2Z7LA

Unphosphorylated mitogen activated protein kinase erk2 in complex with (4-{[5-carbamoyl-4-(3-methylanilino)pyrimidin 2-yl]amino}phenyl)acetic acid
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
340
structure length
329
Chain Sequence
VFDVGPRYTNLSYIGEGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Identification of a key element for hydrogen-bonding patterns between protein kinases and their inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
total genus 103
structure length 329
sequence length 340
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2z7lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2z7lA01
2OSCA 4BF2A 3ZU7A 4E20A 4X6QC 4I3ZA 4MXZA 4ANOA 1LEWA 3FPMA 5L8JA 5KHXA 4TXCA 2E9PA 4BCNA 3OWJA 3EQGA 4ZTQA 4W9WA 2A2AA 4JLCA 5I9XA 1FVVA 3E8NA 4X2NA 3IGGA 4MWIA 1ZYDA 3FI8A 1SVGA 1TQIA 2V7AA 4BDCA 4FV9A 3DKCA 4QMQA 3DXQA 3BYVA 2BAJA 5KE0A 1ZRZA 3RAIA 1FMOE 3HAVA 3GBZA 2UW0A 3UGCA 2ITPA 5AX9A 5A6OA 1RW8A 4YZCA 3NUSA 4AFEA 3EIDA 4PMPA 3ZRMA 4UB7A 4EWHA 1OZ1A 4CNHA 3IS5A 4MD7E 5FEDA 4E8AA 3PP1A 4OTDA 5JFXA 5BYYA 4EH3A 3VW8A 3U6HA 4DEBA 2PZYA 4E6AA 2YM4A 3VQUA 3MFRA 4GFGA 2DQ7X 2DUVA 4H3PA 4BCQA 4IWQA 4DH5A 4DN5A 1YWNA 2X8DA 5L6PA 2H8HA 3BELA 3HEGA 3W55A 2VWBA 3TNWA 4M67A 5E91A 4A7CA 3DJ5A 3T8OA 3S00A 5LMAA 1WBNA 5C4KA 3ZFMA 3WE8A 3DOGA 3MTLA 3R0TA 3OCGA 3PLSA 4FGRA 4WA9A 2Z2WA 1U54B 2QR7A 4KBKA 4I23A 5DWRA 2C6DA 4D1SA 5LARA 5CXZA 1URWA 3U6JA 4YPDA 5K0KA 3UO4A 4FZ7A 5C8NA 5CEOA 3AC8A 3QX4A 2R7IA 3I5NA 2JEDA 3PZHA 2F2UA 5IF1A 3HGKA 4PPAA 2FUMA 3FYJX 3F61A 5DHJA 2Y0AA 5CALA 5B7VA 4EL9A 3D83A 4F1TA 2JAVA 3BHYA 5H8GA 1OL1A 1WBWA 1WBSA 1SMHA 1WBPA 4FIFA 3RWQA 5IEXA 4JX7A 3P0MA 3RPRA 3D5VA 3FYKX 3G6GA 3HP5A 4QYFA 4RFZA 5I9ZA 3A99A 5EYDA 4F09A 4LGGA 4IM3A 1Q3WA 3SKCA 5JEBA 2OBJA 4IANA 4OT5A 3B2TA 3EOCA 3KXHA 3Q4CA 5AR4A 5HG8A 3A7FA 1OL6A 5D1JA 5FRIA 4J7BA 3WF5A 3ZUVA 5EFQA 1AGWA 2W4OA 4DEEA 5A4EA 3SXRA 4BDAA 2KTYA 4EHGA 4YJPA 4L00A 1Q97A 4GK3A 5KMMA 4PTGA 2W06A 4ACDA 2X39A 4DH7A 3QTUA 1WAKA 2IVUA 3DS6A 5CTPA 3F5XA 3QQUA 1WVYA 4QYHA 1QPEA 2XIRA 3O51A 3MA3A 5EW3A 5K4IA 3W2QA 1XH8A 4M3QA 4IDTA 4QP1A 4FA2A 4BCJA 3HYHA 3ZO4A 4GVAA 4ZTMA 4F70A 2R3LA 4IZ7A 4DFBA 2UZNA 3MIAA 4AP7A 3POZA 4EHVA 2B4SB 2OZAA 2R3NA 4D4YA 5F9EA 5HBJA 4CVAA 2QOBA 4NM0A 2BMCA 1JSVA 4O7LA 4DFXE 1CKIA 5BQ0A 4ACMA 1BL6A 4XUFA 3ZBFA 1JQHA 4CEGA 3COIA 4AZFA 2ZV2A 3GNIB 4M8TA 5EH0A 1P14A 3ORMA 5AM6A 3T3VA 5HD4A 1ZY5A 4RX8A 2XIKA 5HX8A 5JZJA 3NMUF 5AUYA 3LLAA 3R7UA 2GTNA 4FTUA 3NYVA 3OEFX 1PXPA 2F57A 4YJSA 1H1QA 3RM7A 5J1VA 2CKPA 2C5YA 4DCAA 3FZTA 2OO8X 4BL1A 4OTIA 4I0RA 3T9IA 2JIUA 4R1VA 5DN3A 3NR9A 5TF9A 4AFJA 3HV3A 3C51A 4IHPA 3FAAA 4FL2A 3RALA 3BLRA 3Q53A 4O22A 3SHEA 4CXAA 3BKBA 3NEWA 4KS8A 3R9RA 2Y4IC 1WFCA 1YI3A 2PUNA 4FVRA 4L01A 4EUTA 2QOKA 2VTQA 3O96A 3DU8A 3EN7A 2OZOA 2J50A 2WTVA 3TJCA 3V51A 3FZOA 3Q2MA 3QTWA 3CPBA 3FJQE 3KB7A 1GOLA 4D4SA 3ELJA 3PY0A 4RBLA 3SX9A 2XMYA 1ERKA 4JQ8A 1PJKA 2CCHA 2WIHA 5C4LA 2EXEA 3EN9A 5FXQA 2HOGA 1YXUA 1JKLA 5CANA 1FVRA 3HV4A 4XX9A 3LCDA 2QU5A 4CKIA 5AV2A 5IA1A 4EOIA 3ZSGA 2VRXA 4A4XA 2OJIA 5J7HA 3MJ1A 4YU2A 3CCNA 2JC6A 3MH2A 3W1FA 5LVMA 3PY1A 3BU5A 3TL8A 3UQGA 4DG2E 3R71A 3WILA 4TKSA 2YM6A 1DI8A 5LCJA 4LRMA 3TUBA 5CU3A 4EBWA 1M52A 3EYGA 3KN5A 3LPBA 4EK6A 5DH3A 2GCDA 4KSPA 3QLGA 3CEKA 2OFVA 4WBOA 3SAYA 4AN2A 4TZRA 2R7BA 3LQ5A 4RVKA 4JG6A 1YXVA 2HY0A 3WIGA 3PIXA 3M1SA 4KBCA 4S33A 1CKPA 3W2CA 2F7ZE 2XJ2A 3CJFA 5CEPA 2PVNA 5EOBA 3F6XA 4LI5A 1YWVA 4YBJA 2QOFA 4O0TA 3MI9A 3DK6A 4DG0E 3EQDA 3KC3A 3ZHPC 4BDFA 4DBXA 2ZM1A 4UV0A 2OXYA 3TJDA 4EUUA 3F3VA 5FEQA 2Z7LA 3LQ8A 2CN8A 4FVQA 3SXSA 1NVRA 2GNGA 2R3GA 2R3OA 4DG3E 5BNJA 1R0PA 2CKQA 5EI6A 2QHNA 2PULA 2XNBA 3OG7A 4BCMA 3LFNA 2CLQA 4FTRA 4CFMA 1Y57A 4KBAA 4CGAA 3L8SA 3IW7A 2BTRA 3GEQA 1R3CA 1GIJA 1W82A 3CTJA 3VF9A 1J7UA 2C68A 4IVAA 3KCKA 3AQVA 4FV1A 2GNFA 1LP4A 4I6BA 1KE6A 4FNWA 4FKJA 5GJGA 3VF8A 1PMVA 5H8EA 5IDNA 2VGPA 2XNMA 2BZIB 4JDIA 4AZVA 1Q8TA 2ZYBA 3R30A 5E92A 4ZMEA 5EDRA 4FVPA 3WF9A 3CIKA 3LM5A 4RQVA 4GFMA 3OWKA 4ANLA 1XH6A 4O0XA 3W2PA 3Q9YA 3FHIA 3V5QA 2QLUA 3TKHA 3ZTXA 3VS5A 1M17A 4QMMA 1JWHA 3QQFA 3NS9A 3VHEA 3VUDA 2JBPA 4L7FA 2F9GA 2W1EA 3PSCA 4FSWA 4O0RA 4ANBA 5IQHA 4EBVA 4YTHA 4FTKA 3R7YA 3N4UA 3IECA 2IZRA 3CTQA 4GG5A 3R1QA 4JBOA 4YO6A 4UWCA 4CMTA 4EK4A 5L3AA 1E9HA 2OJGA 2GNIA 2NP8A 3OCBA 3BYSA 3QD4A 4R3PA 3ZC5A 3FI2A 4C62A 2ITNA 3OZ6A 1REKA 5IA5A 4E3CA 4D9TA 1HCKA 2J7TA 2YDIA 4IX5A 3SA0A 5I9VA 4FSZA 2J4ZA 3RAHA 2W99B 1T45A 2OICA 3E63A 1PKDA 4JBQA 5GZ9A 3RP9A 3TTIA 4BTKA 2VWZA 4PNKA 1IR3A 1GZNA 2F7EE 1W98A 3BYUA 5E8TA 4AU8A 3LMIA 4IB0A 1ZZLA 4RWKA 4BBEA 4D58A 4RJ8A 4NTSA 3VIDA 2C5XA 5AIRA 2NRYA 1R0EA 3UIBA 2R3MA 4DFNA 4RX7A 3QRTA 5D11A 3IG7A 4AQCA 1P4OA 4DINA 4FT5A 1PXIA 3DDPA 3JPVA 4W4YA 5CSHA 2R3RA 2BAKA 3MBLA 5AAGA 2ITYA 4CD0A 4L45A 3NSZA 5HTIA 4ZP5A 5CF6A 4R5SA 5ETFA 2VTMA 1B38A 3RWPA 3QQGA 3Q6WA 4I41A 1KUTA 3SOCA 3PZEA 3R9OA 5AFVA 3UC3A 2DS1A 4CKRA 3R7VA 2WQBA 5DFPA 1KE8A 4K33A 3CSVA 2X2LA 4QMOA 5FGKA 4J71A 3KEXA 2BZKB 5IMEA 4NJDA 3SRVA 3W10A 2A4LA 2ITWA 3GC8A 3AT4A 3V6SA 1PXJA 4TYGA 2QOIA 1TQPA 2UW8A 2UZDA 3BGZA 3CPCA 5AIKA 2BALA 3SQQA 3V8SA 4F0GA 2ETMA 4XG4A 2WQNA 5J95A 4ITHA 5DT0A 1LUFA 3KRXA 5I3RA 3Q5ZA 4U42A 3RHXA 3Q4TA 4GU9A 2CNQA 3F2AA 4XNEA 5AP2A 4HYSA 4IDVA 2RF9A 3BU3A 3ANRA 3U54A 2HELA 2ZMCA 1G5SA 4D9UA 2WAJA 4ITIA 1OB3A 3DZQA 3ERKA 2YABA 4UXQA 3K5UA 2XK3A 4QPSA 3SW7A 5IMXA 3H9OA 4TT7A 3DBDA 3PJ8A 2VX0A 1XHAA 3KRWA 4E93A 4F9WA 1GZKA 3VVHA 4C3FA 5HTCA 1CMKE 3LMHA 4Q5EA 3D5XA 4AG8A 3F82A 3QALE 2I0HA 3QRUA 5DG5A 3D14A 3NAXA 3TNIA 3UDBA 4JRNA 4O7VA 4KRCA 4JOAA 3VC4A 2F2CB 2W1CA 3UE4A 3SC1A 3CQEA 5F95A 3GU7A 3CC6A 4S31A 5I3OA 3ZSIA 2CNVA 5AX3A 4YTIA 3RZBA 5KNJA 3C5UA 4LOQA 2EXCX 1ZLTA 5CI6A 2IG7A 2JIIA 1IASA 4JRVA 2YM7A 3K3JA 3PVWA 4RIYA 3CXWA 4RVTA 4ZIMA 2BRHA 3P08A 5AAFA 4A9RA 3IDCA 1REJA 4BKYA 2UV2A 4C8BA 4ZZNA 3UVRA 4PX6A 4WUAA 5ANDA 1Q99A 1ZMVA 2VV9A 4X3FA 3ZFXA 1ZY4A 1M7NA 1SVHA 3MDYA 3VJOA 4A06A 5HEZA 4DGNA 2QKRA 2YZAA 3R83A 5JZNA 3BE2A 3MVLA 4NZWB 3TZ7A 4BKJA 5AP1A 2X0GA 3O71A 1XH9A 2JD5A 2QOQA 2UW9A 3E87A 4FNZA 4TNDA 2W9ZB 5FP6A 1G3NA 5EKNA 4O7ZA 4ERWA 4F9AA 5FM3A 3CQUA 2VTJA 3CD8A 3COHA 3HDMA 5HCYA 4M69A 1PXKA 4FV5A 3WIKA 2YAKA 2FSMX 2YZLA 3DKOA 2PE1A 5H9BA 3Q60A 5EM7A 4O7WA 4IMYA 3AC3A 4E7WA 4F65A 1JSTA 3HUBA 5DR2A 4IACA 3HL7A 5C01A 3UVPA 2GNJA 2JKOA 2UZUE 4BDDA 1FVTA 4M0ZA 4QP9A 2PE2A 4XLVA 3RCJA 2P4IA 4HVHA 4LYNA 4RRVA 5E7RA 3VUIA 3MFUA 2WTIA 2J0MB 2BVAA 4WUNA 2NRUA 4BZNA 3ORXA 4HZSA 1CDKA 3LFFA 4PDYA 3QTZA 4RJ7A 1PMUA 3R1NA 3GOKA 4TPTA 3PA3A 4IAFA 4TTHB 1SZMA 4PTEA 2QG7A 1OIYA 1Q24A 3VW6A 3EHAA 2IN6A 3FSKA 3ZO1A 3TN8A 2ERZE 1IEPA 2WMWA 4NYEA 5AWMA 3WF8A 4AAAA 4RFMA 4U80A 5EK7A 4AUAA 2G15A 4I4FA 3E7OA 4RSSA 2JKQA 5FTOA 4TWCA 3W33A 5LQFA 5HCZA 2EB3A 3OCSA 3UIMA 3EQPA 2W0JA 3GUBA 4JXFA 4MXYA 3LJ1A 4QT1A 5A4CA 3NX8A 4I94A 2YM5A 4QOXA 4ID7A 4TNBA 3HZTA 4JIKA 2RSVA 2FO0A 2YJSA 4H3BA 4PMSA 4DGMA 5JFVA 3UP7A 4TN6A 5AR2A 3QF9A 4HGSA 5DMZA 4CLJA 4RQKA 2H6DA 3IW8A 4AA5A 4MHAA 5CYIA 4JR7A 4RIYB 2IW9A 1H28A 4FOCA 4FZFB 4RWJA 5CEQA 1YDSE 2G9XA 3COMA 3SLSA 3TKUA 2YHVA 5KZIA 4CG9A 3I7BA 5JRSA 3EKNA 4I24A 4M15A 5IQBA 4X3FB 3EQCA 5EHOA 1CTPE 2ZV8A 3AC2A 5AUVA 5AAEA 5IA0A 4G34A 4D2VA 3R9HA 4BCHA 3V3VA 2P3GX 3DFCB 4QD6A 5F20A 4JIAA 1H0WA 3RHKA 2GQSA 5BUEA 2VWUA 5DGZA 5HORA 5K9IA 1BKXA 3FLWA 1Y6AA 1FINA 2JFLA 3H10A 1Q3DA 3PXFA 3MTFA 1H01A 3NNXA 2PMNX 5EYCA 2X4ZA 4HYIA 1R78A 2XS0A 4JQEA 4M69B 5CSVA 4DLJA 3VRZA 3U55A 2XF0A 4HPTE 4BIEA 5HNGA 2XUUA 3K5VA 3KF7A 3E3BX 4PNIA 5D12A 3WF6A 2CLXA 3HECA 4ASEA 3OT8A 3PRFA 2I6LA 5IQGA 2PVRA 1A9UA 4ZEGA 3PVGA 5EQYA 3MH3A 1OKZA 2PHKA 4Y46A 3CKXA 3FKOA 4L68A 2W1IA 5KHWA 1PY5A 1KE5A 2GHLA 2W96B 4R7BA 1OGUA 3LCSA 4R1YA 3ZBXA 2FSTX 1YXTA 3EZRA 5FLFA 2QC6A 4LRKA 4EK8A 4X2FA 4M14A 5JFSA 4H1JA 1MRVA 3GFEA 2BDJA 2QCSA 4L7SA 4MXOA 5IA2A 4OTFA 5JSMA 3RGFA 3DXPA 4O7TA 3AMAA 1H07A 4AGDA 1PMEA 5AUXA 2ZB1A 3VS4A 2PZRA 1L8TA 3I5ZA 5HZNA 4BWXA 4DHFA 4KS7A 5JQ5A 4BCPA 4DFZE 5CU6A 3OD6X 5BVNA 2VZ6A 3T3UA 2J0LA 2A0CX 4ZSAA 3A2CA 2Z7SA 3EQIA 4BHNA 3R28A 3QBNA 4QO9A 1K2PA 3RM6A 2B9JA 4C4JA 3PA4A 3W16A 2X4FA 4EH8A 1M2RA 3R01A 4RFYA 3P5KA 2HWPA 2ZM4A 4NM5A 4ZTSA 4BI0A 5CT7A 4QTAA 4CMOA 3BLQA 4F99A 3UYTA 2G2FA 2WTJA 3QKMA 4QPMA 2ZV7A 1BLXA 4L46A 4FTMA 5AP3A 3OROA 4TYIA 2WMSA 3OS3A 3P9JA 3R9NA 4OT6A 2WXVA 5FBNC 2E9NA 4RC3A 5DEYA 3ZRLA 2WMXA 1GIHA 4ZLYA 4L8MA 2V22A 3VS1A 4E6DA 4F08A 4FG9A 3R8ZA 3HDNA 4EQCA 1BI8A 2Y7JA 3HV5A 3N51A 3KFAA 3PIZA 3I79A 1OIUA 3LFSA 3SV0A 5LMBA 4HCVA 4GK4A 4H36A 1MRYA 4FKOA 5LWMA 2BIKB 2PPQA 5CXHA 4ZK5A 4EHEA 3IW5A 4OTQA 3B8RA 3Q52A 4JR3A 3MY0A 4N6YA 4NEUA 3O7LB 2ESMA 2CKEA 3JVRA 5HBHA 3SDJA 3WBLA 3UC4A 3IOPA 3L8VA 4USEA 4JJRA 2CDZA 3QA8A 3OF0A 1I44A 3PFQA 2AYPA 4MX9A 4K8AA 3KRLA 4FTOA 4K6ZA 4RLLA 4WG3A 4BR3A 1JKTA 3WARA 1OL2A 5BX0A 4NKAA 2ITVA 5IA4A 4LV5A 4G5PA 3RK7A 5HVKA 2GU8A 2X7GA 4Z3VA 1ZYSA 3PE2A 5A4QA 3OXIA 2ITUA 5LXMA 5HIDA 2GHMA 2ZB0A 4J52A 3QD3A 3TIZA 4ZSGA 2W1FA 4IZYA 3ID6C 2V0DA 5EG3A 4HW7A 1U54A 2OKRA 2UZEA 1DI9A 2LAVA 4O2ZA 4ZXTA 3I6UA 3Q04A 4FG8A 2YIQA 4UY9A 1V0BA 3SGCA 2WB8A 3I81A 4J95A 5ANIA 5F94A 4KSQA 3AT3A 1XQZA 3GU6A 4N70A 4MQ1A 2YLFA 2X7FA 4NM7A 1URCA 5KMLA 3PXYA 2ZDTA 4KINA 3VNTA 4HVSA 2IZSA 4GVJA 3G15A 4CFUA 2QU6A 1Q41A 2EB2A 3QTRA 5H8BA 4FYOA 5IQIA 5ETIA 4U45A 1G8AA 3UZRA 4BYIA 3UO6A 3U9NA 2V5QA 1JKSA 4CZUA 3ENHA 3A60A 3LIJA 4FV4A 3IW4A 2YDJA 2RG5A 4G3FA 3TNPC 3VJNA 4R78A 3NIZA 3QUDA 5E8SA 3LFCA 4EH6A 3R8LA 4GCJA 3GVUA 4O0UA 1YI4A 3QTSA 3V5LA 4C4EA 3H0ZA 3FV8A 4EZ5A 2YM8A 4TY1A 4E4MA 4CFFA 4IJPA 2YCFA 5HIBA 4NCTA 3FZSA 5DLSA 5AP0A 3UODA 5CNOA 4G3EA 1OM1A 4FX3A 3BIZA 2O8YA 3TXOA 2PUIA 3A8XA 4RG0A 3D15A 3PY3A 1H4LA 5C9CA 2RFDA 3TV4A 5KMOA 3WZUA 3UPZA 5DR9A 3TV7A 3BV2A 4D1XA 4UMPA 3K2LA 5JT2A 5M57A 1GNGA 1PYXA 2HZ0A 5AR7A 4BGQA 4FIGA 3UMXA 2ITXA 2JIVA 4U7ZA 4AN3A 4OBOA 1H25A 4KKHA 3ETAA 5ANEA 2DYLA 3QCSA 4CTCA 2BROA 4FTNA 4PTCA 4UYAA 4XG9A 2PVLA 4DGOA 3LM0A 4F1OA 5FEEA 5G6VA 4JNWA 3CY2A 4AGUA 3KK8A 3R8UA 3FBVA 4ZZOA 3LXLA 3C13A 3JS2A 4NJ3A 3E93A 4EOJA 3IKAA 2W7XA 3DXNA 1HOWA 5DEWA 2QLQA 2CKOA 2J0JA 3C4ZA 4NUSA 2EU9A 4I1ZA 2GFSA 4FSNA 3IDPA 3BZ3A 3R02A 3UO5A 4V01A 4O96A 3EH9A 2XK4A 4UALA 4L3LA 1DS5A 2OW3A 4F0FA 4NH1A 4P7EA 2O64A 1KOAA 4IAKA 3RVGA 4TL0A 2YDKA 4YHTA 3Q2JA 1OUKA 3CKWA 3S3IA 3LXPA 4AS0A 3QZFA 2JITA 3ORPA 3V5WA 2Z60A 5EHLA 4ZJIA 5E8YA 5ETAA 3AC5A 3DQXA 4KUJA 4ASDA 3C4FA 4FL3A 4KIOA 4DBNA 5E1SA 2PK9A 2WOUA 2C0OA 3OUKA 4O81A 3I7CA 1W8CA 2B55A 4ITJA 3OUNB 2AUHA 4JX3A 2VO3A 2J2IB 4IB5A 3GT8A 5E8XA 3LVPA 3QTIA 2YERA 1Y6BA 4E5AX 5CSXA 4P5ZA 2Q0NA 3BLHA 4IAYA 3ZUTA 2YCQA 1ZXEA 1GZOA 4UXLA 3P7BA 2W05A 3G2FA 4QTCA 3NUXA 3WF7A 1GY3A 4E4LA 2HW6A 3SVVA 4NWMA 5M55A 3DJ6A 2UZLA 4CSVA 1BMKA 3KGAA 3R63A 4XG6A 5FM2A 3PVUA 3GP0A 2PSQA 5DVRA 4KWPA 4LG4A 2W4JA 1H00A 4C57A 4BDIA 3QWJA 5CF5A 4LMUA 4RA5A 4O86A 3OWLA 4QP6A 5BVDA 3O8UA 4HZRA 3DB6A 4O6LA 4AGWA 4KIPA 4K0YA 1ZYCA 4IM2A 4U81A 4Z7HA 3D94A 2ONLA 5H3QA 3V01A 5EQPA 4FUXA 1UNHA 1OKYA 2OFUA 5TO8A 1UWJA 4UMTA 4QYEA 2OXXA 2PMLX 4C0TA 2OJ9A 4S32A 4FTLA 3ANQA 3OXZA 3W2SA 3ZDUA 4MKCA 3IGOA 4ANMA 5BMSA 4YJQA 4NT4A 4QYYA 3ZSHA 2BUJA 2PVYA 2WQEA 1UVRA 3MB7A 4C4HA 4BYJA 3PXRA 4GT5A 3FC2A 1H1WA 3G9NA 4QTDA 1UNLA 3ZH8A 3SG8A 3P79A 5HBEA 5K4JA 5AV3A 3QCYA 5TKDA 1FBNA 2AC3A 3HMNA 2OI4X 2ONLC 4I6FA 3QLFA 3ZRKA 4OTPA 2YA9A 4PF4A 5IISA 2X9FA 3ZUUA 4AW1A 4YTCA 5GZ8A 5DT3A 3WOWA 5DYJA 4BY9E 2WOTA 1YXXA 3DT1A 5GJDA 2C3JA 3KRJA 2JDSA 2XYNA 4PDSA 3NNWA 2QO2A 4RC2A 2UVZA 5HVJA 3O7LD 2VWXA 4MF0A 3OW4A 3I6WA 4YMJA 1K3AA 3ZC6A 5J5TA 2WTWA 2C3LA 5CAVA 2YN8A 1IAJA 4OGRA 4I6HA 3C0IA 2BDWA 2BRGA 4NW5A 5CZHA 1XWSA 3CLYA 3TV6A 3MGYA 1ZZ2A 2IZUA 3QQKA 4C33A 3QL8A 4ZY6A 3FLYA 5ACKA 3CP9A 3U87A 3AMYA 3FLNC 4EH9A 5EW9A 4Y5QA 2VX1A 2ZOQA 3A4PA 3VHKA 3F7WA 3G9LX 2ZV9A 2SRCA 4GS6A 4RMZA 3WYYA 4MXAA 4PMMA 3G90X 1RDQE 3H4JA 3D5UA 3R8MA 4DT8A 4JVGA 4OBQA 5HICA 2J0IA 4O84A 3QA0A 2P2IA 2BHEA 5C03A 4B8MA 2VGOA 2JDRA 1TKIA 1Y8GA 4D2SA 4MYGA 4EQMA 4RIXA 4WIHA 3PXQA 4GEOA 2QO9A 5HCXA 5HGIA 3NVMB 3LQ3A 3DAEA 1H1RA 4ZJJA 5BPYA 3DZOA 3P78A 3FMMA 3GC9A 2XRUA 4O27B 5CAQA 2BFYA 2OIBA 4EZ7A 1V1KA 3D9VA 1XBCA 3JY9A 5EDQA 5L6WL 4RC4A 3EB0A 3UOLA 4XRLA 4YZ9A 3THBA 4EOQA 1CSNA 4I0TA 4G16A 2HZ4A 4MBJA 4YSJA 1KV1A 4FGBA 3FQSA 3PLAE 3LJ2A 1Y8YA 2WNTA 4R8QA 3FC1X 5HD7A 2WHBA 4FV3A 3BI6A 4CT2A 2B53A 4FOBA 1UU8A 4ZTRA 4UBAA 4KB8A 2XCKA 2XVDA 2YCRA 4JDHA 2Y9QA 2I0YA 4I6QA 4IAZA 4EQUA 3OP5A 3TM0A 3HKOA 4XRJA 4ZTNA 4MQ2A 4DC2A 2X8EA 5JFWA 1W0XC 4ALWA 2J5EA 5DRDA 2C6IA 2ITTA 3QU0A 4HOKA 5CEIA 4G2FA 4J8MA 3UG1A 3AT2A 5HTBA 4V05A 1XBBA 3VUHA 2IW8A 4X2KA 4Y8DA 1YW2A 5IEVA 5IQFA 1P4FA 2FA2A 1H27A 4AGCA 4DT9A 4IX4A 4YUQA 1STCE 1PYEA 4ZLZA 4BZDA 5A3XA 5CX9A 3UNJA 4FZDB 3KKVA 4FTAA 3RJCA 5IQDA 3ORLA 4UEUA 3C7QA 2C69A 4G3DA 1Q61A 2B7AA 2FSOX 2GPHA 4I21A 2BRNA 4J98A 3V5PA 4BDBA 4NL0A 4YC6A 4ALUA 5H2UA 2RGPA 4R3CA 4X7QA 4G6OA 2EWAA 3QD2B 4O2PA 4BCOA 4OW8A 5AADA 3E88A 2P33A 5AR8A 1F5QA 3E3PA 5DNRA 4RT7A 5L2TA 1Q8UA 1VZOA 5EI8A 4CFNA 3C9WA 5JMSA 2O0UA 4PPCA 3PG1A 4FBXA 1ZARA 2PZIA 3EN4A 4GUBA 4U3YA 2WELA 1HCLA 4A9YA 3RMFA 4GIIA 5M44A 4M66A 3MWUA 2OF2A 4WRSA 5C8MA 5EM6A 4FEWA 2ITOA 3ODYX 3B2WA 3WZJA 4LUEA 4BRXA 4ZTHA 3EN6A 4YHJA 1XH4A 2R0IA 3LHJA 4RIXB 3VUMA 5AUUA 3PA5A 4C3RA 4XHKB 3GGFA 2YEXA 4ZY4A 5M09A 3BEAA 3NUYA 3C5IA 4FIJA 5HX6A 3UOKA 2R3IA 4UZDA 4HNIA 2EUFB 2OH0E 4HYUA 4YJNA 2GS7A 4H1MA 4WG4A 1JLUE 1H1SA 1QPJA 3FWQA 4PRJA 4KAOA 2GQRA 3RNYA 3E8DA 3C1XA 3RINA 2YAAA 4HVIA 1J91A 2HXLA 3TCPA 5IQEA 3S1HA 4FE2A 2W4KA 3V5JA 3KRRA 3L1SA 1QCFA 4RVLA 4E1ZA 4Q5HA 4M13A 3NW7A 5HE3A 1UKHA 4EH7A 2YCSA 5HE2A 4AX8A 3I4BA 3ZZEA 5I9UA 5LVPA 1JNKA 2VO0A 4FKSA 2Z02A 4ACGA 1NXKA 2WO6A 4FKIA 5A54A 4MXXA 1IA8A 3FMLA 4F9BA 1U59A 1RE8A 3L8PA 3NVKI 5IQCA 4FT0A 2UZBA 3F3WA 4GFOA 4Q9ZA 4IZ5A 2YIYA 3H9FA 5DBXA 3DK7A 3G5DA 3NDMA 3VAPA 4ZSJA 1FGKA 4NIFB 4QP7A 5CU4A 5E1EA 2WMVA 4XJ0A 3RPVA 5JN2A 3PUPA 3ZOSA 2YWVA 4EH4A 3CQWA 4O82A 5CVHA 3TT0A 2XCHA 1WVWA 2WU7A 5D7VA 3EQHA 2WFYA 3AOXA 4X2GA 3R8VA 3MESA 4XV2A 4Z7GA 4ZY5A 2W5AA 4ZOGA 3R2YA 4YC3A 4DCEA 4E73A 3ZFYA 5JQ8A 2PYWA 1BYGA 1O6KA 3BBTB 4EKLA 3UMWA 5CZIA 4X6RA 3PSDA 4FTIA 4FKPA 3F66A 4FF8A 3BPRA 4YNOA 5K5NA 3QWKA 1YHVA 3LLTA 2IVSA 4U6RA 3PXZA 2QR8A 2XJ0A 4A9UA 4O21A 3RPOA 3A7GA 4XG3A 4FKLA 4DEAA 4EOLA 3GCPA 1IRKA 4BWPA 1JSUA 2E2BA 4DEIA 2W1DA 1VEBA 3EL7A 5AA8A 5KKRB 3FMJA 5CVGA 3FL5A 3BX5A 4MNFA 4OAVB 4NFMA 2BKKA 2PVMA 2G01A 2O63A 2Z8CA 4I5HA 4YLKA 2VWWA 4WNKA 1SVEA 3PP0A 1OBGA 4K1BA 4BCIA 1ZYJA 3G0FA 3OOMA 2HY81 4QMNA 2JGZA 4GT4A 4IBMA 5E8ZA 5J9LA 2PE0A 4EOMA 2XBJA 1J7LA 2XRWA 4X3FC 4Q2AA 2GFCA 4K18A 2PY3A 3DKGA 4CKJA 4DYMA 3H30A 4L3JA 3DBCA 3MA6A 4FV0A 2XNEA 3UNKA 4DFLA 1RJBA 1UV5A 2NO3A 2OXDA 3MS9A 2KULA 5M51A 4L67A 1OI9A 3AC1A 5DA3A 1PXMA 4F9YA 4YC8A 4QQ5A 4U0IA 3SD0A 2I0EA 3AMBA 3R2BA 3AGMA 3KXZA 2WEVA 3D4QA 4PDOA 4AE6A 4MH7A 2Q83A 2C3KA 1NY3A 4DTAA 3R7GA 5J1WA 2HYYA 1YOMA 3JXWA 2YISA 4PPBA 5HVYA 3DFAA 1FQ1B 2I1MA 4QMZA 1XR1A 3DY7A 3OEZA 3EN5A 4FK6A 4HJOA 4WRGA 2O3PA 3C4XA 4U97A 4QNAA 2UW3A 4USDA 2GNHA 4LGDA 2RFSA 2JBOA 3CJGA 5J7BA 3FI4A 4L3PA 4MNEA 4DH3A 2WKMA 4IFGA 3OBGA 3RCDA 1MQ4A 5CQWA 3MPTA 2QHMA 3POOA 1GZ8A 3IDBA 2QOOA 3QC4A 5DT4A 2ACXA 4G1WA 5AR5A 3ZONA 4E5WA 3QZHA 5HLWA 3GI3A 1RQQA 4FMQA 3QGYA 2A1AB 5ITAA 3DNEA 4ZZMA 2OF4A 1BI7A 5JGBA 1WZYA 4ZJVA 5LMKA 4P4CA 3VBVA 3FL4A 4HNFA 3N9XA 4PMTA 4JDKA 3UZPA 1OIQA 1V0PA 2XNOA 3MPMA 5G1XA 3V8WA 2J5FA 5B0XA 4O0WA 4ORKA 1ZOHA 2ETKA 4BICA 3NPCA 1ZOGA 3EMGA 3UJGA 3FMKA 3NAYA 5A6NA 4CLIA 3CY3A 4PL3A 2QD9A 2XKFA 3D0EA 4D2WA 3EFWA 2XK6A 3HMMA 1J1BA 5FDXA 2UW6A 4RJ5A 1SNXA 5IUHA 4RJ3A 5KMIA 1OKWA 2HW7A 2GS6A 4DFUA 4WBBB 4HYHA 5M4IA 4GT3A 3LFAA 1BUHA 5LVOA 1DM2A 5ANKA 2JKKA 2UVYA 4HGTA 2BTSA 2H9VA 3E8EA 1S9IA 4U44A 5LVLA 4EJNA 4I4EA 5CY3A 1OUYA 5KO1A 1IA9A 5IKWA 4BBMA 2ZJWA 2IWIA 5AV1A 5AEPA 5K0XA 5B2LA 3L8XA 2XYUA 3QGWA 3D7TA 4LL5A 4Y83A 4CFWA 4JG7A 5AR3A 2JFMA 4FNYA 5M06A 3FKLA 4XH6A 3S0OA 2A19B 4YURA 3FPQA 4PP9A 2W1HA 4GG7A 4G9RA 1J7IA 5AUWA 2C3IB 3FZPA 4MXCA 3KK9A 1UU3A 4AT5A 1XH5A 4X3JA 3VS6A 4DTBA 3I1AA 4CQGA 2UW4A 1O6LA 3TZMA 5IPJA 1KOBA 3MH1A 4TRLA 3EYHA 5F1ZA 4MBLA 3VS0A 4GJ3A 3R1YA 5CU2A 3ACJA 2PL0A 1Q8WA 2WMTA 2XIXA 1OMWA 3IW6A 3JUHA 5AP6A 4DH1A 2JLDA 3C4EA 4F9CA 3U4UA 1B6CB 5B2KA 3DNDA 4FT3A 3R73A 4EORA 4IVCA 3TNQB 4D0XA 4AXAA 4EEVA 1OBDA 4NTTA 2J51A 4MF1A 4UMQA 2C5NA 4A4OA 4AT4A 4KD1A 3AC4A 3Q32A 4M12A 4DLIA 3VUGA 3II5A 5IDPA 2C30A 1VR2A 4U40A 5E8VA 4WNOA 4E4NA 3NUPA 2R3KA 4OBPA 4W4VA 2VTLA 5CAUA 5KX8A 5L2WA 4BGGA 4OTGA 3OXTA 3ZYAA 4B9DA 5KMKA 2PVKA 5J79A 2OWBA 4MNEB 3TWJA 1IG1A 5BMMA 1OPKA 4AZTA 5ANJA 1F3MC 3QYZA 4GV1A 4OTHA 2W9FB 5L2IA 2VNYA 3P86A 1ZWSA 3E62A 3GXLA 4FV7A 4YNEA 5TT7A 3R04A 2C6LA 2X7OA 2FH9A 4Z9LA 4F4PA 3QHRA 5J9ZA 1G8SA 3MPAA 3ORKA 4E5BA 4ZTLA 4H58A 4V0GA 2XNGA 4HGEA 2PUPA 3EQBA 4IIRA 3GC0A 1J3HA 5DR6A 4R7HA 4U41A 4YZBA 5I9WA 3PVBA 4H39A 3FI3A 3QUPA 4D2RA 1O6YA 2J6MA 2BAQA 2BHHA 1R1WA 3F3TA 3NUNA 1PHKA 4FKQA 5CQUA 4AN9A 4ZMFA 4WHZA 3UPXA 1J1CA 3CE3A 1KE9A 3A7JA 3BHTA 4I93A 4O0SA 4C2VA 4XV3A 4HVDA 2BZHB 2CGUA 4BI2A 1Y91A 5CENA 1PXLA 4XYFA 3OWPA 5CAOA 3GC7A 5IU2A 1Q4LA 3F3UA 3GU4A 4EK5A 2CCIA 4FODA 4YGAA 4O7NA 1UKIA 4XP0A 5FD2A 4OR5A 3BYOA 4W4WA 1OL5A 4J96A 2R2PA 3OOGA 5JGDA 3ZS5A 5KMNA 4XMOA 5T68A 3ATTA 4YJOA 4L52A 5HQ0A 3E7VA 3KMUA 4II5A 3R7EA 2WTKC 4FYNA 3ROYA 4GK2A 4LOPA 3UOHA 3WZDA 3FMHA 3HNGA 4FV2A 3EL8A 4JQ7A 4ANSA 3TUDA 1ZYLA 4LOOA 3D7TB 3D2IA 3I0QA 4YBKA 4ASXA 3V5TA 4RJ4A 4CV8A 4RIWA 4EOPA 2UZVA 1FPUA 3IPHA 3RBWA 3Q9XA 3GCQA 3E64A 3NLBA 4ENXA 4JL9A 2WIPA 1U5QA 4RA4A 2ZM3A 2BDFA 3R1SA 2VTAA 5IH5A 5K5XA 2PMIA 3RAKA 4CYIA 4CV9A 3KU2A 4FV8A 3T9TA 2HK5A 3ZO3A 1OPJA 3VN9A 3MSSA 2BFXA 4CCBA 1ATPE 3NCZA 2RL5A 1PXOA 4HPUE 5I5ZA 2HCKA 3KVWA 3M11A 4FT9A 5KUPA 2B1PA 5KCVA 2R3FA 1UU9A 5FTQA 2IO6A 2RFEA 5CVFA 4IVDA 4IEBA 4AF3A 1X8BA 2RIOA 4G6LA 4XBUA 5CU0A 2QURA 3AD5A 5EM8A 3U9CA 4DTKA 1O9UA 2R3QA 4O91A 2G2HA 2QNJA 2O2UA 2BR1A 2XK9A 4EWQA 4NKSA 3MY1A 2YITA 3QZGA 1NVQA 2C5OA 5DOSA 2VWIA 3SOAA 4ZSEA 1U4DA 1WBOA 1XO2B 5ACBC 4QMVA 3HUCA 5L2QA 4D5KA 4G5JA 2YJRA 5GZAA 4O0VA 4BDHA 5HKMA 5J87A 4FKWA 5K3YA 5JKGA 5HI2A 2VTRA 4W4XA 2UW7A 4BTMA 4V0GB 3TNHA 5TOZA 4AW0A 5DRBA 2BIYA 4O7YA 3NGAA 3P23A 2P0CA 3TZ9A 2R9SA 3COKA 4EOKA 4ANNA 2H96A 2JDVA 1OL7A 2WTKB 5M07A 2QONA 2PU8A 5D41A 3IOKA 2WQOA 4NCTC 3PRIA 3ALNA 1PMNA 4JG8A 3VBTA 1YDTE 2YACA 4DGLC 3HMOA 3A7HA 3L9MA 4USFA 2R3PA 2WQMA 4JDJA 1H0VA 2VD5A 3ITZA 3PXKA 2W1ZA 3QAME 3JVSA 2X6DA 3LFEA 3Q9ZA 3UYSA 4AA4A 4XP3A 5M4UA 4JBPA 1VYWA 3FUPA 2WPAA 3QRIA 2VTNA 3HA8A 2H34A 3R9DA 4AA0A 3B8QA 1U5RA 2F7XE 2QQ7A 2W1GA 5HG9A 4CQEA 4BKZA 4DITA 4FICA 4C61A 4CRLA 3RI1A 5GINE 3VBXA 4F7JA 4GIHA 2IZTA 3OTVA 4O1PA 4B7TA 4FSQA 3UG2A 1KWPA 2F49A 5CI7A 5B2MA 2YLEA 4K11A 5C8KA 4I5MA 2B54A 3Q4UA 3GU5A 4M0YA 3GQIA 3K54A 3P7AA 3R8PA 2BILB 3G51A 5HO8A 5AP4A 5CEMA 3BBWA 4K9YA 4U9AA 4AT3A 3QCQA 4NM3A 4RIWB 4QTEA 4O83A 2C6MA 3GB2A 2R64A 1JBPE 4BWKA 2C6TA 3NUAA 5I4NA 4KABA 2ETRA 4DEHA 1CM8A 3FMNA 5JH6A 4U8ZA 4C7TA 3G6HA 3NZ0A 4HCTA 3MY5A 1NT2A 1XBAA 3IONA 4FZAB 4N6ZA 3W2RA 4G17A 5FDPA 2VN9A 1VJYA 2HWOA 4N4SA 5CT0A 4NSTA 3BHUA 3ZLXA 4DAWA 2R0UA 4UN0C 4IJ9A 2PVJA 2WMAA 2J9MA 2Z7RA 3QRJA 5HOAA 1H08A 3DAKA 4CFXA 2VWVA 4XLIA 3JYAA 2XM9A 4TWOA 3NYOA 4C38A 3FQHA 1VYZA 4TYHA 3VS3A 3FZ1A 3FSFA 2JAMA 5AP5A 4EH2A 5BUJA 4XG2A 4GYIA 4FEUA 1E1VA 4S34A 3OMVA 5TE0A 4YJUA 1MRUA 4XV1A 3V8TA 3VS2A 4BTJA 2GDOA 3KA0A 2OIDA 4BHZA 4EYJA 1K9AA 4CG8A 2FYSA 2CHLA 4PL4A 3NCGA 4O38A 3HRFA 3EFLA 5L6OA 5E8WA 3WZKA 1JAMA 2ZAZA 2X81A 5JGAA 3FDNA 5T6KA 2XBAA 4Z16A 2GQGA 5AM7A 3C4WA 3RK5A 4GKHA 2WEIA 5DI1A 3TDVA 5GNKA 4FT7A 3OBJA 4PY1A 3L9NA 3W32A 3PDTA 5L8KA 2B52A 1WMKA 4IFCA 4MK0A 4F7LA 3R7OA 2VTHA 2BPMA 4S30A 3R7IA 5L2SA 3LXKA 5FUTA 4J99A 4QNYA 4G9CA 2XJ1A 4EOOA 4WSQA 2QI8A 3DTWA 3KQ7A 3QXPA 4GYGA 3R21A 5KBRA 3OT3A 4DEGA 4CFVA 2PZPA 4NK9A 3ZLSA 3OVVA 2G2IA 3GCSA 3HA6A 3EQRA 2C6KA 1WVXA 3D7ZA 4PDPA 4V04A 3KULA 3VULA 5HO7A 4IB1A 1FMKA 4MTAA 4R5YA 3UOJA 4L42A 4F6UA 4E4XA 2LGCA 2E9OA 2VNWA 3UVQA 4D28A 2I7QA 4DA5A 4EYMA 3R00A 4X0MA 4E6CA 4D4VA 1GAGA 1CKJA 3FLQA 2W17A 3C50A 4DGGA 3JR1A 1BX6A 5HG7A 4QMSA 4WT6A 3WI6A 3HLLA 4P90A 3PPJA 2WD1A 4NW6A 4AOJA 3ZCLA 5FXRA 2VUWA 4FK3A 1KSWA 2OJFE 4GL9A 5M4CA 4J8NA 1H1PA 3KXXA 4IADA 3MH0A 3MYGA 4AZEA 4K2RA 1FOTA 2O5KA 5TR6A 5HNIX 2WU6A 3IK3A 2BKZA 3OTUA 4QQCA 5CS6A 4BGHA 4BN1A 2PZ5A 1M14A 3AGLA 3ODZX 5BVFA 5CASA 2HXQA 3TG1A 1M7QA 4CYJA 3LKMA 3GCVA 1QPDA 2W5BA 4NU1A 3JY0A 4D55A 3F69A 3A61A 2BCJA 2ERKA 4D4RA 4BIBA 5EI2A 5EKOA 3EFKA 4DF3A 3F3ZA 3MVMA 4TWPA 3PJCA 4MBIA 3ORIA 4KRDA 3A8WA 2Q0BA 3HMIA 4PP7A 2GSFA 3FE3A 4TYHB 4C4IA 1XH7A 2VWYA 4NFNA 3OW3A 2X8IA 1EH4A 4FKGA 5D9HA 5IUIA 1Z5MA 4I92A 3LFQA 4CRSA 4QYGA 5AV4A 3MN3A 4IWDA 2J0KA 3OY3A 2WMBA 4AE9A 4KIKA 2C1BA 2R3JA 3QD0A 4N0SA 3W2OA 5JRQA 1LEZA 2R4BA 3VBYA 4FSMA 3A7IA 1ZMWA 4X21A 2WGJA 3HX4A 3IO7A 4Y95A 2VTIA 4B4LA 4F6SA 2GMXA 4GRBA 4EC8A 2Z7QA 3ZM9A 2XK7A 3HP2A 2OLCA 4F7NA 2BZJA 2UZOA 3TTJA 4O6EA 4AOTA 3E8CA 4LQMA 1M2QA 2J90A 5HNBA 5C26A 4C58A 2FB8A 3QTQA 4QMYA 3BQCA 3OHTA 2Y8OA 3DBQA 1QMZA 3H3CA 3O23A 3GU8A 4MAOA 4X2JA 3D5WA 4AACA 4FC0A 4BFMA 3FXZA 3LCOA 5A4TA 3QRKA 1WBTA 2B9IA 4FTQA 2RKUA 1LR4A 1ZOEA 3KY2A 2V7OA 2OZAB 3DV3A 4NIFA 2XA4A 3MFTA 2HIWA 3HRCA 2C47A 1APME 4AZSA 3L9LA 5IEYA 4BIDA 3ZXZA 3D2KA 3HRBA 2YWPA 5LWNA 2X6EA 5E9EA 4ZLOA 3OCTA 2Y4IB 3OY1A 5M53A 3KULB 3KL8A 4A4LA 3EQFA 3PG3A 4LUDA 4S2ZA 4APPA 3DDQA 3BHHA 3EKKA 3KMWA 3Q6UA 4M97A 3ULIA 4AZWA 4O7RA 4E26A 4QMPA 3DB8A 5KZ0A 3O2MA 5LCKA 3BQRA 4PWNA 4FTCA 2C4GA 4WSYA 2BRMA 3RNIA 3TUCA 4QMLA 2UUEA 4IAIA 5M4FA 3ROCA 3NW6A 4B6LA 3ACKA 5HIEA 5IZFA 3N4TA 4F63A 3AG9A 3MFSA 2AC5A 3TI1A 3UQFA 1W84A 5CWZA 4XCUA 3MV5A 4FEQA 3CGOA 3QX2A 3NUUA 4OTRA 4Q9SA 3DLZA 1H26A 4EONA 4W8DA 4KA3A 4FTJA 2UW5A 1S9JA 2HAKA 3CR0A 3VS7A 2P55A 3NNUA 4N57A 1TVOA 4IC7A 5L8LA 3FMDA 4LMNA 4D1ZA 4CZTA 3GENA 2XEYA 4QRCA 4WKQA 4UMUA 2I0VA 2XIYA 1F0QA 3ULZA 3PJ2A 1JKKA 5EYMA 4BC6A 4O1OA 2QOLA 4C4GA 2RG6A 2GHGA 4GUEA 3NYXA 3NYNA 4D2TA 3QQLA 1L3RE 2WTCA 3F5UA 1Z9XA 4RJ6A 3SG9A 2YM3A 5GIOE 2QODA 3FQEA 2HZNA 1YOLA 4I22A 1KV2A 3ET7A 4XG8A 4WG5A 4H05A 2I40A 3DKFA 3IQ7A 3H9RA 2PMOX 5CNNA 4C37A 2PVHA 3UIUA 3QKKA 2WMUA 3DAJA 4FR4A 4RZVA 4W8EA 2ZVAA 4EH5A 5KKRC 3KXGA 3BWJA 3MVHA 4KIKB 4Y72A 4FSYA 3VO3A 3VWAA 3W18A 2IJMA 2CMWA 2NNWB 2VO6A 2WZJA 3R22A 1U46A 4FKVA 4C59A 4F0IA 4W9XA 3K3IA 2XKCA 5HG5A 1NA7A 4IX3A 5DPVA 5EHYA 1R39A 3HMPA 4EI4A 1GJOA 4O0YA 1OPLA 3O8TA 5DIAA 3MVJA 5CAPA 4L9IA 4YZDA 3BGQA 4M7IA 3F2NA 4LRJA 3QHWA 5BYLA 4DFYA 4FKUA 3S4QA 5FXSA 4IX6A 2XZSA 4BDGA 3AD6A 3FEGA 3ZLYA 2JDOA 2PUUA 3F5GA 5HU9A 4E6QA 1MP8A 1UWHA 3G33A 5AV0A 4ENYA 2X2MA 4FSRA 4LL0A 5A9UA 4FV6A 5HU3A 1YVJA 2RFNA 3ENMA 1YXSA 4BDEA 4BI1A 2WMRA 3Q5IA 3W8LA 5M56A 2B9HA 5A4LA 3LMGA 5FBOA 5BUIA 1FGIA 2CPKE 3KREA 2HZIA 4J53A 5D10A 3OC1A 2QKWB 5F4NA 3LFDA 4IE9A 2IW6A 3FLZA 1OITA 1YWRA 3LXNA 5AJQA 4G31A 4F6WA 4QP3A 2XKDA 4OUCA 4QMXA 4WOVA 2ZMDA 3KXMA 3VBWA 3KF4A 4ASZA 5HLNA 2C0IA 4DE4A 1YOJA 2UZTA 1BL7A 3MW1A 3NIEA 5AP7A 3SXFA 4RWIA 3FLSA 4HVGA 3F9NA 1SYKA 4L44A 3ZO2A 1E1XA 5FG8A 4D0WA 4G6NA 3U4WA 3DQWA 4QQJA 4QPAA 4HCUA 2X2KA 1M2PA 3LCKA 3MIYA 4YJRA 2IPXA 1B39A 4OLIA 4BCKA 2YIRA 3PPZA 2O65A 3TEIA 4CT1A 3F7ZA 3C0GA 4RWLA 1ZMUA 2X1NA 5EQEA 2HENA 1PRYA 1YRPA 3M42A 3KMMA 4FNXA 4I20A 4J1RA 4P5QA 4B0GA 5GHVA 4BDJA 3O17A 4K77A 5E90A 3FHRA 2B9FA 4D2PA 1Q8ZA 4Y5HA 3LE6A 1T46A 5ICPA 4BB4A 3GQLA 5FP5A 2X9EA 3BEGA 2OU7A 4DH8A 1TQMA 3ZEWA 3FY2A 4EJ7A 3RK9A 4Z55A 4JT3A 2F4JA 2OK1A 2V55A 4A9SA 4ZAUA 1YHWA 1OKVA 3ZM4A 4H3QA 3O8PA 4Y73A 2PTKA 4YP8A 4ALVA 4RLKA 3F5PA 2BRBA 2A27A 4IWOA 4BDKA 2REIA 2NPQA 3FZRA 2C6EA 1UA2A 4QQTA 4XV9A 4FL1A 4BBFA 4ZS0A 5C27A 3WYXA 3F2RA 4CTBA 2UZWE 3C4CA 3E5AA 4XG7A 3C0HA 3M2WA 3FKNA 4RX9A 2XEZA 3MB6A 5E8UA 1AD5A 3P1AA 4C02A 2CJMA 3UQCA 3ORNA 4L43A 4M68A 4UYNA 5BVKA 2VO7A 5BVEA 1KE7A 5KMJA 3FXXA 4C36A 5AUZA 4CZYB 3RAWA 5IQAA 2CGVA 4GJ2A 3F88A 4FIEA 1YQJA 3SRVB 5CSPA 4KKGA 2C1AA 3CGFA 4YTFA 4GKIA 3KVXA 3KN6A 3LAUA 4IW0A 3BV3A 3PSBA 3NNVA 3AXWA 4R6VA 3RPYA 3L9PA 4CMUA 2WTDA 3E92A 3ORZA 5EM5A 3S2PA 4EHZA 5AUTA 4LV8A 3NWWA 4D5HA 4IH8A 1A48A 4R77A 4ONAA 1PF8A 2G1TA 1Q62A 2Y4PA 3LCTA 1DAWA 3QYWA 4XEYA 1NW1A 3LFBA 3CS9A 5IUGA 2Y6OA 5M08A 5A14A 2XM8A 4YPSA 3FMEA 4MVFA 3TACA 1SNUA 3BHVA 4FSTA 1A06A 4UZHA 3U8WA 4U5JA 2QG5A 1JPAA 1PXNA 4MEDA 3ATSA 4WNPA 2GTMA 4U3ZA 4PQNA 4BZOA 4IWPA 2CGXA 3PE1A 4ERKA 4BCGA 3QXOA 4IAAA 4A9TA 3BRBA 1ZAOA 2V62A 4YHFA 3UNZA 5HESA 4TYEA 3RPSA 1SM2A 5L4QA 3GFWA 3DLSA 4FG7A 3HAMA 4WNMA 4F64A 3Q4ZA 5HLPA 2VX3A 3ZMMA 5I0BA 3LJ0A 2XIZA 3BU6A 2CSNA 5A46A 2PWLA 3EFJA 3UTOA 5CSWA 4APCA 3PTGA 3LZBA 5CLPA 4WD5A 2ITQA 1V0OA 2PVFA 4QMTA 4QP8A 5ANGA 5LMKC 4BCFA 3SW4A 4YZMA 4PL5A 3MJ2A 2YFXA 3HVCA 2ITZA 1QPCA 2P2HA 1JOWB 4IM0A 5I9YA 4L53A 4KNBA 1MQBA 5LOHA 4AW2A 2VTPA 4GMYA 4XP2A 1PKGA 3PJ1A 3DK3A 3Q96A 2XP2A 4YR8A 5BYZA 3RZFA 2FVDA 4FEVA 4MCVA 4YZNA 4C34A 3WZEA 2EVAA 4HGLA 3OFMA 4KKEA 4FSUA 3U6IA 5IH4A 4C4FA 4MWHA 5AMNA 4TYJA 4KIQA 4ANQA 3PWDA 3PWYA 3WE4A 1P5EA 4FKTA 3CTHA 1P2AA 1UNGA 2C0TA 2C5VA 5BVOA 3DGKA 2OIQA 2E9VA 4YJVA 4XOYA 5HE1A 5BVWA 3UP2A 4C35A 3VQHA 3TDWA 4IXPA 2GNLA 1OVEA 2VTOA 3BGPA 4F7SA 2B0QA 4MD8E 1YDRE 4YLJA 1NVSA 3LW0A 4F1MA 2VU3A 1GIIA 4LFIA 3VUKA 3REPA 4M84A 1QL6A 4XS2A 4ZS4A 5J8IA 3RTPA 3ZDIA 1JVPP 3DCVA 5HHWA 5FWKK 4GSBA 4FTTA 3UBDA 5E4HA 4EK3A 1YHSA 3H0YA 5ETCA 3CBLA 3RKBA 1XJDA 3VRYA 4Y85A 5JK3A 5HO6A 4B99A 4EC9A 4B8LA 3S95A 3KXNA 3UIXA 3TZ8A 2XK8A 5AA9A 5LVNA 2WMQA 4IVBA 4O7SA 3ZZWA 2EXMA 3A4OX 4JAIA 4IB3A 4QP2A 3UZTA 3U51A 4G3GA 5ANOA 4RZWA 5IG1A 4PV0A 1WBVA 2VTTA 3QQJA 4QMUA 3N4VA 3HV6A 5CEKA 3ZLWA 1YKRA 4R7IA 2IVTA 4YO4A 2Y6MA 5IH6A 4LGHA 3I60A 4U43A 4A07A 3BCEA 2QO7A 4CCUA 1ND4A 4G3CA 1H24A 3DTCA 3HV7A 4QP4A 5EYKA 3ZXTA 3GOPA 2CGWA 5D7AA 1W7HA 4BTFA 3Q9WA 4EKKA 4UMRA 3A62A 3ORTA 4JI9A 4C3PA 4TWNA 1WCCA 2FGIA 3KCFA 3VBQA 5T3QA 5CF4A 1LPUA 3DA6A 4FIHA 1Q5KA 3EWHA 3QKLA 3NW5A 2VAGA 2OJJA 3Q3BA 3ZEPA 3V6RA 2DWBA 4GH2A 3LOKA 4MD9E 3ALOA 1PW2A 4UWBA 4YJTA 3TKIA 3PYYA 5KBQA 1I09A 2XH5A 5EOLA 5J5SA 2CNUA 4ACHA 5FQDC 2C6OA 3DBFA 4AWIA 4FKRA 5J9YA 5EW8A 2OG8A 1OIRA 2OH4A 3VUTA 4BVUA 2QOHA 4OAUC 5GIPE 2QOCA 3EZVA 1W83A 2VTSA 2ZDUA 4I5PA 4L6QA 4WO5A 4YSMA 4ZSLA 5HE0A 4ACCA 3FXWA 3I0OA 4JS8A 4C2WA 4DEDA 2R5TA 3CD3A 2FSLX 3PJ3A 3QQHA 4XOZA 4GW8A 2OGVA 4IQ6A 3QCXA 3P7CA 4FZ6A 4XBRA 4FI1A 1Q8YA 3FY0A 3NRMA 3O0GA 3PIYA 1IAHA 3QUEA 5DE2A 2W5HA 1XKKA 2XNPA 2XB7A 3G0EA 4QMWA 3O50A 3V04A 4RX5A 4RPVA 1AQ1A 2YIXA 4AW5A 2XNNA 4UX9A 4IZAA 4RVMA 1UU7A 5FTGA 5C1QB 2E9UA 4EZ3A 4JAJA 3QZIA 2IVVA 2QVSE 4OTWA 2UVXA 4LM5A 4FIIA 3AD4A 1OECA 3GCUA 1Z57A 1MUOA 4JBVA 4EOSA 3EJ1A 3QFVA 3W8QA 4PUZA 4RGJA 2XKEA 2R3HA 4YLLA 1DAYA 3P4KA 3BE9A 4P2KA 4TW9A 5EDPA 4AOIA 4U79A 3BWFA 3TIYA 4ARKA 1YI6A 2CN5A 4I5CA 4FEXA 3QTXA 1H8FA 4IC8A 3DJ7A 4UWYA 5LJJA 3PPKA 2GS2A 2JKMA 2JDTA 2YIWA 3BYMA 3QC9A 3R6XA 4J97A 4QTBA 4FUYA 4GU6A 5CF8A 4R3RA 4I0SA 5IA3A 3DBEA 4RIOA 5GJFA 3DPKA
chains in the Genus database with same CATH superfamily
2OSCA 4BF2A 3ZU7A 4E20A 4X6QC 4I3ZA 4MXZA 4ANOA 1LEWA 3FPMA 5L8JA 5KHXA 4TXCA 2XAMA 2E9PA 4BCNA 3OWJA 3EQGA 4ZTQA 4W9WA 2A2AA 4JLCA 5I9XA 1FVVA 3E8NA 4X2NA 3IGGA 4MWIA 1ZYDA 3FI8A 1SVGA 1TQIA 2V7AA 4BDCA 4FV9A 3DKCA 4QMQA 3DXQA 3BYVA 2BAJA 5KE0A 1ZRZA 3RAIA 1FMOE 3HAVA 3GBZA 2UW0A 3UGCA 2ITPA 5AX9A 5A6OA 1RW8A 4YZCA 3NUSA 4AFEA 3EIDA 4PMPA 3ZRMA 4UB7A 4EWHA 1OZ1A 4CNHA 3IS5A 4MD7E 5FEDA 4E8AA 3PP1A 4OTDA 5JFXA 5BYYA 4EH3A 3VW8A 3U6HA 4DEBA 2PZYA 4E6AA 2YM4A 3VQUA 3MFRA 4GFGA 2DQ7X 2DUVA 4H3PA 4BCQA 4IWQA 4DH5A 4DN5A 1YWNA 2X8DA 1W2FA 5L6PA 2H8HA 3BELA 3HEGA 3W55A 2VWBA 3TNWA 4M67A 5E91A 2XALA 4A7CA 3DJ5A 3T8OA 3S00A 5LMAA 1WBNA 2XAOA 3ZFMA 5C4KA 3WE8A 3DOGA 3MTLA 3R0TA 3OCGA 3PLSA 4FGRA 4WA9A 2Z2WA 1U54B 2QR7A 4KBKA 4I23A 5DWRA 2C6DA 4D1SA 5LARA 5CXZA 1URWA 3U6JA 4YPDA 5K0KA 3UO4A 4FZ7A 5C8NA 5CEOA 3AC8A 3QX4A 2R7IA 3I5NA 2JEDA 3PZHA 4BJJB 2F2UA 5IF1A 3HGKA 4PPAA 2FUMA 3FYJX 3F61A 5DHJA 2Y0AA 5CALA 5B7VA 4EL9A 3D83A 4F1TA 2JAVA 3BHYA 5H8GA 1OL1A 1WBWA 1WBSA 1SMHA 1WBPA 4FIFA 3RWQA 5IEXA 4JX7A 3P0MA 3RPRA 3D5VA 3FYKX 3G6GA 3HP5A 4QYFA 1XMMA 4RFZA 5I9ZA 3A99A 5EYDA 4F09A 4LGGA 4IM3A 1Q3WA 3SKCA 5JEBA 2OBJA 4IANA 4OT5A 3B2TA 3EOCA 3KXHA 3Q4CA 5AR4A 5HG8A 3A7FA 1OL6A 5D1JA 5FRIA 4J7BA 3WF5A 3ZUVA 5EFQA 1AGWA 2W4OA 4DEEA 5A4EA 3SXRA 4BDAA 2KTYA 4EHGA 4YJPA 4L00A 1Q97A 4GK3A 5KMMA 4PTGA 2W06A 4ACDA 2X39A 4DH7A 3QTUA 1WAKA 2IVUA 3DS6A 5CTPA 3F5XA 3QQUA 1WVYA 4QYHA 1QPEA 2XIRA 3O51A 3MA3A 5EW3A 5K4IA 3W2QA 1XH8A 4M3QA 4IDTA 4QP1A 4FA2A 4BCJA 3HYHA 3ZO4A 4GVAA 4ZTMA 4F70A 2R3LA 4IZ7A 4DFBA 2UZNA 3MIAA 4AP7A 3POZA 4EHVA 2B4SB 2OZAA 2R3NA 4D4YA 5F9EA 5HBJA 4CVAA 2QOBA 4NM0A 2BMCA 1JSVA 4O7LA 4DFXE 1CKIA 5BQ0A 4ACMA 1BL6A 4XUFA 3PUFC 3ZBFA 1JQHA 4CEGA 3COIA 4AZFA 2ZV2A 3GNIB 4M8TA 5EH0A 1P14A 3ORMA 5AM6A 3T3VA 5HD4A 1ZY5A 4RX8A 2XIKA 5HX8A 5JZJA 3NMUF 5AUYA 3LLAA 3R7UA 2GTNA 4FTUA 3NYVA 3OEFX 1PXPA 2F57A 4YJSA 1H1QA 3RM7A 5J1VA 2CKPA 2C5YA 4DCAA 3FZTA 2OO8X 4BL1A 4OTIA 4I0RA 3T9IA 2JIUA 4R1VA 5DN3A 3NR9A 5TF9A 4AFJA 3HV3A 3C51A 4IHPA 3NFGB 3FAAA 4FL2A 3RALA 3BLRA 3Q53A 4O22A 3SHEA 4CXAA 3BKBA 3NEWA 4KS8A 3R9RA 2Y4IC 1WFCA 1YI3A 2PUNA 4FVRA 4L01A 4EUTA 2QOKA 2VTQA 3O96A 3DU8A 3EN7A 2OZOA 2J50A 2WTVA 3TJCA 3V51A 3FZOA 3Q2MA 3QTWA 3CPBA 3FJQE 3KB7A 1GOLA 4D4SA 3ELJA 3PY0A 4RBLA 3SX9A 2XMYA 1ERKA 4JQ8A 1PJKA 2CCHA 2WIHA 5C4LA 2EXEA 3EN9A 5FXQA 2HOGA 1YXUA 1JKLA 5CANA 1FVRA 3HV4A 4XX9A 3LCDA 2QU5A 4CKIA 5AV2A 5IA1A 4EOIA 3ZSGA 2VRXA 4A4XA 4MUQA 2OJIA 5J7HA 3MJ1A 4YU2A 3CCNA 2JC6A 3MH2A 3W1FA 5LVMA 3PY1A 3BU5A 3TL8A 3UQGA 4DG2E 3R71A 3WILA 4TKSA 2YM6A 1DI8A 5LCJA 4LRMA 3TUBA 5CU3A 4EBWA 1M52A 3EYGA 3KN5A 3LPBA 4EK6A 5DH3A 2GCDA 4KSPA 3QLGA 3CEKA 2OFVA 4WBOA 3SAYA 4AN2A 4TZRA 2R7BA 3LQ5A 4RVKA 4JG6A 1YXVA 2HY0A 3WIGA 3PIXA 3M1SA 4KBCA 4S33A 1CKPA 3W2CA 2F7ZE 2XJ2A 3CJFA 5CEPA 2PVNA 5EOBA 3F6XA 4LI5A 1YWVA 4YBJA 2QOFA 4O0TA 3MI9A 3DK6A 4DG0E 3EQDA 3KC3A 3ZHPC 4BDFA 4DBXA 2ZM1A 4UV0A 2OXYA 3TJDA 4EUUA 3F3VA 5FEQA 2Z7LA 3LQ8A 2CN8A 4FVQA 3SXSA 4AXEA 1NVRA 2GNGA 2R3GA 2R3OA 4DG3E 5BNJA 1R0PA 2CKQA 5EI6A 2QHNA 2PULA 4DDGA 2XNBA 3OG7A 4BCMA 3LFNA 2CLQA 4FTRA 4CFMA 1Y57A 4KBAA 4CGAA 3L8SA 3IW7A 2BTRA 3GEQA 1R3CA 1GIJA 1W82A 3CTJA 3VF9A 1J7UA 2C68A 4IVAA 3KCKA 3AQVA 4FV1A 2GNFA 1LP4A 4I6BA 1KE6A 4FNWA 4I6LA 4FKJA 5GJGA 3VF8A 1PMVA 5H8EA 5IDNA 2VGPA 2XNMA 2BZIB 4JDIA 3TMOA 4AZVA 1Q8TA 2ZYBA 3R30A 5E92A 4ZMEA 5EDRA 4FVPA 3WF9A 3CIKA 3LM5A 4RQVA 4GFMA 3OWKA 4ANLA 1XH6A 4O0XA 3W2PA 3Q9YA 3FHIA 3V5QA 2QLUA 3TKHA 3ZTXA 3VS5A 1M17A 4QMMA 1JWHA 3QQFA 3NS9A 3VHEA 3VUDA 2JBPA 4L7FA 2F9GA 2W1EA 3PSCA 4FSWA 4O0RA 4ANBA 3BLAA 4EBVA 5IQHA 4YTHA 4FJVA 4FTKA 3R7YA 3N4UA 3IECA 2IZRA 3CTQA 4GG5A 3R1QA 4JBOA 4YO6A 4UWCA 4CMTA 4EK4A 5L3AA 1E9HA 2OJGA 2GNIA 2NP8A 3OCBA 3BYSA 3QD4A 4R3PA 3ZC5A 3FI2A 4C62A 2ITNA 3OZ6A 1REKA 5IA5A 4E3CA 4D9TA 1HCKA 2J7TA 2YDIA 4IX5A 3SA0A 5I9VA 4FSZA 2J4ZA 3RAHA 2W99B 1T45A 2OICA 3E63A 1PKDA 4JBQA 5GZ9A 3RP9A 3TTIA 4BTKA 2VWZA 4PNKA 1IR3A 1GZNA 2F7EE 1W98A 3BYUA 5E8TA 4AU8A 3LMIA 4IB0A 1ZZLA 4RWKA 4BBEA 4D58A 4RJ8A 4NTSA 3VIDA 2C5XA 5AIRA 2NRYA 1R0EA 3UIBA 2R3MA 4DFNA 4RX7A 3QRTA 5D11A 3IG7A 4AQCA 1P4OA 4DINA 4FT5A 1PXIA 3DDPA 3JPVA 4W4YA 5CSHA 2R3RA 2BAKA 3MBLA 5AAGA 2ITYA 4CD0A 4L45A 3NSZA 5HTIA 4ZP5A 5CF6A 4R5SA 5ETFA 2VTMA 1B38A 3RWPA 3QQGA 3Q6WA 4I41A 1KUTA 3SOCA 3PZEA 3R9OA 3VONA 5AFVA 3UC3A 2DS1A 4CKRA 3R7VA 2WQBA 5DFPA 1KE8A 4K33A 3CSVA 2X2LA 4QMOA 5FGKA 4J71A 3KEXA 2BZKB 5IMEA 4NJDA 3SRVA 3W10A 2A4LA 2ITWA 3GC8A 3AT4A 3V6SA 1PXJA 4TYGA 2QOIA 1TQPA 2UW8A 2UZDA 3BGZA 3CPCA 5AIKA 2BALA 3SQQA 3V8SA 4F0GA 2ETMA 4XG4A 2WQNA 5J95A 4ITHA 5DT0A 1LUFA 3KRXA 5I3RA 3Q5ZA 4U42A 3RHXA 3Q4TA 4GU9A 2CNQA 3F2AA 4XNEA 5AP2A 4HYSA 4IDVA 2RF9A 4FRFA 3BU3A 3ANRA 3U54A 2HELA 2ZMCA 1G5SA 4D9UA 2WAJA 4ITIA 1OB3A 3DZQA 3ERKA 2YABA 4UXQA 3K5UA 2XK3A 4QPSA 3SW7A 5IMXA 3H9OA 4TT7A 3DBDA 3PJ8A 2VX0A 1XHAA 3KRWA 4E93A 4F9WA 1GZKA 3VVHA 4C3FA 5HTCA 1CMKE 3LMHA 4Q5EA 3D5XA 4AG8A 3F82A 3QALE 2I0HA 3QRUA 5DG5A 3D14A 3NAXA 3TNIA 3UDBA 4JRNA 4O7VA 4KRCA 4JOAA 3VC4A 2F2CB 2W1CA 3UE4A 3SC1A 3CQEA 5F95A 3GU7A 3CC6A 4S31A 5I3OA 3ZSIA 2CNVA 5AX3A 4YTIA 3RZBA 5KNJA 3C5UA 4LOQA 2EXCX 1ZLTA 5CI6A 2IG7A 2JIIA 1IASA 4JRVA 2YM7A 3K3JA 3PVWA 4RIYA 3CXWA 4RVTA 4ZIMA 2BRHA 3P08A 5AAFA 4A9RA 3IDCA 1REJA 4BKYA 2UV2A 4C8BA 4ZZNA 3UVRA 4PX6A 4WUAA 5ANDA 1Q99A 1ZMVA 2VV9A 4X3FA 3ZFXA 1ZY4A 1M7NA 1SVHA 3MDYA 3VJOA 4A06A 5HEZA 4DGNA 2QKRA 2YZAA 3R83A 5JZNA 3BE2A 3MVLA 4NZWB 3TZ7A 4BKJA 5AP1A 2X0GA 3O71A 1XH9A 2JD5A 2QOQA 2UW9A 3E87A 4FNZA 4TNDA 2W9ZB 5FP6A 1G3NA 5EKNA 2XANA 4ERWA 4F9AA 4O7ZA 5FM3A 3CQUA 2VTJA 3CD8A 3COHA 3HDMA 5HCYA 4M69A 1PXKA 4FV5A 3WIKA 2YAKA 2FSMX 2YZLA 3DKOA 2PE1A 5H9BA 3Q60A 5EM7A 4O7WA 4IMYA 3AC3A 4E7WA 4F65A 1JSTA 3HUBA 5DR2A 4IACA 3HL7A 5C01A 3UVPA 2GNJA 2JKOA 2UZUE 4BDDA 1FVTA 4M0ZA 4QP9A 2PE2A 4XLVA 3RCJA 2P4IA 4HVHA 4LYNA 4RRVA 5E7RA 3VUIA 3MFUA 2WTIA 2J0MB 2BVAA 4WUNA 2NRUA 4BZNA 3ORXA 4HZSA 1CDKA 3LFFA 4PDYA 3QTZA 4RJ7A 1PMUA 3R1NA 3GOKA 4TPTA 3PA3A 4IAFA 4TTHB 1SZMA 4PTEA 2QG7A 1OIYA 1Q24A 3VW6A 3EHAA 2IN6A 3FSKA 3ZO1A 3TN8A 2ERZE 1IEPA 2WMWA 4NYEA 5AWMA 3WF8A 4AAAA 4RFMA 4U80A 5EK7A 4AUAA 2G15A 4I4FA 3E7OA 4RSSA 2JKQA 5FTOA 4TWCA 3W33A 5LQFA 5HCZA 2EB3A 3OCSA 3UIMA 3EQPA 2W0JA 3GUBA 4JXFA 4MXYA 3LJ1A 4QT1A 5A4CA 3NX8A 4I94A 2YM5A 4QOXA 4ID7A 4TNBA 3HZTA 4JIKA 2RSVA 2FO0A 2YJSA 4H3BA 4PMSA 4DGMA 5JFVA 3UP7A 4TN6A 5AR2A 3QF9A 4HGSA 5DMZA 4CLJA 4RQKA 2H6DA 3IW8A 4AA5A 4MHAA 5CYIA 4JR7A 4RIYB 2IW9A 1H28A 4FOCA 4FZFB 4RWJA 5CEQA 1YDSE 2G9XA 3COMA 3SLSA 3TKUA 2YHVA 5KZIA 4CG9A 3I7BA 5JRSA 3EKNA 4I24A 4M15A 5IQBA 4X3FB 3EQCA 5EHOA 1CTPE 2ZV8A 3AC2A 5AUVA 5AAEA 5IA0A 4G34A 4D2VA 3R9HA 4BCHA 3V3VA 2P3GX 3DFCB 4QD6A 5F20A 4JIAA 1H0WA 3RHKA 2GQSA 5BUEA 2VWUA 5DGZA 5HORA 5K9IA 1BKXA 3FLWA 1Y6AA 1FINA 2JFLA 3H10A 1Q3DA 3BL7A 3PXFA 3MTFA 1H01A 3NNXA 2PMNX 5EYCA 2X4ZA 4HYIA 1R78A 2XS0A 4JQEA 4M69B 5CSVA 4DLJA 3VRZA 3U55A 2XF0A 4HPTE 4BIEA 5HNGA 2XUUA 3K5VA 3KF7A 3E3BX 4PNIA 5D12A 3WF6A 2CLXA 3HECA 4ASEA 3OT8A 3PRFA 2I6LA 5IQGA 2PVRA 1A9UA 4ZEGA 3PVGA 5EQYA 3MH3A 1OKZA 2PHKA 4Y46A 3CKXA 3FKOA 4L68A 2W1IA 5KHWA 1PY5A 1KE5A 2GHLA 2W96B 4R7BA 1OGUA 3LCSA 4R1YA 3ZBXA 2FSTX 1YXTA 3EZRA 5FLFA 2QC6A 4LRKA 4EK8A 4X2FA 4M14A 5JFSA 4H1JA 1MRVA 3GFEA 2BDJA 2QCSA 4L7SA 4MXOA 5IA2A 4OTFA 5JSMA 3RGFA 3DXPA 4O7TA 3AMAA 1H07A 4AGDA 1PMEA 5AUXA 2ZB1A 3VS4A 2PZRA 1L8TA 3I5ZA 5HZNA 4BWXA 4DHFA 4KS7A 5JQ5A 4BCPA 4DFZE 5CU6A 3OD6X 5BVNA 2VZ6A 3T3UA 2J0LA 2A0CX 4ZSAA 3A2CA 2Z7SA 3EQIA 4BHNA 3R28A 3QBNA 4QO9A 1K2PA 3RM6A 2B9JA 4C4JA 3PA4A 3W16A 2X4FA 4EH8A 1M2RA 3R01A 4RFYA 3P5KA 2HWPA 2ZM4A 4NM5A 4ZTSA 4BI0A 5CT7A 4QTAA 4CMOA 3BLQA 4F99A 3UYTA 2G2FA 2WTJA 3QKMA 4QPMA 2ZV7A 1BLXA 4L46A 4FTMA 5AP3A 3OROA 4TYIA 2WMSA 3OS3A 3P9JA 3R9NA 4OT6A 2WXVA 5FBNC 2E9NA 4RC3A 5DEYA 3ZRLA 2WMXA 1GIHA 4ZLYA 4L8MA 2V22A 3VS1A 4E6DA 4F08A 4FG9A 3R8ZA 3HDNA 4EQCA 1BI8A 2Y7JA 3HV5A 3N51A 3KFAA 3PIZA 3I79A 1OIUA 3LFSA 3SV0A 5LMBA 4HCVA 4GK4A 4H36A 1MRYA 4FKOA 5LWMA 2BIKB 2PPQA 5CXHA 4ZK5A 4EHEA 3IW5A 4OTQA 3B8RA 3Q52A 4JR3A 3MY0A 4N6YA 4NEUA 3O7LB 2ESMA 2CKEA 3JVRA 5HBHA 3SDJA 3WBLA 3UC4A 3IOPA 3L8VA 4USEA 4JJRA 2CDZA 3QA8A 3OF0A 1I44A 3PFQA 2AYPA 4MX9A 4K8AA 3KRLA 4FTOA 4K6ZA 4RLLA 4WG3A 4BR3A 1JKTA 3WARA 1OL2A 5BX0A 4NKAA 2ITVA 5IA4A 4LV5A 4G5PA 3RK7A 5HVKA 2GU8A 2X7GA 4Z3VA 1ZYSA 3PE2A 5A4QA 3OXIA 2ITUA 5LXMA 3UDZA 5HIDA 2GHMA 2ZB0A 4J52A 3QD3A 3TIZA 4ZSGA 2W1FA 4IZYA 3ID6C 2V0DA 5EG3A 4HW7A 1U54A 2OKRA 2UZEA 1DI9A 2LAVA 4O2ZA 4ZXTA 3I6UA 3Q04A 4FG8A 2YIQA 4UY9A 1V0BA 3SGCA 2WB8A 3I81A 4J95A 5ANIA 5F94A 4KSQA 3AT3A 1XQZA 3GU6A 4N70A 3KIOC 4MQ1A 2YLFA 2X7FA 4NM7A 1URCA 5KMLA 3PXYA 2ZDTA 4KINA 3VNTA 4HVSA 2IZSA 4GVJA 3G15A 4CFUA 2QU6A 1Q41A 2EB2A 3QTRA 5H8BA 4FYOA 5IQIA 5ETIA 4U45A 1G8AA 3UZRA 4BYIA 3UO6A 3U9NA 2V5QA 4LV7A 1JKSA 4CZUA 3ENHA 3A60A 3LIJA 4FV4A 3IW4A 2YDJA 2RG5A 4G3FA 3TNPC 3VJNA 4R78A 3NIZA 3QUDA 5E8SA 3LFCA 4EH6A 3R8LA 4GCJA 3GVUA 4O0UA 1YI4A 3QTSA 3V5LA 4C4EA 3H0ZA 3FV8A 4EZ5A 2YM8A 4TY1A 4E4MA 4CFFA 4IJPA 2YCFA 5HIBA 4NCTA 3FZSA 5DLSA 5AP0A 3UODA 5CNOA 4G3EA 1OM1A 4FX3A 3BIZA 2O8YA 3TXOA 2PUIA 3W0RA 3A8XA 4RG0A 3D15A 3PY3A 1H4LA 5C9CA 2RFDA 3TV4A 5KMOA 3WZUA 3UPZA 5DR9A 3TV7A 3BV2A 4D1XA 4UMPA 3K2LA 5JT2A 5M57A 1GNGA 1PYXA 2HZ0A 5AR7A 4BGQA 4FIGA 3UMXA 2ITXA 2JIVA 4U7ZA 4AN3A 4OBOA 1H25A 4KKHA 3ETAA 5ANEA 2DYLA 3QCSA 4CTCA 2BROA 4FTNA 4PTCA 4UYAA 4XG9A 2PVLA 4DGOA 3LM0A 4F1OA 5FEEA 5G6VA 4JNWA 3CY2A 4AGUA 3KK8A 3R8UA 3FBVA 4ZZOA 3LXLA 3C13A 3JS2A 4NJ3A 3E93A 4EOJA 3IKAA 2W7XA 3DXNA 1HOWA 5DEWA 1G8KA 2QLQA 2CKOA 2J0JA 3C4ZA 4NUSA 2EU9A 4I1ZA 2GFSA 4FSNA 3IDPA 3BZ3A 3R02A 3UO5A 4V01A 4O96A 3EH9A 3O5AA 2XK4A 4UALA 4L3LA 1DS5A 2OW3A 4F0FA 4NH1A 4P7EA 2O64A 1KOAA 4IAKA 3RVGA 4TL0A 2YDKA 4YHTA 3Q2JA 1OUKA 3CKWA 3S3IA 3LXPA 4AS0A 3QZFA 2JITA 3ORPA 3V5WA 2Z60A 5EHLA 4ZJIA 5E8YA 5ETAA 3AC5A 3DQXA 4KUJA 4ASDA 3C4FA 4FL3A 4KIOA 4DBNA 5E1SA 2PK9A 2WOUA 2C0OA 3OUKA 4O81A 3I7CA 1W8CA 2B55A 4ITJA 3OUNB 2AUHA 4JX3A 2VO3A 2J2IB 4IB5A 3GT8A 5E8XA 3LVPA 3QTIA 2YERA 1Y6BA 4E5AX 5CSXA 4P5ZA 2Q0NA 3BLHA 4IAYA 3ZUTA 2YCQA 1ZXEA 1GZOA 4UXLA 3P7BA 2W05A 3G2FA 4QTCA 3NUXA 3WF7A 1GY3A 4E4LA 2HW6A 3SVVA 4NWMA 5M55A 4JMQA 3DJ6A 2UZLA 4CSVA 3AKJA 1BMKA 3KGAA 2ZFYA 3R63A 4XG6A 5FM2A 3PVUA 3GP0A 2PSQA 5DVRA 4KWPA 4LG4A 2W4JA 1H00A 4C57A 4BDIA 3QWJA 5CF5A 4LMUA 4RA5A 4O86A 3OWLA 4QP6A 5BVDA 3O8UA 4HZRA 3DB6A 4O6LA 4AGWA 4KIPA 4K0YA 1ZYCA 4IM2A 4U81A 4Z7HA 3D94A 2ONLA 5H3QA 3V01A 5EQPA 4FUXA 1UNHA 1OKYA 2OFUA 5TO8A 1UWJA 4UMTA 4QYEA 2OXXA 2PMLX 4O4FA 2OJ9A 4S32A 4C0TA 4FTLA 3ANQA 3OXZA 3W2SA 3ZDUA 4MKCA 3IGOA 4ANMA 5BMSA 4YJQA 4NT4A 4QYYA 3ZSHA 2BUJA 2PVYA 2WQEA 1UVRA 3MB7A 1XMLA 4C4HA 4BYJA 3PXRA 4GT5A 3FC2A 1H1WA 3G9NA 4QTDA 1UNLA 3ZH8A 3SG8A 3P79A 5HBEA 5K4JA 5AV3A 3QCYA 5TKDA 1FBNA 2AC3A 3HMNA 2OI4X 2ONLC 4I6FA 3QLFA 3ZRKA 4OTPA 2YA9A 4PF4A 5IISA 2X9FA 3ZUUA 4AW1A 4YTCA 5GZ8A 5DT3A 3WOWA 5DYJA 4BY9E 2WOTA 1YXXA 3DT1A 5GJDA 2C3JA 3KRJA 2JDSA 2XYNA 4PDSA 3NNWA 2QO2A 4RC2A 2UVZA 5HVJA 3O7LD 2VWXA 4MF0A 3OW4A 3I6WA 4YMJA 1K3AA 3ZC6A 5J5TA 2WTWA 2C3LA 5CAVA 2YN8A 1IAJA 4OGRA 4I6HA 3C0IA 2BDWA 2BRGA 4NW5A 5CZHA 1XWSA 3CLYA 4QDVA 3TV6A 3MGYA 1ZZ2A 2IZUA 3QQKA 4C33A 3QL8A 4ZY6A 3FLYA 5ACKA 3CP9A 3U87A 3AMYA 3FLNC 4EH9A 5EW9A 4Y5QA 2VX1A 2ZOQA 3A4PA 3VHKA 3F7WA 3G9LX 2ZV9A 2SRCA 4GS6A 4RMZA 3WYYA 4MXAA 4PMMA 3G90X 1RDQE 3H4JA 1G8JA 3D5UA 3R8MA 4DT8A 4JVGA 4OBQA 5HICA 2J0IA 4O84A 3QA0A 2P2IA 2BHEA 5C03A 4B8MA 2X0OA 2VGOA 2JDRA 1TKIA 1Y8GA 4D2SA 4MYGA 4EQMA 4RIXA 4WIHA 3PXQA 4GEOA 2QO9A 5HCXA 5HGIA 3NVMB 3LQ3A 3DAEA 1H1RA 4ZJJA 5BPYA 3DZOA 3P78A 3FMMA 3GC9A 2XRUA 4O27B 5CAQA 2BFYA 2OIBA 4EZ7A 1V1KA 3D9VA 1XBCA 3JY9A 5EDQA 5L6WL 4RC4A 3EB0A 3UOLA 4XRLA 4YZ9A 3THBA 4EOQA 1CSNA 4I0TA 4G16A 2HZ4A 4MBJA 4YSJA 1KV1A 4FGBA 3FQSA 3PLAE 3LJ2A 1Y8YA 2WNTA 4R8QA 3FC1X 5HD7A 2WHBA 4FV3A 3BI6A 4CT2A 2B53A 4FOBA 1UU8A 4ZTRA 4UBAA 4KB8A 2XCKA 2XVDA 2YCRA 4JDHA 2Y9QA 2I0YA 4I6QA 4IAZA 4EQUA 3OP5A 3TM0A 3HKOA 4XRJA 4ZTNA 4MQ2A 4DC2A 2X8EA 5JFWA 1W0XC 4ALWA 2J5EA 5DRDA 2C6IA 2ITTA 3QU0A 4HOKA 5CEIA 4G2FA 4J8MA 3UG1A 3AT2A 5HTBA 4V05A 1XBBA 3TYKA 3VUHA 2IW8A 4X2KA 4Y8DA 1YW2A 5IEVA 5IQFA 1P4FA 2FA2A 1H27A 2X0QA 4AGCA 4IX4A 4DT9A 4YUQA 1STCE 1PYEA 4ZLZA 4BZDA 5A3XA 5CX9A 3UNJA 4FZDB 3KKVA 4FTAA 3RJCA 5IQDA 3ORLA 4UEUA 3C7QA 2C69A 4G3DA 1Q61A 2B7AA 2FSOX 2GPHA 4I21A 2BRNA 4J98A 3V5PA 4BDBA 4NL0A 4YC6A 4ALUA 5H2UA 2RGPA 4R3CA 4X7QA 4G6OA 2EWAA 3QD2B 4O2PA 4BCOA 4OW8A 5AADA 3E88A 2P33A 5AR8A 1F5QA 3E3PA 5DNRA 4RT7A 5L2TA 1Q8UA 1VZOA 5EI8A 4CFNA 3C9WA 5JMSA 2O0UA 4PPCA 3PG1A 4FBXA 1ZARA 2PZIA 3EN4A 4GUBA 4U3YA 2WELA 1HCLA 4A9YA 3RMFA 4GIIA 5M44A 4M66A 3MWUA 2OF2A 4WRSA 5C8MA 5EM6A 4FEWA 2ITOA 3ODYX 3B2WA 3WZJA 4LUEA 4BRXA 4ZTHA 3EN6A 4YHJA 1XH4A 2R0IA 3LHJA 4RIXB 3VUMA 5AUUA 3PA5A 4C3RA 4XHKB 3GGFA 2YEXA 4ZY4A 5M09A 3BEAA 3NUYA 3C5IA 4FIJA 5HX6A 3UOKA 2R3IA 4UZDA 4HNIA 2EUFB 2OH0E 4HYUA 4YJNA 2GS7A 4H1MA 4WG4A 1JLUE 1H1SA 1QPJA 3FWQA 4PRJA 4KAOA 2GQRA 3RNYA 3E8DA 3C1XA 3RINA 2YAAA 4HVIA 1J91A 2HXLA 3TCPA 5IQEA 3S1HA 4FE2A 2W4KA 3V5JA 3KRRA 3L1SA 1QCFA 4RVLA 4E1ZA 4Q5HA 4M13A 3NW7A 5HE3A 1UKHA 4EH7A 2YCSA 5HE2A 4AX8A 3I4BA 3W0PA 3ZZEA 5I9UA 5LVPA 1JNKA 2VO0A 4FKSA 2Z02A 4ACGA 1NXKA 2WO6A 4FKIA 5A54A 4MXXA 1IA8A 3FMLA 4F9BA 1U59A 1RE8A 3L8PA 3NVKI 5IQCA 4FT0A 2UZBA 3F3WA 4GFOA 4Q9ZA 4IZ5A 2YIYA 3H9FA 5DBXA 3DK7A 3G5DA 3NDMA 3VAPA 4ZSJA 1FGKA 4NIFB 4QP7A 5CU4A 5E1EA 2WMVA 4XJ0A 3RPVA 5JN2A 3PUPA 3ZOSA 2YWVA 4EH4A 3CQWA 4O82A 5CVHA 3TT0A 2XCHA 1WVWA 2WU7A 5D7VA 3EQHA 2WFYA 3AOXA 4X2GA 3R8VA 3MESA 4XV2A 4Z7GA 4ZY5A 2W5AA 4ZOGA 3R2YA 4YC3A 4DCEA