2Z7LA

Unphosphorylated mitogen activated protein kinase erk2 in complex with (4-{[5-carbamoyl-4-(3-methylanilino)pyrimidin 2-yl]amino}phenyl)acetic acid
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
340
structure length
329
Chain Sequence
b'VFDVGPRYTNLSYIGEGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFLPKEKLKELIFEETARFQPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Identification of a key element for hydrogen-bonding patterns between protein kinases and their inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 103
structure length 329
sequence length 340
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2z7lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2z7lA01
3HRCA 2BAQA 3FJQE 4FV3A 1JPAA 2WTJA 1I09A 3FY2A 3LFNA 3PJ1A 4N6ZA 4XJ0A 2C1BA 4A9RA 4U43A 1Q5KA 3BHUA 3F3TA 3VBQA 1OIUA 4N4SA 3E7VA 3WZEA 3ATTA 2DWBA 5M07A 5DT4A 2PY3A 1G3NA 3PPZA 1PMNA 3JUHA 1OL5A 3GNIB 4JT3A 4BDHA 4V0GB 2NNWB 2R3LA 3DOGA 2WZJA 4GK3A 5LARA 3W2RA 3UG1A 5CT0A 4FSMA 4ZTRA 4DA5A 4PPCA 3L8PA 4TRLA 4YZDA 2Q0BA 3KN5A 2WMWA 4GK2A 4RBLA 5A4CA 4I4EA 1STCE 5FWKK 3PLAE 5AIRA 4UWYA 4JL9A 4LG4A 5EYKA 2WTWA 3EQFA 3II5A 3DAEA 3V5QA 3UQCA 5DA3A 4EUTA 3EFWA 2XK6A 3JS2A 4BL1A 4PTEA 2WTKC 3KVWA 2QC6A 4NEUA 3ANQA 4DN5A 4DCAA 3U6IA 2BROA 3W2SA 4AT4A 4DEGA 2BDWA 2ERKA 4FKPA 5DT0A 5E9EA 5HBHA 3BWFA 4FT0A 4NM7A 2CLQA 3DQXA 1MUOA 5EW8A 2VZ6A 2ZM1A 2JITA 4ALWA 5IA0A 1M2PA 3ELJA 1R39A 5E8ZA 1Z9XA 5BYZA 3GC8A 5JGAA 5AUYA 3U4UA 2YZLA 5KKRC 3WF8A 4RJ4A 4AZSA 2J0JA 4DTKA 3V8SA 3HYHA 4QMNA 3FY0A 4QMOA 5EQYA 3FKLA 3QQHA 1CKIA 2REIA 4O1OA 2GHMA 2X6DA 4FKWA 2C0OA 5M57A 3FAAA 1JKSA 3ZZWA 3QQUA 1ZMUA 4U40A 2PZRA 4FK3A 3MN3A 4LMNA 4V0GA 5D41A 2YDIA 3KGAA 4AA5A 1G5SA 5DE2A 5AM6A 4PX6A 2YJRA 2CPKE 3OCBA 3R9DA 3I60A 5AV1A 4YUQA 4MBJA 3NPCA 4EZ5A 3OG7A 2H96A 2Y6OA 2BRGA 3CQWA 3ALOA 4H05A 3ZLYA 2ZB0A 4EYMA 2O5KA 4M13A 2IW9A 3C4CA 2ITWA 4C4IA 5AAGA 3C5IA 5HCYA 3OEFX 2ETKA 4I0RA 3ACJA 4I4FA 4RIXB 4ZAUA 1WVWA 2OJFE 4BKYA 3HZTA 3TM0A 2UZOA 3OS3A 2EVAA 4NTSA 3ZSIA 5JKGA 3VO3A 5JN2A 3EQCA 4CVAA 1ZZLA 4C3PA 3O8TA 3N9XA 2VTMA 3V5JA 1V0BA 1WBOA 3I6UA 2QOCA 5K0KA 4ENXA 4FTTA 2C0IA 4HPTE 4O86A 4KIQA 4XOZA 4C02A 3Q6WA 4QMSA 4J99A 3H9FA 5B0XA 4IZYA 3AC8A 4F1OA 4BICA 3HX4A 4GVAA 1T45A 3ZFMA 3UODA 5EKOA 4LI5A 3UC4A 1O6LA 2BPMA 2CGWA 2FVDA 3VULA 3NYVA 4GV1A 5EM7A 3FZ1A 4DC2A 3TUBA 4FV4A 4LMUA 4FF8A 3DZQA 3A4PA 3W2OA 4BFMA 5DN3A 1TQMA 3ZBXA 2YCSA 4WNOA 2X7GA 4JNWA 4K11A 3O7LB 4I21A 1GNGA 1H1WA 1JKKA 3PG3A 4C57A 3HA8A 3IW4A 4IANA 3EZVA 5L2WA 3TTIA 3CBLA 3LXKA 4JBVA 3DZOA 4IB5A 5EI8A 3M11A 5BMSA 1XH6A 1BI7A 4RIXA 2B9HA 1P2AA 4ANMA 4E8AA 2R3IA 3MH0A 4ONAA 1YHWA 3UNZA 4A7CA 5JMSA 3FSFA 3AC5A 4MD8E 3DU8A 5IEYA 2J0MB 5H8BA 5FDXA 2YCFA 1X8BA 3HL7A 4AFEA 2ITPA 4G17A 2ESMA 2BFYA 4RQVA 5ANDA 1OL2A 3Q9WA 2YEXA 3BEGA 3CS9A 3QTIA 4YHTA 4ITIA 3HKOA 3R7YA 4TL0A 1OBDA 5CZIA 4K0YA 4PUZA 4XRJA 2G15A 5E8VA 3TNWA 3LPBA 3NUSA 5CS6A 2XBAA 4G3CA 5LVNA 4AFJA 2X2LA 2XNNA 3K54A 2OJJA 1PXJA 1BMKA 4CZTA 4Q9ZA 5CF4A 3MY1A 4OBPA 5DLSA 5I9YA 1YW2A 2DS1A 2UW3A 5AR8A 1UU8A 3BHHA 2A2AA 1H1QA 1I44A 2OICA 2XEYA 3C0GA 4FKOA 2OXYA 4ORKA 4TYHB 4GT4A 1CKJA 3V3VA 5BUIA 4DFZE 4CCUA 3GC9A 4NJDA 1OGUA 1JOWB 3F3UA 5K3YA 3UC3A 4FEVA 1FINA 3KXGA 4RWIA 4ANBA 5HEZA 1H26A 1DAYA 2OFUA 2PZPA 2YWVA 4OTWA 5BUJA 5ACBC 3UZPA 4BWPA 4S30A 4C4FA 3F5UA 3MIAA 1F3MC 3R1SA 3G5DA 3DV3A 5JRSA 4R3PA 4RX9A 1P14A 2PZYA 3NUYA 2UZUE 3WZJA 2IVUA 4Z55A 2VO0A 4HCTA 4I0SA 2XCHA 2YN8A 5C4KA 3QX4A 3NUPA 5IUHA 3QZIA 4XMOA 5LMKA 2YM6A 3W1FA 1PXLA 4G3DA 1UNHA 2IW6A 5GIOE 3MY5A 3MH1A 5FXRA 4ZS0A 4AW1A 3FI8A 3SX9A 2R3GA 2W1EA 4R6VA 5IQBA 4BCMA 3OVVA 3FZRA 4QD6A 2EWAA 4USDA 1OUYA 4AAAA 4EK5A 4FYNA 1WCCA 1WBPA 5JFXA 1XH8A 2GNFA 3QTXA 4NM5A 1H4LA 3FI3A 4BR3A 2PE0A 5D7VA 5F95A 4DFLA 4EOOA 3TCPA 3L9LA 4FV7A 4CMTA 3GCSA 3L9NA 3Q96A 4TYJA 3AQVA 5GIPE 2C4GA 4LM5A 3UYSA 3S0OA 3PUPA 3EWHA 1CMKE 4FNYA 4TYHA 3AGLA 5HE1A 3F2AA 3DKCA 4WBOA 4EK8A 4LL0A 2IPXA 2PUUA 1JVPP 4FMQA 4FNWA 4ANNA 3S95A 4IX5A 1PKGA 3MVLA 4G9RA 2FSOX 4FIIA 3WYXA 3ZDUA 4FTKA 4M0YA 2W7XA 4NCTA 4IJ9A 3TNPC 2OIDA 3VF8A 4BDBA 2VTPA 5AUXA 3QQKA 1ZXEA 1NT2A 3NRMA 5HO7A 5GJGA 3PZHA 4YJSA 1W7HA 3RZBA 4X2KA 1AD5A 4JI9A 5EH0A 4Z7GA 2CHLA 3N4VA 2FB8A 4EOSA 4EK6A 3QZGA 5AUTA 5M55A 4Y46A 2PVRA 3L8VA 5EOLA 4EEVA 4EOIA 5CZHA 1Q62A 2WQNA 3VN9A 4C8BA 4QMVA 2FYSA 5EI6A 3H0YA 5IQAA 4GG7A 3DBFA 4AOJA 5BVDA 5HORA 2Y4PA 2VWYA 2PK9A 2XEZA 1XBCA 4UY9A 4AZVA 4RIOA 3BE2A 2I1MA 3AMBA 2V62A 3NVMB 5IPJA 3FL4A 4FIFA 3QD3A 2VAGA 3FC2A 2PVHA 4OAVB 4EH2A 2R3JA 5ANIA 3LVPA 3VS0A 5AR5A 4ANOA 3PXFA 3Q9XA 1FGIA 5K4IA 2VGPA 4LOOA 4GFMA 4E26A 1H07A 3DLZA 2VRXA 5CQUA 4CFNA 2C6EA 5A54A 4ZSJA 3U6JA 4UEUA 4C61A 1Q8UA 2ZV9A 2C6IA 3AGMA 4IH8A 4U3YA 3R8UA 4ZY5A 4L3LA 3D15A 1BX6A 4UN0C 1L8TA 3ULZA 4WUNA 3DBEA 1G8AA 1KV1A 3CQUA 2R2PA 4JG8A 3QCQA 3QX2A 4AA4A 4BCOA 5EHYA 3FMJA 2IZTA 2VTTA 2XA4A 4W4VA 4BDDA 2ITUA 4J53A 1F5QA 3C50A 3WOWA 2W1IA 3HV5A 5KE0A 5J9YA 2PUIA 4ASEA 2XKCA 3PPKA 4CQEA 4GCJA 2P55A 4IBMA 4CFMA 2HZIA 5M51A 5TOZA 4S2ZA 2VU3A 5H8EA 3HAMA 3WYYA 2VD5A 4DE4A 4GT5A 1DI8A 3T3VA 2B53A 2O3PA 3EQBA 3RHXA 5D10A 3VC4A 3D2IA 4YZNA 5AUUA 3OC1A 4G3EA 4U81A 4JR7A 2HYYA 4WRGA 2Y4IB 4D2TA 5KMLA 5DHJA 3VAPA 4C38A 2W9ZB 3SHEA 4FTMA 4RGJA 2QOHA 5KHXA 3FWQA 1GIJA 3NDMA 2GTMA 4QP4A 4W4YA 5HICA 4ZTMA 4IWQA 4CV9A 3BYMA 4WRSA 3R71A 1CKPA 3BGQA 3QA8A 5IQDA 5BUEA 1Q97A 3ZEPA 5JEBA 2E9PA 1R0PA 1TVOA 3KCKA 2XJ0A 5IA2A 1OL6A 3F66A 3RPSA 2HY81 2RL5A 4EORA 5LQFA 2R3PA 2HXLA 5IA3A 3UJGA 5K9IA 4BGGA 3HP5A 3Q60A 2RGPA 2ZV7A 5HU9A 5IH6A 1QPEA 3Q6UA 2C47A 4RC3A 2YIXA 1SVGA 5J8IA 5I4NA 2XK4A 2JLDA 2B55A 3ZXTA 5AAEA 1R0EA 3HAVA 3O50A 4HVDA 4M68A 1SMHA 2NRUA 3HV4A 4QMWA 3F61A 2PTKA 1O6KA 5J87A 5BYLA 1OIRA 3JVSA 3FZSA 4GYGA 2EXCX 4UXLA 4D2WA 4F1MA 1CSNA 2W1CA 3VQHA 5FDPA 5F20A 4MYGA 3MBLA 4K1BA 1QPCA 4QTBA 5TE0A 3U4WA 3E87A 5I3RA 4YLKA 1ERKA 5HNIX 4JX7A 4UALA 2H9VA 1MRYA 1FVTA 2ACXA 5AIKA 1SM2A 2VTJA 3Q2JA 4EH6A 4PMSA 4TWOA 3E8NA 4B9DA 4BHNA 2OIQA 2QG5A 3QUDA 4DEDA 4F9CA 2R3FA 4FSYA 3B2WA 3SDJA 4RJ5A 3GC7A 4C36A 5HBJA 3I5ZA 1H25A 3KFAA 2OH0E 4O0RA 4Q9SA 4EKKA 4YC3A 5DPVA 3RGFA 3EHAA 3BYVA 4C59A 3RPYA 3IOPA 1NVSA 2PVYA 4LQMA 3TT0A 4HYHA 3PJ2A 4R5SA 5HTIA 4KAOA 5EDRA 1M14A 5FGKA 2I0VA 4KBCA 4HCVA 4LRMA 2JKOA 3BHTA 2Y7JA 2J2IB 3NNUA 4FZFB 4G3FA 4XHKB 4O84A 3MA6A 1SNUA 3OWKA 4ZMEA 2R3KA 4N0SA 4I5MA 3ZHPC 4V04A 3PG1A 3OCGA 2WPAA 3FDNA 5AUZA 4DF3A 3SLSA 5AP1A 5AR4A 3RK7A 3QZHA 4FSWA 2BZKB 1ZOGA 2CCHA 4C4GA 4QMQA 3QF9A 3QKKA 4FKVA 5IA4A 2WOTA 1ZYLA 2WTIA 2G2HA 5A6NA 5ANJA 3W8QA 4AW5A 2CNUA 3F2NA 3RNYA 1OKWA 3CR0A 3VHEA 5J95A 4D0XA 5DYJA 1VR2A 2XIXA 1YXUA 2JAVA 2IJMA 1KOBA 3FXWA 5D7AA 2UW6A 3A8XA 1QPDA 3MI9A 5I9UA 2AYPA 3U9CA 3QU0A 4CV8A 3NZ0A 1XR1A 2OZAB 1ATPE 1TQPA 4YLLA 3AG9A 2WOUA 4OTHA 4DH8A 4I20A 4EJ7A 2VNYA 2X9EA 5AP7A 4PY1A 1H0WA 4FT9A 3P0MA 2AC5A 2EXEA 4S31A 2EUFB 4KABA 4CNHA 2RIOA 3R8MA 5BVFA 2BAKA 3P78A 5HIBA 3RKBA 3GFEA 3UIMA 3DKFA 5JFVA 4HW7A 2F57A 2WGJA 3R30A 3D14A 4BTKA 3ZRLA 2GQSA 5IUGA 3EL7A 2WTVA 2DUVA 3AOXA 3H9RA 2Z02A 3TWJA 4JDJA 4EH4A 3D5WA 4C4EA 1LUFA 1JNKA 2C5YA 3R73A 4IVDA 3COKA 3QHWA 5DEYA 4F6UA 1ZYSA 2P2IA 4JR3A 3Q9YA 2H6DA 1A06A 2XRWA 3L9PA 5E1SA 5E7RA 4EONA 4ZJIA 3NSZA 2VWBA 2XIYA 2FO0A 3NW6A 3KXXA 2UW9A 3TL8A 1J91A 4YO4A 3GC0A 4HYIA 1YOJA 2R3OA 1OM1A 3WF7A 2XP2A 4ZZNA 1XH5A 3HUBA 2BIYA 3OMVA 4XBRA 4BCFA 4ACHA 3RAWA 3UQGA 5DR6A 4GYIA 3W2CA 1QL6A 2GU8A 1GIHA 4QPSA 4RT7A 3R04A 4J98A 4OT5A 5AP0A 4CZUA 4D9UA 5CU3A 4NSTA 1Q61A 4FTQA 2O65A 1E9HA 2JBOA 3FPQA 4G34A 2OZAA 1M17A 3CTHA 4MEDA 3FI4A 2YLEA 5AEPA 1S9IA 4GJ3A 4R3RA 3TDWA 1YDRE 3LM5A 2VWIA 4K77A 5AP4A 5L2QA 4DLIA 2X4ZA 3TV4A 2XNPA 3FQSA 4D2SA 4N6YA 3U54A 5IH4A 3F5XA 3CQEA 2R5TA 4XBUA 2VWVA 3BLRA 3DXPA 3D9VA 3Q04A 4EH7A 4O7SA 3F6XA 3UMXA 5KCVA 3GGFA 2OBJA 1SVHA 5HZNA 5LMAA 2X6EA 5FM2A 4F09A 2VTSA 3UNJA 3MH3A 2XNMA 4XLIA 5LVPA 4IAZA 1TQIA 3COIA 3KQ7A 4O0VA 1KE9A 2BILB 3SG9A 3DAKA 4GUEA 4NL0A 4JG6A 2OF4A 2X81A 2PVJA 1Z5MA 3WF6A 4E5BA 4AA0A 4WBBB 2NRYA 3RAIA 4TYGA 4U0IA 4U42A 1S9JA 1YWNA 2W1DA 4O2PA 3RINA 2BKKA 3DXQA 4IWPA 3TI1A 3MPMA 4IACA 2LAVA 4RJ3A 4LGHA 4A9TA 2QOFA 5AV3A 3KY2A 3LLTA 4H39A 3FYJX 4DINA 3KK8A 1H1SA 3W33A 5L6PA 3OBJA 4DGMA 4L01A 3SXSA 2XK8A 4CGAA 3QALE 5C27A 4FC0A 5IEXA 1YDTE 5LMKC 4C0TA 2FA2A 3BV3A 3HV7A 1UU7A 3RCJA 5CWZA 1L3RE 3TACA 2YM4A 3UVPA 4DITA 5I9WA 1Q3DA 2G2FA 3PA4A 4O21A 1NY3A 3IDCA 3QRJA 1W98A 2JDVA 4FKQA 4F7NA 3ENHA 5E1EA 1FPUA 4FX3A 2QOOA 2E9VA 2FUMA 3DJ6A 4MCVA 1UVRA 2XNBA 3E88A 3TV7A 1JWHA 2QURA 2X4FA 4O6EA 4O7YA 2YIRA 5LWNA 2HK5A 2OLCA 3FSKA 5CAOA 4IFGA 2WMBA 3V51A 3TEIA 3SC1A 5JGBA 3K5VA 1DAWA 1MQ4A 2HY0A 3MW1A 1ZLTA 3GQIA 1JSTA 3LQ5A 3KMWA 4Q2AA 2C5NA 1TKIA 5FEEA 5HQ0A 4JRVA 3KXZA 3PXKA 1IA8A 3DTWA 4GW8A 5HX8A 2VWWA 2XK7A 3MSSA 3OT8A 3R00A 4FUXA 1Y8GA 3AD6A 3KF4A 3NCGA 2VN9A 3QTRA 4NCTC 5I0BA 2G01A 1FBNA 4FUYA 4J95A 2QO9A 1GOLA 3HGKA 3CIKA 3NW7A 2QVSE 5JZNA 3R8LA 2VGOA 4BDFA 5EQPA 3IGGA 3FMMA 1XH4A 5L8LA 4M12A 4CFFA 2ITQA 4YSMA 2VX1A 3PWYA 4BDEA 3CPCA 4BBFA 2QNJA 1PXOA 2OI4X 3COHA 4B4LA 3WF9A 4OTFA 4BI0A 2W5BA 2HZNA 2XMYA 4MXAA 1PY5A 4GKIA 3ATSA 3LCKA 4BN1A 4KBAA 3LMGA 3RZFA 4O1PA 5AX9A 5CEIA 2B9FA 3IECA 4GT3A 5HIEA 3GCQA 4IE9A 3N51A 2YCQA 2IVSA 3MPTA 1NVQA 3R1NA 4JOAA 1OL1A 4S34A 3V8TA 5KBQA 3NNVA 3OZ6A 1GIIA 4I23A 4AGDA 2WHBA 2UZVA 3BU3A 4APCA 3C4FA 2YM5A 4ZJVA 4CKRA 4BDKA 3GCPA 1ZYCA 4USEA 3DB8A 4I1ZA 1BI8A 1WVXA 3FLYA 3A7HA 4GU6A 5AP3A 3UQFA 4OTRA 2GQRA 4XV3A 3GT8A 4EQUA 4FE2A 4Z16A 4BCKA 2YAAA 2WMQA 3NGAA 3BCEA 3F5GA 3U51A 1GY3A 1P4OA 5KMMA 3MFRA 4IWDA 3E62A 3RCDA 1HOWA 2UZWE 2R7IA 1QMZA 5EHOA 3LFEA 3NYXA 3QAME 5JRQA 4FVPA 4QMUA 4QRCA 2HXQA 2OJGA 4JAJA 3Q52A 4UYAA 4X3JA 3JVRA 5AP6A 3LCTA 3W16A 4EHVA 4XV1A 4L7FA 4U3ZA 5J9LA 4FR4A 4F9YA 5GHVA 4ACMA 3CPBA 2C6LA 2BTRA 4OTQA 3COMA 4IEBA 5GZ9A 2I0YA 4RX7A 5HG7A 4QO9A 5KMOA 4IAYA 5ETAA 3BGZA 3JPVA 1ZRZA 1PXKA 2UVYA 4YO6A 5AWMA 3ERKA 3L8XA 3P1AA 4ENYA 4B8LA 3TZ9A 4L43A 4YPDA 4FG9A 5DRDA 3R9NA 3I1AA 2ITVA 3RAHA 3DDQA 4P7EA 4FTNA 4BDJA 2XCKA 4KWPA 2P2HA 4CMOA 3QFVA 5CY3A 3LXPA 3ORTA 2Y0AA 2C6TA 5BX0A 4NYEA 4BYIA 4D4SA 2W4JA 3BIZA 4H3QA 4LOQA 4AE6A 3NUAA 5IH5A 2C69A 3K3JA 5CI7A 2WMTA 4JDIA 2BVAA 3HA6A 5D1JA 4AN2A 5KMJA 4LRJA 5KHWA 3HDNA 3EN6A 4R77A 5HVKA 1ZOEA 4HVGA 5A14A 4Z7HA 4QPAA 3PY0A 1XJDA 3NLBA 4FKGA 4G6OA 5DFPA 5IZFA 5A9UA 4X3FB 3V01A 4IAAA 4EUUA 2AC3A 4RX8A 1F0QA 3NR9A 1B6CB 4O7LA 2W5AA 4AOTA 4ZJJA 2VTHA 4PTCA 4WNMA 4H58A 1KSWA 5CXHA 4WO5A 3CKXA 1IAJA 2J51A 4BRXA 2A4LA 5ETFA 4MKCA 5DT3A 2Y4IC 3BWJA 5G6VA 3QKMA 3R0TA 3OD6X 2W06A 3QGYA 3IW5A 3Q4TA 5E92A 4RFZA 2QHNA 1PXPA 2B4SB 2YFXA 4HPUE 5AJQA 5GZAA 2F9GA 2PL0A 4KRDA 2PMIA 3O23A 3PIZA 2UW0A 3W55A 4AP7A 4ASDA 1Q8ZA 1CM8A 3IW8A 3QGWA 3IK3A 3ZCLA 2JC6A 3UO4A 4D55A 4F1TA 3W8LA 5JGDA 3VBYA 4HVIA 1JLUE 3BI6A 3OXIA 1YI3A 4ZXTA 3VBXA 5FG8A 3RMFA 2YAKA 3P7AA 3EN7A 2RG5A 4XEYA 5CXZA 3KULB 3KB7A 3OOGA 3U9NA 1P5EA 3VUDA 3PLSA 5ANGA 4OAUC 3E8CA 3IW6A 3VRYA 4M3QA 2QCSA 3OXTA 2F7ZE 4JDKA 4YJUA 4IZ5A 3GU5A 5CT7A 5FTQA 2YITA 4BCQA 5CAVA 4XRLA 2V7OA 2UZNA 4JQ8A 5L6OA 2XJ1A 5DEWA 3DBDA 3HV3A 4I93A 4BZOA 2C5VA 4P4CA 5DMZA 2E2BA 2FSLX 2WFYA 1B39A 2JIVA 4HVSA 3SRVB 3MA3A 4RZWA 4TZRA 3PJ8A 4ZZOA 4ZLZA 4O7ZA 4IX6A 2RSVA 4ZTLA 3OXZA 5D11A 1KOAA 3DB6A 5GNKA 3E3BX 3W18A 2O63A 4LUDA 4PDYA 3LHJA 4DTAA 4U97A 3UMWA 4L45A 3MV5A 1OIQA 4AG8A 2RFDA 3S4QA 5J5TA 4FOCA 5J7HA 4FV2A 3QRTA 4CTCA 4WG3A 4AZTA 4WSQA 2UZDA 2Y9QA 3W10A 2VX3A 1OMWA 4X2FA 3S2PA 4FKRA 4R1YA 1H1PA 2FSMX 3CTQA 3FZOA 4QP9A 2OO8X 3F7ZA 4W9WA 2P0CA 4RA4A 4BTMA 4EH9A 5CAQA 3POZA 1Q8TA 5FM3A 5HVYA 3NX8A 1PYXA 4FTOA 1KE6A 3ORZA 4UYNA 3PDTA 3A7JA 5ANOA 2J4ZA 2QHMA 4JRNA 3KA0A 4RZVA 4L9IA 2PUPA 3NNWA 5BNJA 1XKKA 1URCA 3C5UA 4QQCA 5BVOA 3KULA 4H3PA 5HE2A 4L3PA 2IWIA 2X2KA 5DOSA 2Q83A 2BHEA 2JDTA 4ACGA 3FUPA 1MP8A 4NKAA 3UBDA 4AE9A 5B2LA 3F5PA 4QYFA 5GJFA 1NVRA 3WILA 4IZAA 4F99A 5EYMA 2QLUA 3AD4A 3MTFA 2QO2A 5CU4A 1J7UA 5M06A 3QBNA 3L8SA 3PRIA 3Q4ZA 1U4DA 4ZMFA 4O0XA 3OF0A 4Y85A 4YU2A 3PVBA 1R3CA 2BHHA 3NIEA 3FZPA 2QU6A 1CDKA 3RK9A 3ROCA 3TKHA 2ZYBA 3LMHA 3RPVA 4HOKA 3DCVA 5KUPA 2BZIB 2VX0A 4I94A 1OECA 5DR9A 5CU2A 3CLYA 2YHVA 5F94A 5LVMA 3R28A 4LOPA 4P5ZA 4DH1A 4FZ6A 5EM6A 5AA9A 5IMEA 2J50A 4RLLA 5CI6A 5CAPA 1PHKA 4QP8A 5A4LA 2XYUA 4K2RA 3O17A 3IS5A 4FG8A 4AZEA 3BLHA 3QUPA 4PP9A 3T3UA 4YJOA 5TF9A 3MFSA 5AV4A 4ALUA 3SW4A 4O0UA 2JDRA 3LCSA 3BEAA 4MBLA 3BX5A 4O7VA 4P5QA 5CEOA 2YABA 4U9AA 2J5EA 4GUBA 2HW6A 3VBVA 4CD0A 3FHIA 1OI9A 2JAMA 1IG1A 2VO6A 4NT4A 4UXQA 2E9UA 5AR3A 2X39A 2JKQA 2PHKA 4LYNA 2CKOA 5HG8A 1YI4A 4XS2A 5EW3A 3ORXA 4IHPA 2IW8A 2I0EA 1YVJA 4NFMA 3ZC6A 4E4NA 4TPTA 1GJOA 4QMLA 5FBOA 3QD4A 4FTRA 4E1ZA 2OZOA 4MQ1A 1H00A 4MD9E 5K5NA 1KV2A 4IW0A 5KZIA 4U79A 4CRSA 3F3ZA 4F7SA 4UX9A 2ITZA 3R7GA 3DBCA 3R8ZA 3C9WA 2EB2A 3UOHA 4YZMA 4J52A 2P3GX 5EG3A 1SZMA 4MNEB 4BDGA 3O7LD 3QKLA 3LOKA 4PP7A 2DYLA 2WU6A 4Z3VA 3H9OA 3E64A 3BYUA 2QR7A 1YWRA 2CGUA 4QNYA 2J7TA 4C35A 3FMEA 4R5YA 3UGCA 3VS4A 2HOGA 2NP8A 3IGOA 5G1XA 3ZEWA 1DM2A 3RBWA 4A4LA 5CU0A 1UWHA 3ZO3A 2OGVA 3RM6A 3TZ8A 1OPLA 3MIYA 4ZP5A 5FLFA 2F7EE 4I6QA 4KSPA 4BWKA 4QPMA 4ZLYA 3BYSA 5HVJA 4DEEA 3W32A 2I7QA 4PV0A 3ZTXA 4FGBA 3BBTB 5AUWA 4L46A 4FIGA 3R1QA 2B0QA 4XP3A 4FIHA 5CENA 3F69A 4JDHA 4F9AA 3FMKA 3OWPA 4D1SA 4XOYA 3QTUA 2JIIA 2IZSA 5LCKA 3IQ7A 3NAYA 3AC4A 4MWHA 3MJ1A 5E4HA 1DI9A 2XK9A 3I81A 1IA9A 3NYNA 2ZV8A 2X9FA 3SXRA 2F2UA 4UV0A 4DEAA 1OIYA 2XZSA 3ALNA 4IC8A 5FQDC 1T46A 4CLJA 2YIQA 2CCIA 2UW8A 1JQHA 2P4IA 3C1XA 3NWWA 3IG7A 4AOIA 3QCXA 4DYMA 2QONA 4AU8A 3SGCA 3JY0A 4DEBA 4Y72A 1OZ1A 3BQCA 3R9OA 4BIBA 4MNEA 1QCFA 2J0LA 4BF2A 4EQMA 2UZTA 2DQ7X 4AF3A 3HMPA 2GFSA 4EOJA 3OP5A 2Z7QA 3LIJA 4ZSEA 3TKUA 5BVWA 4XG3A 1OPKA 3R6XA 3LAUA 4KA3A 4NW6A 3LCDA 5C03A 3V6RA 3C7QA 3FMLA 3DLSA 2WIPA 1RDQE 3P5KA 2PULA 3GQLA 3JYAA 4G6LA 4LRKA 4ZTHA 4H1JA 4EZ3A 4JBOA 5GINE 3FMDA 5JFSA 4EOPA 2CN8A 1DS5A 3R83A 2VV9A 2YIWA 2W0JA 3C0IA 4UZHA 4GL9A 3LFQA 4F6WA 2RKUA 2JEDA 3VNTA 2BFXA 3LE6A 4FIJA 5AP2A 2R3NA 4YSJA 5DGZA 3R9RA 2VTLA 4O7RA 1YRPA 4QTCA 2VWZA 4F0IA 3LXLA 4CQGA 1JSVA 3W2PA 4AQCA 2YLFA 4NZWB 3H10A 2VTRA 4FZAB 4M0ZA 4W4WA 3WE8A 4G6NA 4FTLA 4DAWA 3UYTA 5LJJA 4D4RA 3SA0A 4FTUA 5HIDA 2C30A 5HE0A 4FV9A 3ZRKA 3EQRA 4GEOA 5FXSA 2C0TA 1BYGA 3GCVA 3GI3A 3JR1A 4S32A 3Q5IA 5HCZA 3HLLA 2OXXA 2XS0A 4AZFA 3UPXA 4F65A 3NVKI 1NXKA 1U5RA 4FZ7A 3A61A 3H4JA 5HD4A 4IMYA 1Q24A 2YZAA 3D0EA 3HV6A 3P86A 3QRIA 3VRZA 1H01A 3WIGA 4F70A 5A6OA 5E8SA 5IF1A 3FEGA 5M56A 1ZYJA 1E1VA 2QR8A 3OW4A 4KRCA 2XNEA 3FBVA 1BLXA 5FP5A 3L9MA 4UBAA 1U54B 4O81A 4IVBA 5M4IA 3CCNA 2CJMA 4XH6A 4QP2A 3KF7A 3TDVA 2WMXA 4LV5A 2QODA 5C8MA 3JY9A 4ZY6A 5LMBA 5IA5A 5T6KA 3UTOA 5D12A 4YTFA 3KKVA 4O0TA 1PMVA 4A4OA 1XQZA 2UZLA 3MS9A 4RJ6A 4X2JA 4RQKA 5BVEA 4DGLC 2BDJA 4FSTA 3CD3A 2HIWA 2ZDUA 3V5WA 4BI1A 4LL5A 3ID6C 5CF5A 2GS6A 2WIHA 3OEZA 1ZY4A 3ZLWA 3H30A 1MRVA 2YCRA 5CSHA 3QYWA 3AC1A 2GHGA 4FSNA 2OKRA 1WBTA 3QUEA 2JKMA 5L4QA 4FL1A 2ONLA 4WNPA 3ZXZA 4F7JA 3LJ1A 3TZMA 3ZUUA 4EWQA 4GIIA 4UB7A 3QTSA 5DWRA 4BI2A 4NIFB 2GNLA 2YIYA 3QRKA 5A4EA 2CNQA 4UWCA 4BC6A 5J9ZA 2UZEA 2A19B 2HELA 3EIDA 3LJ2A 2ITTA 4J7BA 4OR5A 4YGAA 3SQQA 4HGEA 3GXLA 4I3ZA 4X2NA 2BTSA 3VHKA 3OOMA 4AT5A 4FVQA 3UPZA 4EWHA 4UMTA 1H28A 3NUNA 4CEGA 4MAOA 5CVHA 3VUKA 4AW2A 3U6HA 4L6QA 3FZTA 4I92A 3ZH8A 1U54A 3SXFA 2OWBA 4KBKA 4HJOA 4C4HA 4X2GA 3PIYA 3NMUF 3VUHA 1HCLA 4JG7A 4Q5HA 5IDNA 4A9UA 2UW5A 1A9UA 3GU8A 2R3RA 1BUHA 1XH9A 5E8TA 3ULIA 4IB0A 3VS6A 3ZUTA 2HCKA 3OCSA 3F2RA 3B8RA 2OXDA 3PJ3A 4CZYB 2I0HA 2UVZA 4M7IA 3GU4A 3VBWA 1Y57A 3PA3A 1J1CA 3NS9A 4UWBA 5DVRA 3KCFA 2BR1A 3REPA 4BCGA 5J5SA 4AGCA 3ORIA 5TKDA 2W4OA 4YJNA 5AV0A 1KE8A 4QMTA 4ASXA 1Y91A 1ND4A 1GZ8A 1K2PA 2C3KA 2GS7A 2J6MA 3E8EA 4XP0A 4IXPA 4B0GA 4IDTA 4YJTA 1K9AA 3CC6A 4BHZA 3QCYA 4IC7A 4F4PA 4TWCA 3G0FA 3W2QA 3WZKA 2WEVA 4E20A 4FV6A 1PKDA 3QWJA 4NIFA 4U80A 4RJ8A 4QP1A 5AX3A 4XG8A 3A8WA 3C4ZA 3VUTA 4R78A 2RFEA 4HYUA 3GB2A 4OW8A 4QP6A 4APPA 3EKNA 3UO5A 4YTHA 3MVHA 2ERZE 4FTCA 4PWNA 1OB3A 3QQLA 3V04A 4DBNA 3KN6A 5C9CA 3PWDA 3NCZA 4C3FA 2JIUA 3ZRMA 5KBRA 2SRCA 2W1ZA 4Y95A 2BRNA 3BELA 4M69B 5EHLA 4DLJA 4BDCA 2OW3A 2R3QA 5KO1A 2PUNA 3TZ7A 4G3GA 1H8FA 2LGCA 5IA1A 4UMUA 3OT3A 4WHZA 2C6DA 4QMMA 4X21A 4GG5A 2PVNA 3P7CA 4J8MA 2B9IA 2PVKA 2WMAA 3H0ZA 5HLPA 2VTOA 1XHAA 4FEQA 3AXWA 2XM9A 5BMMA 4RVMA 3R7IA 5FEDA 5CEPA 1Y6BA 2C1AA 3FXZA 1Q4LA 2J0KA 4IVAA 5EYDA 4DFBA 4PNKA 3U8WA 4ANQA 4LUEA 2BUJA 5HKMA 5JZJA 3D5XA 4BY9E 4AWIA 3VS5A 1WVYA 3C4EA 4HNFA 2Z7LA 2VWXA 4EHZA 1ZMVA 2CNVA 5HU3A 1M2QA 1YHVA 3P79A 3HRFA 4PTGA 3Q53A 4PMTA 4RPVA 5AFVA 1NW1A 3O71A 4LFIA 3RAKA 4ANLA 4Q5EA 4DT9A 1M7QA 1KWPA 2XH5A 3Q5ZA 4B99A 3QWKA 5FD2A 4K6ZA 3QC4A 3QL8A 5CSPA 3E93A 3ZC5A 5L6WL 3EFJA 4EYJA 3EL8A 5AR2A 2VTAA 3AC2A 4JBQA 3RPOA 3ZOSA 5CEMA 2J5FA 5KMNA 1AGWA 4XG4A 4M14A 3QLFA 2YDKA 3IKAA 2B7AA 3HMMA 4FV5A 4YJVA 4M69A 5EDPA 1ZMWA 3BU5A 4ZLOA 3BRBA 5M44A 3ORKA 2IVTA 2QOIA 4QP3A 4HGSA 4IM3A 1ZYDA 4OT6A 4EQCA 4O6LA 4FTAA 4YR8A 5LVOA 3LQ3A 4O83A 1FVVA 1PYEA 1VZOA 2ZOQA 3F3VA 3R2YA 2J90A 1XBAA 4MWIA 4PDOA 2G9XA 4UMQA 3TIYA 4AUAA 3AMYA 2JDSA 1LEZA 3BV2A 3KRLA 2ITXA 4D2RA 1IRKA 3EMGA 3D7ZA 3EQDA 4MVFA 3G0EA 3R7VA 4D4VA 4FOBA 1J7LA 3NUUA 4HNIA 5LCJA 5GJDA 5J1VA 4EJNA 5ACKA 1J3HA 4QP7A 2VTNA 3O51A 2UW4A 3ROYA 2OIBA 4IM0A 2QQ7A 1R78A 4YJRA 3DBQA 4II5A 2G1TA 4TN6A 4UMPA 4MK0A 2XB7A 1W0XC 5DNRA 4AS0A 3E8DA 2XBJA 4C34A 5LVLA 4FKSA 4FV0A 5AUVA 4PPBA 4V01A 2QOKA 4TWNA 4JBPA 4IB3A 4L44A 4XG2A 4CFWA 3UVQA 4C2WA 3V5LA 2ETMA 4FBXA 1YXXA 3ENMA 3SVVA 3R7EA 4GMYA 3TJDA 2OJ9A 3VS3A 3A7GA 2IZUA 3M2WA 4GIHA 4MX9A 1SYKA 1MQBA 2B54A 2F4JA 3PSBA 4DHFA 2XJ2A 3AT2A 1U46A 5CLPA 5HGIA 4BCPA 5LXMA 3E92A 4C4JA 4EOQA 2OH4A 2PMOX 4OTDA 4RIWB 4DGOA 4EHEA 2H8HA 3C4WA 2W1GA 1YOLA 4QTAA 4K18A 2WMSA 4JJRA 5JK3A 3UDBA 3PVUA 3RTPA 4IFCA 4PRJA 3G6HA 5HD7A 1XWSA 3FLWA 2XF0A 3E3PA 3Q4CA 3TNQB 5C4LA 1UNGA 4E6AA 2BALA 5IMXA 3ZSGA 4L53A 3ORLA 2XIZA 2CLXA 1WZYA 3CGOA 3KVXA 2OSCA 3ET7A 3MFTA 5HO6A 4FKJA 2GCDA 5T3QA 4NM3A 3ZS5A 5KMIA 3RM7A 3BE9A 3UZRA 3S00A 3SD0A 4E6CA 5IU2A 3UIUA 2WELA 4NFNA 4L00A 3IDBA 4DH5A 1FOTA 3DXNA 3KXMA 3A62A 2RG6A 1WBNA 5EFQA 3THBA 1UKHA 5EI2A 3EJ1A 3T9TA 3KXHA 4ZSLA 1UV5A 3KL8A 1ZARA 3D4QA 5CX9A 1PMUA 3UP7A 4FK6A 2BDFA 3PSDA 4ASZA 3SAYA 1XH7A 3PYYA 3MPAA 2YERA 2OG8A 3UOKA 1GZNA 4EZ7A 2R0IA 4RIWA 4MXZA 4QMZA 3Q3BA 1GZOA 1LEWA 4B8MA 4ITHA 3QLGA 3VS7A 3GOKA 4PDPA 5A3XA 4CFVA 1MRUA 2WKMA 3A4OX 2OJIA 3PVWA 4FEWA 3EYGA 2WNTA 1KE5A 4DBXA 4FI1A 3CKWA 3JXWA 3QRUA 4I24A 4L7SA 2BRHA 3M1SA 2XM8A 3T8OA 2QOQA 5EDQA 3AD5A 3DKGA 3FQHA 3VIDA 4FV1A 3ORPA 4FICA 2E9OA 4G1WA 2XRUA 3D5VA 4J1RA 3FLSA 4U7ZA 3D7TB 3SG8A 2KTYA 2PVMA 2EU9A 4K9YA 4MXYA 1REKA 5KZ0A 3GP0A 4ZIMA 2BZHB 4O2ZA 5EK7A 4JQ7A 4ERKA 5I9XA 3LW0A 3BPRA 4D5KA 2ITNA 4QQ5A 4NWMA 4BGQA 2ZM4A 4C62A 2WXVA 5FBNC 2B9JA 4NM0A 4RIYB 3H3CA 3KK9A 3ORNA 4IAFA 5K0XA 3TNHA 4RRVA 3MJ2A 4KIKB 4NJ3A 3LFAA 2EB3A 5CANA 3N4UA 3KEXA 2WU7A 3ETAA 1ZOHA 4G9CA 1PMEA 2GTNA 4M8TA 2A0CX 3RJCA 2R3MA 2WMUA 4FVRA 4U6RA 3ODZX 3Q4UA 4M66A 5E8XA 3V5TA 4ACCA 4CSVA 3DNDA 3I7CA 1JKLA 4U5JA 3P4KA 4Y73A 1YKRA 4YBJA 4NH1A 5CQWA 5DG5A 2JKKA 2YA9A 5DBXA 4MD7E 4O0YA 4C58A 4QYEA 1OITA 4K33A 5IQHA 4I6HA 4J71A 4FTIA 4FT3A 4EH8A 5AM7A 4KINA 3GU7A 2IZRA 5AP5A 3RI1A 2XNGA 3WARA 4XNEA 5HLWA 5I5ZA 5IUIA 4E6DA 4XYFA 3DTCA 3D5UA 4FKIA 2X2MA 1PJKA 4TNDA 4I5PA 2OU7A 1WBVA 2X7OA 3LJ0A 5TO8A 3D7TA 3PY3A 2W1HA 4UMRA 2V5QA 3TUDA 4ZTNA 4RWKA 3LKMA 3LZBA 4YMJA 2YM8A 4L3JA 5HG9A 3UZTA 1GAGA 2PSQA 2UZBA 4ZEGA 3PFQA 3QD0A 4HZSA 4BIDA 1Z57A 4N70A 3TXOA 4RA5A 1SVEA 2Z7RA 2CN5A 4ZK5A 4DEHA 2GHLA 3VF9A 2ITOA 4F64A 3EN9A 1M7NA 4KS7A 4CXAA 3LFFA 5FUTA 4RIYA 2CKQA 4O7NA 2X8IA 2WEIA 2UVXA 3UOJA 4KIKA 4DH3A 4FGRA 4Y5QA 2NPQA 1K3AA 2XVDA 3EN5A 2X8EA 2ONLC 3P9JA 4QYYA 3IO7A 4R3CA 4WT6A 4A9YA 5FXQA 4X3FA 2IG7A 3HRBA 5ETCA 4YZCA 3CTJA 1WBSA 1IR3A 5CTPA 5FTGA 1PF8A 3R01A 3SKCA 4P90A 3POOA 4A07A 4AW0A 4JIKA 5CALA 1XO2B 4FG7A 4G2FA 4OBOA 1YXTA 2W9FB 2ZAZA 3MFUA 5ETIA 1UWJA 2PE1A 5HBEA 2Y6MA 4PF4A 1V1KA 3RVGA 2UUEA 5HTBA 3QQGA 3DS6A 4IM2A 5I9ZA 2V55A 2X7FA 3LMIA 4FSRA 4X7QA 1NA7A 2PZIA 2YJSA 3KRJA 4M15A 2QO7A 4GH2A 4CMUA 3K3IA 5HNGA 2O8YA 2CGXA 4Y83A 4EBWA 3V5PA 2Y8OA 4XLVA 4GFOA 1RE8A 2GNIA 4ERWA 4BBEA 3G90X 5T68A 4FIEA 4DFYA 2PVFA 3WBLA 5FEQA 2IN6A 3F88A 3CD8A 1JBPE 4FNXA 3TKIA 4Y5HA 3A7FA 3WZDA 4WIHA 5M4FA 2F2CB 3MVJA 4XCUA 4AACA 5DR2A 3OWLA 4GFGA 1EH4A 3OBGA 4KS8A 4AN3A 2BMCA 5LWMA 1M52A 1ZWSA 4GU9A 3VS2A 3PXZA 3BHVA 3PE2A 5FRIA 4PL4A 3TG1A 2J9MA 2QOLA 3RALA 4KNBA 4X6QC 5EQEA 4AXAA 5L2SA 4HCUA 1VEBA 1J1BA 2GNJA 3FQEA 4WD5A 4WG4A 4YP8A 3EN4A 3AT4A 4IQ6A 4E6QA 5ICPA 3WE4A 4AGWA 3EFKA 3VWAA 3CGFA 3SRVA 3R2BA 5B2MA 2HZ0A 2FSTX 2GPHA 1JKTA 4QMPA 2WQBA 3R1YA 1Q8YA 3SOCA 1H08A 4CG9A 3UO6A 1VJYA 4W8EA 5I9VA 5E8YA 4QOXA 3E7OA 2C3LA 4J97A 4NTTA 4EC9A 4OTPA 1PRYA 4YTIA 4LGDA 3CJGA 3LM0A 4J96A 4D2PA 3HUCA 4O96A 5BPYA 3OTVA 4O7WA 3ZM9A 3FLNC 5DIAA 4IAIA 1OVEA 3FL5A 2WMVA 3KRXA 4ALVA 2CKPA 1Q3WA 4BZNA 4D4YA 4KUJA 3ZONA 2C5XA 1R1WA 4CCBA 4TT7A 1E1XA 4OTGA 2YISA 3QXPA 4IX4A 3GUBA 3E5AA 4ZZMA 5FP6A 3BU6A 1CTPE 3KC3A 5ITAA 4C3RA 1A48A 4CKJA 4YZBA 4U41A 2XUUA 2KULA 5B2KA 3UP2A 5CF6A 2PU8A 1FVRA 4W9XA 4USFA 3BYOA 3I4BA 4YNEA 1YXSA 2PMLX 5A4QA 3UG2A 3ZLSA 3FMHA 4YNOA 2C5OA 4O7TA 4DH7A 2F49A 4I41A 5CSXA 4ACDA 4EK3A 4O38A 4R7HA 3RNIA 4RVKA 4MNFA 3ZLXA 4A06A 4CG8A 2WAJA 4PQNA 3HP2A 4CYJA 1B38A 4Y8DA 3ZMMA 1W82A 3PVGA 1OL7A 2GNHA 1REJA 4G5PA 4D58A 4RFYA 5IDPA 3EQPA 3QD2B 4RJ7A 3U87A 4E73A 3DFCB 3L1SA 5CEQA 4NKSA 3S1HA 3HMNA 3HVCA 2AUHA 3GFWA 3EFLA 2JD5A 3KRRA 2WQMA 4CFXA 4CFUA 4EL9A 3DFAA 3PXQA 3OTUA 4K8AA 5AV2A 3UIXA 2ZMDA 5EM8A 3B8QA 4OTIA 3VUMA 3DJ5A 5L2IA 4ZTSA 1O9UA 3ZM4A 4QTDA 4QQJA 4MTAA 4BDAA 1OBGA 2RFNA 3ZFXA 3R9HA 3F82A 4QMXA 3R7OA 4BGHA 4QYGA 4GS6A 5C26A 5HTCA 4CT2A 5F4NA 5HOAA 4MH7A 4O0SA 3ITZA 4ID7A 4JXFA 4L8MA 1Q41A 2CMWA 2WO6A 4FNZA 2R64A 3VS1A 4ARKA 5JQ5A 1APME 3GBZA 4BTFA 3C13A 3G2FA 3OWJA 4IWOA 3TNIA 2UW7A 2Z8CA 4D1ZA 4E4XA 2BCJA 3EQGA 1PXMA 4EH3A 3O8PA 3DPKA 3IPHA 2R0UA 1JAMA 4EOMA 3BLQA 4W4XA 1Q8WA 4BWXA 4UZDA 4BDIA 2IVVA 4TYEA 2R7BA 1PXIA 2WQEA 4YBKA 1SNXA 4MHAA 4FSQA 4GVJA 3GU6A 2UV2A 4BCNA 3PXRA 2C6MA 2WTKB 1YXVA 4JLCA 4BIEA 5KMKA 3I7BA 3RPRA 3ZYAA 3UNKA 1V0OA 2W05A 5CAUA 3A7IA 3MTLA 3VBTA 2JFMA 4PDSA 4DGNA 4WNKA 4KSQA 4DT8A 4HYSA 2P33A 4RVLA 3R22A 2BIKB 5C8KA 4DEIA 3UOLA 5IEVA 4AN9A 2R3HA 4DCEA 4BTJA 5A4TA 4DFUA 2W4KA 3IDPA 4C2VA 5K5XA 3DNEA 3EOCA 5L3AA 3HEGA 4YZ9A 5KKRB 3BBWA 2C68A 3DJ7A 1YWVA 5C01A 3FLQA 5H8GA 1VYZA 3HMIA 2ZB1A 1JSUA 3QA0A 2OFVA 2WTDA 3I0QA 4XP2A 3G15A 5CNNA 1IEPA 2F7XE 2HW7A 3CJFA 3LXNA 3NYOA 3QQJA 4H1MA 1G8SA 5M08A 2XYNA 4TKSA 2OF2A 4WUAA 2ZVAA 3IOKA 4BVUA 3U55A 3FKNA 4R8QA 4L52A 4FEUA 5IQGA 1LPUA 1H27A 4H36A 4RC4A 3LQ8A 3OROA 3VJNA 2Z2WA 5EM5A 4RLKA 4TW9A 4A4XA 4FEXA 4TYIA 4Z9LA 2BRBA 3KREA 2QU5A 3LFBA 3MWUA 5C8NA 4FKTA 2GNGA 2ZMCA 3LFCA 3DGKA 4QT1A 4L67A 5TT7A 4GK4A 2XKEA 4TXCA 4ZSAA 2NO3A 5HO8A 2QLQA 3RWQA 5J1WA 2R4BA 5E90A 3ZO2A 2W99B 3VJOA 3AC3A 2PVLA 4W8DA 2PYWA 4YHJA 3AT3A 3O96A 1URWA 3RP9A 3OFMA 3KXNA 4YURA 4RWLA 3CY3A 1PW2A 4XUFA 4E4LA 3OUNB 2VO7A 3VVHA 2QI8A 2W17A 4KB8A 4EBVA 3FI2A 3WF5A 4BKZA 2QOBA 3M42A 3HECA 3G6GA 1WFCA 5ANKA 5CF8A 4C37A 1WMKA 3RWPA 3PA5A 1P4FA 2E9NA 4F08A 4N57A 3NNXA 2JBPA 4I0TA 1WAKA 3ZO4A 3PIXA 2YACA 3TTJA 5EKNA 4R7BA 3PY1A 1PXNA 4O82A 2W5HA 4YLJA 3V6SA 4FYOA 5E8UA 5BVNA 5HX6A 2YDJA 3CE3A 5EYCA 2A27A 1IASA 4FT7A 3E63A 2X1NA 3ZDIA 2VNWA 5CSWA 3CY2A 1H24A 3DAJA 4C33A 3QHRA 4BKJA 4CLIA 5JFWA 4PL5A 1V0PA 4A9SA 1W83A 3FV8A 4D9TA 1AQ1A 4PMPA 4RVTA 3MVMA 4R7IA 4JQEA 2QKWB 3MGYA 3QYZA 2WMRA 4ZY4A 3R63A 2XKDA 4M97A 4XG9A 4RX5A 2ZV2A 2V7AA 4FL3A 4FL2A 2O2UA 5AAFA 2BKZA 2G2IA 3C4XA 2PZ5A 1M2RA 1QPJA 2CDZA 5E91A 3D83A 3NIZA 4NU1A 5HNBA 5H3QA 2W1FA 5TR6A 3CEKA 3CXWA 2BRMA 3GVUA 4QNAA 3PXYA 4YPSA 4AT3A 4DFXE 4F63A 5J7BA 3WZUA 2Q0NA 2HENA 4FKUA 3F3WA 4XV2A 3VQUA 3G9LX 4FODA 3VUGA 3OUKA 5L8JA 1H1RA 2GS2A 3GCUA 5FTOA 3TV6A 5CASA 4GSBA 4WKQA 2IO6A 4RWJA 2B52A 3ACKA 4D5HA 4EI4A 4E3CA 3ODYX 3LCOA 4IIRA 4HZRA 3FC1X 2C3JA 3N4TA 4I6FA 3ZZEA 4F0FA 5F1ZA 1FQ1B 4WOVA 1XBBA 4U44A 4FV8A 5AADA 4IADA 5IKWA 4JVGA 2H34A 3BQRA 4GRBA 2FH9A 5CEKA 4MBIA 2JDOA 1RQQA 2I6LA 4HVHA 3CP9A 4IVCA 3TN8A 4ITJA 2VTIA 2YWPA 3EQHA 4I5CA 4S33A 1H0VA 3A2CA 3ZFYA 3DT1A 3G9NA 3ZSHA 3MH2A 4DG0E 3Q9ZA 3DKOA 1O6YA 1KUTA 4GJ2A 2BZJA 5HHWA 4FSUA 4G5JA 3ZO1A 1ZZ2A 4WA9A 5EOBA 1U5QA 3S3IA 1UNLA 4ZOGA 5F9EA 3GEQA 4OUCA 1WBWA 3DK7A 3PJCA 1GZKA 2O0UA 4X3FC 3FYKX 5ANEA 4JIAA 5A46A 5E8WA 2VTQA 3HDMA 5L8KA 4KIOA 4D0WA 3TUCA 3EYHA 5M09A 4M84A 3OW3A 3G51A 1UU3A 4L42A 4QTEA 3EB0A 5IISA 5M4UA 2CSNA 4IB1A 1IAHA 3HNGA 3OY1A 5M53A 5IQCA 3SOAA 4PMMA 3VUIA 4EH5A 3IONA 2OK1A 4EOKA 3EZRA 2YM7A 2W96B 3Q2MA 5JSMA 4E5WA 3I79A 3KMUA 2JFLA 2WTCA 2HAKA 3KRWA 4BCJA 4BB4A 3QQFA 4LV8A 3TIZA 5GZ8A 5K4JA 4TNBA 2PMNX 4YC6A 2XIKA 4PPAA 3DK6A 4X0MA 3R8PA 1KE7A 5CU6A 2WD1A 4C7TA 5JH6A 4O91A 1W8CA 5HLNA 3DY7A 4YJQA 4TWPA 3NW5A 4TTHB 4CRLA 4H3BA 4IAKA 4O22A 2WQOA 4EOLA 1YDSE 4I6BA 5BVKA 5IG1A 3FHRA 2CKEA 5HESA 5DH3A 5H9BA 4X6RA 3IW7A 2WB8A 2V22A 4JX3A 3MY0A 2CGVA 2XIRA 3QCSA 5KNJA 1FMKA 4F0GA 5HE3A 4FT5A 1HCKA 4BZDA 3QTQA 1UA2A 4MF1A 3FE3A 2ETRA 3A60A 3C51A 3QC9A 4RSSA 3ZBFA 5BQ0A 4RFMA 3F9NA 2QKRA 4ANSA 4BCIA 4DFNA 4DGGA 3UE4A 3DK3A 4KKEA 3V8WA 3NAXA 2ZDTA 1OPJA 3GOPA 1BL7A 3VW6A 3BGPA 3R8VA 3R21A 3VW8A 1FMOE 4DG2E 4BYJA 3DQWA 3LLAA 4ZSGA 3I6WA 4O0WA 4QMYA 3ORMA 3FPMA 2ITYA 2PWLA 4U45A 1U59A 3K2LA 4MF0A 1LR4A 4OGRA 3FLZA 1OKVA 3FKOA 4HGLA 5IQFA 3OCTA 4RMZA 5DI1A 2GDOA 2QD9A 2C3IB 1VYWA 2VWUA 3KMMA 2XNOA 4KKHA 5DRBA 1J7IA 2BAJA 3P23A 4U8ZA 4HGTA 4WSYA 4DG3E 1Q99A 1Y6AA 3PP0A 4BBMA 4NW5A 3KU2A 4PL3A 2GMXA 5CSVA 2VO3A 3PZEA 4IX3A 4MXCA 3QXOA 3ZUVA 3UVRA 1YQJA 4AGUA 3R7UA 2A1AB 4XG7A 4YHFA 1FGKA 4P2KA 2J0IA 3P7BA 3ANRA 5JQ8A 1ZAOA 3NUXA 1YHSA 5CNOA 5J79A 4IJPA 4AX8A 2C6OA 1UKIA 3HMOA 3WI6A 2HWPA 2V0DA 4XG6A 5HCXA 3O2MA 4KD1A 4GKHA 3MDYA 5IQIA 3FXXA 1Y8YA 3F7WA 3MB6A 1BKXA 3BKBA 1ZY5A 4NUSA 4EK4A 3MB7A 5CVGA 4BCHA 5IQEA 1LP4A 1OKZA 4M67A 2X0GA 5I3OA 3RK5A 4B6LA 4DTBA 3C0HA 5KX8A 1YOMA 1YI6A 4FSZA 1OUKA 3OY3A 5AMNA 3PPJA 3D2KA 5AR7A 3UIBA 2GFCA 5JT2A 2ZM3A 1RJBA 3WIKA 4QYHA 2B1PA 3QZFA 4NK9A 5L2TA 2HZ4A 4CTBA 4YJPA 3G33A 3I0OA 3D94A 4I5HA 4MQ2A 2O64A 2VUWA 3PTGA 4F7LA 4F9BA 3A99A 3O8UA 4G31A 3SW7A 3PSCA 2ZJWA 3Q32A 3I5NA 4ZTQA 2Z60A 3T9IA 4F9WA 4E93A 4OBQA 5LOHA 1BL6A 3MESA 3GENA 2FGIA 2PE2A 4RC2A 5H2UA 4CT1A 2GQGA 5M4CA 4JS8A 2RFSA 3TJCA 2XK3A 4QQTA 3BHYA 4FZDB 4O27B 4E4MA 2Z7SA 2I40A 2XKFA 3ZU7A 4I22A 4V05A 4RG0A 3LFSA 3SV0A 2X8DA 3DA6A 4B7TA 4AZWA 4JAIA 4R1VA 2YM3A 3EQIA 5HI2A 5AA8A 2PPQA 2C6KA 5CVFA 5EW9A 4E5AX 4D2VA 4PNIA 4IDVA 4KKGA 4L68A 4MXOA 4D28A 4CYIA 2JGZA 3P08A 1OKYA 4IZ7A 2GSFA 3B2TA 3PRFA 3QTZA 4G16A 4OLIA 3FMNA 4E7WA 4YTCA 5CYIA 3MYGA 3EKKA 4FKLA 3EH9A 5D9HA 4XV9A 4EC8A 4EKLA 4FA2A 2QG7A 4MXXA 3DDPA 3NEWA 5HG5A 3AMAA 3K5UA 1UU9A 2HWOA 3LFDA 4FTJA 3QTWA 2R9SA 3OHTA 4LGGA 4CKIA 2EXMA 4XX9A 3PP1A 3CSVA 4F6SA 4WG5A 2RF9A 3BZ3A 4YC8A 4D1XA 4EHGA 5C1QB 4J8NA 3RHKA 1RW8A 5BYYA 1W84A 4TY1A 5B7VA 3PE1A 4ZS4A 3O0GA 4KIPA 3R02A
chains in the Genus database with same CATH superfamily
3HRCA 2BAQA 3FJQE 4FV3A 1JPAA 2WTJA 1I09A 3FY2A 3LFNA 3PJ1A 4N6ZA 4XJ0A 2C1BA 4A9RA 4U43A 1Q5KA 3BHUA 3F3TA 3VBQA 1OIUA 4N4SA 3E7VA 3WZEA 3ATTA 2DWBA 5M07A 5DT4A 2PY3A 1G3NA 3PPZA 1PMNA 3JUHA 1OL5A 3GNIB 4JT3A 4BDHA 4V0GB 2NNWB 2R3LA 3DOGA 2WZJA 4GK3A 5LARA 3W2RA 3W0NA 3UG1A 5CT0A 4FSMA 4ZTRA 4DA5A 4PPCA 3L8PA 4TRLA 4YZDA 2Q0BA 3KN5A 2WMWA 4GK2A 4RBLA 5A4CA 4I4EA 1STCE 5FWKK 3PLAE 5AIRA 4UWYA 4JL9A 4LG4A 5EYKA 2WTWA 3EQFA 3II5A 3DAEA 3V5QA 3UQCA 5DA3A 4EUTA 3EFWA 2XK6A 3JS2A 4BL1A 4PTEA 2WTKC 3KVWA 2QC6A 4NEUA 3ANQA 4DN5A 4DCAA 1TZDA 3U6IA 2BROA 3W2SA 4AT4A 4DEGA 2BDWA 2ERKA 4FKPA 5DT0A 5E9EA 5HBHA 3BWFA 4FT0A 4NM7A 2CLQA 3DQXA 1MUOA 5EW8A 2VZ6A 2ZM1A 2JITA 4ALWA 5IA0A 1M2PA 3ELJA 1R39A 5E8ZA 1Z9XA 5BYZA 3GC8A 5JGAA 5AUYA 3U4UA 2YZLA 5KKRC 3WF8A 4RJ4A 4AZSA 2J0JA 4DTKA 3V8SA 3HYHA 4QMNA 3FY0A 4QMOA 5EQYA 3FKLA 3QQHA 1CKIA 2REIA 4O1OA 2GHMA 2X6DA 4FKWA 2C0OA 5M57A 3FAAA 1JKSA 3ZZWA 3QQUA 1ZMUA 4U40A 2PZRA 4FK3A 3MN3A 4LMNA 4V0GA 5D41A 2YDIA 3KGAA 4AA5A 1G5SA 5DE2A 5BV3A 5AM6A 4PX6A 2YJRA 2CPKE 3OCBA 3R9DA 3I60A 5AV1A 4YUQA 4MBJA 3NPCA 4EZ5A 3OG7A 2H96A 2Y6OA 2BRGA 3CQWA 3ALOA 4H05A 3ZLYA 2ZB0A 4EYMA 2O5KA 4M13A 2IW9A 3C4CA 2ITWA 4C4IA 5AAGA 3C5IA 5HCYA 2XANA 3OEFX 2ETKA 4I0RA 3ACJA 4I4FA 4RIXB 4ZAUA 1WVWA 2OJFE 4BKYA 3HZTA 3TM0A 2UZOA 3OS3A 2EVAA 4NTSA 3ZSIA 5JKGA 3VO3A 5JN2A 3EQCA 4CVAA 1ZZLA 4C3PA 3O8TA 3N9XA 2VTMA 3V5JA 1V0BA 1WBOA 3I6UA 2QOCA 5K0KA 4ENXA 4FTTA 2C0IA 4HPTE 4O86A 4KIQA 4XOZA 4C02A 3Q6WA 4QMSA 4J99A 3H9FA 5B0XA 4IZYA 3AC8A 4F1OA 4BICA 3HX4A 4GVAA 1T45A 3ZFMA 3UODA 5EKOA 4LI5A 3UC4A 1O6LA 2BPMA 2CGWA 2FVDA 3VULA 3NYVA 4GV1A 5EM7A 3FZ1A 4DC2A 3TUBA 4FV4A 4LMUA 4FF8A 3DZQA 3A4PA 3W2OA 4BFMA 5DN3A 1TQMA 3ZBXA 2AEGA 2YCSA 4WNOA 1OGYA 2X7GA 4JNWA 4K11A 3O7LB 4I21A 1GNGA 1H1WA 1JKKA 3PG3A 4C57A 3HA8A 3IW4A 4IANA 3EZVA 5L2WA 3TTIA 3CBLA 3LXKA 4JBVA 3DZOA 4IB5A 5EI8A 3M11A 5BMSA 1XH6A 1BI7A 4RIXA 2B9HA 1P2AA 4ANMA 4E8AA 2R3IA 3MH0A 4ONAA 1YHWA 3UNZA 4A7CA 5JMSA 3FSFA 3AC5A 4MD8E 3DU8A 5IEYA 2J0MB 5H8BA 5FDXA 2YCFA 1X8BA 3HL7A 4AFEA 2ITPA 4G17A 2ESMA 2BFYA 4RQVA 5ANDA 1OL2A 3Q9WA 2YEXA 3BEGA 3CS9A 3QTIA 4YHTA 4ITIA 3HKOA 3R7YA 4TL0A 1OBDA 5CZIA 4K0YA 4PUZA 4XRJA 2G15A 5E8VA 3TNWA 3LPBA 3NUSA 5CS6A 2XBAA 4G3CA 5LVNA 4AFJA 2X2LA 2XNNA 3K54A 2OJJA 1PXJA 1BMKA 4CZTA 4Q9ZA 5CF4A 3MY1A 4OBPA 5DLSA 5I9YA 1YW2A 2DS1A 2UW3A 5AR8A 1UU8A 3BHHA 2XEYA 2A2AA 1H1QA 1I44A 2OICA 3C0GA 4FKOA 2OXYA 4ORKA 4TYHB 4GT4A 1CKJA 3V3VA 4AAYA 5BUIA 4DFZE 4CCUA 3GC9A 4NJDA 1OGUA 1JOWB 3F3UA 5K3YA 3UC3A 4FEVA 1FINA 3KXGA 2XALA 4RWIA 4ANBA 5HEZA 1H26A 2X0PA 1DAYA 2OFUA 2PZPA 2YWVA 4OTWA 5BUJA 5ACBC 3UZPA 4BWPA 4S30A 4C4FA 3F5UA 3MIAA 1F3MC 3R1SA 3G5DA 3DV3A 5JRSA 4R3PA 4RX9A 1P14A 2PZYA 3NUYA 2UZUE 3WZJA 2IVUA 4Z55A 2VO0A 4HCTA 4I0SA 2XCHA 2YN8A 3W0RA 3QX4A 3NUPA 5C4KA 5IUHA 3QZIA 4XMOA 5LMKA 3VONA 2YM6A 3W1FA 1PXLA 4G3DA 1UNHA 2IW6A 5GIOE 3MY5A 3MH1A 5FXRA 4ZS0A 4AW1A 3FI8A 3SX9A 2R3GA 2W1EA 4R6VA 5IQBA 4BCMA 3OVVA 3FZRA 4QD6A 2EWAA 4USDA 1OUYA 4AAAA 4EK5A 4FYNA 1WCCA 1WBPA 5JFXA 1XH8A 2GNFA 3QTXA 4NM5A 1H4LA 3FI3A 4BR3A 2PE0A 5D7VA 5F95A 4DFLA 4EOOA 3TCPA 3L9LA 4FV7A 4CMTA 3GCSA 3L9NA 3Q96A 4TYJA 3AQVA 5GIPE 2C4GA 4LM5A 3UYSA 3S0OA 3PUPA 3EWHA 1CMKE 4FNYA 4TYHA 3AGLA 5HE1A 3F2AA 3DKCA 4WBOA 4EK8A 4LL0A 2IPXA 4QDVA 2PUUA 1JVPP 4FMQA 4FNWA 4ANNA 3S95A 4IX5A 1PKGA 3MVLA 4G9RA 2FSOX 4FIIA 3WYXA 3ZDUA 4FTKA 4M0YA 2W7XA 4NCTA 4IJ9A 3TNPC 2OIDA 3VF8A 4BDBA 2VTPA 5AUXA 3QQKA 1ZXEA 1NT2A 3NRMA 5HO7A 5GJGA 3PZHA 4YJSA 1W7HA 3RZBA 4X2KA 1AD5A 4JI9A 5EH0A 4Z7GA 2CHLA 3N4VA 2FB8A 4EOSA 4EK6A 3QZGA 5AUTA 5M55A 4Y46A 2PVRA 3L8VA 5EOLA 4EEVA 4EOIA 5CZHA 1Q62A 2WQNA 3VN9A 4C8BA 3TMOA 4QMVA 2FYSA 5EI6A 3H0YA 5IQAA 4GG7A 3DBFA 3UDZA 4AOJA 5BVDA 5HORA 2Y4PA 2VWYA 2PK9A 2XEZA 1XBCA 4UY9A 4AZVA 4RIOA 3BE2A 2I1MA 3AMBA 2V62A 3NVMB 5IPJA 3FL4A 4FIFA 3QD3A 2VAGA 3FC2A 2PVHA 4OAVB 4EH2A 2R3JA 5ANIA 3LVPA 3VS0A 5AR5A 4ANOA 3PXFA 3Q9XA 1FGIA 5K4IA 2VGPA 4LOOA 4GFMA 4E26A 1H07A 3DLZA 2VRXA 5CQUA 4CFNA 2C6EA 5A54A 4ZSJA 3U6JA 4UEUA 4C61A 1Q8UA 2ZV9A 2C6IA 3AGMA 4IH8A 4U3YA 3R8UA 4ZY5A 4L3LA 3D15A 1BX6A 4UN0C 1L8TA 3ULZA 4WUNA 3DBEA 1G8AA 1KV1A 3CQUA 2R2PA 4JG8A 3QCQA 3QX2A 4AA4A 4BCOA 5EHYA 3FMJA 2IZTA 2VTTA 2XA4A 4W4VA 4BDDA 2ITUA 4J53A 1F5QA 3C50A 3WOWA 2W1IA 3HV5A 5KE0A 5J9YA 2PUIA 4ASEA 2XKCA 3PPKA 4CQEA 4GCJA 2P55A 4IBMA 4CFMA 2HZIA 5M51A 5TOZA 4S2ZA 2VU3A 5H8EA 3HAMA 3WYYA 2VD5A 4DE4A 4GT5A 1DI8A 3T3VA 2B53A 2O3PA 3EQBA 3RHXA 5D10A 3VC4A 3D2IA 4YZNA 5AUUA 3OC1A 4G3EA 4U81A 4JR7A 2HYYA 4WRGA 2Y4IB 4D2TA 5KMLA 4AXFA 5DHJA 3VAPA 4C38A 2W9ZB 3SHEA 4FTMA 4RGJA 2QOHA 5KHXA 3FWQA 1GIJA 3NDMA 2GTMA 4QP4A 4W4YA 2AQXA 5HICA 4ZTMA 4IWQA 4CV9A 3BYMA 4WRSA 3R71A 1CKPA 3BGQA 3QA8A 5IQDA 5BUEA 1Q97A 3ZEPA 5JEBA 2E9PA 1R0PA 1TVOA 3KCKA 2XJ0A 5IA2A 1OL6A 3F66A 3RPSA 2HY81 2RL5A 4EORA 5LQFA 2R3PA 2HXLA 5IA3A 3UJGA 5K9IA 4BGGA 3HP5A 3Q60A 2RGPA 2ZV7A 5HU9A 5IH6A 1QPEA 3Q6UA 2C47A 4RC3A 2YIXA 1SVGA 5J8IA 5I4NA 2XK4A 2JLDA 2B55A 3ZXTA 5AAEA 1R0EA 3HAVA 3O50A 4HVDA 4M68A 1SMHA 2NRUA 3HV4A 4QMWA 3F61A 2PTKA 1O6KA 5J87A 5BYLA 1OIRA 3JVSA 3FZSA 4GYGA 2EXCX 4UXLA 4D2WA 4F1MA 1CSNA 2W1CA 3VQHA 5FDPA 5F20A 4MYGA 3MBLA 4K1BA 1QPCA 4QTBA 5TE0A 3U4WA 3E87A 5I3RA 4YLKA 1ERKA 5HNIX 4JX7A 4UALA 2H9VA 1MRYA 1FVTA 2ACXA 5AIKA 1SM2A 2VTJA 3Q2JA 4EH6A 4PMSA 4TWOA 3E8NA 4B9DA 4BHNA 2OIQA 2QG5A 3QUDA 4DEDA 4F9CA 2R3FA 4FSYA 3B2WA 3SDJA 4RJ5A 3GC7A 4C36A 5HBJA 3I5ZA 1H25A 3KFAA 2OH0E 4O0RA 4Q9SA 4EKKA 4YC3A 5DPVA 3RGFA 3EHAA 3BYVA 4C59A 3RPYA 3IOPA 1NVSA 2PVYA 4LQMA 3TT0A 4HYHA 3PJ2A 4R5SA 5HTIA 4KAOA 5EDRA 1M14A 5FGKA 2I0VA 4KBCA 1XMMA 4HCVA 4LRMA 2JKOA 3BHTA 2Y7JA 2J2IB 3NNUA 4FZFB 4G3FA 4XHKB 4O84A 3MA6A 1SNUA 3OWKA 4ZMEA 2R3KA 4N0SA 4I5MA 3ZHPC 4V04A 3PG1A 3OCGA 2WPAA 3FDNA 5AUZA 4DF3A 3SLSA 5AP1A 5AR4A 3RK7A 3QZHA 4FSWA 2BZKB 1ZOGA 4LDTA 2CCHA 4C4GA 4QMQA 3QF9A 3QKKA 4FKVA 5IA4A 2WOTA 1ZYLA 2WTIA 2G2HA 5A6NA 5ANJA 3W8QA 4AW5A 2CNUA 4DHZA 3F2NA 3RNYA 1OKWA 3CR0A 3VHEA 5J95A 4D0XA 5DYJA 1VR2A 2XIXA 1YXUA 2JAVA 2IJMA 1KOBA 3FXWA 5D7AA 2UW6A 3A8XA 1QPDA 3MI9A 5I9UA 2AYPA 3U9CA 3QU0A 4CV8A 3NZ0A 1XR1A 2OZAB 1ATPE 1TQPA 4YLLA 3AG9A 2WOUA 4OTHA 4DH8A 4I20A 4EJ7A 2VNYA 2X9EA 5AP7A 4PY1A 1H0WA 4FT9A 3P0MA 2AC5A 2EXEA 4S31A 2EUFB 4KABA 4CNHA 2RIOA 3R8MA 5BVFA 2BAKA 3P78A 5HIBA 3RKBA 3GFEA 3UIMA 3DKFA 5JFVA 4HW7A 2F57A 2WGJA 3R30A 3D14A 4BTKA 3ZRLA 2GQSA 5IUGA 3EL7A 2WTVA 2DUVA 3AOXA 3H9RA 2Z02A 3TWJA 4JDJA 4EH4A 3D5WA 4C4EA 1LUFA 1JNKA 2C5YA 3R73A 4IVDA 3COKA 3QHWA 5DEYA 4F6UA 1ZYSA 2P2IA 4JR3A 3Q9YA 2H6DA 1A06A 2XRWA 3L9PA 5E1SA 5E7RA 4EONA 4ZJIA 3NSZA 2VWBA 2XIYA 2FO0A 3NW6A 3KXXA 2UW9A 3TL8A 1J91A 4YO4A 3GC0A 4HYIA 1YOJA 2R3OA 1OM1A 3WF7A 2XP2A 4ZZNA 1XH5A 3HUBA 2BIYA 3OMVA 4XBRA 4BCFA 4ACHA 3RAWA 3UQGA 5DR6A 4GYIA 3W2CA 1QL6A 2GU8A 1GIHA 4QPSA 4RT7A 3R04A 4J98A 4OT5A 5AP0A 4CZUA 4D9UA 5CU3A 4NSTA 1Q61A 4FTQA 2O65A 1E9HA 2JBOA 3FPQA 4G34A 2OZAA 1M17A 3CTHA 4MEDA 3NFGB 3FI4A 2YLEA 5AEPA 1S9IA 4GJ3A 4R3RA 3TDWA 1YDRE 3LM5A 2VWIA 4K77A 5AP4A 5L2QA 4DLIA 2X4ZA 3TV4A 2XNPA 3FQSA 4D2SA 4N6YA 3U54A 5IH4A 3F5XA 3CQEA 2R5TA 4XBUA 2VWVA 3BLRA 3DXPA 3D9VA 4DHJA 3Q04A 4EH7A 4O7SA 3F6XA 3UMXA 5KCVA 3GGFA 2OBJA 1SVHA 5HZNA 5LMAA 2X6EA 5FM2A 4F09A 2VTSA 3UNJA 3MH3A 2XNMA 4XLIA 5LVPA 4IAZA 1TQIA 3COIA 3KQ7A 4O0VA 1KE9A 2BILB 3SG9A 3DAKA 4GUEA 4NL0A 4JG6A 2OF4A 2X81A 2PVJA 1Z5MA 3WF6A 4E5BA 4AA0A 4WBBB 2NRYA 3RAIA 4TYGA 4U0IA 4U42A 1S9JA 1YWNA 2W1DA 4O2PA 3RINA 2BKKA 3DXQA 4IWPA 3TI1A 2X0QA 3MPMA 4IACA 2LAVA 4RJ3A 4LGHA 4A9TA 2QOFA 5AV3A 3KY2A 3LLTA 4H39A 3FYJX 4DINA 3KK8A 1H1SA 3W33A 5L6PA 3OBJA 4DGMA 4L01A 3SXSA 2XK8A 4CGAA 3QALE 5C27A 4FC0A 5IEXA 1YDTE 5LMKC 4C0TA 2FA2A 3BV3A 3HV7A 1UU7A 3RCJA 5CWZA 1L3RE 3TACA 2YM4A 3UVPA 4DITA 5I9WA 1Q3DA 2G2FA 3PA4A 4O21A 1NY3A 3UDTA 3IDCA 3QRJA 1W98A 1ST4A 2JDVA 4FKQA 4F7NA 3ENHA 5E1EA 1FPUA 4O4EA 4FX3A 2QOOA 2E9VA 2FUMA 3DJ6A 4DHIB 4MCVA 1UVRA 2XNBA 3E88A 3TV7A 1JWHA 2QURA 2X4FA 4O6EA 4O7YA 2YIRA 5LWNA 2HK5A 2OLCA 2A98A 3FSKA 5CAOA 4IFGA 2WMBA 3V51A 3TEIA 3SC1A 5JGBA 3K5VA 1DAWA 1MQ4A 2HY0A 3MW1A 1ZLTA 3GQIA 1JSTA 3LQ5A 3KMWA 4Q2AA 2C5NA 1TKIA 5FEEA 5HQ0A 4JRVA 3KXZA 4I6LA 3PXKA 1IA8A 3DTWA 4GW8A 5HX8A 2VWWA 2XK7A 3MSSA 3OT8A 3R00A 4FUXA 1Y8GA 3AD6A 3KF4A 3NCGA 2VN9A 3QTRA 4NCTC 5I0BA 2G01A 1FBNA 4FUYA 4J95A 2QO9A 1GOLA 3HGKA 3CIKA 3NW7A 2QVSE 5JZNA 3R8LA 2VGOA 4BDFA 5EQPA 3IGGA 3FMMA 1XH4A 5L8LA 4M12A 4CFFA 2ITQA 4YSMA 2VX1A 3PWYA 4BDEA 3CPCA 4BBFA 2QNJA 1PXOA 2OI4X 3COHA 4B4LA 3WF9A 3BLAA 4OTFA 4BI0A 2W5BA 2HZNA 2XMYA 4MXAA 1PY5A 4GKIA 3ATSA 3LCKA 4BN1A 4KBAA 3LMGA 3RZFA 4O1PA 5AX9A 5CEIA 2B9FA 3IECA 4GT3A 5HIEA 3GCQA 4IE9A 3N51A 2YCQA 2IVSA 3MPTA 1NVQA 3R1NA 4JOAA 1OL1A 4S34A 3V8TA 5KBQA 3NNVA 3OZ6A 1GIIA 4I23A 4AGDA 2WHBA 2UZVA 3BU3A 4APCA 3C4FA 2YM5A 4ZJVA 4CKRA 4BDKA 3GCPA 1ZYCA 4USEA 3DB8A 4I1ZA 1BI8A 1WVXA 3FLYA 3A7HA 4GU6A 5AP3A 3UQFA 4OTRA 2GQRA 4XV3A 3GT8A 4EQUA 4FE2A 4Z16A 4BCKA 2YAAA 2WMQA 3NGAA 3BCEA 3F5GA 3U51A 1GY3A 1P4OA 5KMMA 3MFRA 4IWDA 3E62A 3RCDA 1HOWA 2UZWE 2R7IA 1QMZA 5EHOA 3LFEA 3NYXA 3QAME 5JRQA 4FVPA 4QMUA 4QRCA 2HXQA 2OJGA 4JAJA 3Q52A 4UYAA 4X3JA 3JVRA 5AP6A 3LCTA 3W16A 4EHVA 4XV1A 4L7FA 4U3ZA 5J9LA 4FR4A 4F9YA 5GHVA 4ACMA 3CPBA 2C6LA 2BTRA 4OTQA 3COMA 4IEBA 5GZ9A 2I0YA 4RX7A 5HG7A 4QO9A 5KMOA 4IAYA 5ETAA 3BGZA 3JPVA 1ZRZA 1PXKA 2UVYA 4YO6A 5AWMA 3ERKA 3L8XA 3P1AA 4ENYA 4B8LA 3TZ9A 4L43A 4YPDA 4FG9A 5DRDA 3R9NA 3I1AA 2ITVA 3RAHA 3DDQA 4P7EA 4FTNA 4BDJA 2XCKA 4KWPA 2P2HA 4CMOA 3QFVA 5CY3A 3LXPA 3ORTA 2Y0AA 2C6TA 5BX0A 4NYEA 4BYIA 4D4SA 2W4JA 3BIZA 4H3QA 4LOQA 4AE6A 3NUAA 5IH5A 2C69A 3K3JA 5CI7A 2WMTA 4JDIA 2BVAA 3HA6A 5D1JA 4AN2A 5KMJA 4LRJA 5KHWA 3HDNA 1TFFA 3EN6A 4R77A 5HVKA 1ZOEA 4HVGA 5A14A 4Z7HA 4QPAA 3PY0A 1XJDA 3NLBA 4FKGA 4G6OA 5DFPA 5IZFA 5A9UA 3UDSA 4X3FB 3V01A 4IAAA 4EUUA 2AC3A 4RX8A 4JMQA 1F0QA 3NR9A 1B6CB 4O7LA 2W5AA 4AOTA 4ZJJA 2VTHA 4PTCA 4WNMA 4H58A 1KSWA 5CXHA 4WO5A 3CKXA 1IAJA 2J51A 4BRXA 2A4LA 5ETFA 4MKCA 5DT3A 2Y4IC 3BWJA 5G6VA 3QKMA 3R0TA 3OD6X 2W06A 4O4FA 3QGYA 3IW5A 3Q4TA 5E92A 4RFZA 2QHNA 1PXPA 2B4SB 2YFXA 4HPUE 5AJQA 5GZAA 2F9GA 2PL0A 4KRDA 2PMIA 3O23A 3PIZA 2UW0A 3W55A 4AP7A 4ASDA 4FRFA 1Q8ZA 1CM8A 3IW8A 3QGWA 3IK3A 1W2CA 2JC6A 3UO4A 3ZCLA 4D55A 3W8LA 4F1TA 5JGDA 3VBYA 4HVIA 1JLUE 3BI6A 3OXIA 1YI3A 4ZXTA 3VBXA 5FG8A 3RMFA 2YAKA 3P7AA 3EN7A 2RG5A 4XEYA 5CXZA 4BJJB 3KULB 3KB7A 3OOGA 3U9NA 1P5EA 3VUDA 3PLSA 5ANGA 4OAUC 3E8CA 3IW6A 3VRYA 4M3QA 2QCSA 3OXTA 2F7ZE 4JDKA 4YJUA 4IZ5A 3GU5A 5CT7A 5FTQA 2YITA 4BCQA 5CAVA 4XRLA 2V7OA 2UZNA 4JQ8A 5L6OA 2XJ1A 4O4DA 5DEWA 3DBDA 3HV3A 4I93A 4BZOA 2C5VA 4P4CA 5DMZA 2E2BA 2FSLX 2WFYA 1B39A 2JIVA 4HVSA 3SRVB 3MA3A 4RZWA 4TZRA 3PJ8A 4ZZOA 4ZLZA 4O7ZA 4IX6A 2RSVA 4ZTLA 3OXZA 5D11A 1KOAA 3DB6A 5GNKA 3E3BX 3W18A 2O63A 4LUDA 4PDYA 3LHJA 4DTAA 4U97A 3UMWA 4L45A 3MV5A 1OIQA 4AG8A 2RFDA 3S4QA 5J5TA 4FOCA 5J7HA 4FV2A 3QRTA 4CTCA 4WG3A 4AZTA 4WSQA 2UZDA 2Y9QA 3W10A 2VX3A 1OMWA 4X2FA 3S2PA 4FKRA 4R1YA 1H1PA 2FSMX 3CTQA 3FZOA 4QP9A 2OO8X 3F7ZA 4W9WA 2P0CA 4RA4A 4BTMA 4EH9A 5CAQA 3POZA 1Q8TA 5FM3A 5HVYA 2NYAA 3NX8A 1PYXA 4FTOA 1KE6A 3ORZA 4UYNA 3PDTA 3A7JA 5ANOA 2J4ZA 2QHMA 4JRNA 3KA0A 4RZVA 4L9IA 2PUPA 3NNWA 5BNJA 1XKKA 1URCA 3C5UA 4QQCA 5BVOA 4BJJA 3KULA 2XARA 4H3PA 5HE2A 4L3PA 2IWIA 2X2KA 5DOSA 2Q83A 2BHEA 2JDTA 4ACGA 3FUPA 1MP8A 4NKAA 3UBDA 4AE9A 5B2LA 3F5PA 4QYFA 5GJFA 1NVRA 3WILA 4IZAA 4F99A 5EYMA 2QLUA 3AD4A 3MTFA 2QO2A 5CU4A 1J7UA 5M06A 3QBNA 3L8SA 3PRIA 3Q4ZA 1U4DA 4ZMFA 4O0XA 3OF0A 4Y85A 4YU2A 3PVBA 1R3CA 2BHHA 3NIEA 3FZPA 2QU6A 1CDKA 3RK9A 3ROCA 3TKHA 2ZYBA 3LMHA 3RPVA 4HOKA 3DCVA 5KUPA 2BZIB 2VX0A 4I94A 1OECA 5DR9A 5CU2A 3CLYA 2YHVA 5F94A 5LVMA 3R28A 4LOPA 4P5ZA 4DH1A 4FZ6A 5EM6A 5AA9A 5IMEA 2J50A 4RLLA 5CI6A 5CAPA 1PHKA 4QP8A 5A4LA 2XYUA 4K2RA 3O17A 3IS5A 4FG8A 4AZEA 3BLHA 3QUPA 4PP9A 3T3UA 4YJOA 5TF9A 3MFSA 5AV4A 4ALUA 3SW4A 4O0UA 2JDRA 3LCSA 3W0MA 3BEAA 4MBLA 3BX5A 4O7VA 4P5QA 5CEOA 2YABA 4U9AA 2J5EA 4GUBA 2HW6A 3VBVA 4CD0A 3FHIA 1OI9A 2JAMA 1IG1A 2VO6A 4NT4A 4UXQA 2E9UA 5AR3A 2X39A 2JKQA 2PHKA 4LYNA 2CKOA 5HG8A 1YI4A 4XS2A 5EW3A 3ORXA 4IHPA 2IW8A 2I0EA 1YVJA 4NFMA 3ZC6A 4E4NA 4TPTA 4DDGA 1GJOA 4QMLA 5FBOA 3QD4A 2X0OA 4FTRA 4E1ZA 2OZOA 4MQ1A 1H00A 4MD9E 5K5NA 1KV2A 4IW0A 5KZIA 4U79A 4CRSA 3F3ZA 4F7SA 4UX9A 2ITZA 3R7GA 3DBCA 3R8ZA 3C9WA 2EB2A 3UOHA 4YZMA 4J52A 2P3GX 5EG3A 1SZMA 4MNEB 4BDGA 3O7LD 3QKLA 3LOKA 4PP7A 2DYLA 2WU6A 4Z3VA 3H9OA 3E64A 3BYUA 2QR7A 1YWRA 2CGUA 4QNYA 2J7TA 4C35A 3FMEA 4R5YA 3UGCA 3VS4A 2HOGA 2NP8A 3IGOA 5G1XA 3ZEWA 1DM2A 3RBWA 4A4LA 5CU0A 1UWHA 3ZO3A 2OGVA 3RM6A 3TZ8A 1OPLA 3MIYA 4ZP5A 5FLFA 2F7EE 4I6QA 4KSPA 4BWKA 4QPMA 4ZLYA 3BYSA 5HVJA 4DEEA 3W32A 2I7QA 4PV0A 3ZTXA 4FGBA 3BBTB 5AUWA 4L46A 4FIGA 3R1QA 2B0QA 4XP3A 4FIHA 5CENA 3F69A 4JDHA 4F9AA 3FMKA 3OWPA 4D1SA 4XOYA 3QTUA 2JIIA 2IZSA 5LCKA 3IQ7A 3NAYA 3AC4A 4MWHA 3MJ1A 5E4HA 1DI9A 2XK9A 3I81A 1IA9A 3NYNA 2ZV8A 2X9FA 3SXRA 2F2UA 4UV0A 4DEAA 1OIYA 2XZSA 3ALNA 4IC8A 5FQDC 1T46A 4CLJA 2YIQA 2CCIA 2UW8A 1JQHA 2P4IA 3C1XA 3NWWA 3IG7A 4AOIA 3QCXA 4DYMA 2QONA 4AU8A 3SGCA 3JY0A 4DEBA 4Y72A 1OZ1A 3BQCA 3KIOC 3R9OA 4BIBA 4MNEA 1QCFA 2ZFYA 2J0LA 4BF2A 4EQMA 2UZTA 2DQ7X 4AF3A 3HMPA 2GFSA 4EOJA 3OP5A 2Z7QA 3LIJA 4ZSEA 3TKUA 5BVWA 4XG3A 1OPKA 3R6XA 3LAUA 4KA3A 4NW6A 3LCDA 5C03A 3V6RA 4FJVA 3C7QA 3FMLA 3DLSA 2WIPA 1RDQE 3P5KA 2PULA 3GQLA 3JYAA 4G6LA 4LRKA 4ZTHA 4H1JA 4EZ3A 4JBOA 5GINE 3FMDA 5JFSA 4EOPA 2CN8A 1DS5A 3R83A 2VV9A 2YIWA 2W0JA 3C0IA 4UZHA 4GL9A 3LFQA 4F6WA 2RKUA 2JEDA 3VNTA 2BFXA 3LE6A 4FIJA 5AP2A 2R3NA 4YSJA 5DGZA 3R9RA 2VTLA 4O7RA 1YRPA 4AXDA 4QTCA 2VWZA 4F0IA 3LXLA 4CQGA 1JSVA 3W2PA 4AQCA 2YLFA 4NZWB 3H10A 2VTRA