5DI1A

Map4k4 in complex with an inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
285
Chain Sequence
IDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of an in Vivo Tool to Establish Proof-of-Concept for MAP4K4-Based Antidiabetic Treatment.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
total genus 84
structure length 285
sequence length 297
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5di1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5di1A01
5CF8A 4KBKA 2PMLX 3LFDA 2B0QA 3E8NA 1L8TA 1Q62A 3POZA 4GV1A 4X21A 4XG9A 2C5XA 4PDYA 2C3LA 2FA2A 2JGZA 4GT5A 4XOZA 3W2CA 4WNOA 2GTMA 4P2KA 1H01A 2J0IA 3QHRA 1I44A 3DAKA 4ACDA 3G0FA 2BZKB 1Q3WA 2FO0A 4U43A 4RBLA 1KV1A 4PQNA 3KXZA 4A9SA 1K2PA 4MWIA 5LWNA 3EN7A 3CTJA 4LGHA 4ZSJA 3RGFA 4S34A 3LKMA 4F0FA 3FI4A 2A1AB 3LXNA 4FMQA 4FSYA 4K2RA 4YLKA 4BCNA 4D0WA 1MQ4A 2Q0BA 5AR3A 4FGRA 2XYNA 5CEPA 2EXCX 2Y8OA 4E5AX 4F6WA 5E8UA 3EQBA 4GUEA 3DLSA 3O7LD 4C3RA 3Q52A 4KWPA 4E8AA 3UZTA 1WMKA 3ZBFA 4W4WA 4FTNA 4KKGA 3F6XA 2PVLA 4N57A 4F4PA 4M69A 1H4LA 3DK7A 4XOYA 5IA5A 4QQCA 2YDJA 2BAKA 2X4ZA 4AAAA 5CT7A 3OF0A 4XYFA 5J79A 4WO5A 4N6ZA 4FSUA 3QRKA 3WE8A 2WMVA 1K9AA 2PHKA 4FNYA 5EW8A 3S00A 3DU8A 4O0VA 4DEAA 3DKCA 4LQMA 5JRQA 5KMJA 5IQAA 4AOIA 5AR4A 5M51A 4MK0A 2XYUA 5K5NA 3MPMA 4LI5A 3NW7A 4GFGA 2PU8A 5EDQA 3WBLA 4BI0A 2QONA 2CHLA 4GU6A 4D4RA 5D1JA 4YJRA 2C3JA 3ORIA 3ULIA 4LRMA 3V5WA 3VBVA 5HIEA 4U3YA 2OXXA 5BVFA 2C6OA 4RFZA 3EWHA 3N4TA 2R3HA 3UODA 4AFJA 4FZDB 2W0JA 4TKSA 5CEOA 4MX9A 3OWJA 4D5HA 2AYPA 4MXAA 4XUFA 2ZOQA 2I40A 4M13A 3TV4A 3D5XA 5M53A 2IG7A 4HJOA 2GNHA 4G5PA 4TXCA 1Q5KA 3I1AA 3JPVA 3PJ1A 4YC8A 2VTLA 4CG8A 5CI7A 2YLEA 3BYUA 4IBMA 1ZYLA 2PZPA 3QD0A 4OGRA 4CGAA 4IX5A 3F69A 1GIHA 4FKPA 4NT4A 1XBAA 4QP3A 5KBRA 4CFXA 3BRBA 4D2RA 3V3VA 2VTNA 4NM0A 4DEIA 1WBWA 2J2IB 3VHKA 2P2HA 4JNWA 3IW8A 4L3JA 5AP7A 4B9DA 5HG5A 1YDRE 3L9PA 3PG3A 4JS8A 2VO3A 3UVQA 1OPKA 4BF2A 1OVEA 4NZWB 4IZ7A 4CYIA 4FTUA 4WUNA 3MJ1A 1NY3A 2QKWB 5J1VA 3QL8A 1U5RA 4I4FA 4BY9E 4BIBA 4LYNA 2FSLX 4XRJA 5FDXA 5A54A 4U0IA 2IVSA 1BLXA 1KOAA 2OF2A 2PE0A 2VU3A 3I0QA 1AQ1A 2P0CA 4UYNA 4II5A 4AGWA 4HNFA 5HEZA 3GXLA 4BDKA 3H9RA 1T46A 3BU3A 2UW3A 4IAFA 3KFAA 4BDCA 3QRIA 2QOCA 5EI8A 5JKGA 2WHBA 4C2WA 5M56A 4JLCA 5AM7A 5EQYA 2G9XA 5H8BA 2JAVA 3IQ7A 3S95A 4O7TA 3VBXA 3VRYA 5AIKA 3LCOA 3SA0A 4K18A 4XJ0A 4QMUA 3UIBA 3G2FA 3QRTA 3CY3A 3HRCA 4EHZA 3TJCA 1GJOA 4NKAA 4ZIMA 3FV8A 4FNWA 4BWPA 4PTEA 2BZIB 2JIUA 3AMAA 4RJ5A 4P90A 3FMDA 2ITNA 4QQ5A 3PVGA 1R3CA 4YJPA 4F64A 4YTCA 3KRXA 4FK3A 4B0GA 3HUBA 3FMLA 2FH9A 2FUMA 4I21A 1SVEA 3EFKA 4DEHA 1Z57A 4QMLA 3QCQA 4IVBA 5T68A 4RJ7A 4QRCA 4C59A 2YJSA 4ZJVA 2R3FA 2J0LA 3QALE 3RINA 1J3HA 2ACXA 1Y57A 4XNEA 5L6WL 3QWJA 2V5QA 1OIRA 3WYXA 2GFSA 5L3AA 3SXFA 2C3IB 5D7AA 2G2IA 2WMAA 4E4NA 4AF3A 4ZJJA 5BUEA 4EZ3A 1YWNA 4ZLZA 3FLNC 1ZXEA 5F20A 3ORMA 5EDRA 5DN3A 2ZYBA 4LG4A 1M52A 3R71A 2W99B 3KXHA 3ZYAA 5I9VA 4JL9A 1T45A 3OCSA 1H08A 4D9UA 5T3QA 3E63A 1PXJA 1SVGA 2XIKA 1KE7A 4FSMA 4TN6A 5IEVA 4PMTA 3TL8A 4I23A 4XG3A 1UNGA 1ZMUA 5CU6A 2IN6A 3CR0A 2YM5A 3D5VA 4IC7A 3IGOA 3JVSA 5FTGA 3C4CA 4M69B 2PYWA 4IVAA 1J7LA 1CSNA 2W17A 4BTJA 2HZNA 4YZ9A 2W1IA 3CGFA 2V55A 4IACA 4EC8A 5I3OA 4U81A 4IZYA 4XRLA 4JG6A 5CAOA 4PUZA 2GSFA 4C3PA 3LFCA 3O50A 1YRPA 3V6SA 4DTAA 5KMOA 1H1WA 4FSWA 3PIXA 4FOCA 5EDPA 5HTCA 4PWNA 3C50A 5EQEA 1YI6A 5GZ8A 2I0VA 3F2AA 4IZ5A 4EC9A 2QOIA 3DFAA 2F7XE 2ITQA 2WTKB 4WUAA 4J97A 3U9CA 4AE9A 4AX8A 5LWMA 5J87A 1Q8UA 3R1YA 3DFCB 1R0EA 2YIXA 2XRUA 5IZFA 3A62A 2WGJA 3KB7A 4M0YA 5BYYA 5IA3A 3NYVA 4RA4A 4IM3A 3QU0A 4B8LA 4BGQA 3WILA 2OZAA 4RX9A 4FUXA 3VUKA 4QMNA 5JFXA 1Z9XA 3LM5A 5D11A 3I60A 2OH0E 1G5SA 2HXQA 5GHVA 3LJ1A 4RGJA 3SVVA 5FGKA 4A4LA 2B1PA 2JEDA 4DCEA 2QO2A 2UW7A 4QP6A 4WRSA 1M14A 5LVLA 4DFNA 2HZIA 4F9AA 4E6QA 5ICPA 2GQRA 3DK6A 1AD5A 4P5QA 4D55A 4RVMA 1SZMA 3GU8A 3POOA 4DEDA 3IKAA 4AT4A 5FEQA 5LVOA 4YJQA 2X9FA 1J1BA 2XIZA 2J50A 4JDHA 5CNOA 1Q61A 2FGIA 3SOCA 4DN5A 3MTLA 2F57A 1KE9A 3PXYA 4RSSA 4GRBA 3ZC6A 4MBLA 1XBBA 3BHVA 4AN9A 3FLYA 2R3RA 3U6HA 4BCGA 1YWRA 2Y0AA 3F7ZA 4IANA 4KSQA 5GZ9A 3TKIA 3ENMA 3AGMA 4UEUA 1GIJA 2YZAA 4C4HA 4FZFB 3DJ5A 2PK9A 2XKCA 3LPBA 4HVDA 3ZS5A 4UWCA 4WNPA 4L52A 1VZOA 3MS9A 5AR7A 5DT4A 4PPAA 5GJDA 2NNWB 2HYYA 3Q04A 2XCHA 2G01A 1PMEA 2UW6A 4RIOA 3HVCA 4MVFA 4YJSA 3FI3A 5EFQA 3ZONA 1BI7A 3PVBA 3EJ1A 5HLWA 5HCZA 3UOLA 3QLGA 3VQHA 2WELA 3GU7A 5FRIA 4ZY5A 5KZ0A 4YO4A 3PXFA 3E3BX 4L46A 2KULA 4OR5A 4MAOA 1NVRA 1BYGA 3UOHA 1DS5A 3D14A 4FSTA 4LFIA 5HE2A 1OM1A 3TI1A 5FM2A 4AG8A 4L8MA 4M7IA 2GU8A 3A4PA 3RAIA 3RZFA 2PVMA 3M11A 4E7WA 4F1MA 3BHHA 4WA9A 2O8YA 3COIA 2GNLA 3WE4A 4DGLC 5EKNA 3FKOA 4B6LA 3MGYA 4G31A 2CLQA 2WQNA 1OKVA 4NW6A 2BHEA 5A6NA 1J1CA 4YC6A 2OFUA 4DINA 5CQUA 2ZV7A 3OWKA 4HCVA 4WKQA 1TVOA 3QKKA 5AV1A 4X3FA 3BHTA 4ERWA 5FTOA 5IQDA 4JQ7A 3K54A 4X7QA 3MFUA 2GS2A 5BYZA 4V0GA 2OZAB 5IQBA 4NKSA 1OL5A 4DH7A 5BVOA 5CSPA 3Q2JA 4MEDA 4JXFA 4U97A 3HAMA 2XKFA 4J8NA 5J5TA 5CVGA 5AV0A 3R83A 2VWZA 3G33A 2QOHA 3BBTB 3S1HA 1JQHA 3TUDA 2XUUA 4XHKB 4TWOA 3PA5A 4AW0A 4ZSEA 4UMPA 4E6CA 3HGKA 4Z7GA 2VNWA 5FP6A 3FHRA 3OHTA 2QD9A 3ITZA 4PDSA 4GT4A 4TYHA 1Y6BA 2BRNA 3FQHA 3TXOA 2GMXA 3EN9A 4FTRA 3UMXA 2QG7A 4WSQA 4L7SA 5CSXA 5E8XA 4LOQA 3FZOA 3HNGA 4HGTA 3F88A 3LCDA 4QMMA 3I6UA 2HCKA 1ZYCA 5DG5A 2JIVA 2Z7LA 3GQLA 1XO2B 2OJJA 2VTSA 4JQ8A 4MBJA 5HG9A 5A4EA 2BROA 4AZTA 4YJVA 4O38A 3TJDA 4CFVA 4D1SA 1MP8A 5E92A 3SXRA 1W8CA 2I1MA 5DT3A 4O84A 1QPJA 2W1GA 3I81A 3ORKA 3NX8A 3LLTA 2RG5A 4X2GA 5DFPA 3ETAA 4DGMA 5ETFA 5JK3A 3TIYA 5LCJA 3RPSA 4QMZA 4BKYA 4R7HA 5BYLA 1PMVA 4GIHA 3RM6A 4YSMA 1YXXA 4DFZE 3MA6A 2PTKA 2Z7SA 4GT3A 5J95A 3SRVB 5JRSA 5CS6A 4I22A 3SG9A 2BR1A 3ORTA 1H0WA 5A3XA 5I0BA 5KHXA 2WTJA 4S32A 3TKHA 3EFWA 2XJ2A 3F3ZA 3Q5ZA 2YDIA 2IW9A 4FKIA 2B7AA 1GZNA 5HE0A 3UP2A 3FMHA 3SV0A 1Y91A 2YHVA 3UGCA 1U59A 4F65A 5KBQA 2J6MA 4PTGA 3RALA 4DLJA 4IVDA 3UPXA 3G9LX 3KQ7A 5L8LA 4QYGA 4QMOA 4I0RA 4ONAA 3AC5A 2B9IA 4EQMA 4FV2A 5DT0A 4H36A 3QC4A 2PSQA 3QYWA 4PP7A 5C8KA 4O7YA 2VV9A 4PY1A 2BDJA 3B2WA 4ACGA 3Q96A 4ANSA 1GAGA 5HNBA 4D4SA 3D15A 1W83A 2X2LA 4DLIA 5HLPA 4KSPA 5M4IA 4FEUA 3PG1A 3OUKA 4UB7A 3HLLA 3G90X 1P2AA 2J0MB 5K5XA 5H3QA 1IA8A 2OI4X 3BE9A 3KXXA 4K1BA 3KF7A 5EOLA 4JI9A 3M2WA 5ETIA 3AMBA 4AS0A 3NVKI 2JLDA 5DEYA 3GU5A 3R6XA 2B9JA 4H58A 4ACMA 4PNKA 5EI6A 1TQPA 4ZSGA 3WYYA 1WBTA 4OTPA 1U54A 2VNYA 5EM8A 2OJFE 3FJQE 5HX8A 3FXWA 4FV5A 4NIFB 3R2YA 4F6SA 5DHJA 1H00A 1P4FA 3R8UA 3KL8A 3RPOA 2AUHA 3ZLWA 2XNPA 4H1JA 4BBMA 3L8PA 4FSQA 3P9JA 3D9VA 5TKDA 4E6DA 3L8SA 5AUXA 2QO9A 4CFWA 3ZRMA 4FVPA 4QP9A 4YTFA 4ZTMA 2R0IA 5I9XA 5IKWA 3ZRKA 2XEYA 4D58A 3TNHA 3KMUA 2QVSE 4FIFA 3BV3A 4AE6A 4DBXA 3DZOA 2ZM1A 2WMUA 3AXWA 1LR4A 2OGVA 3VJNA 3KRWA 4DCAA 2ITVA 2QHNA 4QMTA 3NUPA 4CFUA 1CKPA 2CNVA 4IAAA 5HCXA 2GNGA 3VUMA 1JLUE 1XWSA 4D2VA 5FDPA 4F1TA 1ZOHA 4ZLYA 3VIDA 3KULB 3VUTA 3FUPA 4BTMA 4CV9A 1MRYA 3ID6C 2QOKA 4J71A 1UWHA 3RCDA 5L2WA 4RWIA 2WOTA 4AW1A 3FZPA 4HVGA 3C9WA 2KTYA 4C33A 3OWPA 4ITIA 1ZZ2A 3CIKA 4PPBA 4CRLA 4E5WA 3PVUA 4FKOA 4FR4A 4EH8A 4KUJA 3R22A 5HI2A 4O0TA 2LGCA 3VW6A 3ZLYA 1M7QA 4L00A 4XLVA 5AV4A 2HZ4A 3W16A 2J51A 3UP7A 1LEZA 1URCA 3EN4A 2XK8A 4M15A 4AZFA 3MI9A 1CKIA 3CD3A 1TQIA 4IB0A 2E9OA 3PSBA 3ZFMA 3GCSA 4FBXA 4YZCA 1WBPA 2QG5A 3KULA 4NW5A 1S9JA 3MV5A 5E4HA 4UYAA 4NFNA 4R6VA 4A9YA 3IDBA 5IH6A 3QKLA 3H9FA 3ET7A 1H1QA 4K8AA 5AV2A 4FV3A 4YC3A 2VWBA 3BX5A 2UUEA 4IH8A 1DAWA 4U3ZA 2CLXA 3DB8A 2I6LA 4KKHA 5D12A 2CDZA 3COHA 3WZKA 4F7JA 5I9YA 1WFCA 2UVXA 2WXVA 3FC1X 1YXUA 4DT9A 2WOUA 4NIFA 4AA4A 2VWUA 2X7GA 3LXPA 4MF1A 4FTIA 3LAUA 4YNEA 4IX6A 2BUJA 4DFYA 2XIRA 5KMIA 3L9MA 2CNUA 3K2LA 3F9NA 3EQIA 3CXWA 5E8SA 3I7BA 4OBPA 1V0OA 4EOLA 4EHEA 3EIDA 3CGOA 3ORZA 3OWLA 3KC3A 3NS9A 3KVXA 3WARA 4EOMA 2W4JA 5HG7A 4CLIA 4DH8A 1KE8A 2EU9A 2ITZA 2E9VA 3QHWA 2F4JA 4XG2A 2PULA 5HD4A 1Q8YA 1GNGA 4LOPA 5LVMA 2QOFA 4DITA 1TQMA 2WMBA 3HV5A 4I20A 5FQDC 4YURA 3CTQA 4AZWA 4H05A 1R78A 3JR1A 5JGAA 3QYZA 4RG0A 3BHYA 1H1PA 3PZEA 2WD1A 4J98A 4WOVA 3PA4A 4K11A 3UPZA 2YIRA 3F7WA 3QUPA 5J1WA 3O7LB 3P4KA 2QLUA 1B39A 2IJMA 3RCJA 1QL6A 3TG1A 4K33A 1WVYA 4RZVA 3U87A 4JDKA 3G15A 1DI9A 3R04A 3E87A 4M67A 4BYJA 5I9WA 4V04A 2HK5A 3RP9A 4ERKA 4CLJA 4UZDA 2HXLA 4M66A 5CU4A 4RIWB 2OW3A 4FVQA 3E92A 3R1SA 1Q3DA 4CKIA 2WQOA 2CN5A 3GQIA 4BHZA 4MH7A 4L6QA 1ZYSA 4MNEA 5KE0A 1WBSA 3OY1A 1YI3A 5IUHA 2W9ZB 3OMVA 4RZWA 5IEYA 4B4LA 1ZY5A 3NEWA 3V5PA 2BZHB 3K3JA 3UC4A 3KREA 3FL5A 5CYIA 1UKHA 3PYYA 2OXYA 3RHXA 4USFA 3SG8A 3AD5A 4I4EA 2Z7QA 1PYEA 3RPRA 3A8XA 4BTKA 3DLZA 4WNKA 3MB7A 4K6ZA 2JKQA 5ETAA 3FC2A 5AUYA 2J7TA 2OXDA 3HV7A 4XP3A 4C02A 1FVTA 2IO6A 5JZNA 1VEBA 1YXVA 2IVUA 2UVYA 4HYUA 4BI1A 4EH5A 1BL7A 3W32A 4GJ2A 3GP0A 1O9UA 5ANGA 4FIGA 4EOQA 2YFXA 1JPAA 3TNWA 3ZDUA 4FGBA 3LFBA 3O96A 1FQ1B 3H10A 4QO9A 4RIYB 2QOOA 2ZDUA 5T6KA 4QYEA 2P55A 1M17A 4R5SA 5IQGA 4AZVA 4BKZA 3BWJA 5J7BA 1J7IA 3OS3A 3QUDA 5HVYA 1PXNA 1KE5A 4AOJA 5BPYA 3P23A 2A0CX 3QTZA 4FTCA 4IJPA 1PHKA 3P7AA 4IWDA 1OZ1A 4RJ6A 5AA9A 5AUTA 3RK5A 3HMMA 4U41A 2UW9A 4OTRA 4FKWA 3DS6A 4JVGA 1NW1A 5AP1A 1IA9A 3MFRA 3ROYA 4EQUA 4X2FA 3QZHA 3CQWA 3TACA 2BRGA 4BDJA 2F9GA 2E9NA 1G3NA 5C8MA 2BIYA 3MJ2A 3HA8A 4HGSA 5CZHA 3ZMMA 4C7TA 3PJ3A 3VS7A 3F3WA 4FV7A 4BFMA 4TWCA 1J7UA 4X6RA 4F63A 4USEA 4BCFA 4EZ5A 1IAJA 4ORKA 3QRUA 3ZUUA 2WKMA 3EFLA 5DA3A 4F9WA 4R1VA 5IH5A 5GIPE 5L4QA 4YO6A 2P33A 3BYMA 4NEUA 4QYFA 4RC2A 5HX6A 3R9HA 2G2HA 3VUIA 4Y5QA 4BCIA 4RPVA 4EK3A 2IPXA 4KINA 4EUTA 4FK6A 1GY3A 1XH6A 5C01A 1NT2A 3NCGA 3E64A 2CKPA 1WBVA 4C58A 3GVUA 4APPA 3UQFA 2A2AA 3PVWA 3QTXA 4IZAA 5CEKA 1H07A 3PE2A 5DR9A 2X0GA 3D83A 5HESA 3DZQA 3TZ9A 3ZO2A 4EH3A 4NYEA 3C5IA 2O2UA 2W5BA 2XNOA 3QCSA 2JKMA 4YZNA 3NNUA 5L2QA 4WSYA 4IVCA 2UW5A 5FG8A 3ZDIA 2NPQA 2XIYA 4J52A 4O22A 5DBXA 5ANKA 4FICA 3HP2A 3CEKA 4GJ3A 2Y6MA 3D0EA 3EZVA 3LIJA 1KSWA 3NIEA 4YLLA 3TTIA 3ZZEA 2OO8X 2XH5A 3OP5A 4ZTHA 1FGIA 3ZOSA 4BWXA 5LXMA 4L45A 4D1XA 2H96A 3NAYA 4OT6A 3R8ZA 3EN5A 5BMSA 4RQVA 3A4OX 5FXRA 3R21A 2JDVA 3CTHA 3F3UA 2R3IA 3PPZA 3ATTA 3LQ3A 1TKIA 3SHEA 4EOOA 2XM9A 4ITHA 1YWVA 2JKKA 5DGZA 3G5DA 1Y8YA 3VC4A 4W8EA 2C6MA 2JDSA 4P5ZA 4ZS4A 3BEGA 3GI3A 4O6EA 1IASA 5DRBA 4CCBA 3IK3A 3ZFXA 1REKA 3EN6A 3LOKA 3R7GA 1OKWA 4KIKB 4AN3A 5IISA 1HCLA 3ZFYA 5ITAA 4FSNA 3LFFA 3B8QA 4GK3A 3QZIA 1JKLA 3HV3A 2YABA 2NO3A 4IWPA 4UMTA 2GFCA 3FY2A 3EMGA 5CALA 4DTKA 4F0IA 3WIGA 4BN1A 4MKCA 2PVJA 2WMTA 2X9EA 3C4FA 4HOKA 5DE2A 2R3LA 4EJNA 3C51A 3QTQA 5B0XA 3ORLA 3JYAA 1Z5MA 3LXLA 2ZB0A 2JFLA 3DBQA 1OUKA 5L8KA 4EBWA 1S9IA 1UWJA 4XG8A 5HQ0A 4LRKA 3R8LA 2R7BA 4J99A 4BYIA 3EH9A 2YM4A 4WHZA 4QP2A 3LJ0A 3R63A 3OCBA 4HCTA 2YCRA 4JIAA 4CFFA 5M44A 3NDMA 4LUDA 3OXZA 4FIJA 5B7VA 5BQ0A 3QTSA 2CN8A 4R3RA 2ZAZA 5EG3A 4QTAA 4FT5A 3QBNA 1U54B 3GEQA 2C4GA 2W96B 3GOPA 5CX9A 5IQHA 3QX4A 3WF8A 4LRJA 3ALNA 1Y8GA 3KCKA 4BR3A 3R7YA 4RFYA 2VGOA 3M42A 2NRYA 2WMWA 2XBJA 5D10A 3TV7A 3Q9YA 5HGIA 4FIIA 4BB4A 4ZK5A 4I5HA 2EWAA 2WAJA 3LVPA 4R7IA 5HU9A 2W9FB 1UVRA 1EH4A 4FT9A 4PDPA 3TTJA 4BDDA 5IA4A 4OTDA 5A4LA 4GS6A 3LMHA 2UZDA 1VYWA 5CQWA 5ACKA 2ZMCA 4F9BA 4O91A 2GDOA 4EH4A 2C6TA 1RQQA 3BHUA 1O6YA 2VO0A 3ZBXA 4KBAA 4QP4A 4RVTA 2HZ0A 4KB8A 3C4ZA 1WVXA 3DNDA 4C4GA 3UOKA 4MCVA 1JVPP 3BU6A 3D7TA 3IONA 1KV2A 3FYJX 3OC1A 4JR3A 4KRDA 4I92A 3DXQA 4RT7A 4NTSA 4ASXA 3UQCA 5DOSA 2W7XA 4GFOA 2R64A 2XEZA 4MHAA 3FDNA 1JBPE 5F9EA 3C4EA 3BGPA 3QUEA 4KABA 2CNQA 5ANJA 4UY9A 4RJ3A 3F61A 4A4XA 1XJDA 4FTQA 3GUBA 5EH0A 2HIWA 4IHPA 5JN2A 2ITYA 4S33A 1IR3A 4MXCA 4XX9A 4O81A 2R3MA 2W05A 2RFNA 5CZIA 3KRLA 2ONLC 4ANNA 3MY1A 3UMWA 2E9PA 3LJ2A 1L3RE 2VTIA 5ETCA 3IECA 3AC3A 4FKTA 4D2PA 2X8IA 4D4VA 5AAEA 4MNFA 5AV3A 3NR9A 4EK5A 4IM0A 3RAKA 4G1WA 4I0TA 2W5AA 5HIBA 4FKJA 5IH4A 3RI1A 5KMMA 2GNJA 4RIXB 3V8SA 5AADA 4EQCA 4RWLA 4O7LA 2XM8A 4GG7A 3VO3A 5EYKA 4FKUA 2CMWA 4BDIA 3R0TA 5IA2A 5LMAA 5FTQA 3GENA 3FMKA 3VBTA 3DT1A 4KRCA 4MXXA 3QZFA 5AMNA 3VBYA 1O6KA 4JBQA 5CTPA 4JX3A 3L9NA 2R3JA 4PMSA 5FEEA 3PFQA 4U8ZA 4JAIA 3DOGA 5TO8A 4KA3A 5CI6A 5BVNA 2JC6A 3CCNA 5TR6A 2QLQA 2PZIA 5J5SA 1IG1A 3SD0A 4XV1A 4YBKA 5IDPA 3PY3A 4CFNA 3QA0A 5C9CA 4GMYA 3FEGA 3A7FA 4XG6A 5CANA 4O2ZA 2VUWA 5B2LA 5HVJA 5CEQA 3VJOA 1MRVA 5FD2A 4OAUC 4ZLOA 4BBFA 1ZLTA 2GHGA 3O8UA 2RF9A 3QQUA 1OL7A 3AD6A 3PY0A 4GCJA 4BDBA 3ZXZA 1VJYA 4E1ZA 5AP0A 4ENYA 1GOLA 4RRVA 5J9YA 3Q9XA 5FUTA 1ZRZA 3SKCA 2ZB1A 3R2BA 3TZ7A 4UMRA 2OFVA 3F82A 4XG4A 2A4LA 1M2PA 3S3IA 3Q32A 4Y73A 3MVLA 4S31A 3V8TA 2ERKA 4AT5A 2WMSA 3OBGA 4IADA 5K3YA 2VWXA 2R7IA 4OAVB 4I5MA 1P5EA 5L8JA 1VR2A 3P0MA 2B55A 4W9XA 3UYSA 4DG2E 2R0UA 4CMTA 2PY3A 3WF5A 5AJQA 4X2JA 3ZO1A 4BCHA 3HV6A 3G9NA 3OD6X 4M12A 1ZMVA 2RSVA 4CKRA 3PSCA 4L67A 3PIZA 3THBA 2QO7A 3W8LA 4JQEA 3G0EA 1QMZA 3W2PA 4I6HA 3SLSA 4G6LA 2YN8A 3VF9A 3FSKA 3Q9ZA 3NPCA 1SYKA 3P08A 2PVKA 1H25A 2BHHA 2ZJWA 4G3CA 3BQCA 4RIWA 4ZJIA 4C4JA 2XVDA 4TYJA 1ZARA 3Q3BA 3IPHA 4L3PA 2X2MA 3GBZA 4DG0E 2GQGA 2QNJA 4QPSA 4YR8A 4JBPA 2WZJA 3PE1A 5A14A 4O0WA 3W1FA 5AUWA 5GINE 3E93A 3UIUA 1OGUA 2DQ7X 4HPTE 4QNAA 3RZBA 2V0DA 2A19B 3KN6A 3QX2A 4L68A 2VX0A 4DGOA 2ESMA 2XA4A 5CENA 5BX0A 5KMKA 4RX8A 2C6IA 2HWPA 2JBPA 5TOZA 3V01A 3KXMA 4R8QA 1G8AA 5M09A 3TEIA 4AQCA 3KF4A 2Z60A 3QD3A 3RK7A 3VBWA 1BI8A 4W4VA 2Z8CA 3P78A 5G1XA 3MB6A 4BGHA 4M68A 2C0IA 3BELA 4AUAA 2WQEA 3L9LA 3FKLA 4RX5A 3A60A 3BLHA 4KIKA 5I9ZA 4EOPA 4JJRA 5HG8A 4PDOA 3RAWA 3BWFA 4UBAA 2ITTA 4Y83A 3VW8A 3ULZA 3HAVA 4C3FA 4ZZOA 3C5UA 2HELA 2ZV2A 3SRVA 5CF5A 3CPCA 4NU1A 2W1CA 1QPCA 4AACA 3ZCLA 3MFTA 2PPQA 1CTPE 1E9HA 5CWZA 2YIYA 2R3NA 3MN3A 2B53A 2VTAA 5IA1A 3IW4A 5EOBA 2XNNA 4IEBA 3H3CA 4EWHA 3E8DA 5K4JA 3W2OA 4BCJA 4FTTA 2C6KA 5FM3A 4CSVA 2P4IA 2VX3A 2VWVA 4YTIA 2C1AA 2BAJA 3E7VA 3NNXA 4AFEA 3CQUA 4HZSA 1KE6A 4LUEA 2YM6A 5CEMA 3QZGA 2WNTA 4GH2A 4CYJA 5GZAA 2CCHA 2C6EA 4G6NA 2CGWA 4G6OA 3L8VA 5BNJA 4WNMA 4ZEGA 3GCVA 4I0SA 5K9IA 5EM5A 2VTOA 4O27B 5K0XA 5EKOA 2PVRA 3H0ZA 1XBCA 4A9RA 5DR2A 2JD5A 5JFVA 2R3GA 4JOAA 4I3ZA 4N6YA 4AZEA 3HMNA 3UVPA 3Q53A 4A7CA 3R9DA 3DQXA 2CKEA 1REJA 5F94A 4JRVA 5M07A 5M4CA 1UNLA 5IMEA 3RK9A 2ETKA 4JRNA 1GZ8A 3SOAA 3U4UA 2ONLA 4G34A 4O1PA 3R00A 4ZTRA 2UW4A 5IUGA 5HICA 1YQJA 3Q6UA 3TV6A 1NVQA 4QP8A 5C4LA 3RVGA 3KU2A 1A48A 3ZZWA 5M57A 1W98A 5KNJA 4U9AA 4FYNA 3TZ8A 2W1ZA 3PWDA 3FMMA 5DWRA 2R4BA 3CKXA 3NUNA 3VRZA 4ACCA 1NA7A 3PZHA 3QQFA 2VTJA 3TNQB 1BMKA 4A4OA 4FOBA 1DAYA 3NLBA 4IJ9A 4Y72A 1JWHA 5TF9A 5B2MA 3A7GA 3EQFA 4D2SA 1IAHA 4QMXA 2XMYA 3EB0A 1WBNA 5JGDA 2WTDA 3T3VA 3A7JA 4TZRA 4G3DA 3HMIA 2GNIA 1ND4A 2OIBA 4RC3A 1KUTA 3V6RA 2O5KA 3FMNA 1LP4A 4QP7A 4ZMEA 3PSDA 5IF1A 2VWYA 4ZZMA 1Q97A 3QTIA 2YCFA 1R0PA 3NUSA 3QD2B 5ANOA 3AG9A 4FEWA 3FQSA 5D9HA 3ZEPA 5KHWA 4R3CA 5H2UA 5E8VA 2XIXA 4H3PA 2QODA 5AUZA 4QT1A 2O0UA 3UO5A 3MH2A 3W10A 2F2UA 5JT2A 5JH6A 3IDCA 2F7EE 5LMKA 4PX6A 1PRYA 4UXLA 5DIAA 5HZNA 4EH9A 3MFSA 4F09A 1XH8A 1OB3A 3PWYA 4MXZA 3R8VA 4OTWA 4AN2A 1SVHA 1OI9A 4GSBA 1V0BA 3GT8A 4ZZNA 3NZ0A 3DNEA 2QU6A 2RKUA 3QQLA 3NSZA 4OBOA 4ASEA 3OCTA 4DC2A 1Q41A 3CP9A 3OTUA 4HYHA 1KWPA 2YERA 2C1BA 5K0KA 4M97A 1PKGA 5AP5A 2UVZA 4CTBA 1OBDA 4OLIA 4O0UA 3MBLA 5KKRB 2X6EA 3VAPA 4FEQA 1B38A 5E8YA 2G15A 3DA6A 1OL1A 4MQ1A 4YZDA 4CZTA 3EYGA 4QP1A 3RM7A 2X7FA 1Y6AA 3AT4A 1Q8WA 2YCQA 4O0XA 5IQCA 2JIIA 2I0YA 3A7HA 4BZDA 3RBWA 1F5QA 3R9RA 4NFMA 3D4QA 2QR8A 2ITPA 5DPVA 4R5YA 4DFLA 4FV4A 4WBBB 4ANQA 4BHNA 1UU3A 5IDNA 3OT3A 4Y95A 5L2IA 3IS5A 3PUPA 4GEOA 3PLAE 1OIUA 3DTCA 4FV1A 3MWUA 5DR6A 5IMXA 3EQPA 3FLQA 5TE0A 4BDHA 5BVDA 5AP3A 3DGKA 3KVWA 3EYHA 4EOIA 4IAZA 1UU7A 4RVKA 2QR7A 4Y46A 3AC4A 3GU6A 5CSWA 2BRHA 3LM0A 4OTQA 4RA5A 4B7TA 3PA3A 2VRXA 4QMYA 5H9BA 3ZSGA 3EQRA 2BAQA 4MQ2A 4AWIA 4X0MA 1VYZA 3HEGA 4O7NA 4DG3E 5HO7A 2W1FA 3MA3A 3OUNB 4TYEA 5M55A 4GVAA 1BUHA 2WMXA 3MDYA 1PW2A 5M06A 3LZBA 4ZAUA 5AX3A 1OL2A 3FPMA 2B9HA 4JBVA 4OBQA 3R1QA 3MPTA 4IWQA 2BIKB 4CMUA 3QQKA 4EH2A 2W4OA 3R8MA 3I79A 4DA5A 3N4VA 4X3FB 3VQUA 4ZTNA 5EI2A 4FYOA 4R3PA 3LFNA 5HIDA 2UW0A 2R2PA 3VS6A 3TUBA 4M14A 3RNYA 3V5QA 3NRMA 2BFXA 4OTGA 2WFYA 2E9UA 4U7ZA 4AU8A 3N4UA 1U46A 2QURA 3D5UA 3QQJA 4O0YA 5CSHA 3RHKA 4BL1A 3I5NA 3ZO4A 3O71A 1LEWA 2IZTA 3CC6A 3CE3A 3F5UA 4NH1A 4W4XA 3U8WA 3UNZA 4HYSA 3EQDA 5EK7A 3LLAA 2BTRA 3WOWA 4R7BA 2QKRA 2YJRA 5FXSA 1UV5A 3UOJA 2RG6A 5F4NA 4N0SA 1W84A 1FMOE 3P1AA 3QLFA 3S2PA 3KY2A 5IQIA 2V7OA 4J96A 4HNIA 5BVEA 3Q4CA 5E1SA 4N70A 2PVFA 4BCKA 1XQZA 2O63A 4QNYA 3F5XA 4BIDA 2VN9A 3HRBA 3RPVA 4UX9A 2HOGA 5CF4A 4LM5A 3L8XA 4BDFA 3VS2A 4QQTA 4YPSA 3MYGA 3PLSA 5A4TA 4P4CA 2VWIA 4JG8A 2DUVA 3CD8A 1DM2A 3V5TA 3QTUA 4IIRA 3DKFA 3Q2MA 4ZTSA 3R9OA 3S4QA 3NW6A 3M1SA 3QC9A 1IRKA 2C47A 2W1DA 4EHGA 2WMRA 4KBCA 1PXIA 2UZNA 4FT0A 4BBEA 2XNGA 3VUDA 4LL0A 2ZM4A 3Q5IA 3U51A 4CRSA 4DEBA 2V7AA 2VTPA 4QTCA 3VULA 4AW5A 2ITUA 4FZ6A 2BVAA 2ZV8A 3Q6WA 4G17A 4NJ3A 4WIHA 3KGAA 3ZO3A 3D5WA 3FMEA 1OMWA 1M2RA 3TM0A 4FT3A 3Q4UA 5E8TA 4F7SA 4NL0A 4H39A 2IVTA 3U6JA 2OLCA 3Q4ZA 4TY1A 1FVVA 2FSTX 3AGLA 3GCPA 5M4FA 4EOKA 5BUJA 4I5PA 1STCE 2C5VA 5E90A 3BQRA 4EYMA 1BKXA 2OSCA 4FL1A 4GG5A 4MXYA 4O21A 3AOXA 4YP8A 4TL0A 1XH9A 3EOCA 2PUPA 5CLPA 5FLFA 4UZHA 5BVWA 4KNBA 2VO7A 4U45A 3UE4A 1YI4A 2IWIA 5AAGA 4I93A 3RAHA 3W55A 4NTTA 4ZSAA 2GCDA 2YAAA 3C0IA 3O23A 1PYXA 2EUFB 3ALOA 4FC0A 1PXOA 4HZRA 3R7EA 4BDAA 4D1ZA 4EK4A 4F9CA 3MH3A 4YSJA 2P3GX 1AGWA 4FNXA 4Z3VA 5HLNA 5LQFA 2BALA 4V01A 3OCGA 4TW9A 1ZZLA 4FG7A 3C0HA 4O7VA 4YUQA 2ITOA 2J4ZA 4FKGA 2J5EA 5AP6A 5CAUA 2YZLA 3ACJA 4AGDA 4GW8A 3I4BA 2WU6A 5CVHA 2C69A 2IW6A 4C8BA 4NM3A 3FZTA 1APME 1WVWA 3OROA 2Y4IB 3ZTXA 1OL6A 4FA2A 3OVVA 4RLLA 5AR5A 3T9IA 5HE1A 3ZLXA 3EZRA 5E7RA 4EI4A 1FBNA 4FKRA 4LL5A 4ZY4A 4MF0A 2PVHA 5IEXA 3BEAA 3BPRA 1YKRA 2YA9A 3KK9A 2R3PA 3DB6A 4IMYA 5AM6A 4WG5A 5AR2A 5AP2A 3TNIA 3TT0A 4OTIA 5I5ZA 3E3PA 5JFSA 4AA5A 4EK8A 4QTBA 2HY0A 3L1SA 4QMWA 4RWJA 3PXQA 4Z7HA 2CKOA 4O7ZA 4MWHA 1YOJA 5JFWA 4ZSLA 5ANEA 4K9YA 4X2KA 2IVVA 3WZDA 2PMOX 5KMLA 5EQPA 2QC6A 4C35A 4F0GA 4IFGA 3W18A 4ANOA 5AWMA 4ARKA 3AC1A 5HBEA 4TWNA 5LJJA 5IQFA 3FSFA 3RTPA 4O86A 4I24A 2B4SB 2XNBA 4WRGA 4BTFA 4GIIA 4GYIA 4Q9SA 4B8MA 4YGAA 2GS6A 2X81A 5DMZA 2XNEA 4ZY6A 3LCTA 4IDTA 4NUSA 4IM2A 3HECA 4UV0A 4WD5A 2WTIA 4G3EA 1OIQA 3MY5A 2XNMA 2PZ5A 2NRUA 2WIHA 3FE3A 4FF8A 4FUYA 3DBCA 4Z9LA 3DV3A 5HBJA 3F2RA 3I0OA 4RVLA 1YHWA 3VUHA 5HORA 1JSTA 1SM2A 4E73A 5HVKA 2XK4A 4RIYA 3OW3A 1YOLA 4M8TA 3ZEWA 4DTBA 4DEGA 2XK9A 1OKZA 2WTCA 2I7QA 2ETRA 4FX3A 2OJ9A 1P14A 2VTMA 3C0GA 4QMSA 2XK6A 5AX9A 4LGDA 3UO4A 3ODZX 5DEWA 5J9LA 5EYMA 2RFEA 4O83A 2R3KA 2HWOA 3GC7A 5KKRC 5AAFA 5JQ5A 1J91A 4OW8A 5CAQA 2F2CB 2BMCA 3FKNA 2WPAA 2Z2WA 3GB2A 4R1YA 3AC2A 4HPUE 4HYIA 3DBEA 5I3RA 5AR8A 3R01A 1FINA 4FKQA 4X2NA 4CXAA 1OKYA 3BGZA 4G5JA 5G6VA 4TWPA 4DT8A 3DTWA 4CEGA 3FL4A 3NUUA 3ZC5A 4J53A 4W8DA 5J9ZA 3BYSA 2PZRA 4DGNA 2PWLA 2VO6A 5GIOE 2XF0A 3HYHA 4ZTQA 1OPLA 4XEYA 2OBJA 4L7FA 3T8OA 4L3LA 3R28A 3FLZA 4RC4A 4AP7A 4EORA 3SW7A 4IC8A 3FLWA 3EQCA 5FP5A 5HO6A 5HTBA 4FEXA 3HKOA 2B9FA 5A6OA 3QGWA 4QQJA 1JOWB 4O7WA 2Y6OA 4GFMA 3C13A 4Q5HA 3RNIA 1QPEA 4C4IA 3SXSA 5K4IA 3SAYA 3ANRA 3LMGA 3IOPA 3O0GA 1B6CB 4ALVA 3P7CA 4KIOA 4F99A 4BDEA 4TT7A 4CCUA 4F1OA 2H6DA 3TKUA 4L01A 2PE2A 1V1KA 1H1SA 4CG9A 4YU2A 4U44A 2VTRA 4TRLA 4ITJA 4ACHA 3FYKX 1JAMA 3MIYA 2OU7A 2WTWA 3IOKA 4UXQA 3I6WA 5H8EA 4UMUA 4F70A 5L2SA 4FKVA 4MYGA 4YLJA 4C4FA 3DQWA 4U42A 5A4QA 4RFMA 3BYOA 1KOBA 3NNWA 5I4NA 5KO1A 3V51A 4F08A 4ZXTA 2VTHA 4CZUA 2UZLA 2OICA 3CY2A 4MNEB 1BX6A 4LV8A 3OOMA 3R7OA 3ORNA 3UDBA 5JZJA 1YXSA 1MUOA 4BCQA 3W8QA 5ACBC 4G2FA 3FMJA 4GU9A 2JDRA 2AC3A 2DS1A 2C5YA 3MTFA 3QWKA 2C30A 4CQEA 2WTVA 5IU2A 1Q8TA 4FODA 2IW8A 3DKOA 1ZOEA 3OTVA 2PMNX 4RIXA 4O0SA 3QRJA 3UIXA 4O6LA 1JNKA 1Q99A 2G1TA 2XK3A 4EHVA 3NUAA 3PP1A 3UZRA 4YPDA 3GC0A 3EL8A 4EONA 5JMSA 2QOBA 2ETMA 4IQ6A 4EK6A 4AGUA 2YIQA 3KEXA 3VF8A 3MW1A 4GKHA 5LVPA 3EFJA 1ATPE 3A61A 3BU5A 2WMQA 4FVRA 4UN0C 4NWMA 2HW6A 2FYSA 1W7HA 3BZ3A 5CEIA 5HNIX 2GQSA 4AW2A 2EB2A 4D4YA 3D7ZA 2J5FA 1GZKA 2QI8A 1OPJA 2JFMA 5DVRA 1BL6A 3CJGA 4BI2A 3ODYX 5CAPA 5IQEA 3FZ1A 4J1RA 1FGKA 4FTAA 2AC5A 5BUIA 4FE2A 1ZAOA 2I0HA 2XB7A 4IXPA 4M0ZA 2H8HA 4QPAA 4BGGA 5C4KA 5EW3A 2I0EA 2PUNA 2DWBA 4ZMFA 2CPKE 2UZBA 5EHOA 4IAKA 5HO8A 4Z16A 1H24A 1UNHA 3MH1A 5IUIA 2ZM3A 2HAKA 4PMMA 2RFSA 2JDOA 4H1MA 3PRIA 4C36A 2C6DA 1NXKA 3D2IA 3F5GA 5EHYA 4FTLA 4LMUA 4D9TA 2V62A 1JKSA 4K77A 3VWAA 2JKOA 3OW4A 3ZHPC 1RJBA 3PXKA 2LAVA 5C8NA 2JITA 4UMQA 5FBNC 2CGVA 4FIHA 2WQBA 3E5AA 5BVKA 3TIZA 2F49A 4WT6A 4YHTA 4HW7A 3B2TA 4IAIA 3WZEA 3VNTA 3NW5A 4O2PA 4E3CA 2CSNA 5A4CA 2FB8A 4BICA 2W1HA 2ZVAA 4WG3A 4WBOA 2XJ1A 2XKDA 5IG1A 4QYYA 3OBJA 4EH7A 4PL5A 3OFMA 4X3JA 3H30A 5FWKK 3UC3A 5L6OA 2B52A 4XV9A 4QMQA 2XZSA 2XRWA 4CVAA 3NYXA 4MBIA 4NSTA 3AMYA 4XBRA 3GNIB 3CSVA 1HCKA 2G2FA 3D7TB 5AA8A 3ZM9A 1FOTA 4DAWA 3FLSA 4QMPA 4ZS0A 3ZRLA 3BLQA 4RJ4A 4U6RA 4FV8A 2PUUA 5M4UA 5EM7A 4JR7A 4BKJA 4X3FC 1XH5A 1CDKA 2XS0A 2Y4IC 4FZAB 5CASA 4KS8A 5CU3A 3FXXA 2RFDA 2QCSA 4FTMA 4ALWA 3KRRA 5A9UA 3LFAA 1PMNA 2BDFA 1FMKA 5HHWA 4IB1A 4DFXE 1DI8A 2J0KA 4J95A 1H28A 1Q4LA 2BCJA 3KXNA 2EVAA 4XBUA 4XP2A 3RKBA 2X8EA 2RL5A 3DY7A 3QCXA 4Q2AA 4BCMA 3ORPA 4D0XA 5E9EA 3EL7A 2UZWE 2OWBA 4FG9A 2C0OA 4XMOA 3V04A 4TNBA 4DBNA 5KUPA 2BZJA 3C4WA 4FG8A 2O3PA 2DYLA 3NYNA 3KMWA 3ELJA 3MIAA 3O8PA 4FTKA 3KK8A 3BCEA 3QKMA 3D2KA 3JY0A 2C68A 4I41A 2XCKA 4PPCA 4XV3A 4ALUA 5DH3A 4F6UA 4L44A 2NP8A 1UKIA 2H9VA 4W9WA 3ZLSA 3HZTA 4DH3A 3TCPA 3WIKA 4Z55A 3CJFA 4JDIA 4TYIA 4XG7A 5EYDA 3VBQA 2IZSA 4HCUA 3W33A 4JT3A 1UU9A 2WU7A 1R39A 3QXPA 5AUVA 2YWVA 1FVRA 1UA2A 2OG8A 1K3AA 4DH1A 2OF4A 5JGBA 3A7IA 3AD4A 3FZSA 2VZ6A 3PIYA 3EQHA 3HUCA 4QYHA 4U40A 3G6HA 3LHJA 3MH0A 3PTGA 3PDTA 1HOWA 2CGUA 2W1EA 2RGPA 3FHIA 2CJMA 2OKRA 3CLYA 4I6BA 1ERKA 2IZRA 1H0VA 5HD7A 1YOMA 3QGYA 2R9SA 1ZYDA 3ZSHA 4A9UA 5JQ8A 3NMUF 3UJGA 4O82A 3T9TA 5KCVA 2A27A 3FI2A 3P5KA 1JKKA 3CPBA 4IB5A 3RWQA 3QQGA 1JSVA 4J7BA 5FBOA 4CV8A 4YJTA 3DDPA 1A9UA 4O7RA 4F7LA 1PF8A 4PMPA 1YHSA 5F95A 4LMNA 1F0QA 3PP0A 4RMZA 3N51A 4D2WA 4E26A 4YZBA 4ID7A 1ZYJA 5C03A 4TYGA 1U4DA 4BCPA 4C38A 3DXPA 5CXHA 4XH6A 4CD0A 3FWQA 4U79A 5HTIA 4FV0A 4S2ZA 2WIPA 5F1ZA 5HNGA 4G9RA 2X1NA 3T3UA 4C2VA 1W82A 4FTOA 4YTHA 5HKMA 4EH6A 2REIA 1URWA 4LV5A 3UVRA 1M2QA 4ZOGA 3ZU7A 3P7BA 4ZP5A 4OUCA 4KKEA 3NCZA 1FPUA 4B99A 3UNKA 3V5LA 4DEEA 2HY81 2YDKA 1H26A 4BIEA 2PMIA 4I6FA 3B8RA 3LCKA 3UBDA 2IZUA 2FVDA 1U5QA 5DNRA 4G3GA 4DYMA 3P86A 4BDGA 3IGGA 1MRUA 3D94A 2W4KA 3LQ8A 3PJCA 3R30A 1UU8A 3DPKA 4CQGA 1WBOA 3UG1A 4V0GB 5EHLA 3O51A 1WZYA 5ANIA 3FXZA 4F7NA 3H9OA 4GK4A 4FKLA 4AT3A 3KCFA 5TT7A 5DYJA 2GHMA 4JBOA 2ZMDA 2EXMA 4YJNA 1X8BA 2WO6A 4FNZA 4BC6A 4M84A 1Q24A 5A46A 3EQGA 1R1WA 5CU2A 4D2TA 2C5NA 2BRBA 3GFEA 4IX4A 4GVJA 4X6QC 4TYHB 3UZPA 3FZRA 5AP4A 3TNPC 2ZDTA 3NWWA 5E8WA 1PJKA 3KRJA 3QF9A 3JS2A 3O17A 2ITXA 3K3IA 3KA0A 4IX3A 4IWOA 5CVFA 3ZUTA 1OBGA 1XH7A 2PZYA 1M7NA 3DXNA 2R5TA 4FL2A 5EW9A 3PXZA 1QPDA 2YACA 2YWPA 4IB3A 4YJOA 5AFVA 5EM6A 4FV9A 2P2IA 2HENA 3BE2A 3FPQA 4G9CA 4LGGA 3C1XA 2VTTA 1YHVA 4EOSA 3H4JA 3QQHA 1CKJA 2J0JA 1XH4A 4O0RA 4QTDA 3W2RA 3I7CA 3WI6A 2J9MA 3NYOA 3OXIA 4NM5A 1I09A 1SMHA 5E1EA 3LMIA 2OJIA 1JKTA 4QD6A 3ANQA 3F3VA 3C4XA 4MD8E 4V05A 3R7UA 2XK7A 1RW8A 1XKKA 3VS0A 1PXPA 4QMVA 3WF7A 4APCA 3FBVA 4CMOA 4CKJA 5KMNA 3JVRA 5HU3A 4XV2A 3DAEA 4YZMA 5BMMA 3NUXA 3VUGA 3BBWA 2PVNA 2VD5A 1LPUA 3IO7A 4O7SA 2EXEA 2GTNA 3QA8A 2OK1A 5AEPA 4HGEA 1OECA 3I5ZA 3ROCA 4A9TA 3CKWA 4C57A 4Y85A 1CM8A 5GJFA 4BZNA 3BIZA 3R02A 4R78A 3HA6A 3A2CA 3NIZA 2QOLA 3VS3A 4TPTA 4BWKA 2OIQA 3HDNA 2C6LA 1WCCA 3O2MA 3SGCA 4GYGA 3HMOA 2YCSA 4MD9E 3ENHA 3V5JA 3OEFX 1YVJA 4A06A 3KMMA 2BKKA 4KAOA 3Q60A 4E5BA 3DJ6A 4FEVA 3CBLA 4E4XA 3LFEA 4N4SA 5LVNA 4GK2A 4XCUA 3R73A 2Y4PA 2XKEA 3R7VA 5CXZA 3QXOA 3F5PA 4H3QA 3VN9A 5ANDA 4ANBA 2VWWA 2YM3A 4ANLA 2QOQA 1OIYA 3FY0A 3QAME 4RX7A 2UZOA 3DKGA 4ASDA 2PUIA 4DFUA 3IW6A 3IDPA 2GS7A 4KIQA 4EKKA 2OZOA 4MTAA 4QPMA 2Z02A 4RLKA 3TZMA 2XBAA 4KS7A 5C27A 3ZUVA 3QTWA 4EOJA 4CTCA 4EYJA 3E62A 2OH4A 3PXRA 3K5UA 2Z7RA 5M08A 2Y9QA 4YHFA 3EKNA 1E1XA 4FIEA 2UZTA 4U5JA 4AGCA 4IE9A 5LARA 5DRDA 2FSOX 2Q0NA 3LXKA 4WG4A 3R8PA 3HMPA 3PRFA 4C37A 1MQBA 1SNXA 2XJ0A 4A07A 2X4FA 3QCYA 1H8FA 4JIKA 5FXQA 2BDWA 4XP0A 2H34A 2GHLA 4FT7A 5IA0A 1F3MC 4UALA 1YDTE 4QTEA 4G3FA 4YBJA 2F7ZE 3PY1A 3NNVA 4FSRA 2X39A 4Y8DA 3PJ2A 3R1NA 5JEBA 4OTHA 3UNJA 5LMBA 3HX4A 2C5OA 1YXTA 5CY3A 4O1OA 2W5HA 3HL7A 3HV4A 3LW0A 3FQEA 3TUCA 3PJ8A 5HOAA 4EUUA 3SX9A 2GPHA 2VAGA 1LUFA 4DF3A 2PVYA 3AQVA 4I1ZA 4EEVA 5LOHA 2CGXA 5DI1A 2RIOA 3TDVA 3AC8A 3OZ6A 1P4OA 1OUYA 1QCFA 3GC8A 2BTSA 4CNHA 1YW2A 5J8IA 3R9NA 4ENXA 2YAKA 1PY5A 4DHFA 3S0OA 4PV0A 3VS5A 3G6GA 4FSZA 2C3KA 3JUHA 4FTJA 3MY0A 4L42A 3VS1A 4E6AA 2BILB 2SRCA 4JX7A 5L6PA 2UZEA 3DJ7A 2X2KA 3QD4A 4RWKA 4UWYA 4JAJA 3Q9WA 4QOXA 3TN8A 4EWQA 4Q9ZA 1A06A 3U4WA 4G16A 2OJGA 3F66A 4K0YA 4EL9A 2R3QA 4BZOA 3A8WA 4IAYA 4PL4A 1H1RA 4MXOA 3RMFA 5C26A 3SC1A 4OTFA 3K5VA 4S30A 3UIMA 3H0YA 1W0XC 3RPYA 4YJUA 5CT0A 4FZ7A 4AZSA 2BRMA 4DE4A 1OITA 3BV2A 2Y7JA 4ZTLA 3GCQA 3E7OA 3MSSA 4HVSA 3W2QA 4EKLA 3OEZA 3F3TA 4J8MA 3TWJA 1RDQE 5GJGA 5KX8A 3AT3A 3MESA 4CT2A 5CF6A 3LCSA 4E93A 5E8ZA 3HRFA 2C0TA 2WB8A 4IDVA 4LOOA 2B54A 4C4EA 4RQKA 3DK3A 3DDQA 4PP9A 3COKA 3RJCA 2JBOA 1GZOA 1XR1A 3UTOA 3JY9A 4C62A 5J7HA 3KXGA 4TNDA 3CS9A 4P7EA 3UG2A 2V22A 3OXTA 2WEVA 5E91A 1O6LA 2QU5A 4CFMA 3REPA 5JSMA 3U6IA 2W06A 3NGAA 2YM7A 3F2NA 2R3OA 3DCVA 2VX1A 2BKZA 1V0PA 2OIDA 4NJDA 4USDA 5B2KA 3NAXA 4EZ7A 1NVSA 4KIPA 3EHAA 3UYTA 4D28A 3NVMB 2JDTA 3BKBA 3GOKA 4HGLA 3DBDA 3DAJA 1E1VA 3AT2A 1WAKA 5KZIA 4D5KA 3HDMA 3ZSIA 5LMKC 5GNKA 4PF4A 4FKSA 1PXKA 2PE1A 2XP2A 4I6QA 4YNOA 3SW4A 5AUUA 1RE8A 3NUYA 4M3QA 4E4LA 3COMA 2UZUE 1CMKE 5EYCA 5CSVA 3EKKA 4FI1A 5CAVA 4FV6A 2UZVA 3BYVA 2YISA 5D7VA 4L9IA 1YDSE 3HP5A 4C61A 4BCOA 2EB3A 2UW8A 1H27A 1PXMA 5L2TA 4AXAA 2PL0A 3GFWA 3U54A 4DFBA 1PMUA 1PXLA 2GNFA 4NCTC 3E88A 2Q83A 3A99A 4IFCA 4I94A 1ZY4A 2UV2A 3RWPA 2X6DA 3TDWA 1ZWSA 3ORXA 4C0TA 3VVHA 3OOGA 4JDJA 2ZV9A 3LE6A 4Q5EA 3FAAA 2FSMX 4GKIA 3ATSA 1ZOGA 5FEDA 4HVHA 2YM8A 1XHAA 3IW5A 4OT5A 4YHJA 4AOTA 3BI6A 3QTRA 3E8EA 3GGFA 4MD7E 4UWBA 4E20A 3MPAA 2BPMA 4AA0A 2WQMA 4TTHB 4XS2A 2WEIA 4R77A 3G51A 3KKVA 3N9XA 4KD1A 3KN5A 2E2BA 4NK9A 5C1QB 3U55A 4U80A 2CCIA 3II5A 3U9NA 2VGPA 3E8CA 3WF6A 3JXWA 4O96A 3PPJA 4ANMA 3LFQA 4NM7A 5IPJA 4F9YA 3PPKA 2ITWA 3V8WA 4C34A 3ACKA 3OT8A 4E4MA 2YEXA 3QFVA 3VHEA 4PL3A 3ZM4A 5I9UA 5CU0A 3GCUA 2QQ7A 5HE3A 1Q8ZA 4ASZA 4DGGA 2JAMA 3SQQA 3W2SA 4NCTA 3WZUA 4XLIA 2YITA 3ZH8A 4FL3A 4CT1A 4EBVA 3WF9A 1SNUA 3IW7A 3DBFA 4GL9A 2O65A 1IEPA 2VTQA 2ERZE 3LQ5A 2X8DA 2J90A 4IW0A 4PNIA 4Y5HA 3MVMA 1PKDA 5HCYA 3BGQA 2HW7A 4CZYB 4PRJA 3UO6A 3GU4A 4W4YA 2O64A 3C7QA 3P79A 3Q4TA 3ZXTA 2BFYA 3ERKA 3IG7A 1JSUA 2YIWA 5HBHA 3R7IA 4BVUA 3UQGA 5CNNA 4HVIA 3MVJA 4RJ8A 4L53A 1G8SA 1GIIA 3MVHA 2CKQA 4H3BA 2QHMA 5D41A 2X7OA 4JG7A 4GUBA 3OG7A 3BLRA 5AIRA 4BRXA 4YMJA 5LCKA 4L43A 4EJ7A 5DLSA 2YLFA 3WZJA 1ZMWA 4PTCA 3VS4A 5H8GA 3SDJA 3O8TA 3GC9A 3CQEA 4DH5A 3LFSA 3OY3A 4I5CA 3FI8A 2WTKC
chains in the Genus database with same CATH superfamily
5CF8A 4KBKA 2PMLX 3LFDA 2B0QA 3E8NA 1L8TA 1Q62A 3POZA 4GV1A 4X21A 4XG9A 2C5XA 4PDYA 2C3LA 2FA2A 2JGZA 4GT5A 4XOZA 3W2CA 4WNOA 2GTMA 4P2KA 3PFYA 1H01A 2J0IA 3QHRA 1I44A 3DAKA 4ACDA 3G0FA 2BZKB 1Q3WA 2FO0A 4U43A 4RBLA 1KV1A 4PQNA 3KXZA 4A9SA 1K2PA 4MWIA 5LWNA 3EN7A 3CTJA 4LGHA 4ZSJA 3RGFA 4S34A 3LKMA 4F0FA 3FI4A 2A1AB 3LXNA 4FMQA 4FSYA 4K2RA 4YLKA 4BCNA 4D0WA 1MQ4A 2Q0BA 5AR3A 4FGRA 4QEBA 2XYNA 5CEPA 2EXCX 2Y8OA 4E5AX 4F6WA 5E8UA 3EQBA 4GUEA 3DLSA 3O7LD 4C3RA 3Q52A 4KWPA 4E8AA 3UZTA 1WMKA 3ZBFA 4W4WA 4FTNA 4KKGA 3F6XA 2PVLA 4N57A 4F4PA 4M69A 1H4LA 3DK7A 4XOYA 5IA5A 4QQCA 2YDJA 3ML1A 2BAKA 2X4ZA 4AAAA 5CT7A 3OF0A 4XYFA 5J79A 4WO5A 4N6ZA 4FSUA 3QRKA 3WE8A 2WMVA 1K9AA 2PHKA 4FNYA 5EW8A 3S00A 3DU8A 4O0VA 4DEAA 3DKCA 4LQMA 5JRQA 5KMJA 5IQAA 4AOIA 5AR4A 5M51A 4MK0A 2XYUA 5K5NA 3MPMA 4LI5A 3NW7A 4GFGA 2PU8A 5EDQA 3WBLA 4AXEA 4BI0A 2QONA 2CHLA 4GU6A 1ST0A 4D4RA 5D1JA 4YJRA 2C3JA 3ORIA 3ULIA 4LRMA 3V5WA 3VBVA 5HIEA 4U3YA 2OXXA 5BVFA 2C6OA 4RFZA 3W0NA 3EWHA 3N4TA 2R3HA 3UODA 4AFJA 4FZDB 2W0JA 4TKSA 5CEOA 2X0PA 3OWJA 4MX9A 2AYPA 4MXAA 4XUFA 2ZOQA 4D5HA 3P5JC 2I40A 4M13A 3TV4A 3D5XA 5M53A 2IG7A 4HJOA 2GNHA 4G5PA 4TXCA 1Q5KA 3I1AA 3JPVA 3PJ1A 4YC8A 2VTLA 4CG8A 5CI7A 2YLEA 3BYUA 4IBMA 1ZYLA 2PZPA 3QD0A 4OGRA 4CGAA 4IX5A 3F69A 1GIHA 4FKPA 4NT4A 1XBAA 4QP3A 5KBRA 4CFXA 3BRBA 4D2RA 3V3VA 2VTNA 4NM0A 4DEIA 1WBWA 2J2IB 3VHKA 2P2HA 4JNWA 3IW8A 4L3JA 5AP7A 4B9DA 5HG5A 1YDRE 3L9PA 3PG3A 4JS8A 2VO3A 3UVQA 1OPKA 4BF2A 1OVEA 4NZWB 4IZ7A 4CYIA 4FTUA 4WUNA 3MJ1A 1NY3A 2QKWB 5J1VA 3QL8A 1U5RA 4I4FA 4BY9E 4BIBA 4LYNA 2FSLX 4XRJA 5FDXA 5A54A 4U0IA 2IVSA 1BLXA 1KOAA 2OF2A 2PE0A 2VU3A 3I0QA 1AQ1A 2P0CA 4UYNA 4II5A 4AGWA 4HNFA 5HEZA 3GXLA 4BDKA 3H9RA 1T46A 3BU3A 2UW3A 4IAFA 3KFAA 4BDCA 3QRIA 2QOCA 5EI8A 5JKGA 2WHBA 4C2WA 5M56A 4JLCA 5AM7A 5EQYA 2G9XA 5H8BA 2JAVA 3IQ7A 4BJJA 3S95A 4O7TA 3VBXA 3VRYA 5AIKA 3LCOA 3SA0A 4K18A 4XJ0A 4QMUA 3UIBA 3G2FA 3QRTA 3CY3A 3HRCA 4EHZA 3TJCA 1GJOA 4NKAA 4ZIMA 3FV8A 4FNWA 4BWPA 4PTEA 2BZIB 2JIUA 3AMAA 4RJ5A 4P90A 3FMDA 2ITNA 4QQ5A 3PVGA 1R3CA 4YJPA 4F64A 2XAMA 4YTCA 3KRXA 4FK3A 4B0GA 3HUBA 3FMLA 2FH9A 2FUMA 4I21A 1SVEA 3EFKA 4DEHA 1Z57A 4QMLA 3QCQA 4IVBA 5T68A 4RJ7A 4QRCA 4C59A 2YJSA 4ZJVA 2R3FA 2J0LA 3QALE 3RINA 1J3HA 2ACXA 1Y57A 4XNEA 5L6WL 3QWJA 2V5QA 1OIRA 3WYXA 2GFSA 5L3AA 3SXFA 2C3IB 5D7AA 2G2IA 2WMAA 4E4NA 4AF3A 4ZJJA 5BUEA 4EZ3A 1YWNA 4ZLZA 3FLNC 1ZXEA 5F20A 3ORMA 5EDRA 5DN3A 2ZYBA 4LG4A 1M52A 3R71A 2W99B 3KXHA 3ZYAA 5I9VA 4JL9A 1T45A 3OCSA 1H08A 4D9UA 5T3QA 3E63A 1PXJA 1SVGA 2XIKA 1KE7A 4FSMA 4TN6A 5IEVA 4PMTA 3TL8A 4I23A 4XG3A 1UNGA 1ZMUA 5CU6A 2IN6A 3CR0A 2YM5A 3D5VA 4IC7A 3IGOA 3JVSA 5FTGA 3C4CA 4M69B 2PYWA 4IVAA 1J7LA 1CSNA 2W17A 4BTJA 2HZNA 4YZ9A 5BV3A 2W1IA 3CGFA 2V55A 4IACA 4EC8A 5I3OA 4U81A 4IZYA 4XRLA 1TFFA 4JG6A 5CAOA 4PUZA 2GSFA 4C3PA 3LFCA 3O50A 1YRPA 3V6SA 4DTAA 5KMOA 1H1WA 4FSWA 3PIXA 4FOCA 5EDPA 5HTCA 4PWNA 3C50A 5EQEA 1YI6A 5GZ8A 2I0VA 3F2AA 4IZ5A 4EC9A 2QOIA 3DFAA 2F7XE 2ITQA 2WTKB 4WUAA 4J97A 3U9CA 4AE9A 4AX8A 5LWMA 5J87A 1Q8UA 3R1YA 3DFCB 1R0EA 2YIXA 2XRUA 5IZFA 3A62A 2WGJA 3KB7A 4M0YA 5BYYA 5IA3A 3NYVA 4RA4A 4IM3A 3QU0A 4B8LA 4BGQA 3WILA 2OZAA 4RX9A 4FUXA 3VUKA 4QMNA 5JFXA 1Z9XA 3LM5A 5D11A 3I60A 2OH0E 1G5SA 2HXQA 5GHVA 3LJ1A 4RGJA 3SVVA 5FGKA 4A4LA 2B1PA 2JEDA 4DCEA 2QO2A 2UW7A 4QP6A 4WRSA 1M14A 5LVLA 4DFNA 2HZIA 4F9AA 4E6QA 5ICPA 2GQRA 3DK6A 1AD5A 4P5QA 4D55A 4RVMA 1SZMA 3GU8A 3POOA 4DEDA 3IKAA 4AT4A 5FEQA 5LVOA 4YJQA 2X9FA 1J1BA 2XIZA 2J50A 4JDHA 5CNOA 1Q61A 2FGIA 3SOCA 4DN5A 3MTLA 2F57A 1KE9A 3PXYA 4RSSA 4GRBA 3ZC6A 4MBLA 1XBBA 3BHVA 4AN9A 3FLYA 2R3RA 3U6HA 4BCGA 1YWRA 2Y0AA 3F7ZA 4IANA 4KSQA 5GZ9A 3TKIA 3ENMA 3AGMA 4UEUA 1GIJA 2YZAA 4C4HA 4FZFB 3DJ5A 2PK9A 2XKCA 3LPBA 4HVDA 3ZS5A 4UWCA 4WNPA 4L52A 1VZOA 3MS9A 5AR7A 5DT4A 4PPAA 5GJDA 2X0QA 2NNWB 2HYYA 3Q04A 2XCHA 2G01A 1PMEA 2UW6A 4RIOA 3HVCA 4MVFA 4YJSA 3FI3A 5EFQA 3ZONA 1BI7A 3PVBA 3EJ1A 5HLWA 5HCZA 3UOLA 3QLGA 3VQHA 2WELA 3GU7A 5FRIA 4ZY5A 5KZ0A 4YO4A 3PXFA 3E3BX 4L46A 2KULA 4OR5A 4MAOA 1NVRA 1BYGA 3UOHA 1DS5A 3D14A 4FSTA 4LFIA 5HE2A 1OM1A 3TI1A 5FM2A 4AG8A 4L8MA 4M7IA 2GU8A 3A4PA 3RAIA 3RZFA 2PVMA 3M11A 4E7WA 4F1MA 3BHHA 4WA9A 2O8YA 3COIA 2GNLA 3WE4A 4DGLC 5EKNA 3FKOA 4B6LA 3MGYA 4G31A 2CLQA 2WQNA 1OKVA 4NW6A 2BHEA 5A6NA 1J1CA 4YC6A 2OFUA 4DINA 5CQUA 2ZV7A 3OWKA 4HCVA 4WKQA 1TVOA 3QKKA 5AV1A 4X3FA 3BHTA 4ERWA 5FTOA 5IQDA 4JQ7A 3K54A 4X7QA 3MFUA 2GS2A 5BYZA 4V0GA 2OZAB 5IQBA 4NKSA 1OL5A 4DH7A 5BVOA 5CSPA 3Q2JA 4MEDA 4JXFA 4U97A 3HAMA 2XKFA 4J8NA 5J5TA 3O5AA 5CVGA 5AV0A 3R83A 2VWZA 3G33A 2QOHA 3BBTB 3S1HA 1JQHA 3TUDA 2XUUA 4XHKB 4TWOA 3PA5A 4AW0A 4ZSEA 4UMPA 4E6CA 3HGKA 4Z7GA 2VNWA 5FP6A 3FHRA 3OHTA 2QD9A 3ITZA 4PDSA 4GT4A 4TYHA 1Y6BA 2BRNA 3FQHA 3TXOA 2GMXA 3EN9A 4FTRA 3UMXA 2QG7A 4WSQA 4L7SA 5CSXA 5E8XA 4LOQA 3FZOA 3HNGA 4HGTA 3F88A 3LCDA 4QMMA 3I6UA 2HCKA 1ZYCA 5DG5A 2JIVA 2Z7LA 4DHIB 3W0MA 3GQLA 1XO2B 2OJJA 2VTSA 4JQ8A 4MBJA 5HG9A 5A4EA 2BROA 4AZTA 4YJVA 4O38A 3TJDA 4CFVA 4D1SA 1MP8A 5E92A 3SXRA 1W8CA 2I1MA 5DT3A 4O84A 1QPJA 2W1GA 3I81A 3ORKA 3NX8A 3LLTA 2RG5A 4X2GA 5DFPA 3ETAA 4DGMA 5ETFA 5JK3A 3UDSA 3TIYA 5LCJA 3RPSA 4QMZA 4BKYA 4R7HA 5BYLA 1PMVA 4GIHA 3RM6A 4YSMA 1YXXA 4DFZE 3MA6A 2PTKA 2Z7SA 4GT3A 5J95A 3SRVB 5JRSA 5CS6A 4I22A 3SG9A 2BR1A 3ORTA 1H0WA 5A3XA 5I0BA 5KHXA 2WTJA 4S32A 3TKHA 3EFWA 2XJ2A 3F3ZA 3Q5ZA 2YDIA 2IW9A 4FKIA 2B7AA 1GZNA 5HE0A 3UP2A 3FMHA 3SV0A 1Y91A 2YHVA 3UGCA 1U59A 4F65A 5KBQA 2J6MA 4PTGA 3RALA 4DLJA 3W0OA 4IVDA 3UPXA 3G9LX 3KQ7A 5L8LA 4QYGA 4QMOA 4I0RA 4ONAA 3AC5A 2B9IA 4EQMA 4FV2A 5DT0A 4H36A 3QC4A 2PSQA 3QYWA 4PP7A 5C8KA 4O7YA 2VV9A 4PY1A 2BDJA 3B2WA 4ACGA 3Q96A 4ANSA 1GAGA 5HNBA 4D4SA 2NYAA 3D15A 1W83A 2X2LA 4DLIA 5HLPA 4KSPA 5M4IA 4FEUA 3PG1A 3OUKA 4UB7A 3HLLA 3G90X 1P2AA 2J0MB 5K5XA 5H3QA 1IA8A 2OI4X 3BE9A 3KXXA 4K1BA 3BL9A 3KF7A 5EOLA 4JI9A 3M2WA 5ETIA 3AMBA 4AS0A 3NVKI 2JLDA 5DEYA 3VONA 3GU5A 3R6XA 2B9JA 4H58A 4ACMA 4PNKA 5EI6A 1TQPA 4ZSGA 3WYYA 1WBTA 4OTPA 1U54A 2VNYA 5EM8A 2OJFE 3FJQE 5HX8A 3FXWA 4FV5A 4NIFB 3R2YA 4F6SA 5DHJA 1H00A 1P4FA 3R8UA 3KL8A 3RPOA 2AUHA 3ZLWA 2XNPA 4H1JA 4BBMA 3L8PA 4FSQA 3P9JA 3D9VA 5TKDA 4E6DA 3L8SA 5AUXA 2QO9A 4CFWA 3ZRMA 4FVPA 4QP9A 4YTFA 4ZTMA 2R0IA 4O4DA 5I9XA 5IKWA 3ZRKA 2XEYA 4D58A 3TNHA 3KMUA 2QVSE 4FIFA 3BV3A 4AE6A 4DBXA 3DZOA 2ZM1A 2WMUA 3AXWA 1LR4A 2OGVA 3VJNA 3KRWA 4DCAA 2ITVA 2QHNA 4QMTA 3NUPA 4CFUA 1CKPA 2CNVA 4IAAA 5HCXA 2GNGA 3VUMA 1JLUE 1XWSA 4D2VA 5FDPA 4F1TA 1ZOHA 4ZLYA 3VIDA 3KULB 3VUTA 3FUPA 4BTMA 4CV9A 1XMLA 3W0PA 1MRYA 3ID6C 2QOKA 4J71A 1UWHA 3RCDA 5L2WA 4RWIA 2WOTA 4AW1A 3FZPA 3PUFC 4HVGA 3C9WA 2KTYA 4C33A 3OWPA 4ITIA 1ZZ2A 3CIKA 4PPBA 4CRLA 4E5WA 3PVUA 4FKOA 4FR4A 4EH8A 4KUJA 3R22A 5HI2A 4O0TA 2LGCA 3VW6A 3ZLYA 1M7QA 4L00A 4XLVA 5AV4A 2HZ4A 3W16A 2J51A 3UP7A 1LEZA 1URCA 3EN4A 2XK8A 4M15A 4AZFA 3MI9A 1CKIA 3CD3A 1TQIA 4IB0A 2E9OA 3PSBA 3ZFMA 3GCSA 4FBXA 4YZCA 1WBPA 2QG5A 3KULA 4NW5A 1S9JA 3MV5A 5E4HA 4UYAA 4NFNA 4R6VA 4A9YA 3IDBA 4BVUA 5IH6A 3QKLA 3H9FA 3ET7A 1H1QA 4K8AA 5AV2A 4FV3A 4YC3A 2VWBA 3BX5A 2UUEA 4IH8A 1DAWA 4U3ZA 2CLXA 3DB8A 2I6LA 4KKHA 5D12A 2CDZA 3COHA 3WZKA 4F7JA 5I9YA 2A98A 1WFCA 2UVXA 2WXVA 3FC1X 1YXUA 4DT9A 2WOUA 4NIFA 4AA4A 2VWUA 2X7GA 3LXPA 4MF1A 4FTIA 3LAUA 4YNEA 4IX6A 4LV7A 2BUJA 4DFYA 2XIRA 5KMIA 3L9MA 2CNUA 3K2LA 3F9NA 3EQIA 3CXWA 5E8SA 3I7BA 4OBPA 1V0OA 4EOLA 4EHEA 3EIDA 3CGOA 3ORZA 3OWLA 3KC3A 3NS9A 3KVXA 3WARA 4EOMA 2W4JA 5HG7A 4CLIA 4DH8A 1KE8A 2EU9A 2ITZA 2E9VA 3QHWA 2F4JA 4XG2A 2PULA 5HD4A 1Q8YA 1GNGA 4LOPA 5LVMA 2QOFA 4DITA 1TQMA 2WMBA 3HV5A 4I20A 5FQDC 4YURA 3CTQA 4AZWA 4H05A 1R78A 3JR1A 5JGAA 3QYZA 4RG0A 3BHYA 1H1PA 3PZEA 2WD1A 4J98A 4WOVA 3PA4A 4K11A 3UPZA 2YIRA 3F7WA 3QUPA 5J1WA 3O7LB 3P4KA 1VLRA 2QLUA 1B39A 2IJMA 3RCJA 4F78A 1QL6A 3TG1A 4K33A 1WVYA 4RZVA 3U87A 4JDKA 3G15A 1DI9A 3R04A 3E87A 4M67A 4BYJA 5I9WA 2XALA 4V04A 2HK5A 3RP9A 4ERKA 4CLJA 4UZDA 2HXLA 4M66A 5CU4A 4RIWB 2OW3A 4FVQA 3E92A 3R1SA 1Q3DA 4CKIA 2WQOA 2CN5A 3GQIA 4BHZA 4MH7A 4L6QA 1ZYSA 4MNEA 5KE0A 1WBSA 3OY1A 1YI3A 5IUHA 2W9ZB 3OMVA 4RZWA 5IEYA 4B4LA 1ZY5A 3NEWA 3V5PA 2BZHB 3K3JA 3UC4A 2XAOA 3KREA 3FL5A 5CYIA 1UKHA 3PYYA 2OXYA 3RHXA 4USFA 3BL7A 3SG8A 3AD5A 4I4EA 2Z7QA 1PYEA 3RPRA 3A8XA 4BTKA 3DLZA 4WNKA 3MB7A 4K6ZA 2JKQA 5ETAA 3FC2A 5AUYA 2J7TA 2OXDA 3HV7A 4XP3A 4C02A 1FVTA 2IO6A 5JZNA 1VEBA 1YXVA 2IVUA 2UVYA 4HYUA 4BI1A 4EH5A 1BL7A 3W32A 4GJ2A 3GP0A 1O9UA 5ANGA 4FIGA 4EOQA 2YFXA 1JPAA 3TNWA 3ZDUA 4FGBA 3LFBA 3O96A 1FQ1B 3H10A 4QO9A 4RIYB 2QOOA 2ZDUA 5T6KA 4QYEA 2P55A 1M17A 4R5SA 5IQGA 4AZVA 4BKZA 3BWJA 5J7BA 1J7IA 3OS3A 3QUDA 5HVYA 4QDEA 1PXNA 1KE5A 4AOJA 5BPYA 3P23A 2A0CX 3QTZA 4FTCA 4IJPA 1PHKA 3P7AA 4IWDA 1OZ1A 4RJ6A 5AA9A 5AUTA 3RK5A 3HMMA 4U41A 2UW9A 4OTRA 4FKWA 3DS6A 4JVGA 1NW1A 5AP1A 1IA9A 3MFRA 3ROYA 4EQUA 4X2FA 3QZHA 3CQWA 3TACA 2BRGA 4BDJA 2F9GA 2E9NA 1G3NA 5C8MA 2BIYA 3MJ2A 3HA8A 4HGSA 5CZHA 3ZMMA 4C7TA 3PJ3A 3VS7A 3F3WA 4FV7A 4BFMA 4TWCA 1J7UA 4X6RA 4F63A 4USEA 4BCFA 4EZ5A 1IAJA 4ORKA 3QRUA 3ZUUA 2WKMA 3EFLA 5DA3A 4F9WA 4R1VA 5IH5A 5GIPE 5L4QA 4YO6A 2P33A 3BYMA 4NEUA 4QYFA 4RC2A 5HX6A 3R9HA 2G2HA 3VUIA 4Y5QA 4BCIA 4RPVA 4EK3A 2IPXA 4KINA 4EUTA 4FK6A 1GY3A 1XH6A 5C01A 1NT2A 3NCGA 3E64A 2CKPA 1WBVA 4C58A 3GVUA 4APPA 2AQXA 3UQFA 2A2AA 3PVWA 3QTXA 1ST4A 4IZAA 5CEKA 1H07A 3PE2A 5DR9A 2X0GA 3D83A 5HESA 3DZQA 3TZ9A 3ZO2A 4EH3A 4NYEA 3C5IA 2O2UA 2W5BA 2XNOA 3QCSA 2JKMA 4YZNA 3NNUA 5L2QA 4WSYA 4IVCA 2UW5A 5FG8A 3ZDIA 2NPQA 2XIYA 4J52A 4O22A 5DBXA 5ANKA 4FICA 3HP2A 3CEKA 4GJ3A 2Y6MA 3D0EA 3EZVA 3LIJA 1KSWA 3NIEA 4YLLA 3TTIA 3ZZEA 2OO8X 2XH5A 3OP5A 4ZTHA 1FGIA 3ZOSA 4BWXA 5LXMA 4FJVA 4L45A 4D1XA 2H96A 3NAYA 4OT6A 3R8ZA 3EN5A 5BMSA 4RQVA 3A4OX 5FXRA 3R21A 2JDVA 3CTHA 3F3UA 2R3IA 3PPZA 3ATTA 3LQ3A 1TKIA 3SHEA 4EOOA 2XM9A 4ITHA 1YWVA 2JKKA 5DGZA 3G5DA 1Y8YA 3VC4A 4W8EA 2C6MA 2JDSA 4P5ZA 4ZS4A 3BEGA 3GI3A 4O6EA 1IASA 5DRBA 4CCBA 3IK3A 3ZFXA 1REKA 1G8KA 3EN6A 3LOKA 3R7GA 1OKWA 4KIKB 4AN3A 5IISA 1HCLA 3ZFYA 5ITAA 4FSNA 3LFFA 3B8QA 4GK3A 3QZIA 1JKLA 3HV3A 2YABA 2NO3A 4IWPA 4UMTA 2GFCA 3FY2A 3EMGA 5CALA 4DTKA 4F0IA 3WIGA 4BN1A 4MKCA 2PVJA 2WMTA 2X9EA 3C4FA 4HOKA 5DE2A 2R3LA 4EJNA 3C51A 3QTQA 5B0XA 3ORLA 3JYAA 1Z5MA 3LXLA 2ZB0A 2JFLA 3DBQA 1OUKA 5L8KA 4EBWA 1S9IA 1UWJA 4XG8A 5HQ0A 4LRKA 3R8LA 2R7BA 4J99A 4BYIA 4MUQA 3EH9A 2YM4A 4WHZA 4QP2A 3LJ0A 3R63A 3OCBA 4HCTA 2YCRA 4JIAA 4CFFA 5M44A 3NDMA 4LUDA 3OXZA 4FIJA 5B7VA 5BQ0A 3QTSA 2CN8A 4R3RA 2ZAZA 5EG3A 4QTAA 4FT5A 3QBNA 1U54B 3GEQA 2C4GA 2W96B 3GOPA 5CX9A 5IQHA 3QX4A 3WF8A 4LRJA 4BJJB 3ALNA 1Y8GA 3KCKA 4BR3A 3R7YA 4RFYA 2VGOA 3M42A 2NRYA 2WMWA 2XBJA 5D10A 3TV7A 3Q9YA 5HGIA 4FIIA 4BB4A 4ZK5A 4I5HA 2EWAA 2WAJA 3LVPA 4R7IA 5HU9A 2W9FB 1UVRA 1EH4A 4FT9A 4PDPA 3TTJA 4BDDA 5IA4A 4OTDA 5A4LA 4GS6A 3LMHA 2UZDA 1VYWA 5CQWA 5ACKA 2ZMCA 4F9BA 4O91A 2GDOA 4EH4A 2C6TA 1RQQA 3BHUA 1O6YA 2VO0A 3ZBXA 4KBAA 4QP4A 4RVTA 2HZ0A 4KB8A 3C4ZA 1WVXA 3DNDA 4C4GA 3UOKA 4MCVA 1JVPP 3BU6A 3D7TA 3IONA 1KV2A 3FYJX 3OC1A 4JR3A 4FRFA 4KRDA 4I92A 3DXQA 4RT7A 4NTSA 4ASXA 3UQCA 5DOSA 2W7XA 4GFOA 2R64A 2XEZA 4MHAA 3FDNA 1JBPE 5F9EA 3C4EA 3BGPA 3QUEA 4KABA 2CNQA 5ANJA 4UY9A 4RJ3A 3F61A 4A4XA 1XJDA 4FTQA 3GUBA 5EH0A 2HIWA 4IHPA 5JN2A 2ITYA 4S33A 1IR3A 4MXCA 4XX9A 4O81A 2R3MA 2W05A 2RFNA 5CZIA 3KRLA 2ONLC 4ANNA 3MY1A 3UMWA 2E9PA 3LJ2A 1L3RE 2VTIA 5ETCA 3IECA 3AC3A 4FKTA 4D2PA 2X8IA 4D4VA 5AAEA 4MNFA 5AV3A 3NR9A 4EK5A 4IM0A 3RAKA 4G1WA 4I0TA 2W5AA 5HIBA 4FKJA 5IH4A 3RI1A 5KMMA 2GNJA 4RIXB 3V8SA 5AADA 4EQCA 4RWLA 4O7LA 2XM8A 4GG7A 3VO3A 5EYKA 4FKUA 2CMWA 4BDIA 3R0TA 5IA2A 5LMAA 5FTQA 3GENA 3FMKA 3VBTA 3DT1A 4KRCA 4MXXA 3QZFA 5AMNA 3VBYA 1O6KA 4JBQA 5CTPA 4JX3A 3L9NA 2R3JA 4PMSA 5FEEA 3PFQA 4U8ZA 4JAIA 3DOGA 5TO8A 4KA3A 5CI6A 5BVNA 2JC6A 3CCNA 5TR6A 2QLQA 2PZIA 5J5SA 1IG1A 3SD0A 4XV1A 4YBKA 5IDPA 3PY3A 4CFNA 3QA0A 5C9CA 4GMYA 3FEGA 3A7FA 4XG6A 5CANA 4O2ZA 2VUWA 5B2LA 5HVJA 5CEQA 3VJOA 1MRVA 5FD2A 4OAUC 4ZLOA 4AXCA 4BBFA 1ZLTA 2GHGA 3O8UA 2RF9A 3QQUA 1OL7A 3AD6A 3PY0A 4GCJA 4BDBA 3ZXZA 1VJYA 4E1ZA 5AP0A 4ENYA 1GOLA 4RRVA 5J9YA 3KIOC 3Q9XA 5FUTA 1ZRZA 3SKCA 2ZB1A 3R2BA 3TZ7A 4UMRA 3W0QA 2OFVA 3F82A 4XG4A 2A4LA 1M2PA 3S3IA 3Q32A 4Y73A 3MVLA 4S31A 3V8TA 2ERKA 4AT5A 2WMSA 3OBGA 4IADA 5K3YA 2VWXA 2R7IA 4OAVB 4I5MA 1P5EA 5L8JA 1VR2A 3P0MA 2B55A 4W9XA 3UYSA 4DG2E 2R0UA 4CMTA 2PY3A 3WF5A 5AJQA 4X2JA 3ZO1A 4BCHA 3HV6A 3G9NA 3OD6X 4M12A 1ZMVA 2RSVA 4CKRA 3PSCA 4L67A 3PIZA 3THBA 2QO7A 3W8LA 4JQEA 3G0EA 1QMZA 3W2PA 4I6HA 3SLSA 4G6LA 2YN8A 3VF9A 3FSKA 3Q9ZA 3NPCA 1SYKA 3P08A 2PVKA 1H25A 2BHHA 2ZJWA 4G3CA 3BQCA 4RIWA 4ZJIA 4C4JA 2XVDA 4TYJA 1ZARA 3Q3BA 3IPHA 4L3PA 2X2MA 3GBZA 4DG0E 2GQGA 2QNJA 4QPSA 4YR8A 4JBPA 2WZJA 3PE1A 5A14A 4O0WA 3W1FA 5AUWA 5GINE 3E93A 3UIUA 1OGUA 2DQ7X 4HPTE 4QNAA 3RZBA 2V0DA 2A19B 3KN6A 3QX2A 4L68A 2VX0A 4DGOA 2ESMA 2XA4A 5CENA 5BX0A 5KMKA 4RX8A 2C6IA 2HWPA 2JBPA 5TOZA 3V01A 3KXMA 4R8QA 1G8AA 5M09A 3TEIA 4AQCA 3KF4A 2Z60A 3QD3A 3RK7A 3VBWA 1BI8A 4W4VA 2Z8CA 3P78A 5G1XA 3MB6A 4BGHA 4M68A 2C0IA 3BELA 4AUAA 2WQEA 3L9LA 3FKLA 4RX5A 3A60A 3BLHA 4KIKA 5I9ZA 4EOPA 4JJRA 5HG8A 4PDOA 3RAWA 3BWFA 4UBAA 2ITTA 4Y83A 3VW8A 3ULZA 3HAVA 4C3FA 4ZZOA 3C5UA 2HELA 2ZV2A 3SRVA 5CF5A 3CPCA 4NU1A 2W1CA 1QPCA 4AACA 3ZCLA 1G8JA 3MFTA 2PPQA 1CTPE 1E9HA 5CWZA 2YIYA 2R3NA 3MN3A 2B53A 2VTAA 5IA1A 3IW4A 5EOBA 2XNNA 4IEBA 3H3CA 4EWHA 3E8DA 5K4JA 3W2OA 4BCJA 4FTTA 2C6KA 5FM3A 4CSVA 2P4IA 2VX3A 2VWVA 4YTIA 2C1AA 2BAJA 3E7VA 3NNXA 4AFEA 3CQUA 4HZSA 1KE6A 4LUEA 2YM6A 5CEMA 3QZGA 2WNTA 4GH2A 4CYJA 5GZAA 2CCHA 3NFFB 2C6EA 4G6NA 2CGWA 4G6OA 3L8VA 5BNJA 4WNMA 4ZEGA 3GCVA 4I0SA 5K9IA 5EM5A 2VTOA 4O27B 5K0XA 4DDIA 5EKOA 2PVRA 3H0ZA 1XBCA 4A9RA 5DR2A 4JMQA