KRDA 4YJNA 4ZTRA 2CNQA 4A4LA 4FTAA 3AKLA 4R8QA 4RZVA 4DAWA 4BDIA 1Y6BA 3LM5A 3QTIA 3KMWA 2X9EA 4ITIA 4XG2A 4BDCA 4QMOA 1PXLA 5DEYA 1SMHA 4U81A 3ZBFA 4CFMA 4FE2A 4DLJA 5M56A 3G90X 3CIKA 3O2MA 3QF9A 3OWJA 2B9FA 1O6YA 3WYXA 1FGKA 3SV0A 4C61A 3PG1A 4GFOA 2PTKA 5C01A 3PG3A 1ZXEA 4YC6A 5I4NA 4GIIA 3CE3A 1QPJA 5KBQA 4HNFA 3PJ1A 4MQ2A 3SA0A 4Y8DA 4FEUA 3LMHA 5A4TA 3K2LA 4TXCA 4NJ3A 4ANNA 3IK3A 3UG2A 4DC2A 4FTLA 2PE1A 3EQCA 1TFFA 3AGMA 2R7IA 3GCQA 2QOQA 5D7AA 5L3AA 4O7TA 1KOAA 2EXEA 4LGGA 5AAEA 2C30A 4XNEA 1K9AA 3N4VA 5M55A 3NIEA 4IW0A 1RJBA 3HMNA 2CSNA 4GT5A 4RQVA 3MFSA 1DAWA 3QTRA 4BN1A 4CTBA 1U54A 4AG8A 3LJ0A 4FT5A 4G9CA 5BVOA 4HYSA 3P08A 4KAOA 4QMSA 2XIYA 2C6KA 2R0IA 4XRLA 4BBMA 4LDTA 4U0IA 4W4VA 3C4CA 4O38A 3VS4A 3U4UA 4DYMA 3S00A 4BCPA 4UXLA 4PF4A 4FV8A 1J91A 3HP5A 4O0RA 4X2GA 4ZAUA 2JDTA 1UNHA 3ZSIA 1Q8UA 5IEXA 3ID6C 2RFSA 4CTCA 5HG8A 1M7QA 3BLAA 2OFVA 2V22A 2X0OA 4DHJA 3ZRMA 3R2YA 1W2DA 4IQ6A 3FC1X 3ZEPA 5C4LA 4ZLOA 4BCKA 4EZ5A 2YLFA 2W99B 3RP9A 5K0KA 3AC3A 3ZHPC 3ZOSA 2C0TA 2QHMA 4K8AA 5KMIA 2B52A 3HMIA 2G2IA 2GNFA 2WQMA 3NUUA 3SQQA 2XP2A 3JR1A 4FTKA 3DNEA 3EQPA 4MD9E 4D9TA 4FV4A 1GIJA 3ORZA 4V0GA 5EYKA 2BRMA 3TYKA 2VWZA 5I3OA 2ETMA 4ZP5A 4D4RA 5M57A 3VS6A 3QHRA 2XNMA 2GU8A 1PY5A 3OWLA 3LQ3A 3L9NA 3WF6A 2WOUA 2PY3A 3CQUA 2ETKA 3N9XA 5AUYA 3RHXA 2XJ1A 4DA5A 3NX8A 3UMWA 4YUQA 1VLRA 1OIRA 1U59A 3TDWA 2O5KA 2UW6A 4DG3E 5A6OA 2GPHA 3E8DA 3DQWA 5AV3A 4QMYA 2GNHA 5C9CA 4FTCA 2QOFA 3RPSA 3A99A 4IX6A 4AU8A 4DDIA 5J79A 3TJDA 5AIKA 3G15A 4C36A 3KY2A 4AOIA 1UWJA 4LRJA 4I20A 4DEBA 5IZFA 5C1QB 4O2ZA 2I1MA 2OSCA 4NM5A 3VAPA 5KX8A 3A7JA 3QXPA 2OWBA 4QTDA 3PJ3A 5DPVA 1ZOEA 2GNJA 4K2RA 4L67A 2A0CX 1PMUA 2YLEA 3WF8A 3NYNA 4CG9A 5IUIA 3UQGA 4FSMA 4RVKA 3QYWA 4UZDA 3EH9A 1OL7A 3FQHA 4GK3A 4O4EA 4O21A 3NUPA 2OGVA 3R8VA 3C0HA 4K18A 3NNUA 3H10A 3UJGA 4OTDA 3FI4A 4FTQA 4DINA 1OKWA 5JMSA 2ZV9A 1JSTA 2PMIA 4MXZA 2F57A 3PA3A 5JGAA 3R9HA 1BI8A 5KZIA 3G2FA 4M13A 2VD5A 4TYHA 4FSNA 3T3UA 4YHFA 3O50A 3L8PA 4AZTA 5LWNA 4E93A 3OP5A 4FV9A 4JL9A 4P2KA 2PUUA 2QC6A 4CFUA 3E7VA 1H0VA 3A60A 3PTGA 4NM7A 2PUIA 4AAAA 5AR4A 2CHLA 3BU3A 4ZTSA 4EH5A 1OITA 3EQHA 5HTBA 4YC8A 3D5WA 2QG5A 4MWHA 3TNWA 4I5HA 3G51A 5BVFA 5FEEA 2OU7A 1H01A 2B9HA 4IH8A 3PUFC 4S34A 3VIDA 3JY9A 2WEVA 3LQ8A 2BMCA 4IZAA 4OLIA 2WMXA 4TT7A 4EBVA 4JX3A 4FGBA 2X8IA 4H36A 3UYTA 4RWLA 2UZDA 4PMPA 3R1SA 1SNXA 4O1PA 4TL0A 4RJ7A 4NCTA 1OUKA 4MD8E 4NZWB 1L8TA 4OAUC 2IPXA 2X7OA 3SHEA 5TOZA 3TNHA 4FVQA 3DDPA 2PVLA 4E20A 1DM2A 3QRKA 3B8RA 4AWIA 4ZY5A 4RPVA 3ZO4A 2C0OA 2PWLA 2JDVA 2ZMCA 4O4BB 4QPAA 3PVGA 4NUSA 5CAPA 2BUJA 3AKJA 4Q5EA 1XJDA 4CRSA 2B0QA 2DWBA 4C38A 3EQFA 3UDTA 2WQEA 1MRUA 3QHWA 4GH2A 4L68A 3TCPA 2BHHA 1Z5MA 3UOHA 4BZDA 4NFNA 3QGWA 4HGLA 3FI8A 3D0EA 4O7YA 4ZIMA 4N57A 2A1AB 4FKWA 2R64A 4FBXA 4Z7GA 5AA9A 4G6OA 2BTRA 2XKDA 3MFRA 3G9LX 4KKEA 4L52A 4GW8A 4IBMA 3TIZA 4HVDA 1J7IA 1ZYLA 3SVVA 3FZTA 2V0DA 3C51A 2OIBA 4PY1A 3QZFA 3FLQA 3V8SA 5BMMA 5BVEA 4FG7A 2B9IA 2UVXA 4D4YA 3KCFA 2IVUA 4YZDA 4J7BA 2J50A 5EI2A 3WZJA 5HO6A 1O6LA 3M2WA 3SG8A 4FIIA 5CAVA 3EIDA 3R8MA 5I5ZA 2DQ7X 1Y91A 2F49A 4EYJA 2GQSA 3QCXA 5D10A 2PVFA 3ENMA 1FMKA 4RRVA 4U8ZA 4MKCA 1W83A 4IHPA 1ZZ2A 4HVIA 3TN8A 3W16A 5JFXA 3HL7A 4AGCA 5ETCA 4RX5A 2XNBA 3D5UA 5FBOA 4JAJA 3MVHA 5L8JA 3LW0A 3QXOA 5L8LA 3CP9A 2V55A 3QQKA 3QU0A 4WNKA 5T6KA 1R1WA 3GNIB 1REKA 2ZV2A 1JVPP 1LR4A 4KBKA 3QTSA 4OTFA 4X3FA 4CCBA 4QP4A 3AG9A 2H6DA 4RJ3A 4C57A 4ZTMA 3IW6A 3E63A 4JAIA 3UZTA 2C3LA 3QUPA 5EOBA 4D2WA 5ACBC 5T3QA 3GCVA 1UKHA 2X1NA 3OHTA 5CAOA 4DHZA 1OL2A 4GYIA 3WF7A 2W17A 3QQFA 2HENA 4FC0A 4W4YA 3QC9A 3DLSA 4NH1A 3RMFA 1ZOGA 4TN6A 4FTIA 4OAVB 3OF0A 4J8NA 3HA8A 3A8WA 1ZYDA 5L2WA 2GCDA 5AUVA 4HYIA 2X39A 1ZYSA 3CC6A 4QO9A 3JUHA 2RFEA 4LOPA 1UU7A 1F5QA 1KE9A 4P90A 2EB3A 5EYMA 3VULA 4BI2A 1WBWA 4XJ0A 3QZHA 4GMYA 4TPTA 3NRMA 2R3FA 3ZS5A 5DVRA 5GNKA 3QGYA 3SD0A 4BGQA 4X2JA 3W0OA 3VUIA 3BGZA 5CZHA 4EOPA 2CGVA 1OZ1A 4YHJA 4GVAA 4XV1A 4ZOGA 2R7BA 3ZTXA 1P14A 1BYGA 1Q62A 3PP0A 5ANOA 3FMEA 4V04A 5EW8A 3U9CA 4XMOA 2CNUA 3JPVA 3W0RA 5KMNA 2NNWB 2HZNA 2ITYA 1OECA 4BDAA 3SXFA 2W05A 2ZM4A 4U7ZA 3HMMA 4G3EA 4F6UA 4ZZMA 3MVLA 5CT0A 5EQYA 4GVJA 4RJ4A 4F70A 4DG0E 2ZOQA 2HCKA 3VBVA 2PVRA 3GC0A 5ETFA 3BL7A 5EH0A 4YJQA 3SW4A 3SX9A 2W1ZA 3W2QA 2XNGA 3PIXA 3QQGA 5CU6A 4YP8A 2VX0A 3ZCLA 3D5XA 3R7OA 1R39A 4IB5A 2HY81 4C02A 3HX4A 4C4JA 4YZMA 4EOKA 1KSWA 4Y5QA 3CEKA 3U4WA 2ZB1A 3GOPA 5AX9A 2YM5A 3G9NA 3BKBA 3Q4TA 4BDFA 3ATTA 4WRGA 4USDA 3DKFA 4XBRA 5EQPA 5E90A 3ALOA 3TKIA 4BI0A 3W2PA 4AGUA 2OBJA 3VBWA 4YTCA 5ANDA 3RCJA 4IB3A 2CJMA 1AGWA 2PVMA 3QYZA 4BTKA 5HQ0A 3CJGA 5DI1A 2AEGA 1PXNA 4PL5A 4FJVA 4RJ6A 3ZZEA 1FMOE 4BCGA 2BDWA 4FT3A 5J1WA 3PP1A 4WNPA 3OWKA 3PXQA 2VO7A 4KS7A 2X7FA 3LLAA 3BHHA 3R02A 2VO6A 3BYOA 3ZRKA 5HU3A 4BVUA 4KSPA 4FKSA 4R5SA 5IMEA 4CXAA 3OROA 4L9IA 4G1WA 3QUEA 4QQJA 4AGWA 4FNYA 1X8BA 3DAJA 3Q5ZA 3QL8A 4CSVA 2JKMA 4EK8A 4RC4A 3GENA 4IMYA 5E8TA 3THBA 1Q3DA 3GP0A 4NFMA 4QMZA 5JRQA 5BUIA 2JDRA 3DLZA 1OGYA 1PW2A 4EK6A 3I7CA 3MA6A 2XIXA 4IM3A 4OTIA 3MTLA 3ZLXA 2C6EA 3S4QA 1XH7A 1SZMA 5CSVA 4QD6A 3L9MA 4E26A 5E7RA 2IF8A 3R9RA 3R28A 3AMBA 3W0MA 4MH7A 4G16A 3DB8A 3KMMA 1OL6A 4WUAA 5TR6A 4MBLA 2RG5A 3OW4A 3ODZX 3HRBA 1KOBA 2XK6A 4DE4A 3A7HA 5C8MA 4XCUA 3O5AA 4BDBA 4IFGA 1ZYCA 3CXWA 4QYFA 3QX2A 2FH9A 3F6XA 4ASEA 3VBQA 1MP8A 4AT4A 3UIMA 2C4GA 4A4OA 4EORA 5DRBA 2HWOA 3MB6A 3NUAA 2REIA 3AKKA 3UIBA 4AXCA 2VWWA 5CQWA 3QD0A 3DU8A 4FKQA 4IZYA 4M3QA 2WTKB 4AXAA 3P7CA 4N6YA 3VRZA 4CRLA 4DEEA 3CPBA 5FM2A 3HAMA 3ZLYA 2RIOA 1YOLA 4GK2A 4GK4A 5J7BA 4PQNA 2W7XA 4BIBA 4HVHA 4ENXA 4RA5A 5EYDA 2OK1A 4QTCA 4CMTA 3R8UA 2FB8A 3NUYA 4HW7A 5M44A 4W9XA 4FKRA 4JQ8A 3V04A 3UYSA 1TKIA 2IJMA 3U6HA 4QDEA 4BIEA 3EN7A 2SRCA 3DKCA 1YWRA 2YAAA 4XG6A 4DEAA 2WMTA 3DBQA 4NM3A 5DIAA 5HEZA 5ANJA 4FTNA 4Z16A 4BICA 4FSWA 5DFPA 4GL9A 4FKGA 4MAOA 1REJA 2J51A 2QONA 5CVHA 4C2VA 3ORLA 2YN8A 3IDCA 4ZJIA 5CI6A 3IOKA 3L8VA 2IVTA 5HI2A 2IVSA 3L9LA 5CSPA 4DH1A 4EHEA 4QEBA 2RSVA 1JKLA 3KQ7A 5AR7A 3ZSHA 4AP7A 1PMVA 1UU8A 3QWKA 4EOLA 2PVHA 5DT4A 3ANRA 4UB7A 3BLRA 5JH6A 4EWHA 1R0PA 4KIOA 1IG1A 4R6VA 4BCJA 2J0KA 3IW5A 3AGLA 3MIYA 4FKLA 2ZMDA 3EQIA 3BEAA 4LFIA 3DJ7A 5HNBA 3ULZA 4ASDA 3UPZA 5EM8A 2GNIA 4UWBA 4QYGA 4TNDA 3OMVA 3VF9A 5HBJA 3PY1A 3FEGA 4FT7A 4M8TA 4F08A 5HX8A 1E1XA 4YSMA 4UYAA 3HA6A 3UG1A 5CVFA 3U6IA 2I7QA 3ATSA 2XNNA 4KBCA 3TUCA 2ZDTA 3I6UA 3D4QA 3LXNA 3QCQA 1APME 4MCVA 2X81A 4A9YA 3MA3A 4QYHA 2C0IA 3NS9A 3WI6A 3QX4A 3HZTA 4OBOA 1XKKA 3EKKA 3NW5A 3EZVA 4MD7E 2AUHA 2XH5A 4USFA 5KHXA 2Y4IB 2HZIA 3GU6A 4RMZA 3C1XA 3PA4A 5L2TA 3QZIA 3M42A 2ITTA 4QPSA 4TWNA 1CKJA 2BCJA 2W1CA 4K1BA 4TYGA 3C50A 3TI1A 2GHMA 2I0EA 2XVDA 4AACA 5CTPA 4EQUA 2UW3A 4LRKA 3CSVA 5CI7A 3TNIA 1ZARA 4L00A 4NYEA 5CNNA 4KB8A 5A4CA 3UOKA 3KULB 2HELA 3HMOA 4IDTA 2OXXA 3TL8A 3WIGA 3F3WA 2QG7A 3UC4A 5IF1A 3BLQA 3NWWA 4EQMA 4XP3A 4IWDA 3TUBA 2H96A 2RKUA 4DN5A 4LOOA 4FOCA 3MWUA 3PY3A 4J71A 5D9HA 3ZZWA 3LCSA 4FIEA 3CGFA 1CKIA 4IAZA 1YI4A 2VWIA 3F3UA 3GCPA 1JQHA 3Q60A 2YITA 4E4MA 2G15A 2VWUA 3VBYA 4QTAA 4AZFA 3NUSA 4EOQA 2OI4X 4XG8A 5TO8A 3LCTA 1WZYA 3NFFB 4I6LA 2PVNA 4L7FA 3S2PA 4AQCA 5HBEA 5H8BA 4PDOA 3BE9A 5J8IA 2JDOA 4GUBA 2X0QA 3MJ2A 3QRUA 2CLXA 3COMA 3BBWA 3RM6A 4F99A 4FSYA 3DPKA 4FSTA 4MXAA 2C3JA 4BY9E 4NKAA 4IE9A 4EI4A 3G0FA 4CZYB 4YURA 3UO6A 2WPAA 1JKKA 3MPMA 1O9UA 2X0GA 3FLYA 4I4EA 3OWPA 1PMEA 3FUPA 4RWIA 4X0MA 2JLDA 5AAFA 4AW1A 1JKTA 4UWCA 5LVPA 4KA3A 4AZEA 4S30A 2YIRA 4Y95A 3UE4A 4Q9ZA 1YXSA 4N6ZA 2VX1A 3ZDIA 4H3PA 4IVCA 4YZ9A 3ZU7A 1YXXA 3RWPA 3I1AA 5IQDA 2BRGA 4FG9A 4O22A 3UO4A 1LEWA 2ONLA 3ZDUA 4CKRA 2W0JA 5J7HA 4AE9A 2UVYA 4RJ8A 5BVNA 2ITUA 5BVKA 4ZTHA 4FR4A 4EOSA 4XEYA 2J0LA 5DG5A 5AA8A 3Q5IA 5BQ0A 2BTSA 3OC1A 4E6DA 1O6KA 1ZOHA 4LL5A 1GOLA 3KU2A 4R7HA 3NUXA 1YRPA 5ANGA 3T9TA 2UZTA 1UWHA 4IJPA 5AP4A 4OT5A 4B7TA 2J0IA 3OY1A 5AP5A 1UA2A 1BKXA 2YIWA 2IN6A 3NYOA 4RVLA 3OVVA 3UP2A 3KXGA 3MI9A 2J7TA 4RT7A 4MNFA 2QURA 4BWXA 5IPJA 3W2RA 3MN3A 2WIPA 3PY0A 4CG8A 2WTVA 3BX5A 5KMKA 1ZMVA 2HXQA 2XM9A 3HV7A 5HE3A 2VO0A 4F9YA 4UX9A 1I09A 2PE0A 4LI5A 2WTWA 1JSVA 2FSLX 3DZQA 3FJQE 4B8LA 3RK5A 4EH8A 1UU9A 2RL5A 5J5SA 2OF2A 5DHJA 5KCVA 3BIZA 3R8LA 3RALA 5I9ZA 3NNVA 2X6EA 3FYJX 5KHWA 4LMNA 4EHZA 1PJKA 3S95A 4JDJA 2BRHA 1J3HA 1UNGA 5K9IA 3UP7A 2YEXA 1WAKA 1PYEA 2HY0A 2WQBA 3DKGA 5DR6A 2CKPA 2XARA 4RC3A 4NTSA 4XLIA 4IDVA 2PVKA 3OTVA 3C0IA 5CWZA 4DCAA 1SM2A 2R3GA 4CFVA 5HCXA 4DH3A 3RWQA 4EK5A 4JRVA 3G6HA 2WMUA 3PLSA 2PULA 1YDSE 1OPKA 2WFYA 3BHVA 5KZ0A 3OFMA 3OT8A 4FX3A 2OJIA 2W96B 5JKGA 2E9NA 2Z7RA 3BYMA 4IAFA 4LM5A 5DH3A 4XOYA 1U5RA 3R63A 2GS6A 5AEPA 4DHFA 5FDXA 5HORA 2BALA 3KF4A 2CCIA 4F09A 5T68A 2WGJA 2QOKA 4X21A 2W1EA 4WT6A 1JWHA 3PFYA 2UZVA 5IQCA 1BMKA 4BCHA 4WKQA 4FEVA 2BDJA 2WU6A 3JVRA 4FNWA 4AXDA 4H58A 4WG4A 4D1ZA 3K5VA 3R30A 4II5A 2XKFA 3MY0A 2J4ZA 4V0GB 5C27A 4UXQA 2Q83A 5KE0A 3COHA 3D83A 3MVMA 4KIQA 5FP5A 5HE0A 3IPHA 4ASXA 5AJQA 2HAKA 5E1SA 4U45A 4OBQA 1SYKA 3IW7A 4QOXA 4AZWA 2BPMA 3QZGA 2YAKA 1H25A 5E8ZA 2XK8A 4DHIB 5E9EA 3EN5A 3E64A 3F88A 1MUOA 1VR2A 4YTIA 4FUXA 3TJCA 1J1CA 4F63A 3A4OX 5JFVA 1DS5A 5FQDC 3I81A 4TW9A 4EK3A 2EB2A 4BDEA 4BFMA 4G6NA 4M14A 4EL9A 5LQFA 2BKZA 4ANSA 3OT3A 5G1XA 4YJPA 4HOKA 1LP4A 2XJ0A 3F5PA 4YMJA 3VUGA 1BX6A 3ULIA 4UBAA 4RG0A 3D5VA 2PZYA 5AUZA 2J6MA 4MUQA 2VGPA 2C6DA 3HRFA 4NJDA 3VQHA 2ITOA 2G01A 4BB4A 1BL6A 5AR8A 4KKHA 4RSSA 4AN3A 3KB7A 3ORPA 5GZ9A 3WZEA 5IDNA 3P4KA 1NT2A 1I44A 4JMQA 1VEBA 4BDHA 2BROA 4BZOA 2PSQA 4PPBA 3L8SA 1WBVA 3A7FA 3KCKA 2Z7LA 5HCYA 3TT0A 3D7ZA 2RF9A 1Q97A 2F4JA 4AFJA 4HCTA 5M4CA 5CF4A 5ETAA 2A27A 4JT3A 3QA8A 4ACMA 3TNPC 4KIPA 4QNAA 1IR3A 2VWBA 3Q2MA 3U51A 4RGJA 2ZAZA 3QKKA 4TYHB 4BCQA 5FXSA 3HRCA 4BKZA 2YIYA 4YJRA 2QHNA 4ALUA 2JAVA 3ODYX 4AA5A 4EHGA 4PRJA 5IQGA 2XRUA 4QNYA 2J0JA 3FPQA 2Z2WA 5CALA 2P4IA 3II5A 3CY2A 2BAJA 2E9OA 4ZSEA 2PZPA 4ENYA 2VNYA 1M14A 2IW9A 3OCTA 3GOKA 1H1WA 3Q52A 5E4HA 2FSMX 1TZDA 3E5AA 2RGPA 4NM0A 3ETAA 3RPYA 1Q5KA 3ITZA 5M4FA 5M06A 4DFXE 3K54A 3PWDA 4FSZA 2CN5A 4JG7A 3R21A 4O2PA 4PP7A 4D58A 4G3GA 3CS9A 3LFDA 3HGKA 3ZC5A 2BZHB 2CKOA 2BZIB 4H05A 4Z3VA 2CCHA 2J5EA 2XKCA 3UZPA 2B55A 3BU5A 2XAMA 3VO3A 1GNGA 2YERA 4NT4A 4DEDA 5LVOA 4QDVA 1R3CA 4L3LA 3QA0A 2VTJA 4L53A 2XNPA 4AW2A 5CAUA 4NU1A 4D2PA 4GFGA 2GQRA 2XB7A 1ZYJA 3TKUA 5IH6A 4JDHA 5E92A 2G1TA 2GMXA 1H0WA 3MH0A 1W2CA 3BU6A 4E4LA 3R7IA 1ST4A 3R7UA 3FMDA 4WRSA 4FZ7A 2WU7A 2Y0AA 4PMMA 4MF0A 4F7SA 5H2UA 5TE0A 2YZAA 5IA2A 1OIYA 5HKMA 5HTCA 3K5UA 2AC5A 4O91A 5IKWA 2WMAA 2WMWA 3ELJA 3QKMA 1ATPE 1JKSA 3W0PA 2OICA 4PP9A 4D2VA 5E8UA 3FL5A 4XV9A 4D2SA 3NAYA 2QOLA 3N51A 3OXIA 2KTYA 5C03A 4R78A 5CF6A 2PMNX 2IZSA 2XYUA 3CTHA 4W9WA 2B53A 4Y46A 5H3QA 4D0WA 4AZSA 1XMLA 2IWIA 3E3BX 4FK6A 3UMXA 4JJRA 3BLHA 3TG1A 3E92A 5IDPA 2BFYA 3WF5A 4ACGA 2UZLA 3DXQA 3FLZA 4YO6A 4PUZA 4G3CA 4U6RA 3V5JA 3PVBA 3CQEA 4XOZA 3FI2A 3KRWA 3RINA 1LUFA 4GU6A 3W8QA 3Q96A 4YLKA 2R4BA 2EXMA 2OJGA 4TWPA 2BHEA 3KXMA 2B4SB 2PHKA 2W5HA 2YCQA 1H8FA 5AUTA 3L1SA 1JPAA 4C58A 4CKJA 4X3FB 5FEDA 4ZSJA 3W32A 5BUEA 4D28A 3MPTA 4I5MA 4QP8A 1UKIA 5BYZA 2GTNA 2YISA 5AX3A 4TZRA 2PU8A 2BDFA 3F5GA 5EYCA 2UUEA 3UODA 2HOGA 3LCDA 2XANA 3IGGA 3B2WA 3HEGA 3VUMA 5GZAA 4H39A 4NW5A 1GZ8A 4GEOA 3V8WA 2Z02A 4E8AA 3MPAA 4G2FA 1HCLA 1MRVA 3P7BA 1GIHA 4DH7A 1XHAA 2GSFA 4ZY4A 5EKNA 4NIFA 3VUDA 3BRBA 4J96A 5A9UA 1NVSA 5ACKA 4DTAA <