5KBRA

Pak1 in complex with 7-azaindole inhibitor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
288
structure length
259
Chain Sequence
EKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAEVAIKQELIINEILVMRENKNPNIVNYLDSYWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRNIKSDNILLGMDGSVKLTDFGFCAKRSEMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLDMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PAK 1
publication title Optimization of Highly Kinase Selective Bis-anilino Pyrimidine PAK1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 259
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kbrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kbrA01
4D4SA 3ORLA 4U80A 3FSFA 3T8OA 2QO9A 2PZYA 1ZYDA 3H4JA 3OC1A 2VWXA 4LL0A 1DM2A 5DR9A 5E8VA 3U9CA 4CCBA 3OHTA 3QTQA 4ZSGA 4FI1A 4ZLYA 3O51A 2BCJA 1Q97A 4ZLZA 4BR3A 3QTUA 4WIHA 2C6KA 2GHGA 3UDBA 4OTQA 5HBJA 4Q5EA 3R30A 5E8TA 3MTFA 3I5ZA 4TL0A 3TNWA 3I6WA 5CU2A 1Y8YA 3DS6A 5HBHA 2QD9A 4CG8A 4I41A 5FWKK 3HAVA 4RJ7A 1APME 4C62A 2XK3A 4JIKA 4XG9A 2PK9A 3BYVA 4FL2A 3L9NA 1KE9A 3SXSA 3B8RA 4Z16A 1LUFA 5I3OA 1OL7A 2W4JA 5CI7A 3S0OA 4ZSAA 1OL1A 2R3PA 4FKJA 2R9SA 4M14A 3VQUA 1PRYA 2R3MA 2ZM1A 4KUJA 2VTOA 4NJ3A 3THBA 3TNIA 5BYLA 1H07A 2XK8A 4E4LA 1JPAA 3CEKA 4FV7A 3ZEWA 1KOAA 3KB7A 5AR8A 2J7TA 5CF6A 3ITZA 4WD5A 3I0QA 3R04A 4OTGA 1YHVA 4QMYA 4ERKA 2UW3A 4FKIA 1XR1A 3IQ7A 5E92A 3DNEA 3ZTXA 4D2VA 2VTIA 2X7OA 5HQ0A 2BRBA 4ANNA 2OO8X 4EK4A 4GJ2A 3GGFA 3RP9A 1BMKA 2QOIA 3AGLA 4CT1A 1A48A 4ORKA 4PDOA 4FTKA 4J1RA 3DU8A 5DR6A 4LGDA 5HG7A 3PIYA 5BUJA 3G5DA 3L8SA 2C6LA 2JD5A 4GKHA 2B9JA 4B9DA 2YM8A 3GVUA 4YC3A 2JDVA 3ANRA 5D12A 5ICPA 1OKVA 4L43A 4TYHA 3IG7A 4RVKA 4I6HA 4QNAA 5CEPA 3OD6X 3QWKA 3ALNA 5IH5A 2B52A 4KIPA 2V22A 5T68A 2B55A 2YISA 3R73A 2JAMA 3FYJX 4NKAA 2WMXA 3W2RA 3FKNA 4A06A 5KMNA 5TKDA 1TQMA 3JVRA 4J52A 5C4KA 4I6QA 5EHLA 1OMWA 3MVJA 4IJPA 5AUXA 3IDCA 4ENYA 3ZM9A 2QO2A 2X39A 4H58A 5JFXA 1MQBA 2GS6A 5AR3A 2JAVA 2OW3A 4IM3A 4PL3A 2HWOA 3BIZA 5DT3A 5KZ0A 3PVWA 2CKPA 5EFQA 5ETAA 4YNOA 3HRFA 3CD3A 2UZEA 1VJYA 1BL7A 4XG7A 5BVEA 3JUHA 3UVPA 4FSNA 5CS6A 3P7BA 4FMQA 3RHXA 3VRYA 1O6KA 3ACKA 4IH8A 3VUKA 4F64A 3A61A 2GNGA 3EFKA 5D10A 4FT5A 2PZIA 4RFZA 2OZOA 3TXOA 4S33A 3VO3A 3LCTA 1JSTA 4MXZA 4M0YA 3LHJA 2CCIA 4O0VA 5EOBA 4DH5A 2YN8A 4QP1A 4YZMA 4H1JA 3SDJA 1GZ8A 5K4IA 4O21A 3GCUA 2W05A 2XH5A 4D55A 4IAZA 3G6GA 3QQGA 4QMVA 3KKVA 3MYGA 3DKGA 3H3CA 4XOZA 3JS2A 3RHKA 4DFXE 1BKXA 5AIKA 4QNYA 2OH4A 4W4VA 5CZIA 3SXFA 4DTBA 5HNIX 1YW2A 4NTSA 2PSQA 3P23A 2ZV2A 3V51A 5C8KA 4YJTA 2W9FB 2R3RA 3NUUA 1H1WA 4FSUA 3SOAA 5DI1A 3ULIA 3ZXZA 5CAOA 5KMLA 3Q9ZA 3CGOA 5FTQA 3DB8A 4BIBA 5LCKA 4KKGA 4O0YA 2ZYBA 4UXQA 5KCVA 3SG9A 2F7EE 5KE0A 2GU8A 3IW8A 2I1MA 2WTVA 2OU7A 5KMMA 3E5AA 4HYUA 2EVAA 3C4XA 3QTXA 3NCGA 5BVFA 4QQJA 3L1SA 1YOJA 3R7EA 1SNUA 2VWWA 3FLQA 3QKKA 4UY9A 3WZDA 3R8ZA 3MH2A 3HAMA 3DB6A 4FIHA 3MFUA 1S9JA 3T9IA 2F49A 4C59A 3BGQA 5FEQA 5CALA 5HE0A 3F2RA 4EOPA 3IONA 4D28A 3VUMA 2ITWA 5DE2A 5IQBA 3OMVA 3QTIA 4DHFA 5CSWA 4D2WA 2BAJA 3GCQA 5E8YA 1OIYA 5EH0A 4C4EA 3OY1A 3PZHA 4L00A 5K0KA 1URCA 1YDTE 3OFMA 1U4DA 3VQHA 1IG1A 3GFEA 3QQFA 3R00A 1PXOA 4M3QA 5ANEA 3WOWA 4BDJA 5BVWA 4ALUA 4DF3A 3HRCA 3LW0A 5HE1A 4ZMFA 1ZY5A 5AUVA 4JX3A 1CKIA 5B0XA 2XK4A 4DH3A 3QTSA 3FY0A 4S34A 4E4MA 3A7FA 3CR0A 5AP3A 4FG9A 4I6FA 2VO6A 4P2KA 4AOJA 2WEIA 1W82A 4KSPA 2J50A 3KRWA 4IWDA 2HW6A 2UVXA 2GFSA 3D94A 4M0ZA 5CY3A 5JH6A 4RQKA 4O27B 3G15A 3JR1A 1L3RE 4L7SA 5GZ8A 3FSKA 5BYZA 2C6DA 2BRMA 4C37A 4W4XA 4IM2A 5IF1A 3KXXA 5B2LA 3PXFA 4K2RA 3KF4A 1J1CA 5TF9A 5KUPA 4YHFA 4R1VA 4WHZA 2GNIA 2CSNA 2QKRA 3MBLA 2IVSA 4OAVB 1DI8A 5JMSA 5HOAA 4O2PA 3QTWA 5IMXA 1BI7A 2QOHA 4N0SA 4R3RA 4W4WA 4I5HA 3VBXA 3WIKA 4K0YA 3JXWA 4M84A 2W1ZA 5JRSA 3N4UA 4AA5A 3GP0A 3GNIB 2PMIA 4Y5QA 4C4JA 4DTKA 4IWPA 5FDPA 4S32A 2WTWA 4QPMA 2ITVA 1JNKA 2J4ZA 3DTCA 5CX9A 2G1TA 4MF0A 3UIBA 3TWJA 2OJGA 3VS0A 4OTDA 3VUIA 2PUPA 3RAHA 5H2UA 1J7UA 1PMEA 4ZTQA 4PPCA 4IANA 3ELJA 3Q6WA 4ZY6A 4AS0A 2QLUA 3RJCA 3VNTA 1UV5A 3OCGA 3ATTA 4D1SA 4G31A 2C6TA 4RWKA 3RMFA 3DBFA 1KV1A 1OL6A 3R21A 3U51A 3BZ3A 3PXKA 3QYZA 1U59A 4QP7A 3ORPA 2B4SB 4RC4A 2X81A 3EIDA 5D7AA 5J9LA 5KZIA 3QUEA 4FGRA 3D14A 3Q2JA 3GFWA 4RJ6A 1JKKA 5E8XA 1IA8A 3PVGA 4WO5A 4GKIA 3EN4A 2REIA 3AQVA 2XBJA 3R7UA 3WF8A 3CKWA 5HCXA 3ZEPA 4C57A 3DAEA 4OR5A 3L8PA 3S4QA 4AN2A 2FVDA 4QO9A 3VS1A 4XP3A 3FLSA 1PKGA 1IEPA 4XYFA 5CSXA 3NX8A 4F1TA 4GYGA 4X2KA 1ZZ2A 3R01A 3FI2A 4MBLA 5AP6A 3UZRA 1A06A 2WMQA 2E2BA 4I92A 4D4VA 1TKIA 3O7LB 4EOOA 2PHKA 3SQQA 4GT4A 4I5CA 4A7CA 1UVRA 4AAAA 4C58A 4L6QA 1B39A 4F6WA 2QU6A 3F2AA 4I6BA 2RFDA 4U40A 3NUPA 2BALA 1OB3A 3BLHA 4K9YA 4X2JA 4ZTLA 3TKUA 5J1WA 3FBVA 2YZAA 1YOLA 3FHIA 3FMHA 4FSZA 2QNJA 4FV9A 4QPSA 5FGKA 5AX3A 2ZAZA 2Z8CA 4M69A 5HZNA 3BCEA 3QKMA 2NPQA 3FLYA 3O96A 3AT3A 4H36A 4P5QA 5JT2A 2CGXA 2I6LA 4K8AA 4JG6A 4HYIA 2WEVA 2W1GA 1R1WA 2I0HA 5DT0A 1OKZA 1LP4A 1OL5A 2X7FA 4HGSA 4RT7A 5EI2A 4FA2A 4NK9A 3NW7A 3ORNA 5CQWA 3RWQA 4K33A 3HDNA 2RGPA 4CLIA 5IPJA 1PXMA 3FAAA 4MXAA 3ZO2A 5A6OA 2PVHA 3C7QA 1P5EA 3QQLA 4O91A 4F0FA 4YR8A 1PHKA 2YWVA 4QP8A 4QMPA 4RRVA 4E6AA 2G2IA 4IB3A 4M12A 2QVSE 3FKLA 4UWBA 4YO6A 3WZEA 5A4EA 1RW8A 3NYVA 4TZRA 3KEXA 3MA6A 4I3ZA 2WQMA 3EZVA 2WQBA 4IB1A 1M52A 5DWRA 4GU6A 2F2UA 2WU7A 3OW3A 3DNDA 4LUDA 3F5PA 2DS1A 5EM8A 1FQ1B 3UO4A 4CRLA 3LXKA 4EJNA 4ZLOA 5L2QA 3KGAA 4E73A 3MB7A 4FV6A 4YUQA 3UC3A 3HYHA 2UW8A 5EQEA 4TPTA 3PSCA 3W1FA 2PE2A 4S2ZA 2JKKA 1UKIA 4XP2A 5T6KA 1M17A 2X8IA 3P0MA 3QQJA 2DUVA 4BTFA 4J96A 4XHKB 2OZAB 2QURA 2ZB1A 3HGKA 3FMEA 4BTJA 4CFVA 2Z60A 4BL1A 2YWPA 3FL4A 2XNBA 1PMUA 5HX6A 2UZUE 4QYHA 5AV2A 3LFBA 5AAEA 2QHMA 2R3JA 5M53A 2HXLA 1BLXA 3RK7A 3VBTA 4KIKB 5HEZA 3IKAA 4LRMA 2GPHA 3EYGA 2BAQA 2XIYA 3QWJA 4AX8A 1FBNA 2EXCX 1PKDA 3QQKA 5CU6A 1ZYJA 4F9AA 3IS5A 2VWVA 3Q4ZA 3NIEA 2PWLA 3ZHPC 2AYPA 2XB7A 3O71A 4FBXA 3QYWA 4CNHA 3FMJA 3P1AA 3TACA 4QMLA 1NVSA 2XJ1A 3NDMA 3UO6A 4ZXTA 5G6VA 1JQHA 4DA5A 2WTKB 2G15A 4AE6A 3ZXTA 3WZUA 1KE7A 4YJUA 3ORTA 2JDSA 1SVEA 2VD5A 4B4LA 2W4KA 3ID6C 3MIYA 4B0GA 2IO6A 2WMUA 3PVUA 4LRKA 4PMSA 3BX5A 2VU3A 2CLXA 4XG3A 5HLWA 5J7HA 1H28A 3U87A 3EQCA 3FY2A 3RAWA 2QI8A 3DZOA 3S00A 4EOIA 5HD7A 3E63A 4DLIA 1Z57A 2PVNA 4USFA 3AXWA 4M68A 5HG5A 4FSMA 3ULZA 4ACCA 3SC1A 4ITJA 1SVGA 2HAKA 4LGHA 4OT6A 4BCMA 4FF8A 3A7JA 2VX1A 2W4OA 5D7VA 3BQRA 3QHRA 3VULA 1ZZLA 2GNLA 4CZTA 3PIXA 4FKSA 1DI9A 1Q62A 5A3XA 4HCTA 5IUGA 4CFWA 2W17A 4EWHA 3NUSA 3TUCA 1K9AA 4KKHA 2UZOA 2X9EA 2Y7JA 4JR3A 2YDJA 2R5TA 3LOKA 3SG8A 5E8SA 5H8GA 5FXRA 5HICA 5TOZA 4RVMA 2BR1A 3Q9XA 1HCKA 1K3AA 1PMVA 1QPCA 2BDFA 3KY2A 4RVTA 4FKQA 2FSOX 3O8TA 4GW8A 3A8XA 3Q4TA 4FTRA 2WD1A 5CVFA 5JFVA 4EC8A 3E8CA 3U6IA 3P7CA 1QPDA 3GEQA 3NGAA 1RDQE 1LR4A 1Q8UA 1Q4LA 2QOFA 1G8AA 2QR8A 1UNHA 5I9YA 4E6QA 2UW0A 4BCOA 3BE9A 4EZ7A 3TNQB 3DQXA 4H1MA 1CMKE 3HV3A 1PF8A 4GIIA 4PTEA 5A54A 3H9OA 3NNWA 4NW6A 5EOLA 3IGOA 1O6YA 3PY3A 2KULA 2V0DA 4L7FA 3ET7A 4JBPA 4K18A 4YJQA 3BYUA 2C3JA 4RC3A 2YERA 3RI1A 1OVEA 1YRPA 5ACBC 4AW0A 4UZDA 1UU9A 2VX0A 2UW4A 3R9HA 4KA3A 4N4SA 3EYHA 4UEUA 3EHAA 2FH9A 2VTPA 3OEFX 2I0EA 4V04A 5M4CA 3PP0A 1Q3DA 3P7AA 4KIOA 4O7VA 1PXJA 4JDIA 4R3PA 3P86A 4L52A 5CYIA 3UQCA 1V1KA 3DTWA 3ZZWA 4EOMA 3UP2A 2AC5A 5CSPA 2UZNA 3RTPA 1H1RA 4N6ZA 4ACDA 1ZARA 2R3QA 3EFWA 5HGIA 2VRXA 4DEDA 3BU6A 5AV1A 3OT8A 3BLRA 2ERKA 1H0VA 1ZWSA 1H01A 3F3VA 4PTCA 4O0RA 2ITPA 4QQCA 1PMNA 4QP4A 2V7AA 3TEIA 2OBJA 4QMNA 4NCTC 5I9UA 5AM7A 5LVNA 3TKHA 4GRBA 4ANSA 5K0XA 4P7EA 4AUAA 4RIXB 3GT8A 3R28A 3VRZA 2X8EA 4QMTA 2XIRA 2PMNX 2R7IA 4X0MA 5BUEA 2PVKA 1VYWA 1J3HA 2PE0A 4G3GA 4LYNA 4Z55A 1J7LA 2JBOA 1CTPE 2HZIA 4IX3A 5IA3A 4DH8A 4O1OA 5AR7A 4QMUA 3NYNA 4GK4A 3G2FA 3FLWA 3TZMA 4W4YA 2ZV7A 4BKZA 1GZOA 4F7NA 1ZY4A 2ESMA 2QHNA 5CEMA 5EYCA 4TRLA 1ZYSA 2CNUA 3D7TA 3KVXA 5TR6A 2Y9QA 4DBNA 3FMKA 3QRUA 3FXZA 4ZY5A 4G3FA 4IZYA 2XIKA 4NIFA 3GQLA 3UIUA 2H96A 2PMOX 3F61A 4AOIA 4YJRA 2A19B 2H9VA 4CV8A 4DG2E 5IQFA 5HI2A 3TUBA 5HE3A 5FEDA 5DIAA 5M4FA 3ALOA 4HPTE 4MHAA 3K3JA 5TE0A 2WTDA 4GMYA 4EKLA 4XH6A 1TVOA 4MK0A 3MH3A 2XNPA 5CU4A 5I4NA 4WSYA 4QMZA 2Y6OA 3C50A 1YI6A 4C4GA 3CP9A 3II5A 4FNZA 4L3PA 3V5JA 3OXTA 2OF4A 4NWMA 4OAUC 2XNOA 1R39A 3KMMA 1KE6A 3AOXA 5JZJA 3R1QA 3DLZA 1ND4A 4R77A 2C3KA 1VEBA 2P0CA 2VZ6A 4GK3A 3ROYA 3RPSA 2J9MA 4DGGA 2O63A 3IW7A 3DK3A 2VWBA 3OCSA 4C3FA 1P2AA 4Y95A 2QOCA 2EU9A 2R3HA 4FSYA 2QOKA 2ERZE 3MY0A 3DKCA 4AZVA 4QTDA 4ASXA 3LM5A 2VWIA 5LOHA 3SHEA 3ANQA 4OBQA 1GOLA 3ZM4A 2IVUA 2JITA 4XLVA 4R7BA 2C30A 5CNOA 4R7HA 2WMBA 3MJ2A 1ZRZA 2WKMA 2YJRA 3KQ7A 3QLFA 4AWIA 4N57A 4BCFA 4O7YA 3ORMA 2JBPA 4GT5A 4RZWA 5I9WA 4M7IA 5FBNC 1YXXA 3IECA 4V05A 3FL5A 5IA2A 2PUUA 4WNOA 4BHNA 4EH5A 4P4CA 3RM6A 4ZSJA 3SX9A 3KF7A 4QP6A 1PYEA 2XNMA 2C1AA 2Q0BA 4W9XA 3R9RA 5AR2A 1DAWA 4GCJA 2V62A 3BHUA 5JN2A 3KN5A 3PPZA 3NMUF 3R9OA 4FOCA 4OTPA 1JKSA 5IEYA 4ZP5A 4E26A 3C0GA 3KK9A 3EKNA 3IGGA 1OECA 4IB0A 2WFYA 4JRNA 5EDPA 2RF9A 4NJDA 4GL9A 5EI8A 3W2PA 4BDCA 4FG7A 4UMUA 5KMKA 5E1EA 1WBVA 3PRIA 2VTAA 4F99A 4D5KA 4X2GA 2O5KA 2YCSA 2QOBA 4M67A 5HNGA 5IA4A 1NVRA 4D4YA 3HEGA 2NRYA 2UZVA 4IQ6A 4JAJA 2F9GA 4DGOA 5F1ZA 2QLQA 4DBXA 4QTAA 4U81A 3BU5A 3C4WA 3OXZA 4X6QC 2ETKA 2VWYA 3CBLA 1YDSE 3IDBA 3KRLA 3Q9WA 2BTSA 3LMHA 4EYMA 5GHVA 4UBAA 3OOGA 1OBGA 4WUAA 3N4VA 4FV0A 2WU6A 4Z3VA 3IO7A 4RX8A 3ZFXA 4O0UA 1YI3A 3CD8A 3H0ZA 4FNYA 4LMUA 2XJ0A 1XBBA 5E8WA 4D1XA 5E1SA 4E93A 4DCAA 2W06A 5CAUA 2YDKA 2I7QA 3U4WA 4WG5A 4ZZOA 5IQDA 1M2PA 2GNHA 2YIWA 4JVGA 2HXQA 3ZLSA 4C4FA 5BPYA 2W96B 1PXIA 2GS2A 4KB8A 4D4RA 4EOKA 4YZ9A 4EQMA 4FZ7A 2XNNA 2OJJA 2XS0A 1SYKA 4IXPA 3R8VA 3ZFMA 3VS6A 3ZO1A 5AUTA 4EL9A 4O7RA 1STCE 3NAYA 2W1CA 3EN9A 2CNQA 2VNYA 3D0EA 4MAOA 5CSHA 2QO7A 2X6EA 3ZZEA 2OXXA 2XYUA 3ROCA 3NRMA 3D15A 5C26A 2C5VA 4BGQA 4F1MA 2BIYA 3BPRA 3OBGA 3QZGA 2Y8OA 3QL8A 3COIA 3ZDIA 3EQHA 4MKCA 1AD5A 4PL4A 4AACA 4CSVA 4FGBA 2AUHA 2C5OA 4IMYA 3L8VA 3M11A 3VIDA 1UKHA 3FPQA 4O1PA 5HU9A 2IN6A 4GK2A 3WE4A 2R4BA 1Z5MA 4F6UA 3KCKA 2BKZA 2J5FA 2W5BA 3VBQA 4RZVA 2R3NA 5JFWA 5AV4A 2Z02A 2Z7LA 4K1BA 2QONA 3P5KA 4H3QA 5AM6A 5BVKA 2FYSA 3IOPA 3HA8A 3OROA 4XOYA 4KINA 4G9RA 2HZ4A 3TDWA 4MQ2A 3OZ6A 2GTNA 4AOTA 4BCPA 3ZDUA 4UYNA 4Y73A 4YGAA 3RALA 3VC4A 4A9UA 5A4CA 2CNVA 1OPJA 3OG7A 2XEYA 3BWJA 4WG4A 5ETIA 5CEQA 4JRVA 3W16A 3GU5A 3MDYA 4FTNA 3NS9A 3RM7A 3EKKA 5IEVA 2VTNA 3BLQA 3MA3A 3PTGA 3RNIA 4FZ6A 4EH7A 4YO4A 3NUAA 3W8QA 4G34A 3LCDA 4JQEA 2BFYA 4L44A 2GNJA 3DLSA 2IZSA 4O81A 3GU4A 3ZC5A 4YMJA 1RQQA 2QCSA 5HIDA 4GS6A 4O7ZA 4Y85A 3W2QA 4AF3A 4D2RA 5C8NA 4K77A 4EOLA 3ZU7A 3EJ1A 3U9NA 2OF2A 4ASEA 4BTMA 5EDQA 3VUGA 4FKVA 4PTGA 3U4UA 4QMQA 4HNFA 3FEGA 3N51A 5J87A 3LKMA 2OFVA 3OY3A 5EYMA 3SGCA 3F7WA 2JC6A 3EQRA 3G9NA 3PSDA 5AUUA 4O7TA 3PPJA 2CGVA 3HP5A 3LMIA 4J7BA 5AMNA 3BE2A 1UNLA 1UWJA 2R2PA 3E3BX 4FICA 3MN3A 4FX3A 1ZMWA 2CN5A 3E8NA 4XV9A 3G0EA 3ERKA 3EN6A 2XKFA 4XUFA 3VHKA 3COHA 1GZNA 1WAKA 3IDPA 5CWZA 5C27A 3WF6A 4EH4A 2PULA 3QKLA 3F3ZA 4E7WA 4QP2A 2F57A 3EFLA 5E91A 4R5YA 5FBOA 3MI9A 4M15A 4TYGA 5DFPA 3RAIA 2VGPA 4QQTA 4O86A 3V5QA 5LMKC 2G2HA 2W1DA 4AW1A 5LCJA 2OIQA 2ETRA 2PVYA 4RIOA 1NA7A 2HELA 3KXNA 4IIRA 3C5UA 3P4KA 5GNKA 4JG7A 3RNYA 3CTQA 3UPZA 2XRWA 1UU8A 4FIFA 3ZC6A 5AIRA 3R2YA 4DH7A 4EONA 4BCGA 3COMA 3UC4A 3UGCA 4BY9E 3A7HA 4WRGA 3OUNB 3TUDA 3LXLA 4EORA 4IHPA 5FD2A 4C3RA 4YJOA 3TZ8A 2J0KA 2QR7A 3CJFA 2X2MA 5CU3A 1OBDA 4D2SA 3QD3A 5F9EA 4TYJA 4R78A 2OI4X 4AGUA 4LOPA 4ZTRA 5DT4A 2BHHA 2OK1A 3LQ5A 5GJDA 3ZSGA 2YM5A 1U54A 5IKWA 5L8JA 1DS5A 3LCSA 3EL7A 4Q2AA 2FSTX 3NNUA 3VW6A 4D2TA 5B2MA 4NM3A 4WOVA 3GC7A 4A4OA 3LFSA 5L3AA 3MFSA 4EHVA 4F4PA 1J7IA 3PFQA 4IDVA 4WNMA 4AA0A 5ETFA 4EOJA 5C9CA 2FO0A 2GHMA 3MGYA 4UB7A 5ITAA 5IQEA 1W7HA 2CLQA 3Q04A 2C0IA 4IX4A 5L2IA 4O2ZA 4RVLA 2J0IA 3WI6A 4RX7A 3CY3A 3AMBA 2YLEA 5E9EA 3R7VA 4X6RA 5A4TA 1SMHA 3OBJA 3CPBA 2PL0A 4I0TA 4L3LA 5AUWA 4R7IA 3RCJA 4ZS4A 1G3NA 1GY3A 4EK6A 1LPUA 4FNWA 4G5JA 5TO8A 4FT3A 1GJOA 4WBOA 4JDKA 3DT1A 3MH0A 5CASA 3ZFYA 2XMYA 3R7GA 3U55A 4RFYA 5L8KA 3FMMA 3DDPA 2PY3A 1ZYCA 3I60A 4JDJA 2VTLA 3HMOA 3TCPA 1PXLA 4U7ZA 5KBRA 4AT5A 2WQEA 2YITA 5IQCA 1JVPP 4EOSA 4NW5A 2BZKB 5C8MA 1CSNA 2GHLA 2R64A 3K2LA 4MXOA 2R7BA 5EI6A 2VWUA 2BZHB 4E4XA 4AG8A 2A2AA 4XG4A 2DWBA 3POZA 4F08A 3NUNA 4DEHA 5AUZA 4BCIA 2RL5A 2W1IA 2Z7QA 3FMLA 3I1AA 2CCHA 4S31A 3FWQA 3OWKA 2V55A 2OJ9A 3LFCA 4PDPA 2PUIA 2RG6A 3DBDA 3BV3A 3R0TA 4CMOA 5AEPA 4L53A 2GQSA 2BZIB 3QC4A 1XH8A 4BBEA 4F0GA 3TV4A 1MP8A 3AGMA 3ORKA 4BI1A 2XBAA 2YFXA 2GQRA 3Q32A 3QA0A 4I24A 2C3IB 2UW9A 2V5QA 4G3DA 3CXWA 4MBIA 2O2UA 3SXRA 4FV3A 4EK8A 3JY9A 2BRNA 2GFCA 4IW0A 4MWIA 1YQJA 4FTTA 4LQMA 2P2IA 1Q8WA 4FVRA 3ZRMA 4DEBA 2OIDA 3MIAA 3KREA 3ATSA 4EJ7A 4Y8DA 4D9UA 3QZFA 3TV6A 3V8TA 4ALVA 2OZAA 2Y4PA 3EQFA 5CT0A 3TV7A 3UG2A 4BFMA 1ZOHA 4YHJA 3WBLA 2VO0A 4CEGA 2ZDTA 3HMNA 5CANA 3PY1A 2VTJA 3AD4A 4WRSA 3SKCA 4EEVA 4B7TA 3UZPA 3I0OA 2C0OA 3CTHA 4G6OA 4KIKA 4UN0C 2BRHA 3U54A 3MH1A 3PA3A 4KNBA 3VBWA 3PY0A 4BVUA 4C02A 4KKEA 3BBTB 3KULB 3GU8A 4FV4A 2XK6A 4UWYA 1MRYA 3WYYA 5J7BA 5D41A 5DA3A 3L9PA 3R1SA 3R7YA 2W99B 2YDIA 3PIZA 3REPA 3MPAA 4QTEA 4G16A 5J9ZA 3ZBXA 4AU8A 3C13A 5CSVA 4X3FB 2QKWB 3E87A 1U54B 2FA2A 1MQ4A 4I20A 2QODA 3M1SA 2P33A 4I0RA 4JBOA 4GSBA 2QOLA 3ENMA 3O23A 5JEBA 1WBNA 1I44A 3GI3A 5M57A 2ONLA 5IQGA 2XNGA 4MNFA 4TYEA 3MV5A 3PJ3A 4ENXA 1KWPA 2VN9A 2WNTA 3V04A 2BAKA 3F5UA 3P08A 4J8MA 4E6CA 4E1ZA 3C1XA 4FKPA 4QPAA 3GENA 4FTAA 5HHWA 1R0PA 3KXHA 3Q3BA 1P4FA 1R0EA 2I0VA 1V0BA 5FUTA 3HA6A 4DTAA 1QL6A 4KWPA 4EI4A 1NT2A 3K3IA 1WVWA 3DFCB 4CZYB 5GJFA 5CTPA 4JBVA 5DVRA 5LQFA 3TJCA 4P5ZA 3QXOA 3AD6A 4C33A 2BRGA 4NSTA 5FM2A 4I4EA 4WT6A 3OT3A 4DFNA 4GVJA 1XWSA 3ZLYA 1WBOA 1U5RA 4AZSA 4EWQA 1Q8ZA 4FYNA 4RMZA 2OKRA 5HU3A 4YTIA 3JVSA 4TWPA 4JL9A 2R0UA 1NY3A 5K5XA 3COKA 2XCKA 2A4LA 3CS9A 4CT2A 4JS8A 3QHWA 1WBPA 4OLIA 5J5TA 4IWQA 3HL7A 2C4GA 4TKSA 4U79A 4TNBA 1WZYA 2IVVA 5EM5A 2BMCA 3MTLA 4E4NA 4IACA 4YBKA 4EK5A 4PNKA 2DYLA 5L2WA 2CKOA 2PZ5A 1LEWA 2IPXA 4O96A 1W0XC 3H9FA 3A4PA 4I5PA 4DLJA 4Q9SA 4ANLA 5KHXA 3M2WA 3NYXA 4IB5A 4H39A 2J0LA 3VS5A 4L45A 2SRCA 4D2PA 4NUSA 4OW8A 2EWAA 3EMGA 2OJFE 3QU0A 4NM7A 4KAOA 2QG7A 3FMDA 4ACHA 3OWLA 4FL3A 3P9JA 3R1YA 3QRKA 4NL0A 4JIAA 1QPEA 4YJNA 2XKEA 4BDDA 2W5AA 4YLJA 4Z7GA 5EG3A 2JIIA 4FK3A 1ZAOA 4NM5A 1GZKA 2PZRA 4EYJA 3R9NA 5LWMA 3TTIA 1JAMA 2PVRA 4BZDA 3CCNA 5I9XA 1JOWB 3DAJA 3RPOA 3GCSA 4JT3A 1Y6BA 3PWYA 4L42A 5CT7A 3VS7A 4C36A 1OIQA 4I23A 3ZUTA 4YTCA 2ZMCA 4BHZA 2A0CX 2VUWA 2XIZA 4RIXA 4QTCA 2YA9A 4FEVA 4XBUA 3GUBA 2J2IB 4RBLA 4BZOA 1IRKA 2YAKA 3DQWA 3PZEA 2EXEA 3UQFA 4XV2A 3UG1A 2P4IA 2C69A 3VF9A 3C4CA 5HE2A 1YI4A 1BUHA 1DAYA 2EXMA 3NWWA 3R1NA 1FGIA 4XNEA 3TM0A 3A8WA 4BKJA 4BWKA 5CXHA 3EN7A 3LCOA 3DCVA 3SOCA 4HNIA 3UZTA 4YBJA 2X8DA 4FKTA 5L6WL 3VN9A 4PRJA 4LV8A 5DEYA 3B2TA 3C51A 3HUCA 3LXPA 4KIQA 3ZYAA 5BUIA 3LE6A 4I5MA 4YJSA 4ID7A 3HRBA 5E8UA 1Q99A 4QMMA 1E1XA 1RE8A 5IA1A 3NR9A 4O7NA 3ENHA 4JDHA 2XA4A 2VX3A 3AT4A 4OTHA 3FI3A 5LVPA 1I09A 2YIXA 3BI6A 4B8LA 4BDHA 4YLKA 4X3FC 5FM3A 4G17A 5AUYA 4FTUA 3K54A 3DOGA 3HNGA 5M06A 4X2NA 2X2LA 1CDKA 3BRBA 3CKXA 3GOKA 3F3TA 4HCVA 4MQ1A 4OBOA 3O0GA 3U8WA 3VS4A 4EZ5A 4ZJIA 4O82A 4FZAB 3UYSA 3UNJA 1H25A 1TQPA 4FG8A 4NU1A 4O0XA 3ZSHA 3CQUA 4QTBA 2YZLA 3ZUVA 5ANIA 4FT0A 2FB8A 4N70A 5HIBA 3V6RA 4D0XA 1YVJA 3A62A 4IAKA 3ZO4A 4L01A 4PMPA 2B9FA 2R3OA 1H27A 3VUTA 3PG3A 3RINA 4FV1A 3KXZA 4LI5A 5CZHA 3QTZA 2YCRA 5I9ZA 3FXXA 4U3ZA 1KSWA 3QQUA 4HVGA 3VF8A 2P55A 4DH1A 4DINA 3VS2A 4AN9A 4N6YA 4GG7A 5FXSA 2C6EA 4DFBA 5JSMA 4CTCA 4DEGA 2BILB 4QOXA 3AD5A 3SRVB 5IMEA 3L9LA 3BYMA 3FJQE 4HCUA 3ORIA 5EW3A 4NFNA 4MBJA 2XF0A 3VW8A 2UVYA 1KV2A 2EB2A 2O8YA 3B2WA 3C4FA 3R8UA 4YTFA 3AC3A 3GU7A 4MCVA 3EOCA 3TI1A 4BCNA 4GU9A 1QCFA 5DNRA 4ZJJA 3KC3A 3QAME 4QQ5A 5BMSA 1H24A 2GMXA 2XP2A 4FEXA 1FGKA 1YHSA 4X7QA 2OLCA 4FKWA 1Q8YA 4JLCA 3SAYA 3NCZA 4DITA 1GIHA 3FC1X 4GFMA 4U8ZA 3HV5A 1SNXA 1YWNA 4B99A 2WHBA 4G9CA 5LMBA 1YXVA 3PE2A 4EH9A 1XBAA 5EQYA 3DK6A 5JGDA 2VTRA 3AC8A 2A27A 1P4OA 5EM6A 3RPVA 4RGJA 4U41A 4ANBA 3WIGA 4B6LA 4O22A 5HO6A 2HWPA 4NFMA 4RC2A 4IVBA 4EC9A 1Q24A 4JG8A 1FMOE 1Y8GA 1H8FA 3MJ1A 3MWUA 4BCHA 4H05A 2YAAA 3EH9A 4X3JA 3LJ1A 4OT5A 1WFCA 3C0HA 4XRJA 4EH6A 4CFNA 4Z7HA 2A1AB 4JJRA 4EOQA 2C6IA 4I93A 4J8NA 5HVKA 3OS3A 3DV3A 3NIZA 1YDRE 5L2SA 1JLUE 2OXDA 3F5GA 3ZH8A 2WZJA 1PXNA 2ITNA 4YZBA 5EHYA 3MVMA 4XG8A 5BQ0A 3L9MA 1A9UA 3RKBA 4USEA 1B6CB 2OSCA 3E7VA 1O6LA 4DEIA 5KMJA 3SA0A 3QRJA 3ZCLA 3SW4A 4ZTNA 4LOQA 4DFLA 4DFUA 2H6DA 1IASA 3QCYA 4LUEA 2RSVA 3PXRA 3QRIA 4PPBA 4FEUA 2WQOA 5FP5A 4ACMA 4ZTSA 1OUKA 2XK7A 4FTMA 4PP9A 3R83A 4QD6A 4DGMA 4IAIA 3FHRA 2GQGA 3OTUA 3TZ9A 1H4LA 2IZRA 4RPVA 2WAJA 3EWHA 3LAUA 4J71A 4JR7A 5M4UA 5BYYA 3NNVA 4M8TA 5GZ9A 3IW5A 3AC5A 3MY1A 4C61A 3UODA 4MF1A 2HYYA 5DYJA 2BZJA 4FTQA 3EL8A 3DZQA 3HV7A 3NSZA 1WCCA 4XP0A 4AW5A 3A4OX 3MPMA 2VWZA 3TTJA 3VWAA 4XG6A 3HV4A 3PYYA 2BTRA 3PXQA 4ZTHA 4G2FA 1O9UA 2RFSA 1LEZA 5K4JA 4FEQA 3EFJA 4LFIA 4XMOA 3T3UA 4AZEA 5J79A 2GCDA 1H1QA 3A60A 4KBCA 4FC0A 3WZKA 4BDKA 3O7LD 4FV2A 4G3EA 4APPA 3R2BA 4YZDA 4FTIA 5IDNA 1V0OA 3FV8A 5ANKA 4O7WA 4YPSA 3PE1A 3LM0A 2HY0A 5KBQA 4YURA 4O84A 2BUJA 2YACA 4U44A 3WF5A 5LMAA 3MS9A 1ATPE 5E4HA 3DJ5A 4II5A 5HKMA 2BKKA 2PVLA 1JKTA 1G8SA 5CF8A 1PXKA 4IEBA 4NT4A 4UMQA 4PY1A 4TNDA 4EHGA 4QYGA 4IAYA 2UZBA 5DEWA 1KE8A 1EH4A 4IBMA 1UU7A 2AC3A 2GNFA 2Y4IC 2J6MA 3KXGA 3Q9YA 3WF9A 4PDYA 4O6EA 4FSTA 3UBDA 4XG2A 3RBWA 1XH9A 1OM1A 4PX6A 5I0BA 5ETCA 3OF0A 2RFEA 1OIUA 3UE4A 3I5NA 2Z7SA 5LARA 4YPDA 5DMZA 4F7SA 4NTTA 3FZTA 2YM3A 4HVDA 4KRCA 1XJDA 2VGOA 3P78A 4XEYA 4UMTA 5EW8A 2IZUA 3S95A 4YSMA 4F6SA 4GG5A 4ANOA 1HOWA 4ASZA 4MD7E 3VAPA 1U46A 2CPKE 2ITZA 3MY5A 3U6JA 2BFXA 4QRCA 2R3KA 3I4BA 4YNEA 3ZO3A 4BF2A 4CRSA 4D0WA 3IPHA 2BHEA 3O17A 2IW6A 4I21A 2C5NA 4PF4A 3KL8A 3BWFA 4AZTA 4QP3A 1ZMVA 3Q6UA 4RA5A 3PRFA 3G6HA 3F82A 2B9HA 1HCLA 3CE3A 3EQPA 4IX5A 4C2WA 3VS3A 5CENA 5CF5A 3HP2A 4QYFA 3CTJA 2VO7A 2UZLA 5AAGA 5J9YA 2ZJWA 2PPQA 4PMMA 4BDGA 3KRRA 2RKUA 4GV1A 3LFAA 4P90A 4J95A 4XJ0A 3UO5A 3ZLXA 4U42A 2WTJA 4K6ZA 2B53A 5EW9A 4DG0E 3E88A 2FGIA 3E7OA 4RX5A 3SW7A 5DN3A 2W0JA 2QOOA 2WMVA 2JKMA 1OKWA 1JKLA 4BDIA 5AJQA 4BCJA 3UIXA 3NUYA 2W7XA 4AFJA 3R9DA 1J91A 4YHTA 4RIWB 3HMIA 4FZDB 1XQZA 4HYSA 5FG8A 4TXCA 2JLDA 2IW8A 4EBVA 5HCZA 4ARKA 3OCBA 4F65A 3CIKA 4RIYB 4TWCA 5EQPA 4RJ5A 1WBTA 4WKQA 5CVGA 4U0IA 4E5AX 4AGDA 4TYIA 2PVJA 4F70A 4FSQA 4DT8A 4AZFA 1FVVA 2ITYA 1FINA 2QU5A 2ZDUA 4RJ3A 3V5WA 3O2MA 3LFNA 2C6OA 4DGNA 4YSJA 3RVGA 1T45A 3E93A 5KKRC 5J95A 2UW7A 3FLZA 4AT3A 4FYOA 4J98A 1OIRA 2QC6A 3Q4CA 3FLNC 1YXSA 3QX2A 3LMGA 4IE9A 4E8AA 2E9NA 2VTTA 2J0MB 2UVZA 3Q60A 3FMNA 4FNXA 4AZWA 1M2QA 4BI0A 1WMKA 3A7IA 3MESA 1M7QA 4G6NA 4NZWB 4O7SA 1YXUA 2OH0E 3BEGA 4RG0A 3R8MA 5JK3A 4MD9E 4JBQA 4U5JA 4U6RA 1S9IA 4K11A 3BHHA 3PVBA 3W33A 2CDZA 4EHZA 1CM8A 3T3VA 3ZUUA 2IG7A 3GC0A 2F2CB 4NH1A 4BRXA 5A14A 3H0YA 5KX8A 4O83A 5L6OA 2HW7A 5AADA 5M56A 4MTAA 5A46A 1M7NA 4XV1A 3QALE 4UALA 4BZNA 3MFRA 3G33A 3DBEA 2XK9A 4FTJA 1W83A 5AR4A 4G1WA 1GIIA 5E7RA 3FZPA 4FVPA 4YC6A 3W18A 4O7LA 5IQAA 3TZ7A 3BBWA 1F0QA 2CKEA 1QPJA 4RWLA 4BKYA 3W55A 5K5NA 3FI8A 4I4FA 3PJCA 4M66A 2BVAA 2E9PA 4ZOGA 4A9YA 2W1EA 1MRVA 4O0WA 4CLJA 2W9ZB 2UZTA 2ZM4A 3QC9A 2YLFA 4LOOA 4R3CA 3EZRA 3QUDA 5A9UA 3RPYA 4JNWA 3NEWA 3UNZA 3EQIA 5AR5A 4CFMA 1CKPA 4ITIA 2JGZA 4ZS0A 2BROA 2QOQA 3AC4A 1H26A 5AX9A 1BX6A 1E1VA 2O3PA 1W8CA 3Q5IA 3KA0A 3LLTA 3DFAA 5CAPA 2OIBA 2C47A 1FOTA 2R3IA 3KN6A 1FMKA 3Q53A 4ZY4A 4PNIA 3JYAA 2G01A 3LJ0A 3CQEA 3NNXA 1V0PA 3PLSA 4PV0A 3CJGA 1PW2A 4O0SA 3H30A 4ZEGA 5KNJA 2ITUA 4AE9A 4V0GA 5H8BA 4DEEA 4R8QA 1NXKA 3BYSA 4CMUA 5B2KA 4DYMA 4RX9A 5JFSA 4YZCA 4KBAA 5IUIA 1SM2A 3LQ8A 5EK7A 4FUYA 4C38A 2H34A 3GB2A 5HO8A 3LFFA 3TNHA 4QT1A 4UV0A 4BTKA 2QG5A 4IADA 4C8BA 5D11A 3TN8A 3BGZA 3BHVA 3VHEA 3KULA 4FKOA 3R7OA 3TIZA 5IEXA 2C3LA 2VV9A 4TWNA 1VZOA 2O65A 4I94A 4IDTA 4CFXA 4EQCA 4RWJA 3ODYX 1OZ1A 1TQIA 1WBSA 2X6DA 2UW6A 3PJ2A 3AMAA 5GJGA 1UWHA 4X3FA 1OI9A 3H10A 3V3VA 3DBCA 3F7ZA 3D2KA 5IISA 4HW7A 2Y6MA 3DJ6A 5HX8A 2CKQA 4CKIA 1XH4A 4XLIA 4PMTA 2EUFB 1Y91A 2OWBA 4LRJA 4ANMA 4TT7A 2CMWA 4TWOA 4E5WA 3G51A 3OP5A 4PL5A 2X1NA 3WILA 4OTRA 3UOJA 5HTCA 4GIHA 5GZAA 2JDRA 1K2PA 2J0JA 2YCQA 1JSVA 3BHTA 3I81A 4BBFA 3OXIA 5LVMA 2XJ2A 2NRUA 5C4LA 4R5SA 3QGYA 4DCEA 5KMOA 2NNWB 4KD1A 4ZK5A 4PWNA 5CVHA 2IWIA 1Q8TA 3PSBA 5TT7A 3D2IA 1G5SA 3ZSIA 4ONAA 5KO1A 1M14A 1BL6A 4IFGA 3ORZA 3NVKI 4TN6A 4HZRA 2R3FA 3OCTA 3PJ8A 1RJBA 4FSWA 4FL1A 4MYGA 2ZM3A 2PU8A 2PVFA 2J90A 2UUEA 4X2FA 5E8ZA 3KMWA 3IW4A 4GYIA 3FE3A 2IW9A 4AXAA 2VTHA 4CMTA 4AP7A 3SVVA 3W32A 3IOKA 2IJMA 5JRQA 3B8QA 3O50A 4FT7A 5DOSA 3VJOA 2WMTA 2E9UA 1FVRA 3PA5A 2JIUA 3GCVA 3R71A 3W8LA 4CZUA 4CVAA 2GSFA 1PY5A 3F3UA 2PUNA 1YOMA 4AGWA 4RLKA 1ZOGA 3UOLA 4WBBB 1SZMA 4ANQA 3RAKA 4F9YA 3KK8A 5BVOA 1OPLA 4IVCA 5M55A 2FSMX 3GBZA 4BGGA 4JXFA 4FODA 4OBPA 2GDOA 3FYKX 4BGHA 5HIEA 5M08A 4BCKA 1NVQA 1P14A 4O6LA 2WIPA 2CGUA 1PYXA 3G0FA 2JDOA 3KFAA 4CYIA 4YTHA 4IAFA 2HY81 5ANOA 2WIHA 2JDTA 3W2SA 4NCTA 5G1XA 1ZMUA 2WO6A 2YCFA 3QD0A 4C3PA 5IQHA 4CFUA 3T9TA 3JPVA 4IAAA 5FQDC 4ZAUA 3LFQA 3TIYA 4DAWA 5LJJA 3V5TA 4XV3A 4IM0A 2R3LA 5EYDA 1JWHA 5EKOA 4IX6A 4V0GB 3D83A 4RFMA 3V6SA 5M51A 1YHWA 3D9VA 4FIEA 3D7ZA 4TYHB 4DGLC 4EZ3A 2VO3A 1F3MC 4YJVA 3F3WA 3A7GA 3MVHA 3PP1A 2R0IA 1KE5A 2W1HA 2WXVA 3LXNA 3QZIA 3CQWA 4KBKA 2Z2WA 4MD8E 2ZMDA 4FIJA 2YM4A 3NPCA 3Q2MA 4YJPA 3LFEA 4XS2A 4EQUA 4D1ZA 5ANJA 2B7AA 2VTSA 4L46A 5DHJA 3PDTA 3OOMA 5J5SA 5AP5A 3VVHA 2WTCA 2XZSA 4HJOA 4R6VA 4GUEA 4GT3A 2C1BA 4CCUA 2WMSA 4F63A 4BDFA 2NP8A 3R6XA 5HD4A 2X0GA 4UZHA 2XKDA 5HNBA 4L8MA 2JKOA 5H3QA 3LIJA 5HLNA 2XM9A 2YIRA 2OG8A 4HOKA 3HKOA 1W84A 3HMPA 5BNJA 5CNNA 2LGCA 4NKSA 3G9LX 3V8SA 4CFFA 3LVPA 4FR4A 1WVXA 3VJNA 3NAXA 3QFVA 3DBQA 3Q96A 4Y5HA 5ACKA 4C2VA 3V5LA 3QX4A 4EH2A 4EUUA 4BCQA 3MFTA 3RGFA 3OTVA 3O8PA 5JQ8A 1FVTA 2R3GA 1BYGA 4IC8A 4AGCA 4FOBA 4BIDA 3FPMA 4KSQA 1UA2A 3MVLA 4I0SA 1IA9A 4JAIA 3FI4A 4FE2A 1ZXEA 5HLPA 3DGKA 3QRTA 3PA4A 4PUZA 4FIIA 3RK5A 5BX0A 5I9VA 3C4ZA 4ASDA 5BMMA 1J1BA 4UMPA 4NEUA 1XKKA 4ZJVA 3S1HA 2ITXA 4C4IA 4TW9A 2F4JA 3V01A 4MH7A 1KUTA 5AFVA 2PE1A 1XH5A 3AC1A 3TNPC 5JQ5A 5F95A 2WPAA 1XO2B 4EBWA 4GFOA 3ZS5A 4KABA 5CEKA 3PPKA 4MXYA 3DKFA 2Y0AA 3FQEA 4ZSLA 2O64A 1ERKA 2IVTA 5CXZA 3DK7A 4QMSA 5HESA 4L67A 3VUHA 4MEDA 4LM5A 5IA0A 3VBVA 3OWPA 2X4FA 4QP9A 3LLAA 2V7OA 4V01A 4ERWA 1Y6AA 3LJ2A 5AAFA 4A9RA 4BI2A 4FKLA 2XYNA 4FV5A 1L8TA 3ETAA 5H8EA 1OPKA 5FDXA 2PVMA 5J8IA 3SRVA 4RWIA 3FQHA 2ZV8A 4WUNA 3ZLWA 4MXXA 2YM6A 3KCFA 5AP4A 5FEEA 1AQ1A 4FSRA 4LMNA 3R02A 3NW5A 4GFGA 4BBMA 4JOAA 4RJ4A 3H9RA 3NZ0A 2E9VA 3I79A 1JBPE 5EYKA 3UVRA 1H0WA 3EQBA 4G5PA 2PTKA 2VNWA 2X2KA 2HZNA 4HPUE 5L6PA 2H8HA 2ZB0A 4C0TA 5KMIA 5GINE 4DN5A 4CKRA 5A6NA 3BELA 3AC2A 5BVNA 2X9FA 3LQ3A 3F2NA 4KS7A 4MX9A 4YP8A 2XCHA 4HVHA 5J1VA 3ACJA 3GC9A 3QUPA 4BDAA 1GAGA 2WOTA 4FTCA 2X4ZA 1PJKA 5AA9A 3R22A 5JGAA 1ZLTA 3UYTA 1XH6A 3RWPA 3DXPA 3V5PA 3HVCA 1Q5KA 5ANDA 4U3YA 4L9IA 5EM7A 3WYXA 1R3CA 2YEXA 3V8WA 4GJ3A 2ACXA 1B38A 5DPVA 3FKOA 3QCSA 5HORA 1MRUA 2J51A 4DFYA 3AMYA 2ETMA 3Q5ZA 2UV2A 5HBEA 4BYJA 2OFUA 3POOA 2NO3A 4C7TA 1IAHA 3SV0A 4A9SA 4PQNA 3VBYA 4CD0A 2ZV9A 4EK3A 1Y57A 2HK5A 5AP0A 1KOBA 5DRDA 3LCKA 2CN8A 1WBWA 4FKGA 5T3QA 3SD0A 3HLLA 5L4QA 2EB3A 3UIMA 3M42A 3K5VA 4ZMEA 3AG9A 4WNKA 4FT9A 3DPKA 4GH2A 4U97A 1VR2A 4GUBA 5FXQA 2OXYA 4F9WA 3DKOA 2P3GX 4AW2A 3PJ1A 4EHEA 3QA8A 4QMOA 3D4QA 1IAJA 4A9TA 2C5YA 3NUXA 4USDA 3RZFA 4Y46A 5M07A 3IW6A 4Q9ZA 3BEAA 4GEOA 4G6LA 3CSVA 3OUKA 4AA4A 4HVSA 3PXYA 5F94A 5IUHA 4UX9A 3UMXA 5CF4A 2ITQA 2QQ7A 3DXNA 3JY0A 3EQDA 4HYHA 3UVQA 5HTIA 4OUCA 4RJ8A 1URWA 1W98A 4EUTA 5HO7A 3PWDA 3E3PA 4IZ7A 3CLYA 3CC6A 3S3IA 4IVDA 3ZMMA 4BICA 5CQUA 2BDWA 3PUPA 1AGWA 4H3BA 4CV9A 2WOUA 2F7ZE 3OW4A 2OGVA 4U45A 3RZBA 4QMWA 3KVWA 4YLLA 3BHYA 5HVYA 2FUMA 3UJGA 3QF9A 3CPCA 4LV5A 3WE8A 3ZBFA 3Q4UA 4FEWA 4CQGA 4BDEA 2GS7A 4Y72A 5DGZA 5HG9A 1JSUA 2F7XE 2P2HA 1PXPA 2PZPA 4O38A 3QZHA 3UOKA 2XEZA 1F5QA 3W10A 4F7LA 3F9NA 1XH7A 2XIXA 1ZOEA 3A99A 4FKRA 4MNEA 4O0TA 4Q5HA 4ACGA 1XHAA 2HZ0A 2Y4IB 4CXAA 3E8EA 5FLFA 5F20A 4F9CA 5LXMA 4LL5A 4C34A 1H1SA 2WGJA 5EHOA 3E92A 3DXQA 3PLAE 5AP1A 2C68A 1YXTA 3FZRA 1YWRA 5IQIA 4FK6A 4ZIMA 3TDVA 4IWOA 3QBNA 4C4HA 3D5UA 4LG4A 3F5XA 5CI6A 5HTBA 4U9AA 5E90A 4M69B 5JZNA 4FKUA 4APCA 2I0YA 4CG9A 5LWNA 3UPXA 4B8MA 4GVAA 3NVMB 2UW5A 4KS8A 4F0IA 2YJSA 3NYOA 4H3PA 5CEIA 5IDPA 3FC2A 4E3CA 4JQ8A 4RQVA 5K3YA 2ZOQA 5LMKA 4JX7A 3FZ1A 3C5IA 5A4QA 2JFLA 3C9WA 2JEDA 4M13A 4W8DA 4RSSA 4FUXA 4WNPA 2XKCA 2XUUA 3G90X 3N9XA 3EQGA 3QCQA 1Q61A 3I7CA 4RA4A 1Q3WA 4FIGA 3EB0A 4R1YA 2E9OA 5M09A 5HCYA 2WELA 5DLSA 2RG5A 4BC6A 4PP7A 3MB6A 3L8XA 3QD4A 2Q83A 4E6DA 4LGGA 4FVQA 5BVDA 2GTMA 3CY2A 4DE4A 1XBCA 2XM8A 4DC2A 2WMAA 1U5QA 3IK3A 3QD2B 3QCXA 5FTOA 4XX9A 4J97A 4D9TA 4ZZNA 3U6HA 4CTBA 4NYEA 4QYEA 4BB4A 2UZDA 1OKYA 4ALWA 3TL8A 4AN3A 5M44A 3VUDA 3QGWA 3C4EA 3KRJA 2BDJA 4IC7A 4A07A 4F7JA 5B7VA 3EN5A 4OGRA 4DG3E 2CHLA 3RPRA 4YC8A 2W1FA 4A4LA 3WZJA 2WMRA 2RIOA 4FTOA 2BPMA 4X21A 5GIOE 3D5VA 3ZRKA 3F6XA 3QTRA 4L68A 4RIWA 4HVIA 4BN1A 4FTLA 5D1JA 5D9HA 3NW6A 4UMRA 3FZSA 5LVOA 4CGAA 3NLBA 4RIYA 5DRBA 3BV2A 3GOPA 5KKRB 3DJ7A 1YKRA 4XCUA 5JKGA 2HENA 2ZVAA 4HGLA 3FXWA 4EH3A 3ZONA 5AA8A 3PG1A 3LFDA 4EH8A 4YU2A 2FSLX 3HUBA 4D5HA 5CU0A 2J5EA 3D5WA 1FPUA 2HIWA 3LPBA 3QQHA 3SLSA 4RLLA 5FRIA 3R8LA 3BYOA 4IVAA 3WF7A 4CQEA 4XRLA 3UTOA 1WVYA 2OJIA 3LZBA 2YHVA 2HOGA 2I40A 3F88A 3UP7A 1REKA 3CGFA 3F69A 5I5ZA 1IR3A 1H00A 3DY7A 3W2CA 3WARA 5IH4A 3D5XA 3HV6A 3TKIA 3Q52A 4FZFB 3TJDA 5K9IA 1X8BA 2C0TA 3AT2A 2WTKC 4F1OA 5IZFA 4ZSEA 4E20A 2UZWE 4ITHA 4IZ5A 2KTYA 4PPAA 5A4LA 2JFMA 4WA9A 1OITA 5GIPE 1ZYLA 4MWHA 5CEOA 3N4TA 4MNEB 4F09A 2X7GA 2YABA 5I3RA 3S2PA 2ONLC 3FDNA 3FUPA 3KRXA 3ZRLA 3ZOSA 4G3CA 3UMWA 1Z9XA 5HG8A 2CJMA 2HCKA 5AV3A 4AFEA 4F9BA 4IZAA 4ZTMA 3E62A 3QXPA 4J53A 4DT9A 2PYWA 5CLPA 2LAVA 2B0QA 5AWMA 5L2TA 4BDBA 3DA6A 5AV0A 4BIEA 3GC8A 4WSQA 4I22A 5AP2A 5L8LA 4Y83A 4KRDA 4BWPA 3MPTA 4WG3A 3FQSA 5F4NA 3W2OA 1QMZA 4C35A 5C1QB 4XBRA 4JQ7A 5ANGA 3GXLA 1MUOA 4D58A 5H9BA 1UU3A 3QLGA 4E5BA 1SVHA 2XNEA 3RK9A 3BQCA 1E9HA 3GU6A 3R63A 3MSSA 4TTHB 1H1PA 5CAQA 5C03A 1BI8A 3UOHA 4A4XA 2YIYA 2JIVA 3DAKA 3E8DA 3I7BA 4OTFA 4UYAA 2XVDA 3OEZA 1OGUA 3OWJA 4I1ZA 2PMLX 2IZTA 5KHWA 4BWXA 3BKBA 2G9XA 3E64A 2XRUA 3R7IA 4W8EA 3ORXA 4IFCA 2OICA 3DDQA 1H08A 1R78A 3C0IA 4S30A 3K5UA 3HDMA 5IG1A 3A2CA 3I6UA 2C5XA 2DQ7X 4OTWA 4OTIA 4Z9LA 4EKKA 4W9WA 3UNKA 1M2RA 4AT4A 1OUYA 1T46A 4L3JA 4ZZMA 2VAGA 4BYIA 3GQIA 2WMWA 1YWVA 3TT0A 5FP6A 3KU2A 3BGPA 3F66A 1OL2A 1CKJA 4CKJA 3TG1A 5M4IA 3PXZA 4CYJA 4M97A 4UXLA 2BIKB 3UQGA 4FV8A 4TY1A 3HX4A 2Z7RA 4UWCA 3RCDA 5FTGA 5AP7A 4HZSA 3P79A 5DR2A 5C01A 2RFNA 4DFZE 4YZNA 5EDRA 4AQCA 3ODZX 3GCPA 3O8UA 4NM0A 5JGBA 5DH3A 4DEAA 3KMUA 3BU3A 2CGWA 4QMXA 2B1PA 4JI9A 4MVFA 2VTQA 3MW1A 1REJA 4IJ9A 2YM7A 5DBXA 3HECA 5CAVA 5HVJA 5IH6A 1UNGA 2WB8A 4MXCA 3R8PA 2G2FA 3FZOA 2VTMA 3HZTA 4QYYA 1GIJA 2ITTA 2Q0NA 4PDSA 5LVLA 5IA5A 2B9IA 2JKQA 2WTIA 2ITOA 4J99A 5IU2A 1GNGA 5EKNA 2B54A 1VYZA 1Q41A 2W5HA 1NW1A 2WQNA 3OVVA 4HGTA 2YIQA 3D7TB 3HMMA 4HGEA 4U43A 2C6MA 5DG5A 2O0UA 3KXMA 4NIFB
chains in the Genus database with same CATH superfamily
4D4SA 3ORLA 4U80A 3FSFA 3T8OA 2QO9A 2PZYA 1ZYDA 3H4JA 3OC1A 2VWXA 4LL0A 1DM2A 5DR9A 5E8VA 3U9CA 4CCBA 3OHTA 4I6LA 3QTQA 4ZSGA 4FI1A 4ZLYA 3O51A 2BCJA 1Q97A 4ZLZA 4BR3A 3QTUA 4WIHA 2C6KA 2GHGA 3UDBA 4OTQA 5HBJA 4Q5EA 3R30A 5E8TA 3MTFA 3I5ZA 4TL0A 3TNWA 3I6WA 5CU2A 1Y8YA 3DS6A 5HBHA 2QD9A 4CG8A 4I41A 5FWKK 3HAVA 4RJ7A 1APME 4C62A 2XK3A 4JIKA 4XG9A 2PK9A 3BYVA 4FL2A 3L9NA 1KE9A 3SXSA 3B8RA 4Z16A 1LUFA 5I3OA 1OL7A 2W4JA 5CI7A 3S0OA 4ZSAA 1OL1A 2R3PA 4FKJA 2R9SA 4M14A 3VQUA 1PRYA 2R3MA 2ZM1A 4KUJA 2VTOA 4NJ3A 3THBA 3TNIA 5BYLA 1H07A 2XK8A 4E4LA 1JPAA 3CEKA 4FV7A 3ZEWA 1KOAA 3KB7A 5AR8A 2J7TA 5CF6A 3ITZA 4WD5A 3I0QA 3R04A 4OTGA 1YHVA 4QMYA 4ERKA 2UW3A 4FKIA 1XR1A 3IQ7A 5E92A 3DNEA 3ZTXA 4D2VA 2VTIA 2X7OA 5HQ0A 2BRBA 4ANNA 2OO8X 4EK4A 4GJ2A 3GGFA 3RP9A 1BMKA 2QOIA 3AGLA 4CT1A 1A48A 4ORKA 4PDOA 4FTKA 4J1RA 3DU8A 5DR6A 4LGDA 5HG7A 3PIYA 5BUJA 3G5DA 3L8SA 2C6LA 2JD5A 4GKHA 2B9JA 4B9DA 2YM8A 3GVUA 4YC3A 2JDVA 3ANRA 5D12A 5ICPA 1OKVA 2AEGA 4L43A 4TYHA 3IG7A 4RVKA 4I6HA 4QNAA 5CEPA 3OD6X 3QWKA 3ALNA 5IH5A 2B52A 4KIPA 2V22A 5T68A 2B55A 2YISA 3R73A 2JAMA 3FYJX 4NKAA 2WMXA 3W2RA 3FKNA 4A06A 5KMNA 5TKDA 1TQMA 3JVRA 4J52A 5C4KA 4I6QA 5EHLA 1OMWA 3MVJA 4IJPA 5AUXA 3IDCA 4ENYA 3ZM9A 2QO2A 2X39A 4H58A 5JFXA 1MQBA 2GS6A 5AR3A 2JAVA 2OW3A 4IM3A 4PL3A 2HWOA 3BIZA 5DT3A 5KZ0A 3PVWA 2CKPA 5EFQA 5ETAA 4YNOA 3HRFA 3CD3A 2UZEA 1VJYA 1BL7A 4XG7A 5BVEA 3JUHA 3UVPA 4FSNA 5CS6A 3P7BA 4FMQA 3RHXA 3VRYA 1O6KA 3ACKA 4IH8A 3VUKA 4F64A 3A61A 2GNGA 3EFKA 5D10A 4FT5A 2PZIA 4RFZA 2OZOA 3TXOA 4S33A 3VO3A 3LCTA 1JSTA 4MXZA 4M0YA 3LHJA 2CCIA 4O0VA 5EOBA 4DH5A 2YN8A 4QP1A 4YZMA 4H1JA 3SDJA 1GZ8A 5K4IA 4O21A 3GCUA 2W05A 2XH5A 4D55A 4IAZA 3G6GA 3QQGA 4QMVA 3KKVA 3MYGA 3DKGA 3H3CA 4XOZA 3JS2A 3RHKA 4DFXE 1BKXA 5AIKA 1G8KA 4QNYA 2OH4A 4W4VA 5CZIA 3SXFA 4DTBA 5HNIX 2XALA 1YW2A 4NTSA 2PSQA 3P23A 2ZV2A 3P5JC 3V51A 5C8KA 4YJTA 2W9FB 2R3RA 3NUUA 1H1WA 4FSUA 3SOAA 5DI1A 3ULIA 3ZXZA 5CAOA 5KMLA 3Q9ZA 3CGOA 5FTQA 3DB8A 4BIBA 5LCKA 4KKGA 4O0YA 2ZYBA 4UXQA 5KCVA 3SG9A 2F7EE 5KE0A 2GU8A 3IW8A 2I1MA 2WTVA 2OU7A 5KMMA 3E5AA 4HYUA 2EVAA 3C4XA 3QTXA 3NCGA 5BVFA 4QQJA 4O4DA 3L1SA 1YOJA 3R7EA 1SNUA 2VWWA 3FLQA 3QKKA 4UY9A 3WZDA 3R8ZA 3MH2A 3HAMA 3DB6A 4FIHA 3MFUA 1S9JA 3T9IA 2F49A 4C59A 3BGQA 5FEQA 5CALA 3AKLA 5HE0A 3F2RA 4EOPA 3IONA 4D28A 4BJJA 3VUMA 2ITWA 5DE2A 5IQBA 3OMVA 3QTIA 4DHFA 5CSWA 4D2WA 2BAJA 3GCQA 5E8YA 1OIYA 5EH0A 4C4EA 3OY1A 3PZHA 4L00A 5K0KA 1URCA 1YDTE 3OFMA 1U4DA 3VQHA 1IG1A 3GFEA 3QQFA 3R00A 1PXOA 4M3QA 5ANEA 3WOWA 4BDJA 5BVWA 4ALUA 4DF3A 3HRCA 3LW0A 5HE1A 4ZMFA 1ZY5A 5AUVA 4JX3A 1CKIA 5B0XA 2XK4A 4DH3A 3QTSA 3FY0A 4S34A 4E4MA 3A7FA 3CR0A 5AP3A 4FG9A 4I6FA 2VO6A 4P2KA 4AOJA 2WEIA 1W82A 4KSPA 2J50A 3KRWA 4IWDA 2HW6A 2UVXA 2GFSA 3D94A 4M0ZA 5CY3A 5JH6A 4RQKA 4O27B 3G15A 3JR1A 1L3RE 4L7SA 5GZ8A 3FSKA 5BYZA 2C6DA 2BRMA 4C37A 4W4XA 4IM2A 5IF1A 3KXXA 5B2LA 3PXFA 4K2RA 3KF4A 1J1CA 5TF9A 5KUPA 2XANA 4YHFA 4R1VA 4WHZA 2GNIA 2CSNA 2QKRA 3MBLA 2IVSA 4OAVB 1DI8A 5JMSA 5HOAA 4O2PA 3QTWA 5IMXA 1BI7A 2QOHA 4N0SA 4R3RA 4W4WA 4I5HA 3VBXA 3WIKA 4K0YA 3JXWA 4M84A 2W1ZA 5JRSA 3N4UA 4AA5A 3GP0A 3GNIB 2PMIA 4Y5QA 4C4JA 4DTKA 4IWPA 5FDPA 4S32A 2WTWA 4QPMA 2ITVA 1JNKA 2J4ZA 3DTCA 5CX9A 2G1TA 4MF0A 3UIBA 3TWJA 2OJGA 3VS0A 4OTDA 3VUIA 2PUPA 3RAHA 5H2UA 1J7UA 1PMEA 4ZTQA 4PPCA 4IANA 3ELJA 3Q6WA 4ZY6A 4AS0A 2QLUA 3RJCA 3VNTA 1UV5A 3OCGA 3ATTA 4D1SA 4G31A 2C6TA 4RWKA 3RMFA 3DBFA 1KV1A 1OL6A 3R21A 3U51A 3BZ3A 3PXKA 3QYZA 1U59A 4QP7A 3ORPA 2B4SB 4RC4A 2X81A 3EIDA 5D7AA 5J9LA 5KZIA 3QUEA 2IF8A 4FGRA 3D14A 3Q2JA 3GFWA 4RJ6A 1JKKA 5E8XA 1IA8A 3PVGA 4WO5A 4DHZA 4GKIA 3EN4A 2REIA 3AQVA 2XBJA 3R7UA 3WF8A 3CKWA 5HCXA 3ZEPA 4C57A 3DAEA 4OR5A 3L8PA 3S4QA 4AN2A 2FVDA 4QO9A 3VS1A 4XP3A 3FLSA 1PKGA 1IEPA 4XYFA 5CSXA 3NX8A 4F1TA 4GYGA 4X2KA 3NFGB 1ZZ2A 3R01A 3FI2A 4MBLA 5AP6A 3UZRA 1A06A 2WMQA 2E2BA 4I92A 4D4VA 1TKIA 3O7LB 4EOOA 2PHKA 3SQQA 4GT4A 4I5CA 4A7CA 1UVRA 4AAAA 4C58A 4L6QA 1B39A 4F6WA 2QU6A 3F2AA 4I6BA 2RFDA 4U40A 3NUPA 2BALA 1OB3A 3BLHA 4K9YA 4X2JA 4ZTLA 3TKUA 5J1WA 3FBVA 2YZAA 1YOLA 3FHIA 3FMHA 4FSZA 2QNJA 4FV9A 4QPSA 5FGKA 5AX3A 2ZAZA 2Z8CA 4M69A 5HZNA 3BCEA 3QKMA 2NPQA 3FLYA 3O96A 3AT3A 4H36A 4P5QA 5JT2A 2CGXA 2I6LA 4K8AA 4JG6A 4HYIA 2WEVA 2W1GA 1R1WA 2I0HA 5DT0A 1OKZA 1LP4A 1OL5A 2X7FA 4HGSA 4RT7A 5EI2A 4FA2A 4NK9A 3NW7A 3ORNA 5CQWA 3RWQA 4K33A 3HDNA 2RGPA 4CLIA 5IPJA 1PXMA 3FAAA 4MXAA 3ZO2A 5A6OA 2PVHA 3C7QA 1P5EA 3QQLA 4O91A 3UDTA 4F0FA 4YR8A 1PHKA 2YWVA 4QP8A 4QMPA 4RRVA 4E6AA 2G2IA 4IB3A 4M12A 2QVSE 3FKLA 4UWBA 4YO6A 3WZEA 5A4EA 1RW8A 3NYVA 4TZRA 3KEXA 3MA6A 4I3ZA 2WQMA 3EZVA 2WQBA 4IB1A 1M52A 5DWRA 4GU6A 2F2UA 2WU7A 3OW3A 3DNDA 4LUDA 3F5PA 2DS1A 5EM8A 1FQ1B 3UO4A 4CRLA 3LXKA 4EJNA 4ZLOA 5L2QA 3KGAA 4E73A 3MB7A 4FV6A 4YUQA 3UC3A 3HYHA 2UW8A 5EQEA 4TPTA 3PSCA 3W1FA 2PE2A 4S2ZA 2JKKA 1UKIA 4XP2A 1VLRA 5T6KA 1M17A 2X8IA 3P0MA 3QQJA 2DUVA 4BTFA 4J96A 4XHKB 2OZAB 2QURA 2ZB1A 3HGKA 3FMEA 4BTJA 4CFVA 2Z60A 4BL1A 2YWPA 3FL4A 2XNBA 1PMUA 5HX6A 2UZUE 4QYHA 5AV2A 3LFBA 5AAEA 2QHMA 2R3JA 5M53A 2HXLA 1BLXA 3RK7A 3VBTA 4KIKB 5HEZA 3IKAA 4LRMA 2GPHA 3EYGA 2BAQA 2XIYA 3QWJA 4AX8A 1FBNA 2EXCX 1PKDA 3QQKA 5CU6A 1ZYJA 4F9AA 3IS5A 2VWVA 3Q4ZA 3NIEA 2PWLA 3ZHPC 2AYPA 2XB7A 3O71A 4FBXA 3QYWA 4CNHA 3FMJA 3P1AA 3TACA 4QMLA 1NVSA 2XJ1A 3NDMA 3UO6A 4ZXTA 5G6VA 1JQHA 4DA5A 4AQKA 2WTKB 2G15A 4AE6A 3ZXTA 3WZUA 1KE7A 4YJUA 3ORTA 1W2FA 1SVEA 2JDSA 2VD5A 2W4KA 4B4LA 3MIYA 4B0GA 2IO6A 2WMUA 3PVUA 3ID6C 4LRKA 4PMSA 3BX5A 2VU3A 2CLXA 4XG3A 5HLWA 5J7HA 1H28A 3U87A 3EQCA 3FY2A 3RAWA 2QI8A 3DZOA 3S00A 4EOIA 5HD7A 3E63A 4DLIA 1Z57A 2PVNA 4USFA 3AXWA 4M68A 5HG5A 4FSMA 3ULZA 4ACCA 3SC1A 4AXFA 4ITJA 1SVGA 2HAKA 4LGHA 4OT6A 4BCMA 4FF8A 3A7JA 2VX1A 2W4OA 5D7VA 3BQRA 3QHRA 3O5AA 3VULA 1ZZLA 2GNLA 4CZTA 3PIXA 4FKSA 1DI9A 1Q62A 5A3XA 4HCTA 5IUGA 4CFWA 2W17A 4EWHA 3NUSA 3TUCA 1K9AA 4KKHA 2UZOA 2X9EA 2Y7JA 4JR3A 2YDJA 2R5TA 3LOKA 3SG8A 5E8SA 5H8GA 5FXRA 5HICA 5TOZA 4RVMA 2BR1A 3Q9XA 1HCKA 1K3AA 1PMVA 1QPCA 2BDFA 3KY2A 4RVTA 4FKQA 2FSOX 3O8TA 4GW8A 3A8XA 3Q4TA 4FTRA 2WD1A 5CVFA 5JFVA 4EC8A 3E8CA 3U6IA 3P7CA 1QPDA 3GEQA 3NGAA 1RDQE 1LR4A 1Q8UA 1Q4LA 2QOFA 1G8AA 2QR8A 1UNHA 5I9YA 4E6QA 2UW0A 4BCOA 3BE9A 4EZ7A 3TNQB 3DQXA 4H1MA 3BL9A 1CMKE 3HV3A 1PF8A 4GIIA 4PTEA 5A54A 3H9OA 3NNWA 4NW6A 5EOLA 3IGOA 1O6YA 3PY3A 2KULA 2V0DA 4L7FA 3ET7A 4JBPA 4K18A 4YJQA 3BYUA 2C3JA 4RC3A 2YERA 3RI1A 1OVEA 1YRPA 5ACBC 4AW0A 4UZDA 1UU9A 2VX0A 2UW4A 3R9HA 4KA3A 4N4SA 3EYHA 4UEUA 3EHAA 2FH9A 2VTPA 3OEFX 2I0EA 4V04A 5M4CA 3PP0A 1Q3DA 3P7AA 4KIOA 4O7VA 1PXJA 4JDIA 4R3PA 3P86A 4L52A 5CYIA 3UQCA 1V1KA 3DTWA 3ZZWA 4EOMA 3UP2A 2AC5A 5CSPA 2UZNA 3RTPA 1H1RA 4N6ZA 4ACDA 1ZARA 2R3QA 3EFWA 5HGIA 2VRXA 4DEDA 3BU6A 5AV1A 3OT8A 3BLRA 2ERKA 1H0VA 1ZWSA 1H01A 3F3VA 4PTCA 4O0RA 2ITPA 4QQCA 1PMNA 4QP4A 2V7AA 3TEIA 2OBJA 4QMNA 4MUQA 4NCTC 5I9UA 5AM7A 5LVNA 3TKHA 4GRBA 4ANSA 5K0XA 4P7EA 4AUAA 4RIXB 3GT8A 3R28A 3VRZA 2X8EA 4QMTA 2XIRA 2PMNX 2R7IA 4X0MA 5BUEA 2PVKA 1VYWA 1J3HA 2PE0A 4G3GA 4LYNA 4Z55A 1J7LA 2JBOA 1CTPE 2HZIA 4IX3A 5IA3A 4DH8A 4O1OA 5AR7A 4QMUA 3NYNA 4GK4A 3G2FA 3FLWA 3TZMA 4W4YA 2ZV7A 4BKZA 1GZOA 4F7NA 1ZY4A 2ESMA 2QHNA 5CEMA 5EYCA 4TRLA 1ZYSA 2CNUA 3D7TA 3KVXA 5TR6A 2Y9QA 4DBNA 3FMKA 3QRUA 3FXZA 4ZY5A 4G3FA 4IZYA 2XIKA 4NIFA 3GQLA 3UIUA 2XAMA 2H96A 2PMOX 3F61A 3PFYA 4AOIA 4YJRA 2A19B 2H9VA 4CV8A 4DG2E 5IQFA 5HI2A 3TUBA 5HE3A 5FEDA 5DIAA 5M4FA 3ALOA 4HPTE 4MHAA 3K3JA 5TE0A 2WTDA 4GMYA 4EKLA 4XH6A 1TVOA 4MK0A 3MH3A 2XNPA 5CU4A 5I4NA 4WSYA 4QMZA 2Y6OA 3C50A 1YI6A 4C4GA 3CP9A 3II5A 4FNZA 4L3PA 3V5JA 3OXTA 2OF4A 4NWMA 4OAUC 2XNOA 1R39A 3KMMA 1KE6A 3AOXA 5JZJA 3R1QA 3DLZA 1ND4A 4R77A 2C3KA 1VEBA 2P0CA 2VZ6A 4GK3A 3ROYA 3RPSA 2J9MA 4DGGA 2O63A 3IW7A 3DK3A 2VWBA 3W0SA 3OCSA 4C3FA 1P2AA 4Y95A 2QOCA 2EU9A 2R3HA 4FSYA 2QOKA 2ERZE 3MY0A 3DKCA 4AZVA 4QTDA 4ASXA 3LM5A 2VWIA 5LOHA 3SHEA 3ANQA 4OBQA 1GOLA 3ZM4A 2IVUA 2JITA 4XLVA 4R7BA 1TFFA 2C30A 5CNOA 4R7HA 2WMBA 3MJ2A 1ZRZA 2WKMA 2YJRA 3KQ7A 3QLFA 4AWIA 4N57A 4BCFA 4O7YA 3ORMA 2JBPA 4GT5A 4RZWA 5I9WA 4M7IA 4DDIA 5FBNC 1YXXA 3IECA 4V05A 3FL5A 5IA2A 2PUUA 4WNOA 4BHNA 4EH5A 4P4CA 3RM6A 4ZSJA 3SX9A 3KF7A 4QP6A 1PYEA 2XNMA 2C1AA 2Q0BA 4W9XA 3R9RA 5AR2A 1DAWA 4GCJA 2V62A 3BHUA 5JN2A 3KN5A 3PPZA 3NMUF 3R9OA 4FOCA 4OTPA 1JKSA 5IEYA 4ZP5A 4E26A 3C0GA 3KK9A 3EKNA 3IGGA 1OECA 4IB0A 2WFYA 4JRNA 5EDPA 2RF9A 4NJDA 4GL9A 5EI8A 3W2PA 4BDCA 4FG7A 4UMUA 5KMKA 5E1EA 1WBVA 3PRIA 2VTAA 4F99A 4D5KA 4X2GA 2O5KA 2YCSA 2QOBA 4M67A 5HNGA 5IA4A 1NVRA 4D4YA 3HEGA 2NRYA 2UZVA 4IQ6A 4JAJA 2F9GA 4DGOA 5F1ZA 2QLQA 4DBXA 4QTAA 4U81A 3BU5A 3C4WA 3OXZA 4F78A 4X6QC 2ETKA 2VWYA 3CBLA 1YDSE 3IDBA 3KRLA 3Q9WA 2BTSA 3LMHA 4EYMA 5GHVA 4UBAA 3OOGA 1OBGA 4WUAA 3N4VA 4FV0A 2WU6A 4Z3VA 3IO7A 4RX8A 3ZFXA 4O0UA 1YI3A 3CD8A 3H0ZA 4FNYA 4LMUA 2XJ0A 1XBBA 5E8WA 4D1XA 5E1SA 4E93A 4DCAA 2W06A 5CAUA 2YDKA 2I7QA 3U4WA 4WG5A 4ZZOA 5IQDA 1M2PA 2GNHA 2YIWA 4JVGA 2HXQA 3ZLSA 4C4FA 5BPYA 2W96B 1PXIA 2GS2A 4KB8A 4D4RA 4EOKA 4YZ9A 4EQMA 4FZ7A 2XNNA 2OJJA 2XS0A 1SYKA 4IXPA 3R8VA 3ZFMA 3VS6A 3ZO1A 5AUTA 4EL9A 4O7RA 1STCE 3NAYA 2W1CA 3EN9A 2CNQA 2VNYA 3D0EA 4MAOA 5CSHA 2QO7A 2X6EA 3ZZEA 2OXXA 2XYUA 3ROCA 3NRMA 3D15A 5C26A 2C5VA 4BGQA 4F1MA 2BIYA 3BPRA 2AQXA 3OBGA 3QZGA 2Y8OA 3QL8A 3COIA 3ZDIA 3W0OA 3EQHA 4MKCA 1AD5A 4PL4A 4AACA 4CSVA 4FGBA 2AUHA 2C5OA 4IMYA 3L8VA 3M11A 3VIDA 1UKHA 3FPQA 4O1PA 5HU9A 2IN6A 4GK2A 3WE4A 2R4BA 1Z5MA 4F6UA 3KCKA 2BKZA 2J5FA 2W5BA 3VBQA 4RZVA 2R3NA 5JFWA 5AV4A 2Z02A 2Z7LA 4K1BA 2QONA 3P5KA 4H3QA 5AM6A 5BVKA 2FYSA 3IOPA 3HA8A 3OROA 4XOYA 4KINA 4G9RA 2HZ4A 3TDWA 4MQ2A 3OZ6A 2GTNA 4AOTA 4BCPA 3ZDUA 4UYNA 4Y73A 4YGAA 3RALA 3VC4A 4A9UA 5A4CA 2CNVA 1OPJA 3OG7A 2XEYA 3BWJA 4WG4A 5ETIA 5CEQA 4JRVA 3W16A 3GU5A 3MDYA 4FTNA 3NS9A 3RM7A 3EKKA 5IEVA 2VTNA 3BLQA 3MA3A 3PTGA 3RNIA 4FZ6A 4EH7A 4YO4A 3NUAA 3W8QA 4G34A 3LCDA 4JQEA 2BFYA 4L44A 1W2CA 2GNJA 3DLSA 2IZSA 4O81A 3GU4A 3ZC5A 4YMJA 1RQQA 2QCSA 5HIDA 4GS6A 4O7ZA 4Y85A 3W2QA 4AF3A 4D2RA 5C8NA 4K77A 4EOLA 3ZU7A 3EJ1A 3U9NA 2OF2A 4ASEA 4BTMA 5EDQA 3VUGA 4FKVA 4PTGA 3U4UA 4QMQA 4HNFA 3FEGA 3N51A 5J87A 3LKMA 2OFVA 3OY3A 5EYMA 3SGCA 3F7WA 2JC6A 3EQRA 3G9NA 3PSDA 5AUUA 4O7TA 3PPJA 2CGVA 3HP5A 3LMIA 4J7BA 5AMNA 3W0RA 4AXEA 3BE2A 1UNLA 1UWJA 2R2PA 3E3BX 4FICA 3MN3A 4FX3A 1ZMWA 2CN5A 3E8NA 4XV9A 3G0EA 3ERKA 3EN6A 2XKFA 4XUFA 3VHKA 3COHA 1GZNA 1WAKA 3IDPA 5CWZA 5C27A 3WF6A 4EH4A 2PULA 3QKLA 3F3ZA 4E7WA 4QP2A 2F57A 3EFLA 5E91A 4R5YA 5FBOA 3MI9A 4M15A 4TYGA 5DFPA 3RAIA 2VGPA 4QQTA 4O86A 3V5QA 5LMKC 2G2HA 2W1DA 4AW1A 5LCJA 2OIQA 2ETRA 2PVYA 4RIOA 1NA7A 2HELA 3KXNA 4IIRA 1OGYA 3C5UA 3P4KA 5GNKA 4JG7A 3RNYA 3CTQA 3UPZA 2XRWA 1UU8A 4FIFA 3ZC6A 5AIRA 3R2YA 4DH7A 4EONA 4BCGA 3COMA 3UC4A 3UGCA 4BY9E 3A7HA 4WRGA 3UDZA 3OUNB 3TUDA 3LXLA 4EORA 4IHPA 5FD2A 4C3RA 4YJOA 3TZ8A 2J0KA 2QR7A 3CJFA 2X2MA 5CU3A 1OBDA 4D2SA 3QD3A 5F9EA 4TYJA 2A98A 2OI4X 3KIOC 4R78A 4AGUA 4LOPA 4ZTRA 5DT4A 2BHHA 2OK1A 3LQ5A 5GJDA 3ZSGA 2YM5A 1U54A 5IKWA 5L8JA 1DS5A 3LCSA 3EL7A 4Q2AA 2FSTX 3NNUA 3VW6A 4D2TA 5B2MA 4NM3A 4WOVA 3GC7A 4A4OA 3LFSA 5L3AA 3MFSA 4EHVA 4F4PA 1J7IA 3PFQA 4IDVA 4WNMA 4AA0A 5ETFA 4EOJA 5C9CA 2FO0A 2GHMA 3MGYA 4UB7A 5ITAA 5IQEA 1W7HA 2CLQA 3Q04A 2C0IA 4IX4A 5L2IA 4O2ZA 4RVLA 2J0IA 3WI6A 4RX7A 3CY3A 3AMBA 2YLEA 5E9EA 3R7VA 2IEWA 4X6RA 5A4TA 1SMHA 3OBJA 3CPBA 2PL0A 4I0TA 4L3LA 5AUWA 4R7IA 3RCJA 4ZS4A 1G3NA 1GY3A 4EK6A 1LPUA 4FNWA 4G5JA 5TO8A 4FT3A 1GJOA 4WBOA 4JDKA 4AXDA 3DT1A 3MH0A 5CASA 3ZFYA 2XMYA 3R7GA 3U55A 4RFYA 5L8KA 3FMMA 3DDPA 2PY3A 1ZYCA 3I60A 4JDJA 2VTLA 3HMOA 3TCPA 1PXLA 4U7ZA 5KBRA 4AT5A 2WQEA 2YITA 5IQCA 1JVPP 4EOSA 4NW5A 2BZKB 5C8MA 1CSNA 2GHLA 2R64A 3K2LA 4MXOA 2R7BA 5EI6A 2VWUA 2BZHB 4E4XA 4AG8A 2A2AA 4XG4A 2DWBA 3POZA 4F08A 3NUNA 4DEHA 5AUZA 4BCIA 2RL5A 2W1IA 2Z7QA 3FMLA 3I1AA 2CCHA 4S31A 3FWQA 3OWKA 2V55A 2OJ9A 3LFCA 4PDPA 2PUIA 2RG6A 3DBDA 3BV3A 3R0TA 4CMOA 5AEPA 4L53A 2GQSA 3VONA 2BZIB 3QC4A 1XH8A 4BBEA 4F0GA 3TV4A 1MP8A 3AGMA 3ORKA 4BI1A 2XBAA 2YFXA 3TYKA 2GQRA 3Q32A 3QA0A 4I24A 2C3IB 2UW9A 2V5QA 4G3DA 3CXWA 4MBIA 2O2UA 3SXRA 4FV3A 4EK8A 3JY9A 2BRNA 2GFCA 4IW0A 4MWIA 1YQJA 4FTTA 4LQMA 2P2IA 1Q8WA 4FVRA 3ZRMA 4DEBA 2OIDA 3MIAA 3KREA 3ATSA 4EJ7A 4Y8DA 4D9UA 3QZFA 3TV6A 3V8TA 4ALVA 2OZAA 2Y4PA 3EQFA 5CT0A 3TV7A 3UG2A 4BFMA 1ZOHA 4YHJA 3WBLA 2VO0A 4CEGA 2ZDTA 3HMNA 5CANA 3PY1A 2VTJA 3AD4A 4WRSA 3SKCA 4EEVA 4B7TA 3UZPA 3I0OA 2C0OA 3CTHA 4G6OA 4KIKA 4UN0C 2BRHA 3U54A 3MH1A 3PA3A 4KNBA 3VBWA 3PY0A 4BVUA 4C02A 4KKEA 3BBTB 3KULB 3GU8A 4FV4A 2XK6A 4UWYA 1MRYA 3WYYA 5J7BA 5D41A 5DA3A 3L9PA 3R1SA 3R7YA 2W99B 2YDIA 3PIZA 3REPA 3MPAA 4QTEA 4G16A 5J9ZA 3ZBXA 4AU8A 3C13A 5CSVA 4X3FB 2QKWB 3E87A 1U54B 2FA2A 1MQ4A 4I20A 2QODA 3M1SA 2P33A 4I0RA 4JBOA 4GSBA 2QOLA 3ENMA 3O23A 5JEBA 1WBNA 1I44A 3GI3A 5M57A 2ONLA 5IQGA 2XNGA 4MNFA 4TYEA 3MV5A 3PJ3A 4ENXA 1KWPA 2VN9A 2WNTA 3V04A 2BAKA 3F5UA 3P08A 4J8MA 4E6CA 4E1ZA 3C1XA 4FKPA 4QPAA 3GENA 4FTAA 5HHWA 1R0PA 3KXHA 3Q3BA 1P4FA 1R0EA 2I0VA 1V0BA 5FUTA 3HA6A 4DTAA 1QL6A 4KWPA 4EI4A 1NT2A 3K3IA 1WVWA 3DFCB 4CZYB 5GJFA 5CTPA 4JBVA 5DVRA 5LQFA 3TJCA 4P5ZA 3QXOA 3AD6A 4C33A 2BRGA 4NSTA 5FM2A 4I4EA 4WT6A 3OT3A 4DFNA 4GVJA 1XWSA 3ZLYA 1WBOA 1U5RA 4AZSA 4EWQA 1Q8ZA 4FYNA 4RMZA 2OKRA 5HU3A 4YTIA 3JVSA 4TWPA 4JL9A 2R0UA 1NY3A 5K5XA 3COKA 2XCKA 2A4LA 3CS9A 4CT2A 4JS8A 3QHWA 1WBPA 4OLIA 5J5TA 4IWQA 3HL7A 2C4GA 4TKSA 4U79A 4TNBA 1WZYA 2IVVA 5EM5A 2BMCA 3MTLA 4E4NA 4IACA 4YBKA 4EK5A 4PNKA 2DYLA 5L2WA 2CKOA 2PZ5A 1LEWA 2IPXA 4O96A 1W0XC 3H9FA 3A4PA 4I5PA 4DLJA 4Q9SA 4ANLA 5KHXA 3M2WA 3NYXA 4IB5A 4H39A 2J0LA 3VS5A 4L45A 2SRCA 4D2PA 4NUSA 4OW8A 2EWAA 3EMGA 2OJFE 3QU0A 4NM7A 4KAOA 2QG7A 2ZFYA 3FMDA 4ACHA 3OWLA