5DI1A

Map4k4 in complex with an inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
285
Chain Sequence
IDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Discovery of an in Vivo Tool to Establish Proof-of-Concept for MAP4K4-Based Antidiabetic Treatment.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 285
sequence length 297
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5di1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5di1A01
3POZA 1CM8A 4CFWA 1GZ8A 3OW4A 1J91A 2RG6A 4RGJA 5CANA 1YI3A 4IW0A 4ASXA 3MPAA 3CQEA 1ZWSA 3MTLA 3TTJA 1H1RA 5HBHA 2XK8A 4P4CA 3OXZA 3DOGA 3RP9A 4EOQA 5A4CA 1UKHA 4F9AA 3W2PA 3F2NA 2PVKA 4ZTRA 3ZC6A 3M2WA 2QOOA 2QOHA 5JSMA 4LL5A 5K4JA 3FMNA 3C51A 4QQJA 3P9JA 3MFUA 4QPSA 4NM3A 3HZTA 2BFYA 4Y73A 4AOTA 3VS3A 3DT1A 2XH5A 4NWMA 4OTPA 3MBLA 4MK0A 3DAEA 5I0BA 2PUIA 4S34A 4W4XA 4GK4A 2R3LA 4TKSA 2J2IB 3P7CA 4ZSEA 4BCJA 4TL0A 5AV0A 4CFXA 3OTUA 1Q4LA 1FINA 2BTRA 2XNEA 2PYWA 4QQCA 3VUDA 1OIUA 1URCA 4C4IA 4U97A 4BRXA 3DXNA 5BPYA 2BRNA 2HYYA 4YJNA 4HGTA 4U7ZA 3C13A 4EUTA 2A1AB 4KB8A 4OTFA 2JC6A 3BHTA 3HA6A 5DEWA 3TZ9A 2F2UA 3FV8A 2J0KA 3F3WA 1VYZA 4O0RA 4F1OA 4TXCA 5FQDC 3QXOA 4U43A 3CC6A 3DZQA 4AWIA 4O7RA 3LFDA 1ATPE 5IF1A 2PMOX 5JT2A 2RIOA 1FVRA 4I94A 2PL0A 3PE1A 4FZ6A 4A4LA 2QG7A 2JIUA 3RK5A 3TV4A 4AGUA 1DAYA 3BQRA 3KK9A 3QTRA 5LJJA 3HNGA 4LV8A 4B0GA 1BI7A 4LI5A 1WCCA 3R9HA 4C3PA 5HIBA 2ZV8A 4H58A 3MIYA 5AWMA 3V04A 4EOIA 2YZAA 4PRJA 4U9AA 3NGAA 5D7VA 4R7HA 4UX9A 4R5YA 1ZXEA 1Q8TA 1JSTA 4JQ8A 2G2IA 4FSWA 1E1VA 2VTQA 3KRJA 3GC9A 4X2JA 4NUSA 3MPTA 1LEZA 3EL8A 4FVPA 3JR1A 4KIPA 4FGRA 2IW6A 4MHAA 3BHYA 2X2KA 5CX9A 2ZJWA 4EEVA 5HZNA 4MH7A 3KRRA 2VNWA 4U3ZA 4L01A 5E8TA 1GJOA 4AW0A 5JRSA 3RPYA 1M7QA 3NRMA 2BHEA 4XUFA 3AC3A 3RPRA 4E5WA 1DI9A 2BKZA 2B55A 2C0TA 2CGVA 4BCPA 4O6LA 3UP7A 4TWCA 3FLNC 4KS7A 3R8PA 4FR4A 1XBBA 3N4UA 4FKJA 4X2KA 3MWUA 4F4PA 3KRLA 5HU9A 3ACKA 3EFKA 4BDJA 2VWXA 4BCIA 3VBQA 2VUWA 5HNBA 4ZP5A 4A9TA 4DEBA 2CSNA 3GP0A 4U42A 4YNOA 4E7WA 4FL1A 1GZOA 4GMYA 4S2ZA 4XV1A 4DLIA 1XHAA 3Q52A 4UEUA 4CV8A 4DEEA 5J1WA 4J98A 1UV5A 4UMPA 2XB7A 1Q62A 5CI7A 3VUTA 1Q41A 5FG8A 4GFGA 2VTIA 4MWIA 4FTNA 3LJ1A 4F99A 4IWPA 3TUCA 2UW4A 2WOTA 3DPKA 4E5BA 3HYHA 4C3RA 4H39A 4W4YA 4E4MA 1OKYA 4O7TA 3KL8A 4NCTA 4YBJA 4K77A 3QALE 5A6OA 2VTAA 2ZM4A 1O6LA 4WO5A 2XIXA 3FLZA 2XMYA 5IUGA 4ZLZA 4MXOA 4FG7A 2J90A 3FZOA 1ZYCA 4FK6A 3DQWA 2C3JA 2C6LA 3EN4A 5AP7A 3LLAA 3VBXA 5DGZA 3V5PA 2WMRA 5EYKA 4XOZA 3F61A 2C1BA 4I20A 5EI8A 3ENHA 3R6XA 5E7RA 3VF9A 4ZIMA 2J5FA 3OY1A 2VX3A 3LCDA 4F0FA 4D9TA 2RF9A 4FZDB 3S95A 3O8TA 5EM6A 2IVSA 4BKJA 3JVSA 4EH9A 3MH1A 4LV5A 5AA9A 1PKGA 2VWWA 4PY1A 1LUFA 2BIYA 3WYYA 5HTBA 5AIRA 4F6WA 4HCTA 4FODA 4G6OA 3V5WA 3EYGA 2ERKA 4DGGA 4QMXA 3D94A 4IAZA 3TACA 1OKVA 4BF2A 5DIAA 2JEDA 2YAAA 2J0IA 3TV7A 3QQFA 5BMMA 3LMIA 2FSLX 2B7AA 3DA6A 5CEIA 4B4LA 3W32A 5HE2A 3NYOA 4RWJA 1ZLTA 4CZYB 3MY0A 3Q60A 5GZAA 4L53A 3R7YA 2W96B 2XNMA 3AGLA 1REKA 3GEQA 4QMZA 5KHXA 3EZRA 5DT0A 2ZM1A 2C69A 3U9CA 1M2RA 2JDRA 5GHVA 4FEQA 4EC9A 2X4FA 4IIRA 5JQ8A 3Q9XA 2NPQA 5TF9A 2C3LA 2GS2A 5K0XA 1FOTA 4U80A 5GIPE 3KN6A 2B52A 1KWPA 4FMQA 2XCHA 5HKMA 1JPAA 3ZXZA 2ZV7A 3U6IA 5IMXA 3ALOA 3KCKA 4ZXTA 3O50A 3QCSA 3ZMMA 4F70A 2YM5A 4CKJA 4FG8A 3PA3A 2J0MB 4UMQA 2QOBA 4GUEA 4EHEA 1ZYSA 1TQIA 2WQMA 2CMWA 3K5VA 3UPXA 4FKPA 4NTSA 2VWBA 4O0VA 3V6RA 4AE9A 2WIHA 4CG9A 5KUPA 3IGGA 3U51A 5T68A 5TT7A 3Q3BA 5CQUA 4ZJIA 3NPCA 3LJ0A 3ZBFA 4DFLA 4F7NA 4FT5A 4CYIA 5TR6A 3CKWA 4PV0A 2WTKC 3OCBA 3FZSA 4LOQA 4TW9A 3NIEA 3DKGA 4O86A 1Q8WA 3ORKA 1ZMVA 4KIQA 5IUIA 2J4ZA 5M09A 3C0HA 2Z60A 4FSRA 3UOLA 4A4OA 4NYEA 5CAQA 2PMNX 4EH6A 3KVXA 4BCMA 4G16A 3SG8A 4J97A 2NO3A 2OIQA 4FT7A 4O83A 3UGCA 3RMFA 3PJ1A 5J9LA 4MXCA 2FSTX 4UY9A 3LCKA 2HWPA 1NXKA 4IB3A 4ZSGA 4PTCA 4DFYA 3R22A 3V6SA 3KULA 5CENA 4XP3A 2R3IA 4N70A 1NT2A 4I6FA 2X8EA 3EQCA 5E8UA 1LR4A 3P0MA 4MF0A 4QMPA 2VGPA 2VWUA 3VQUA 3IQ7A 5HG5A 2BRBA 3QLFA 4ZTQA 4I22A 3D7TB 3O17A 4BKZA 4W9XA 4YTHA 1TQMA 4FV2A 3DJ5A 1HCLA 2CGWA 2PK9A 3RTPA 3FJQE 3OCSA 5L8JA 1NVRA 2C0IA 4R8QA 4BZNA 3L8PA 3O7LB 4IH8A 2CLQA 4F6SA 4RJ6A 4HGLA 3IW8A 4WUNA 3G9NA 1VR2A 3UO5A 2VNYA 3O51A 1YVJA 2VGOA 3FBVA 4YJSA 5J9YA 4JT3A 4FE2A 4DLJA 1JNKA 2JAVA 2UZNA 2WTIA 2Z7RA 3K3JA 3KMWA 2VWZA 3L8VA 4FIEA 3R1SA 4YP8A 1BI8A 2JDTA 4JIKA 2YLEA 4K9YA 4YJQA 2RFSA 5L8KA 3TM0A 3OUKA 4U5JA 5BVEA 2Z2WA 1RE8A 5EKOA 3FI8A 5J7BA 3IW6A 3CBLA 3T9TA 1UVRA 3C4ZA 3MVJA 2WD1A 1UNLA 2W1FA 5DRDA 1IEPA 1JVPP 3QAME 1JOWB 2VTHA 2YCQA 4F9CA 1OECA 3ZM4A 5D9HA 3CGOA 1BX6A 4EQUA 4IAAA 5J9ZA 4O84A 3R8LA 2WTCA 3WZDA 1LPUA 5I9VA 5HG8A 3TN8A 3SA0A 5TKDA 5K5XA 3MIAA 4FUXA 4MBJA 3DB6A 3GU5A 4FIIA 3IW4A 4C7TA 3QX2A 1CSNA 1Y8GA 2BAQA 3NWWA 3KRWA 3HP2A 4FIHA 3I60A 4PTGA 3CE3A 3NYVA 4KKGA 4M97A 2FVDA 1VEBA 2G2FA 3GQLA 4I6QA 4JS8A 5H8EA 4AN3A 3P78A 2JKOA 4EK6A 1OPJA 2R3KA 4AS0A 3AC5A 3LMGA 5CEOA 3L1SA 2PZIA 4RIYB 5F9EA 2OXXA 2EXEA 5CS6A 4RPVA 2HY81 1S9IA 4PP9A 3RAHA 1MRUA 3UG1A 3COHA 4FTIA 3FY2A 3OF0A 2XKDA 4GVJA 4HGEA 1OIQA 2YM8A 3IECA 2GNJA 2XNOA 3I5NA 2I0HA 3CJGA 4F0IA 1PKDA 4IDVA 4TT7A 3OY3A 3ZUVA 3HA8A 2IW9A 4BTFA 4IM0A 3F7WA 4UV0A 4YZDA 4QNAA 1M7NA 4M69A 3CGFA 3RKBA 2VO0A 3BHVA 5D10A 3PG1A 2Y4IC 4PL5A 5CQWA 3QL8A 3QZGA 4LRJA 4TTHB 3FYKX 4B6LA 3CCNA 4EQCA 2ETKA 4RC4A 2KTYA 4HYUA 4TY1A 4ZZMA 3A7GA 4LOPA 4KS8A 3MVLA 3ZSIA 3A7JA 3GI3A 1FVVA 2UW5A 3IPHA 3E64A 3NUPA 2RFDA 3NUSA 4QMWA 4WUAA 5HCXA 3VBVA 4D2WA 2OLCA 4YJUA 1OIYA 5A46A 3DXPA 3PA4A 2GHMA 3UZPA 2GTMA 4I0SA 2PVRA 3EN5A 1OB3A 4YNEA 4M12A 3PXQA 4Y72A 5K9IA 4EC8A 4RT7A 1W0XC 1UA2A 4F65A 1VZOA 2PMIA 3R7OA 3PXZA 2IJMA 3N9XA 4J7BA 4K2RA 3LQ8A 4L3JA 3BE2A 2WEVA 4XG9A 5EQEA 2QURA 3F2AA 3PJ8A 4ZS0A 3PLAE 3PVBA 3D83A 5EM7A 3SG9A 4P5QA 3TZ7A 5DR2A 1WBSA 2F7ZE 3BLHA 3KFAA 4NT4A 5AR4A 4KINA 2BRHA 4PPCA 4ORKA 4XP0A 4CNHA 2WPAA 4MNEA 4UXQA 2YISA 3FE3A 5HLNA 3UDBA 4TZRA 1GIJA 4ALUA 2YAKA 4BDFA 4EWHA 4PNKA 3KXZA 2XK7A 3BBTB 3R00A 4QP3A 3IK3A 5HICA 4EH2A 4YZMA 5LMBA 2CNUA 3I0OA 1PYXA 4MEDA 5KE0A 3T3UA 4C3FA 3W2CA 3ZHPC 5BUIA 1QL6A 2R4BA 2C3IB 4HCVA 1G5SA 5F20A 3CPCA 3I6UA 4IX4A 4OTWA 3COMA 3ET7A 3BGZA 3OBGA 1B39A 4FKVA 3W8QA 2UZUE 1R0EA 3D15A 4XRLA 4IAYA 1BMKA 4AP7A 4ARKA 4EOMA 2HOGA 2C6DA 3DAKA 3FY0A 5FBOA 4MXYA 4O82A 2C4GA 4PL4A 4W9WA 4RX9A 3HRBA 5IKWA 3WF8A 4E8AA 4EONA 5AJQA 3FKLA 2QVSE 3D9VA 1YI6A 3MDYA 3VBYA 3UG2A 1YRPA 2C68A 3AXWA 4JLCA 4D4RA 2P4IA 2QKRA 3C50A 1JAMA 4FTAA 3CS9A 2B1PA 2GFCA 2VX0A 4JR7A 2QO7A 2W1IA 3ZRKA 3QCYA 4L45A 1KUTA 4L8MA 1ZMWA 2QOIA 4ITIA 4Z7HA 5EM8A 2GQSA 3R83A 3H0ZA 5AM6A 3TNIA 4C4EA 3DBQA 4AXAA 4JBVA 2B4SB 1MP8A 2V5QA 2OSCA 1YXVA 3F3VA 3GXLA 4D2PA 4EK4A 4FEWA 1FGIA 3CY2A 2JKKA 4FL2A 3ROYA 5EKNA 4E26A 2GMXA 1H24A 3WZUA 3C4EA 4RLLA 3EYHA 3QBNA 3L9MA 4RX8A 4CRSA 3EN9A 4X7QA 2HZIA 2BR1A 5AR3A 2XK3A 4K18A 3MFRA 3R7IA 1J7LA 1SMHA 2YCRA 4AA0A 4AZVA 4FKLA 1H00A 4YBKA 4EOPA 1OL7A 5EHLA 3AC4A 3E62A 4FX3A 4IFGA 1W82A 4HVHA 3FQHA 1K3AA 5IEXA 4FSNA 1O9UA 3POOA 3PP0A 4C57A 3BYMA 3PE2A 4KIKA 5FWKK 2HZ0A 3LW0A 4Z7GA 2FO0A 1YI4A 2I40A 1JKKA 3E8DA 5BUJA 3HUCA 4QO9A 5EW8A 5HO6A 5AR8A 4YHJA 4BCKA 3G15A 1F3MC 3CQWA 4PWNA 4BCFA 2EVAA 1V0BA 3G6GA 3OXIA 1OPLA 5ANDA 4R7BA 1SVEA 3DLZA 1W7HA 5DI1A 4JI9A 5E8XA 4RQVA 4XMOA 3ZTXA 4HYHA 4JVGA 5E8ZA 4RFMA 3OD6X 2OF4A 2VWVA 5DOSA 4O1PA 2XKCA 2JDSA 4M0YA 4NM5A 4XRJA 3WIKA 2R2PA 5AP6A 2YLFA 1KE7A 1PW2A 3QHRA 4BIEA 3QTSA 5HO7A 3TUBA 3TKUA 3A8XA 4IXPA 4EZ5A 3UC3A 2R3QA 5FD2A 1FMKA 4KABA 4NM7A 4WD5A 3SOAA 3SW4A 2G15A 4TNDA 2W0JA 4IFCA 5FXQA 5JKGA 1RW8A 4F7JA 3F3ZA 2CGXA 2FB8A 3EQBA 4L44A 4CQEA 5A9UA 3F88A 3QD4A 3NUAA 2XS0A 3QRIA 3GCUA 2PUUA 3COKA 4IM2A 1H26A 2R7BA 4U40A 1UU9A 4TPTA 3GBZA 2RFNA 3HUBA 2OFVA 3NW5A 2UZEA 3GFWA 5IISA 1YHSA 3KEXA 2YWPA 2GNHA 2VTOA 2WKMA 4EUUA 3LJ2A 4N6YA 5AP4A 1YW2A 2WHBA 4PPBA 4APCA 5CASA 2QI8A 5M07A 5I4NA 4Z16A 5HVYA 4PF4A 1ZY5A 4C36A 5A4TA 3ZZEA 3V8SA 2ONLA 2X6EA 3K2LA 3Q32A 4GG5A 4OTHA 4CLJA 4E3CA 3R01A 5HCZA 3RZBA 5DBXA 1J3HA 4DFBA 4XG7A 2X2MA 4BYIA 4Q9ZA 2YHVA 5AUZA 5HE0A 2FA2A 2YFXA 3K3IA 1TVOA 1Y57A 1SZMA 3TJCA 3IGOA 4FSUA 2OZAA 2GHLA 4I6BA 4HVDA 2O65A 4Y83A 2OH4A 2X39A 3GC7A 4JQEA 4BWPA 4ZSAA 1GZKA 2IN6A 3CLYA 4UWCA 3FYJX 2A2AA 4DG0E 3PP1A 3OVVA 1H08A 2YIXA 3FC1X 3PWDA 4O91A 4O6EA 3MI9A 5M08A 3GVUA 4J95A 3N4TA 3VC4A 3RM7A 2BILB 2Y6OA 4V04A 5JRQA 4RJ7A 2R3OA 3D5VA 5EDRA 2ITWA 3UODA 3DBCA 3P86A 3TNQB 4MNEB 4CTCA 3ZXTA 2GS6A 3W2QA 3WYXA 4ZZNA 4AA4A 5IDPA 4XG6A 2AC5A 3AMBA 4R3PA 2WMXA 2QG5A 1KV2A 4L67A 2ITZA 1UU3A 2HWOA 4GK3A 4J52A 5ANGA 3OCGA 3TNPC 4IZ5A 3PY3A 3QD3A 3ZO4A 3BWJA 5CU6A 2J9MA 2Y8OA 5CF5A 2VN9A 3QCXA 3ORLA 3DV3A 1Q8YA 2ONLC 3E8CA 5HTCA 1OL6A 1LP4A 2WMBA 4DG3E 4CT1A 5AMNA 3JVRA 5LOHA 1YHWA 3EQRA 4I41A 4WSQA 3SLSA 5BYLA 4Y46A 4FKUA 4I4EA 2HCKA 1Y6BA 1E9HA 1OI9A 4MBIA 2HW6A 4CFMA 5JFXA 4LGDA 2C5NA 1XKKA 4FEVA 4H3QA 4E20A 2WNTA 4BHNA 4PDYA 5I9YA 5DRBA 3VUMA 3QQJA 4E73A 4YO6A 4EK8A 3VUGA 4ACCA 4K1BA 4YC8A 5E8WA 1OITA 1P5EA 4EHVA 4KBKA 3JUHA 4X0MA 2GQRA 4WOVA 5C27A 4XV9A 3EN7A 1YOJA 1QMZA 4QT1A 3DFCB 3F5UA 3RBWA 3DLSA 1HOWA 5KZ0A 3WF5A 1XWSA 4NL0A 4N4SA 4JR3A 3UMWA 4FSYA 5C1QB 4AU8A 5L6PA 4BDDA 2GFSA 2JGZA 4I23A 5AV2A 2VTNA 2P2IA 3C4CA 4QYEA 5C8KA 3UZTA 4GS6A 3ODZX 3QGWA 4TYEA 1IA9A 5IA0A 2W4OA 4V0GB 3ZLYA 3CPBA 3V5QA 3ATTA 5AV1A 4IWDA 4KIKB 4Y5HA 4A9RA 2UZBA 3GNIB 4F7LA 4GSBA 2WMTA 5M4FA 3O0GA 3MA3A 3ZLSA 4DYMA 3ZYAA 2VV9A 3TKIA 3VN9A 4ERWA 2SRCA 4FTJA 4QQTA 5EH0A 4HVSA 3GOKA 5GNKA 5ACBC 2F57A 2J7TA 1QPDA 3VS5A 4L00A 3JY0A 3O7LD 5CY3A 5IQDA 5E1SA 4ZOGA 3LM5A 5HCYA 2OGVA 4M66A 5A6NA 5E9EA 4FIFA 2YIWA 1T46A 2YM3A 3DAJA 4ZSLA 4FF8A 4YPSA 2IVUA 4EBWA 2A19B 4GFOA 5TOZA 2EXCX 4AW5A 3D7ZA 2CDZA 3KXMA 3T9IA 4PMPA 3PSDA 3NNUA 2WTWA 5G1XA 4D0XA 4D4VA 5DT4A 4A9UA 3H9FA 4Z55A 5KBQA 2QHNA 4PTEA 4KNBA 2XBAA 3VS7A 4PP7A 3NW7A 2HZ4A 4U3YA 3RPOA 4CV9A 3S0OA 4Q2AA 3BRBA 3LFSA 4QP9A 4WG4A 4O2ZA 4WRSA 3IDPA 3G5DA 3MSSA 2W1CA 4FA2A 3DTWA 2DS1A 3FLYA 4OTIA 5LWNA 4XBRA 4PMSA 1J1BA 2QOLA 2JBPA 3TV6A 4E6QA 4I5HA 3QWJA 4BCHA 2WMUA 2C1AA 4AFJA 2YCSA 4DTBA 3SXSA 4FV1A 4IADA 1WBOA 4YJRA 1OPKA 1JWHA 2BHHA 4BDIA 5DHJA 2R64A 4JAJA 3H4JA 4FV0A 3AD5A 1GIIA 3GFEA 2QOCA 3BEAA 3DK6A 2B0QA 5ANIA 3D7TA 3VIDA 3C7QA 2X6DA 3HX4A 1XBAA 3FUPA 4GFMA 4KSPA 1U46A 1Q3WA 3Q53A 5C01A 4E6AA 2YACA 3BYSA 1T45A 2OK1A 3QUEA 2E9VA 4AN9A 4BR3A 3E3PA 2W5AA 4QTDA 5CVFA 1X8BA 3GU7A 4O0XA 4R1VA 3O8PA 1FGKA 5AR2A 2OZAB 5EI6A 3E93A 4NZWB 1Y6AA 5FEQA 4LQMA 4JDIA 2XKEA 4EOSA 4QTEA 4YJPA 4O7NA 2BAJA 4JOAA 4X2GA 2HZNA 4XYFA 2DWBA 4I4FA 2X2LA 4DCEA 3KY2A 4LMUA 4IAFA 2V7AA 3KB7A 3OWPA 5IA4A 2JLDA 4EOJA 2XVDA 4A9SA 4D4YA 3PWYA 4MD7E 1YWVA 4R7IA 1WVXA 5FEDA 3FLSA 1DAWA 4J8NA 4HNIA 1DS5A 3NAXA 4UYAA 5LMKA 2IG7A 5BVNA 2F2CB 4TRLA 1M14A 2PHKA 4UMRA 5CZHA 4BTMA 3HGKA 3OROA 4MQ2A 1PXOA 3WZEA 4DEHA 2JDOA 5C4LA 2UW0A 3G0FA 3KXNA 3S1HA 3A60A 3ZEPA 2QO9A 3KA0A 5F95A 4RIYA 4U0IA 2R5TA 3CKXA 2C5VA 3GC0A 4IWQA 3SC1A 3DK7A 4ZJVA 1Y8YA 4TNBA 5ICPA 4A07A 1G3NA 1H28A 2ZV2A 3NUUA 4FTTA 4NM0A 1PXMA 3RPVA 3UVQA 5FBNC 4XNEA 5DEYA 3G51A 4BDCA 2XNPA 3MGYA 3ZC5A 5AUWA 2XRWA 4BDKA 3BU3A 2A0CX 4FT9A 4YLJA 3PDTA 4E4XA 4CEGA 3BIZA 3HV6A 3CP9A 3ULIA 4QMSA 4AW1A 4J99A 1F0QA 2WMWA 4LG4A 4DGNA 4YU2A 4FYOA 2PUNA 4RX5A 3W2RA 5D11A 5DNRA 3UQFA 1IAHA 2XCKA 4IVDA 4XJ0A 4CCBA 3Q2JA 3D4QA 4KAOA 1YHVA 5AUUA 4KRCA 4XHKB 5DMZA 3SW7A 2J0JA 2F7XE 4QPMA 4AT3A 4JDKA 3HRCA 1V1KA 3R7VA 3SDJA 4RA5A 5I3RA 3WF9A 4G3EA 2R3NA 3M42A 2GSFA 2XEYA 4F9WA 3BGPA 3WBLA 4IAKA 3CTQA 2R3MA 3PLSA 4JAIA 4PDSA 1FQ1B 4BDAA 5LMKC 4L7FA 1OIRA 2UZLA 4DFNA 3FMMA 5KNJA 3HAMA 3WOWA 2X9FA 4FIGA 4NCTC 4BCNA 3NAYA 5G6VA 5L2QA 1WZYA 3SRVB 3BZ3A 2PVYA 5ANOA 3VS4A 3IS5A 5HQ0A 2J6MA 3E87A 2W9FB 5CAOA 3CD3A 1KE5A 4PX6A 5CU2A 4IB1A 3LLTA 4H1MA 2H9VA 4YJVA 4YGAA 5EYDA 2VAGA 5HG7A 4BZDA 1G8AA 4AN2A 5EK7A 3JY9A 3BI6A 1BL7A 3LFCA 3PXKA 3UOHA 5IMEA 4QTBA 4BCQA 4IAIA 2R7IA 2WQOA 4EBVA 1Q24A 4QMMA 3E92A 4Z9LA 5ETIA 1OBGA 4QOXA 4GJ2A 3F66A 4C4HA 3QUPA 2NP8A 1O6YA 2W7XA 3DZOA 3UOKA 3LM0A 3FXWA 4AZWA 3GUBA 4FI1A 4FKSA 1P14A 2JIIA 5DG5A 1Q97A 3QWKA 3ZCLA 4OBQA 3ZS5A 5HU3A 5CAPA 2C5YA 1YOMA 2PZRA 4QYHA 3PVWA 3BU5A 1ZAOA 1A48A 4PNIA 3R8VA 1ZZLA 2QD9A 2PWLA 2E2BA 3PZEA 3EWHA 2BZJA 2IO6A 3TL8A 5H2UA 3BV2A 3ZFXA 3AOXA 2UW8A 4WNMA 4D0WA 4RX7A 1NA7A 2X1NA 4YSMA 4ZMEA 2BVAA 2OO8X 5GZ8A 4FV4A 5AUYA 5IQEA 5ITAA 1YXSA 3AG9A 5IQIA 4R3CA 4IX3A 4EYMA 5KMIA 1V0OA 2GPHA 4IQ6A 2UVXA 4L42A 4CXAA 1OM1A 1H01A 3W16A 4IWOA 1DM2A 5L2WA 2R0IA 4V01A 3PY1A 4PL3A 4ZJJA 3MTFA 5BVOA 1XH7A 5L2TA 3FMLA 3R73A 3VJOA 2E9OA 3EQPA 2ITNA 3ZRMA 1URWA 4MQ1A 2ZDUA 4D1ZA 2YIYA 3FQSA 3DY7A 2B9JA 5AV3A 4CFFA 4MX9A 4FOBA 1JBPE 1ZOHA 4CVAA 5KMKA 2PE1A 3DKOA 3ORIA 1UWJA 5M4IA 4YHTA 3AC1A 3KREA 4BDHA 3P5KA 1WVYA 3DCVA 5KZIA 1W83A 2JKQA 3ZFMA 1Q3DA 2RKUA 5CSWA 2ETMA 5L2IA 2QLQA 3HDMA 4AT4A 4AT5A 4QP4A 3FMEA 2OXYA 3DK3A 5HHWA 4D1SA 1ZMUA 4EQMA 5CEQA 2BDWA 5KMMA 1TKIA 3BX5A 3AMYA 2QU5A 3DJ6A 5CU4A 3TG1A 4NSTA 3BQCA 4XOYA 2FUMA 5D7AA 3RK7A 5L2SA 3LXKA 4O0YA 3ROCA 2PVFA 1IRKA 1Q8UA 3A4OX 4YC6A 3IW7A 4MD9E 5IH5A 4FEXA 3LHJA 2UUEA 4GW8A 4H05A 5C4KA 1BL6A 1OGUA 2PVMA 2QCSA 4HPUE 3ZBXA 4HW7A 4GV1A 4I24A 1IASA 2OBJA 2OJFE 3FDNA 5H3QA 4NH1A 1SVGA 2RG5A 2UW6A 5D41A 4BHZA 3UNKA 5F1ZA 3IKAA 5LVOA 4MF1A 3A7FA 3TNHA 3EL7A 3LVPA 3Q9WA 5HD7A 4RLKA 5IA1A 4V05A 3SOCA 4EH3A 3PIXA 4QQ5A 2W1HA 2XKFA 4FKTA 5FRIA 1WBTA 3VJNA 2XF0A 5BVDA 5JQ5A 3LFNA 4G9CA 3LZBA 3U54A 4GCJA 2XYUA 3QC9A 4D5HA 2V55A 3OT8A 5EHOA 3UJGA 1QPJA 4XP2A 3LIJA 1U54A 2PZPA 2VO3A 5FXRA 4P2KA 4M68A 3H9OA 2GNLA 3CXWA 4D28A 2YIQA 5I9XA 3R7UA 2GHGA 1JSUA 4M3QA 5CVHA 2R3JA 3I6WA 4FKOA 4I92A 4WNKA 5J7HA 4DT8A 3QD0A 3D5XA 5KKRB 4AF3A 2HW7A 4Z3VA 4IZ7A 4FSTA 5IQCA 2H34A 5CSHA 1GIHA 3F5GA 5CU0A 5IU2A 1PXPA 4FC0A 3BPRA 3Q6UA 2PVLA 2WTDA 4DT9A 5DT3A 3D2KA 4O0WA 3DB8A 4JX7A 2CN8A 1Z57A 2O0UA 4N57A 4N0SA 5CNNA 2BZIB 4FSMA 4GJ3A 5HEZA 4TYHA 5KX8A 1W8CA 3ELJA 3PVGA 5HNGA 3OHTA 4ALWA 3CTHA 5AP2A 3S2PA 4ZAUA 2H8HA 3RWPA 2PMLX 4HCUA 5KBRA 1UKIA 3P7AA 3SV0A 4USFA 3P23A 2UW7A 4ANSA 3QQUA 1MRVA 5FDXA 4HYIA 3UQCA 4C4FA 3OEFX 2O5KA 3LXLA 4D4SA 1XH9A 4L46A 4CMUA 3NW6A 2C6IA 2CNVA 4ZS4A 4OTQA 1SVHA 3TZ8A 3GCSA 5IA5A 4II5A 2GQGA 4BN1A 3Q9YA 1M2QA 3FXZA 4L3LA 5AIKA 5HO8A 1PMVA 3FLWA 1L8TA 3PTGA 3ZLXA 4G31A 5E1EA 3P08A 4NIFA 1R0PA 4YZCA 4QD6A 3R9DA 2YJSA 2PVHA 3RAKA 4B8MA 4C8BA 5AA8A 1Z5MA 4DEGA 1UWHA 2Z7LA 3I81A 4G3DA 2NNWB 3R63A 3RPSA 3TT0A 3OFMA 4GEOA 3ZSGA 4G2FA 3UO4A 1PYEA 3FL4A 3IO7A 3MJ2A 2I7QA 2R0UA 3F82A 4IX6A 5E8SA 4QP7A 4FBXA 4M0ZA 4I1ZA 4Y5QA 4HNFA 3RAIA 2EWAA 2IZRA 3HMNA 1H4LA 3IONA 4O0SA 2ITPA 1IAJA 3R9RA 4C58A 4IM3A 4MBLA 2PZYA 2Z7QA 3ZSHA 2OH0E 4JBQA 2F4JA 4RA4A 3KF4A 2YABA 5AAGA 3RINA 5AV4A 3KN5A 4EYJA 5BUEA 3E88A 2GNIA 2EB3A 5TO8A 1H1WA 3QFVA 4TWNA 1IA8A 2JAMA 3NNWA 3FEGA 3R8MA 5T6KA 4GT3A 4OLIA 3I0QA 4RVTA 4UBAA 1KE6A 3P79A 4I0TA 4PUZA 4RJ3A 4BBMA 3A7IA 4TYIA 2ZV9A 3QTQA 4RSSA 3RALA 3ERKA 3IG7A 2XUUA 4GU6A 3UNJA 1QCFA 4IB5A 3K5UA 4NTTA 2YN8A 3RK9A 4X3FA 3ANRA 4UWYA 3DDPA 3R1YA 5GJFA 5CT0A 1SYKA 4BFMA 3TUDA 2O64A 4M13A 3SKCA 3UIXA 3V3VA 3OWJA 5FM2A 5EYMA 3KMMA 4LM5A 2PE0A 4D1XA 4WBBB 3VUKA 2RSVA 3W1FA 4QP2A 4AE6A 3MW1A 3GQIA 2BROA 5JMSA 3ODYX 3B2WA 4FV6A 2CKPA 5L3AA 3WE4A 2FSMX 4RWIA 4DE4A 1ZOGA 1EH4A 5AEPA 4EOLA 3LAUA 3LE6A 1APME 4APPA 4RQKA 2Y7JA 3FZRA 3I5ZA 2VWIA 5HBEA 4FKQA 1G8SA 2HELA 4K0YA 5AP3A 4BIDA 3R02A 2GS7A 2X8DA 3FPQA 5LQFA 4FV8A 4FZAB 3DNEA 4ONAA 3VF8A 4JBPA 4C4GA 4V0GA 4CTBA 2WMVA 4WHZA 5BVFA 3QRTA 4ZTMA 4DH8A 2Q83A 2UZOA 3SXFA 4CQGA 5BNJA 1ZARA 4KBCA 3ZM9A 1WVWA 3FSFA 3N4VA 3MESA 4QMNA 3FAAA 3HKOA 4YZNA 5CI6A 2JIVA 3KVWA 3QXPA 2Y4PA 3FHRA 1QPEA 3A4PA 3KXXA 4R5SA 3FLQA 5FTOA 3O71A 2DUVA 2ZM3A 3FMJA 1Z9XA 4RC2A 2ESMA 1KSWA 2X7FA 3QRUA 3EFWA 3KKVA 5AM7A 5M4CA 2BIKB 2VTMA 4XH6A 5HLPA 5LCKA 3UYTA 3ZOSA 3L8SA 5GINE 3UC4A 3TJDA 1CMKE 3EJ1A 1CKJA 4WNOA 1U54B 4BTJA 2BDFA 4BCOA 3CD8A 3QGYA 4BIBA 2OW3A 1WBVA 4ITHA 4DH7A 3BHHA 5FP6A 2JITA 4UZDA 3PXFA 4ZLYA 1R39A 4ITJA 3M11A 3MB6A 5E4HA 1M52A 4AGDA 4EK3A 1BKXA 2Y0AA 5B0XA 4DHFA 4W4WA 3Q2MA 4X2NA 4JXFA 4GK2A 3DBDA 2J5EA 4U8ZA 2WQNA 5HE3A 3QLGA 2VTPA 4C59A 4MXXA 4EZ3A 5CSPA 1ND4A 4FTOA 4J8MA 4EOOA 4B9DA 2ZVAA 3OW3A 4U45A 5K5NA 3VAPA 2XM8A 2X4ZA 3KK8A 4G34A 4XV2A 5FP5A 2XIKA 4I5MA 3UYSA 4CKRA 2BPMA 3VUHA 3PXYA 4ZY4A 4M67A 3QF9A 3IOKA 4D9UA 4ZLOA 4BCGA 4D2SA 3EKNA 5JFVA 5KMOA 3OXTA 5KO1A 2KULA 3PSCA 4TYHB 4GYGA 4GT4A 4WIHA 3R21A 4WSYA 5ETAA 4R78A 4GYIA 4AZTA 3MFSA 3V5LA 4IB0A 3C1XA 2XA4A 4I6HA 3RWQA 5J1VA 5B2LA 1OKZA 3NEWA 2XP2A 3C0IA 3BKBA 1YWRA 1XBCA 1PJKA 4LFIA 2ITOA 3CY3A 4O27B 4XV3A 5JGBA 5CF4A 5CEPA 3FI2A 5JFWA 3AT3A 3PUPA 4KRDA 2NRUA 1S9JA 2BZKB 3H30A 4FTUA 3LQ3A 1CKIA 3I79A 3Q4CA 5CXZA 2UVYA 2JD5A 1H1SA 4YC3A 4O0TA 3R7EA 5EQYA 3D5UA 4HZSA 1XR1A 2IZSA 1QPCA 4NIFB 2WQEA 4FGBA 1STCE 1NVQA 4GL9A 4LUEA 1JSVA 4WA9A 4C35A 3MB7A 2GTNA 1UU8A 1JKSA 2C0OA 3QKLA 3T8OA 5JN2A 4WG3A 2B54A 3S00A 4IJPA 4ZSJA 3OOGA 3REPA 1Q5KA 2IPXA 3BLRA 4WKQA 5L8LA 1SNXA 2X81A 3AD6A 3QHWA 4IZAA 2JBOA 5M53A 3JPVA 3PPJA 2W17A 2EU9A 4BICA 4PDOA 3PPZA 3JXWA 4GT5A 1YXUA 3UBDA 2HAKA 4L6QA 4J53A 1XH8A 3E63A 4G6NA 5CYIA 3BYUA 4PMTA 5HX6A 5M44A 3GC8A 3QYWA 4L68A 5CLPA 2ZDTA 3MY5A 2HXQA 5L6OA 4UALA 3F7ZA 4W4VA 2Y9QA 1MQBA 5AP0A 4DH1A 4FK3A 1CTPE 2ERZE 5ETFA 2OF2A 2GU8A 1H8FA 4DEIA 1Q61A 3EB0A 2Z8CA 5I9UA 4FSQA 3HV4A 4DFXE 4BWXA 2VU3A 4AOJA 3LCOA 5CAVA 4BZOA 3RHXA 3FQEA 3ZDUA 2QNJA 4JNWA 3TZMA 1I09A 4CZUA 4X6QC 1CDKA 4B7TA 4OUCA 5I9WA 4AW2A 5HIDA 1NY3A 4P90A 4DF3A 1AGWA 3AT2A 2XIZA 3ALNA 4PQNA 2C6KA 1H25A 2WIPA 3JYAA 5HGIA 3G0EA 4MXAA 2UZDA 4X3FB 2WO6A 1JKTA 2WZJA 3UMXA 3FMDA 4EH5A 1PXKA 4GG7A 2OIBA 3VS1A 5HORA 4QTAA 5JZJA 1A06A 2HY0A 2RGPA 3A2CA 3OCTA 4O22A 4RG0A 5AX3A 3P7BA 4MD8E 4YZ9A 3VQHA 4GU9A 4HGSA 2XK4A 3GENA 3PYYA 4XG8A 3SVVA 4FTRA 3EHAA 4F6UA 3BGQA 2QR7A 3AQVA 2QU6A 3R8UA 4YZBA 3RNIA 2XK9A 2BDJA 4HZRA 3VUIA 2X7OA 4WBOA 3NIZA 2B53A 3E7OA 3TCPA 4BVUA 5DLSA 4FVRA 4JJRA 3SRVA 1RDQE 1J1CA 5CXHA 3W10A 2VTTA 4CFVA 4DN5A 2PTKA 4YURA 3VULA 3MV5A 5BVKA 3CSVA 2R9SA 4YR8A 1PF8A 3I7CA 3HP5A 4FTMA 4L52A 3W8LA 3BE9A 4IACA 1R78A 1JKLA 2WELA 4GUBA 5EYCA 5ANJA 3QTWA 4FNWA 4DITA 2ITYA 1K2PA 3R1QA 4G17A 1FPUA 3OUNB 2YITA 4FIJA 2QOQA 4UMUA 3D2IA 3DJ7A 3A8WA 3F9NA 3NSZA 4H36A 4E1ZA 2FSOX 2BRMA 1OMWA 3GB2A 2VX1A 2XJ0A 4J96A 4RFZA 2OZOA 3TI1A 3TTIA 4EKLA 2WMAA 1FBNA 5FDPA 3W55A 3F2RA 2UZWE 4B99A 3C0GA 4DBXA 3ZFYA 1XO2B 4F7SA 4R3RA 5C9CA 4E4NA 3QZFA 3PXRA 3G2FA 4U6RA 4EH4A 3VS6A 4CCUA 1JLUE 5CZIA 2IVVA 5HLWA 2ZOQA 3KRXA 3UO6A 2P55A 3QX4A 4FG9A 3I7BA 4K8AA 3B8RA 4NKAA 2R3HA 3FXXA 3UNZA 5DWRA 3OMVA 2E9NA 4FOCA 2AUHA 3KMUA 2WMSA 4FZFB 4XBUA 5DH3A 3T3VA 4KSQA 4CYJA 2UVZA 4BGGA 3CQUA 4JDHA 2YDJA 4RRVA 3Q5IA 5B2MA 2ITXA 4J71A 3EOCA 4IE9A 4K33A 4QYFA 4BI1A 5EQPA 4EOKA 1NW1A 3TDVA 4IZYA 2W5HA 1PMUA 3DNDA 4JG8A 4RJ8A 4S30A 2VO7A 5CTPA 5J87A 4F1TA 5IZFA 3LFAA 2W99B 2REIA 3Q4ZA 2A27A 3A7HA 2W1ZA 5CVGA 4BBEA 3MH2A 3QTUA 4O7SA 3DS6A 5GJDA 3VVHA 4CD0A 3PJ3A 4R1YA 3NUYA 4UXLA 4LGGA 2OJIA 4ANBA 3C9WA 4A7CA 5DFPA 5IQHA 1P2AA 3FI4A 2EUFB 2IW8A 3EQGA 3AMAA 3ITZA 2C30A 5A54A 3LCSA 4A9YA 4QTCA 4RBLA 4QRCA 4JRNA 3R7GA 4G5PA 2XBJA 4GKHA 4DG2E 3QZHA 2UW3A 2W9ZB 4BDBA 4XG2A 1SM2A 3NYXA 4FZ7A 2GDOA 4C02A 4EI4A 3U4WA 3PY0A 2X7GA 3QYZA 1YDRE 4W8EA 2XEZA 4RFYA 3UTOA 2G1TA 3O2MA 4MNFA 5ANEA 4YTCA 4ZTLA 4AGCA 4BI2A 1HCKA 3ZUUA 4CKIA 3ZO3A 4ZZOA 3S4QA 4P7EA 3ZH8A 2PUPA 2QQ7A 3ORNA 2XIYA 5CF6A 5FUTA 3WZJA 2WTVA 3F6XA 5EOLA 3OWKA 3E7VA 5HBJA 3QUDA 2CKOA 4G5JA 5DPVA 4U81A 3WF7A 4QMLA 4RWLA 3QQGA 3SD0A 4ANLA 2C3KA 4F64A 1M2PA 3HEGA 3QA8A 4QP1A 3ACJA 5GJGA 1OL5A 1PY5A 3CTJA 3EH9A 3QD2B 4O7LA 4CT2A 4I3ZA 4FKWA 3LKMA 2CKEA 2WGJA 1ZY4A 2WQBA 4BL1A 2YA9A 2QHMA 2CCHA 3FZ1A 4QMUA 2ETRA 2P0CA 3U9NA 2QODA 5EDQA 5HE1A 3GU6A 5LVMA 3RCDA 3VW8A 3KC3A 3FMKA 3V5JA 2HK5A 4FTQA 3H3CA 3LXNA 4YSJA 3ID6C 3SAYA 5BYZA 3VRYA 4ZK5A 1VYWA 3UVRA 3IW5A 5J95A 2OWBA 3QZIA 1ZYDA 2B9IA 2C6EA 3HMMA 5EI2A 5CU3A 4PPAA 4UZHA 5E91A 4RVKA 4IBMA 5B2KA 2ITTA 3L8XA 3OP5A 3W2OA 5BMSA 5L6WL 3WE8A 3MA6A 5HVKA 5EOBA 3ZDIA 1MRYA 5IEYA 3HECA 5IH6A 3I1AA 3WZKA 3R9OA 4RMZA 3NNVA 4C61A 5J5SA 2XNGA 2C47A 1WMKA 5J8IA 1MUOA 4X21A 4OW8A 4FNZA 4ZEGA 5BQ0A 4C0TA 3GU8A 3TWJA 2X0GA 5J79A 3EIDA 1KOAA 2E9PA 3GU4A 2XNNA 3OG7A 5JZNA 4ACMA 3BCEA 3RAWA 3HV7A 3KXGA 2YWVA 3IDCA 4C4JA 3FKOA 3NYNA 4RIWA 2G01A 4DCAA 2BTSA 4JX3A 4KIOA 3VHKA 4AQCA 2W4JA 3F3UA 4FICA 2J51A 4S31A 4FYNA 5IQAA 1KOBA 4FVQA 4UMTA 4Y95A 4IVBA 1AD5A 3PJCA 1DI8A 5HVJA 2CHLA 2R3PA 3ANQA 2J0LA 3O23A 1XH4A 5HX8A 5IUHA 4K11A 2I0EA 4BGHA 4IHPA 3DBFA 2CPKE 4CLIA 3VNTA 4ZTNA 5T3QA 2YCFA 4BTKA 2AYPA 4RC3A 3UQGA 5AUTA 2F9GA 2OU7A 3AD4A 3I4BA 3NCGA 2ZMCA 5M56A 4QMYA 3R04A 2QC6A 5DR9A 3ULZA 4JRVA 4YLLA 1PXLA 2RL5A 1R3CA 3EMGA 3OS3A 5HI2A 4D58A 3RJCA 4AAAA 4EHGA 4ZY5A 4M15A 2ITQA 3SXRA 4QNYA 4XG4A 5EM5A 5KKRC 1ZOEA 3GCQA 4TN6A 3TNWA 4ANOA 4ASDA 5KMNA 3QRJA 2ZAZA 4O7WA 2O63A 1GAGA 5E8VA 3DTCA 3D0EA 5ETCA 4C2WA 3BEGA 3OBJA 1PXJA 5CSVA 3FPMA 4CSVA 3QU0A 4YHFA 3UZRA 4FSZA 2VTSA 5AR7A 5AFVA 3QQLA 4FTLA 4O38A 1OKWA 3OWLA 2BZHB 2F49A 2IWIA 2JKMA 5K3YA 4FKIA 3TKHA 4L9IA 4LL0A 1PHKA 1KE9A 5AUXA 5H9BA 1H1PA 2GNGA 2PVJA 4ACDA 5AP1A 4O2PA 4BC6A 4OR5A 4AZEA 2YM7A 4LRKA 4FKGA 4NK9A 2EXMA 5KHWA 3AC2A 2YEXA 5ANKA 4FKRA 3FWQA 1OL2A 3CR0A 3DFAA 4EORA 4AX8A 3DKCA 3EFJA 3SHEA 3LFFA 2ZYBA 4USEA 5JH6A 4UN0C 4IC7A 2WEIA 3KF7A 3OOMA 4NKSA 4ALVA 4KUJA 3F5PA 1LEWA 3R2BA 4BI0A 4ERKA 4USDA 3E5AA 4DC2A 3W2SA 3ZZWA 2C5OA 4F9BA 3KCFA 3U4UA 3V8WA 2WAJA 5J5TA 3BHUA 1J7IA 2YDKA 4LGHA 2Y6MA 4FTCA 3PVUA 3M1SA 4O1OA 5E90A 3W18A 2X9EA 4G3GA 3EZVA 4KA3A 2VZ6A 5HG9A 4CMOA 5IDNA 1WBNA 4GVAA 2UZVA 3F69A 4H1JA 1Q8ZA 1Y91A 3LCTA 2EB2A 2QOKA 3LPBA 4AUAA 1ZRZA 2XZSA 5CEMA 1REJA 3BYVA 3OT3A 2OKRA 2X8IA 3IDBA 1K9AA 4CFNA 5HD4A 3HLLA 4RVLA 4DH3A 1YDSE 3WF6A 2BMCA 4AFEA 3VWAA 1PRYA 3BELA 5AX9A 3QCQA 4E6CA 2QO2A 4P5ZA 2W05A 4ACHA 4HJOA 5LARA 2W4KA 3SGCA 4A06A 3OEZA 3NDMA 4NJDA 1ZYLA 3PG3A 1PMEA 3HL7A 4CG8A 3QTIA 1J7UA 4S32A 3NMUF 1OL1A 3NX8A 3ZO2A 4QP6A 1OUYA 3DKFA 3II5A 2O8YA 3Q4UA 4FNXA 3FZTA 3ETAA 2XK6A 4Y8DA 5C8MA 2PE2A 3FMHA 4RIXA 4HOKA 4XG3A 3SX9A 1H1QA 4WRGA 5FLFA 5A4QA 3V51A 5EG3A 3CEKA 2W1DA 2AC3A 4OBOA 3HV5A 4TWPA 2LAVA 4AZSA 1SNUA 4BWKA 3KU2A 4FTKA 5CWZA 4XLIA 5AR5A 4QYGA 2A4LA 4R77A 4YO4A 5JGAA 3MVMA 4ACGA 4D55A 2F7EE 3D5WA 4EJNA 5HNIX 4YLKA 5EW3A 3Q4TA 3ZU7A 3ZO1A 2XIRA 3GCVA 4PMMA 3NLBA 1H27A 3RGFA 3GCPA 5CSXA 3KXHA 2P33A 3HMPA 3GOPA 3EN6A 4E4LA 2OJGA 4X3JA 4LYNA 5BVWA 5JFSA 1WFCA 3U6JA 2B9FA 3QTZA 3NVMB 3EQFA 3FHIA 3F3TA 1OZ1A 3FSKA 2VWYA 2WU7A 3GGFA 4JG6A 5EFQA 4F63A 4E93A 5AADA 2V22A 3RVGA 3ZLWA 3UIBA 2I0YA 3MY1A 3TXOA 2BUJA 3BWFA 3ORPA 3KQ7A 3QTXA 2WXVA 4I5PA 2W1GA 2WOUA 3R1NA 3LFEA 4XLVA 4MKCA 4AACA 2W5BA 5A4LA 2CJMA 5HESA 3ZRLA 5IH4A 2VTJA 1JQHA 3MN3A 2PPQA 1U5QA 3A61A 4RIWB 5GIOE 4D2RA 3PRIA 4I93A 3BYOA 3VBWA 5FXSA 2G2HA 4EHZA 4D2VA 3C4XA 3C5UA 5CF8A 5DE2A 5EHYA 4RVMA 5LVLA 1WBPA 5FTGA 3UPZA 1R1WA 1ZZ2A 4DAWA 3ORZA 2WTKB 4RJ4A 2ZB1A 3Q9ZA 5D12A 2B9HA 2H96A 2UV2A 4IEBA 5CALA 3PPKA 5CT7A 2R3FA 4QMOA 4S33A 3DU8A 3UVPA 2YIRA 4GKIA 4ASZA 4B8LA 4ASEA 2OI4X 3G90X 3ORMA 1UNGA 1XJDA 3VO3A 5FTQA 5HTIA 2QLUA 2R3GA 1P4FA 4ENXA 4JBOA 3PSBA 1MQ4A 4FV5A 2GNFA 3V01A 4LUDA 5C26A 4BYJA 5B7VA 2Z02A 3AGMA 3OTVA 4I0RA 5K4IA 4ZMFA 4GRBA 5LWMA 3AT4A 3ORTA 2C6OA 4TYJA 5KCVA 4EH8A 2W06A 3N51A 2YJRA 2R3RA 5FGKA 1TQPA 5HIEA 4AZFA 2OG8A 3NCZA 5AP5A 4DGLC 4FEUA 4O7YA 4RJ5A 4YTIA 3VS2A 3PIYA 2PU8A 4YTFA 3OZ6A 3A62A 2WB8A 4O21A 2UZTA 3THBA 3QC4A 3QQHA 4KBAA 3UOJA 1NVSA 1U5RA 4O0UA 1UU7A 2HENA 3NNXA 3Q6WA 3ENMA 5TE0A 4E6DA 1YXXA 2E9UA 3QQKA 3DBEA 5A4EA 2DQ7X 5AAEA 3TEIA 2YERA 4CRLA 2VTRA 5ACKA 1IG1A 4CZTA 4E5AX 1L3RE 1H0VA 2WU6A 2XJ1A 2YDIA 3WARA 4BBFA 4JG7A 3R30A 3ZONA 3HMIA 4DBNA 2XRUA 4O7ZA 1BUHA 2H6DA 5DN3A 4MAOA 5EDPA 5I5ZA 5JK3A 3EQIA 1AQ1A 3G33A 3FZPA 5LVPA 4GIIA 3B2TA 3NZ0A 4UWBA 4DFUA 4O81A 3NUXA 1KE8A 4G6LA 2FGIA 3R71A 4XS2A 5C8NA 2VRXA 4AG8A 4BB4A 3Q96A 3V5TA 4MYGA 4G3FA 4R6VA 4C38A 3WILA 3LFBA 4XX9A 5M55A 4EK5A 3LMHA 4ZY6A 4KD1A 2Z7SA 1WBWA 2PULA 5D1JA 3BU6A 3U8WA 5CEKA 1GY3A 5M4UA 2YM4A 2XNBA 4KKEA 4EWQA 4NW5A 4L7SA 4A4XA 4OTRA 3HMOA 1VJYA 3QKKA 3ZUTA 4JQ7A 2G9XA 4C34A 5DA3A 5AAFA 3G9LX 4XCUA 5E92A 5BYYA 3KULB 4NFMA 4LMNA 4I21A 2PY3A 3E3BX 4LRMA 4C37A 3P1AA 3RCJA 4DGMA 5I3OA 2CKQA 3PJ2A 4NFNA 2Q0NA 3VBTA 2I0VA 3SQQA 3TIZA 1GZNA 2CNQA 2JDVA 1V0PA 1FMOE 4JL9A 3LQ5A 3Q04A 4O7VA 4CGAA 4Q9SA 5DR6A 3OC1A 4C62A 2CLXA 4ENYA 3H0YA 1YOLA 3EFLA 3HVCA 4KKHA 3RNYA 4JIAA 5CAUA 2HIWA 4YJTA 5JGDA 3MVHA 4O96A 1M17A 4RIXB 5LCJA 4M84A 4OAVB 2OICA 3D14A 4QYYA 4IX5A 1OBDA 2OXDA 5F4NA 2I6LA 3H10A 4BGQA 4G9RA 4IC8A 4MXZA 5M06A 4X3FC 1XQZA 2Y4IB 3L9LA 3O8UA 3PZHA 5M57A 1FVTA 2QR8A 3R9NA 5IQFA 1YXTA 1ZYJA 2QONA 4TYGA 4Q5EA 4DTKA 2V62A 3C4WA 4FV7A 3A99A 3FL5A 4ID7A 1H07A 5BX0A 2QOFA 1Q99A 4F08A 2VO6A 2ITUA 3VRZA 3RM6A 4RZWA 2LGCA 4IJ9A 4W8DA 5HOAA 4FNYA 3IOPA 1GOLA 3KGAA 4ZTHA 3RZFA 4ANMA 4TWOA 4C2VA 3WIGA 2BKKA 3UIUA 3GT8A 2BFXA 3QA0A 1B6CB 1I44A 4RIOA 3PFQA 4BY9E 2QKWB 2P2HA 1F5QA 3VS0A 4YJOA 1PXIA 1RQQA 3PRFA 1U59A 4YMJA 4Q5HA 2XYNA 3F5XA 4OTDA 5CNOA 5IG1A 4NJ3A 4HVGA 5KMJA 4OT6A 3U6HA 4AGWA 1OVEA 4DINA 3R28A 2OJ9A 2XM9A 3DDQA 3EQDA 3U55A 3W33A 3E8NA 4YPDA 3NR9A 4BKYA 4EKKA 4X2FA 3R2YA 2XJ2A 2OIDA 4LOOA 5IA3A 4DEAA 2BALA 3K54A 4EL9A 2CGUA 4X6RA 3MPMA 5IQBA 1U4DA 4QMTA 4H3BA 4C33A 4WNPA 2WMQA 3C4FA 3ATSA 4NEUA 5IA2A 1XH6A 2FH9A 3FI3A 4I5CA 4M69B 1WAKA 3TIYA 2O3PA 1ERKA 3B8QA 4FT0A 4F09A 2ZMDA 4OBPA 5H8BA 4EH7A 4QPAA 4CFUA 2O2UA 3LXPA 3R0TA 4QMVA 1PXNA 2VD5A 4WT6A 1KV1A 2CCIA 2WTJA 3QRKA 4G1WA 3MH0A 3HRFA 1UNHA 5AUVA 3RI1A 1RJBA 2VTLA 3CIKA 2OFUA 3NUNA 5E8YA 4HVIA 4DA5A 4M14A 4U41A 3CJFA 4ANQA 2JFMA 3S3IA 4NW6A 3DGKA 4FL3A 4H3PA 3NVKI 3WI6A 3LFQA 4AOIA 4F0GA 2C5XA 4XEYA 4F9YA 4FV9A 5LVNA 3DXQA 5LXMA 4JDJA 4OGRA 4OTGA 5F94A 4EJ7A 4MCVA 3QKMA 2PVNA 4DTAA 3HDNA 2P3GX 2PSQA 1PMNA 2V0DA 4K6ZA 4M8TA 5KMLA 3BLQA 5JEBA 5M51A 3HAVA 3TDWA 3BBWA 3LOKA 4DEDA 3G6HA 2DYLA 3FKNA 4YUQA 1H0WA 2ZB0A 1O6KA 2I1MA 1B38A 2ITVA 3MH3A 4HPTE 3R8ZA 3Q5ZA 2RFEA 3VW6A 4ANNA 5A3XA 4D2TA 2J50A 2JFLA 5A14A 3O96A 1IR3A 1BYGA 3E8EA 4OAUC 5L4QA 4Y85A 4HYSA 5IQGA 5C03A 3NS9A 4U44A 5H8GA 4AA5A 2BRGA 2ACXA 1A9UA 5DVRA 3H9RA 1XH5A 5EW9A 4DGOA 3AC8A 3MFTA 3RHKA 4G3CA 2IVTA 4QMQA 5LMAA 4MWHA 5FEEA 2HXLA 2GCDA 4WG5A 3P4KA 2IZUA 2IZTA 4U79A 4GH2A 4QP8A 4IANA 1OUKA 2W1EA 4CMTA 3V8TA 4J1RA 1W98A 5DYJA 4GIHA 1E1XA 4KWPA 3DQXA 2C6TA 4PDPA 2UW9A 4N6ZA 4ZTSA 3FC2A 2BAKA 4BDGA 4BDEA 4IVCA 3C5IA 3UIMA 3MS9A 3PIZA 4RWKA 5I9ZA 2Q0BA 2CN5A 3JS2A 1GNGA 3UE4A 4FV3A 5IPJA 2FYSA 4OT5A 4EZ7A 4FUYA 3EKKA 3PA5A 2BCJA 3BV3A 4DFZE 3U87A 4IVAA 3EQHA 3COIA 4L43A 1YWNA 3L9NA 4L3PA 4UB7A 4UYNA 2PZ5A 4IDTA 4IMYA 2OJJA 2WFYA 3MYGA 4MTAA 4MVFA 4NU1A 4RZVA 1P4OA 2V7OA 3MJ1A 3ORXA 5FM3A 3VHEA 4M7IA 4F1MA 2YZLA 2C6MA 1BLXA 1YKRA 5IEVA 3L9PA 1CKPA 5GZ9A 1YQJA 4DH5A 4D5KA 4FT3A 2NRYA 3HV3A 3UP2A 5K0KA 1YDTE 2YM6A 3ZEWA 1W84A
chains in the Genus database with same CATH superfamily
3POZA 1CM8A 4CFWA 1GZ8A 3OW4A 1J91A 2RG6A 4RGJA 5CANA 1YI3A 4IW0A 4ASXA 3MPAA 3CQEA 1ZWSA 3MTLA 3TTJA 1H1RA 4BJJB 5HBHA 2XK8A 4P4CA 3OXZA 3DOGA 3RP9A 4EOQA 5A4CA 1UKHA 4F9AA 3W2PA 3F2NA 2PVKA 4ZTRA 3ZC6A 3M2WA 2QOOA 2QOHA 5JSMA 4LL5A 5K4JA 3FMNA 3C51A 4QQJA 3P9JA 3MFUA 4QPSA 4NM3A 3HZTA 2BFYA 4Y73A 4AOTA 3VS3A 3DT1A 1XMMA 2XH5A 4NWMA 4OTPA 3MBLA 4MK0A 3DAEA 5I0BA 2PUIA 4S34A 4W4XA 4GK4A 2R3LA 4TKSA 2J2IB 3P7CA 4ZSEA 4BCJA 4TL0A 5AV0A 4CFXA 3OTUA 1Q4LA 1FINA 2BTRA 2XNEA 2PYWA 4QQCA 3VUDA 1OIUA 1URCA 4C4IA 4U97A 4BRXA 3DXNA 5BPYA 2BRNA 2HYYA 4YJNA 4HGTA 4U7ZA 3C13A 4EUTA 2A1AB 4KB8A 4OTFA 2JC6A 3BHTA 3HA6A 5DEWA 3TZ9A 2F2UA 3FV8A 2J0KA 3F3WA 1VYZA 4O0RA 4F1OA 4TXCA 5FQDC 3QXOA 4U43A 3CC6A 3PFYA 3DZQA 4AWIA 4O7RA 3LFDA 4DHJA 1ATPE 5IF1A 2PMOX 5JT2A 2RIOA 1FVRA 4I94A 2PL0A 3PE1A 4FZ6A 4A4LA 2QG7A 2JIUA 3RK5A 3TV4A 4AGUA 1DAYA 3BQRA 3KK9A 3QTRA 5LJJA 3HNGA 1ST0A 4LV8A 4B0GA 1BI7A 4LI5A 1WCCA 3R9HA 4C3PA 5HIBA 2ZV8A 4H58A 3MIYA 5AWMA 3V04A 4EOIA 2YZAA 4PRJA 4U9AA 3NGAA 5D7VA 4R7HA 4UX9A 4R5YA 1ZXEA 1Q8TA 1OGYA 1JSTA 4JQ8A 2G2IA 4FSWA 1E1VA 2VTQA 3KRJA 3GC9A 4X2JA 4NUSA 3MPTA 1LEZA 3EL8A 4FVPA 3JR1A 4KIPA 4FGRA 2IW6A 4MHAA 3BHYA 2X2KA 5CX9A 2ZJWA 4EEVA 5HZNA 4MH7A 3KRRA 2VNWA 4U3ZA 4L01A 5E8TA 1GJOA 4AW0A 5JRSA 3RPYA 1M7QA 3NRMA 2BHEA 4XUFA 3AC3A 3RPRA 4E5WA 1DI9A 2BKZA 2B55A 2C0TA 2CGVA 4BCPA 4O6LA 3UP7A 4TWCA 3FLNC 4KS7A 3R8PA 4FR4A 1XBBA 3N4UA 4FKJA 4X2KA 3MWUA 4F4PA 3KRLA 5HU9A 3ACKA 3EFKA 4BDJA 2VWXA 4BCIA 3VBQA 2VUWA 5HNBA 5BV3A 4ZP5A 4A9TA 4DEBA 2CSNA 1G8KA 3BL9A 3GP0A 4U42A 4YNOA 4E7WA 4FL1A 1GZOA 4GMYA 4S2ZA 4XV1A 4DLIA 1XHAA 3Q52A 4UEUA 4CV8A 4DEEA 5J1WA 4J98A 1UV5A 4AAYA 4UMPA 2XB7A 1Q62A 5CI7A 3VUTA 1Q41A 5FG8A 4GFGA 2VTIA 4MWIA 4FTNA 3LJ1A 4F99A 4IWPA 3TUCA 3VONA 2UW4A 2WOTA 3DPKA 4E5BA 3HYHA 4C3RA 4H39A 4W4YA 4E4MA 1OKYA 4O7TA 3KL8A 4NCTA 4YBJA 4K77A 3QALE 5A6OA 2VTAA 2ZM4A 1O6LA 4WO5A 2XIXA 3FLZA 2XMYA 3W0NA 5IUGA 4ZLZA 4MXOA 4FG7A 2J90A 3FZOA 1ZYCA 4FK6A 3DQWA 2C3JA 2C6LA 3EN4A 5AP7A 3LLAA 3VBXA 5DGZA 3V5PA 2WMRA 5EYKA 4XOZA 3F61A 2C1BA 4I20A 5EI8A 3ENHA 3R6XA 5E7RA 3VF9A 4ZIMA 2J5FA 3OY1A 2VX3A 3LCDA 4F0FA 4D9TA 2RF9A 4FZDB 3S95A 3O8TA 5EM6A 2IVSA 4BKJA 3JVSA 4EH9A 3MH1A 4LV5A 5AA9A 1PKGA 2VWWA 4PY1A 1LUFA 2BIYA 3WYYA 5HTBA 5AIRA 4F6WA 4HCTA 4FODA 4G6OA 3V5WA 3EYGA 2ERKA 4DGGA 4QMXA 3D94A 4IAZA 3TACA 1OKVA 4BF2A 5DIAA 2JEDA 2YAAA 2J0IA 3TV7A 3QQFA 5BMMA 3LMIA 2FSLX 2B7AA 3DA6A 5CEIA 4B4LA 3W32A 5HE2A 3NYOA 4RWJA 1ZLTA 4CZYB 3MY0A 3Q60A 5GZAA 4L53A 3R7YA 2W96B 2XNMA 3AGLA 1REKA 3GEQA 4QMZA 5KHXA 3EZRA 5DT0A 2ZM1A 2C69A 3U9CA 1M2RA 2JDRA 5GHVA 4FEQA 4EC9A 2X4FA 4IIRA 5JQ8A 3Q9XA 2NPQA 5TF9A 2C3LA 2GS2A 5K0XA 1FOTA 4U80A 5GIPE 3KN6A 2B52A 1KWPA 4FMQA 2XCHA 5HKMA 1JPAA 3ZXZA 2ZV7A 3U6IA 5IMXA 3ALOA 3KCKA 4ZXTA 3O50A 3QCSA 3ZMMA 4F70A 2YM5A 4CKJA 4FG8A 3PA3A 2J0MB 4UMQA 2QOBA 4GUEA 4EHEA 1ZYSA 1TQIA 2WQMA 2CMWA 3K5VA 3UPXA 4FKPA 4NTSA 2VWBA 4O0VA 3V6RA 4AE9A 3AKLA 2WIHA 4CG9A 5KUPA 3IGGA 3U51A 5T68A 5TT7A 3Q3BA 5CQUA 4ZJIA 3NPCA 3LJ0A 3ZBFA 4DFLA 4F7NA 4FT5A 4CYIA 5TR6A 3CKWA 4PV0A 2WTKC 3OCBA 3FZSA 4LOQA 4TW9A 3NIEA 3DKGA 4O86A 1Q8WA 3ORKA 1ZMVA 4KIQA 5IUIA 2J4ZA 5M09A 3C0HA 2Z60A 4FSRA 3UOLA 4A4OA 4NYEA 5CAQA 2PMNX 4EH6A 3KVXA 4BCMA 4G16A 3SG8A 4J97A 2NO3A 2OIQA 4AXEA 4FT7A 4O83A 3UGCA 3RMFA 3PJ1A 5J9LA 4MXCA 2FSTX 4UY9A 3LCKA 2HWPA 1NXKA 4IB3A 4ZSGA 4PTCA 4DFYA 3R22A 3V6SA 3KULA 5CENA 4XP3A 2R3IA 4N70A 1NT2A 4I6FA 2X8EA 3EQCA 5E8UA 1LR4A 3P0MA 4MF0A 4QMPA 2VGPA 2VWUA 3VQUA 3IQ7A 5HG5A 2BRBA 3QLFA 4ZTQA 4I22A 3BLAA 3D7TB 3O17A 4BKZA 4W9XA 4YTHA 1TQMA 4FV2A 3DJ5A 1HCLA 2CGWA 2PK9A 3RTPA 3FJQE 4DHZA 3OCSA 5L8JA 1NVRA 2C0IA 4R8QA 4BZNA 3L8PA 3O7LB 4IH8A 2CLQA 4F6SA 4RJ6A 4HGLA 3W0SA 3IW8A 4WUNA 3G9NA 1VR2A 3UO5A 2VNYA 3O51A 1YVJA 2VGOA 3FBVA 4YJSA 5J9YA 4JT3A 4FE2A 4DLJA 1JNKA 2JAVA 2UZNA 2WTIA 2Z7RA 3K3JA 3KMWA 2VWZA 3L8VA 4FIEA 3R1SA 4YP8A 1BI8A 2JDTA 4JIKA 2YLEA 4K9YA 4YJQA 2RFSA 5L8KA 3TM0A 3OUKA 4U5JA 5BVEA 2Z2WA 1RE8A 5EKOA 3FI8A 5J7BA 3IW6A 3CBLA 3T9TA 1UVRA 3C4ZA 3MVJA 2WD1A 1UNLA 2W1FA 5DRDA 1IEPA 1JVPP 3QAME 1JOWB 2VTHA 2YCQA 4F9CA 1OECA 3ZM4A 5D9HA 3CGOA 1BX6A 4EQUA 4IAAA 5J9ZA 4O84A 3R8LA 2WTCA 3WZDA 1LPUA 5I9VA 5HG8A 3TN8A 3SA0A 5TKDA 5K5XA 3MIAA 4FUXA 4MBJA 3DB6A 3GU5A 4FIIA 3IW4A 4C7TA 3QX2A 1CSNA 1Y8GA 2BAQA 3NWWA 3KRWA 3HP2A 4FIHA 3I60A 4PTGA 3CE3A 3NYVA 4KKGA 4M97A 2FVDA 1VEBA 2G2FA 3GQLA 4I6QA 4JS8A 5H8EA 4AN3A 3P78A 2JKOA 4EK6A 1OPJA 2R3KA 4AS0A 3AC5A 3LMGA 5CEOA 3L1SA 2PZIA 4RIYB 5F9EA 2OXXA 2EXEA 5CS6A 4RPVA 2HY81 1S9IA 4PP9A 3RAHA 1MRUA 3UG1A 3COHA 4FTIA 3FY2A 3OF0A 2XKDA 4GVJA 4HGEA 1OIQA 2YM8A 3IECA 2GNJA 2XNOA 3I5NA 2I0HA 3CJGA 4F0IA 1PKDA 4IDVA 4TT7A 3OY3A 3ZUVA 3HA8A 2IW9A 4BTFA 4IM0A 3F7WA 4UV0A 4YZDA 4QNAA 1M7NA 4M69A 3CGFA 3RKBA 2VO0A 3BHVA 5D10A 3PG1A 2Y4IC 4PL5A 5CQWA 3QL8A 3QZGA 4LRJA 4TTHB 3FYKX 4B6LA 3CCNA 4EQCA 2ETKA 4RC4A 2KTYA 4HYUA 4TY1A 4ZZMA 3A7GA 4LOPA 4KS8A 3MVLA 3ZSIA 3A7JA 3GI3A 1FVVA 2UW5A 3IPHA 3E64A 3NUPA 2RFDA 3NUSA 4QMWA 4WUAA 5HCXA 3VBVA 4D2WA 2OLCA 4YJUA 1OIYA 5A46A 3DXPA 3PA4A 2GHMA 3UZPA 2GTMA 4I0SA 2PVRA 3EN5A 1OB3A 4YNEA 4M12A 3PXQA 4Y72A 5K9IA 4EC8A 4RT7A 1W0XC 1UA2A 4F65A 1VZOA 2PMIA 3R7OA 3PXZA 2IJMA 3N9XA 4J7BA 4K2RA 3LQ8A 4L3JA 3BE2A 2WEVA 4XG9A 5EQEA 2QURA 3F2AA 3PJ8A 4ZS0A 3PLAE 3PVBA 3D83A 5EM7A 3SG9A 4P5QA 3TZ7A 5DR2A 1WBSA 2F7ZE 3BLHA 3KFAA 4NT4A 2IF8A 5AR4A 4KINA 1G8JA 2BRHA 4PPCA 4ORKA 4XP0A 4CNHA 2WPAA 4MNEA 4UXQA 2YISA 3FE3A 5HLNA 3UDBA 4TZRA 1GIJA 4ALUA 2YAKA 4BDFA 4EWHA 4PNKA 3KXZA 2XK7A 3BBTB 3R00A 4QP3A 3IK3A 5HICA 4EH2A 4YZMA 5LMBA 2CNUA 3I0OA 1PYXA 4MEDA 5KE0A 3T3UA 4C3FA 3W2CA 3ZHPC 5BUIA 1QL6A 2R4BA 2C3IB 4HCVA 1G5SA 5F20A 3CPCA 3I6UA 3BL7A 4IX4A 4OTWA 3COMA 3ET7A 3BGZA 3OBGA 1B39A 4FKVA 3W8QA 2UZUE 1R0EA 3D15A 4XRLA 4IAYA 1BMKA 4AP7A 4ARKA 4EOMA 2HOGA 2C6DA 3DAKA 3FY0A 5FBOA 4MXYA 4O82A 2C4GA 4PL4A 4W9WA 4RX9A 3HRBA 5IKWA 3WF8A 4E8AA 4EONA 5AJQA 3FKLA 2QVSE 3D9VA 1YI6A 3MDYA 3VBYA 3UG2A 1YRPA 2C68A 3AXWA 4JLCA 4D4RA 2P4IA 2QKRA 3C50A 1JAMA 4FTAA 2B1PA 2GFCA 3CS9A 2VX0A 4JR7A 2QO7A 2W1IA 3ZRKA 3QCYA 4L45A 1KUTA 4L8MA 1ZMWA 2QOIA 4ITIA 4Z7HA 5EM8A 2GQSA 3R83A 3H0ZA 5AM6A 3TNIA 4C4EA 3DBQA 4AXAA 4JBVA 2B4SB 1MP8A 2V5QA 2OSCA 1YXVA 3F3VA 3GXLA 4D2PA 4EK4A 4FEWA 1FGIA 3CY2A 2JKKA 4FL2A 3ROYA 5EKNA 4E26A 2GMXA 1H24A 3WZUA 3C4EA 4RLLA 3EYHA 3QBNA 3L9MA 4RX8A 4CRSA 3EN9A 4X7QA 2HZIA 2BR1A 5AR3A 2XK3A 4K18A 3MFRA 3R7IA 1J7LA 1SMHA 2YCRA 4AA0A 4AZVA 4FKLA 1H00A 4YBKA 4EOPA 1OL7A 5EHLA 3AC4A 3E62A 4FX3A 4IFGA 1W82A 4HVHA 3FQHA 1K3AA 5IEXA 4FSNA 1O9UA 3POOA 3PP0A 4C57A 3BYMA 3PE2A 4KIKA 5FWKK 2HZ0A 3LW0A 4Z7GA 4LV7A 2FO0A 1YI4A 2I40A 1JKKA 3E8DA 5BUJA 3HUCA 4QO9A 5EW8A 5HO6A 5AR8A 4YHJA 4BCKA 2XARA 3G15A 1F3MC 3CQWA 4PWNA 4BCFA 2EVAA 1V0BA 3G6GA 3OXIA 1OPLA 5ANDA 4R7BA 1SVEA 3DLZA 1W7HA 5DI1A 4JI9A 5E8XA 4RQVA 4XMOA 3ZTXA 4DDGA 4HYHA 4JVGA 5E8ZA 4RFMA 3OD6X 2OF4A 2VWVA 5DOSA 4O1PA 2XKCA 2JDSA 4M0YA 4NM5A 4XRJA 3WIKA 2R2PA 5AP6A 2YLFA 1KE7A 1PW2A 3QHRA 4BIEA 3QTSA 5HO7A 3TUBA 3TKUA 3A8XA 4IXPA 4EZ5A 4O4EA 2R3QA 5FD2A 1FMKA 4KABA 4NM7A 4WD5A 3SOAA 3SW4A 2G15A 4TNDA 2W0JA 4IFCA 5FXQA 5JKGA 1RW8A 4F7JA 3F3ZA 2CGXA 2FB8A 3EQBA 4L44A 4CQEA 5A9UA 3F88A 3QD4A 3NUAA 2XS0A 3QRIA 3GCUA 2PUUA 3COKA 4IM2A 1H26A 2R7BA 4U40A 1UU9A 4TPTA 3GBZA 3UC3A 2RFNA 3HUBA 2OFVA 3NW5A 2UZEA 3GFWA 5IISA 1YHSA 3KEXA 2YWPA 2GNHA 2VTOA 4FJVA 2WKMA 4EUUA 3LJ2A 4N6YA 5AP4A 1YW2A 2WHBA 4PPBA 4APCA 5CASA 2QI8A 5M07A 5I4NA 4Z16A 5HVYA 4PF4A 1ZY5A 4C36A 5A4TA 3ZZEA 3V8SA 2ONLA 2X6EA 3K2LA 3Q32A 4GG5A 4OTHA 4CLJA 4E3CA 3R01A 5HCZA 3RZBA 5DBXA 1J3HA 4DFBA 4XG7A 2X2MA 4BYIA 4Q9ZA 2YHVA 5AUZA 5HE0A 2FA2A 2YFXA 3K3IA 1TVOA 1Y57A 1SZMA 3TJCA 3IGOA 4FSUA 2OZAA 2GHLA 4I6BA 4HVDA 2O65A 4Y83A 2OH4A 2X39A 2X0OA 3GC7A 4JQEA 4BWPA 4JMQA 4ZSAA 1GZKA 2IN6A 3CLYA 4UWCA 3FYJX 2A2AA 4DG0E 3PP1A 3OVVA 1H08A 2YIXA 3FC1X 3PWDA 4O91A 4O6EA 3MI9A 5M08A 3GVUA 4J95A 3N4TA 3VC4A 3RM7A 2BILB 2Y6OA 4V04A 5JRQA 4RJ7A 2R3OA 3D5VA 5EDRA 2ITWA 3UODA 3DBCA 3P86A 3TNQB 4MNEB 4CTCA 3ZXTA 2GS6A 3W2QA 3WYXA 4ZZNA 4AA4A 5IDPA 4XG6A 2AC5A 3AMBA 4R3PA 2WMXA 2QG5A 1KV2A 4L67A 2ITZA 1UU3A 2HWOA 4GK3A 4J52A 5ANGA 3OCGA 3TNPC 4IZ5A 3PY3A 3QD3A 3W0RA 3ZO4A 3BWJA 5CU6A 2J9MA 2Y8OA 2X0PA 5CF5A 2VN9A 3QCXA 3ORLA 3DV3A 1Q8YA 2ONLC 3E8CA 5HTCA 1OL6A 1LP4A 2WMBA 4DG3E 4CT1A 5AMNA 3JVRA 5LOHA 1YHWA 3EQRA 4I41A 4WSQA 3SLSA 5BYLA 4Y46A 4FKUA 4I4EA 2HCKA 1Y6BA 1E9HA 1OI9A 4MBIA 2HW6A 4CFMA 5JFXA 4LGDA 2C5NA 1XKKA 4FEVA 4H3QA 4E20A 2WNTA 4BHNA 4PDYA 5I9YA 5DRBA 3VUMA 3QQJA 4E73A 4YO6A 4EK8A 3VUGA 4ACCA 4K1BA 4YC8A 5E8WA 1OITA 1P5EA 4EHVA 4KBKA 3JUHA 1TFFA 4X0MA 2GQRA 4WOVA 5C27A 4XV9A 3EN7A 4QEBA 1YOJA 1QMZA 4QT1A 3DFCB 3F5UA 3RBWA 3DLSA 1HOWA 5KZ0A 3WF5A 1XWSA 4NL0A 4N4SA 4JR3A 3UMWA 4FSYA 5C1QB 4AU8A 5L6PA 4BDDA 2GFSA 2JGZA 4I23A 5AV2A 2VTNA 2P2IA 3C4CA 4QYEA 5C8KA 3UZTA 4GS6A 3ODZX 3QGWA 4TYEA 1IA9A 5IA0A 2W4OA 4V0GB 3ZLYA 3CPBA 3V5QA 3ATTA 5AV1A 4IWDA 4KIKB 4Y5HA 4A9RA 2UZBA 3GNIB 4F7LA 4GSBA 2WMTA 5M4FA 3O0GA 3MA3A 3ZLSA 4DYMA 3ZYAA 2VV9A 3TKIA 3VN9A 4ERWA 2SRCA 4FTJA 4QQTA 5EH0A 4HVSA 3GOKA 5GNKA 5ACBC 2F57A 2J7TA 1QPDA 3VS5A 4L00A 3JY0A 3O7LD 5CY3A 5IQDA 5E1SA 4ZOGA 3LM5A 5HCYA 2OGVA 4M66A 5A6NA 5E9EA 4FIFA 2YIWA 1T46A 2YM3A 3DAJA 4ZSLA 4FF8A 4YPSA 2IVUA 4EBWA 2A19B 4GFOA 5TOZA 2EXCX 4AW5A 3D7ZA 2CDZA 3KXMA 3T9IA 4PMPA 3PSDA 3NNUA 2WTWA 5G1XA 4D0XA 4D4VA 5DT4A 4A9UA 3H9FA 4Z55A 5KBQA 2QHNA 4PTEA 4KNBA 2XBAA 3VS7A 4PP7A 3NW7A 2HZ4A 4U3YA 3RPOA 1ST4A 4CV9A 3S0OA 4Q2AA 3BRBA 3LFSA 4QP9A 4WG4A 4O2ZA 4WRSA 3IDPA 3G5DA 3MSSA 2W1CA 4FA2A 3DTWA 2DS1A 3FLYA 4OTIA 5LWNA 4XBRA 4PMSA 1J1BA 2QOLA 2JBPA 3TV6A 3PUFC 4E6QA 4I6LA 4AQKA 4I5HA 3QWJA 4BCHA 2WMUA 2C1AA 4AFJA 2YCSA 4DTBA 3SXSA 4FV1A 4IADA 1WBOA 4YJRA 1OPKA 1JWHA 2BHHA 4BDIA 5DHJA 2R64A 4JAJA 3H4JA 4FV0A 3AD5A 1GIIA 3GFEA 2QOCA 3BEAA 1W2FA 3DK6A 2B0QA 5ANIA 3D7TA 3VIDA 3C7QA 2X6DA 3HX4A 4FRFA 1XBAA 3FUPA 4GFMA 4KSPA 1U46A 1Q3WA 3Q53A 5C01A 4E6AA 2YACA 3BYSA 1T45A 2OK1A 3QUEA 2E9VA 4AN9A 4BR3A 3E3PA 2W5AA 4QTDA 5CVFA 1X8BA 3GU7A 4O0XA 4R1VA 3O8PA 1FGKA 5AR2A 2OZAB 5EI6A 3E93A 4NZWB 1Y6AA 5FEQA 4LQMA 4JDIA 2XKEA 4EOSA 4QTEA 4YJPA 4O7NA 2BAJA 4JOAA 4X2GA 2HZNA 4XYFA 2DWBA 4I4FA 2X2LA 4DCEA 3KY2A 4LMUA 4IAFA 2V7AA 3KB7A 3OWPA 5IA4A 2JLDA 4EOJA 2XVDA 4A9SA 4D4YA 3PWYA 4MD7E 1YWVA 4R7IA 1WVXA 5FEDA 3FLSA 1DAWA 4J8NA 4HNIA 1DS5A 3NAXA 4UYAA 5LMKA 2IG7A 5BVNA 2F2CB 4TRLA 1M14A 2PHKA 4UMRA 5CZHA 4BTMA 3HGKA 3OROA 4MQ2A 1PXOA 3WZEA 4DEHA 2JDOA 2NYAA 5C4LA 2UW0A 3G0FA 3KXNA 3S1HA 3A60A 3ZEPA 2QO9A 3KA0A 5F95A 4RIYA 4U0IA 2R5TA 3CKXA 2C5VA 3GC0A 4IWQA 3SC1A 3DK7A 4ZJVA 1Y8YA 4TNBA 5ICPA 4A07A 1G3NA 1H28A 2ZV2A 3NUUA 4FTTA 1W2CA 1PXMA 4NM0A 3RPVA 3UVQA 5FBNC 4XNEA 5DEYA 3G51A 4BDCA 2XNPA 3MGYA 3ZC5A 5AUWA 2XRWA 4BDKA 3BU3A 2A0CX 4FT9A 4YLJA 3PDTA 4E4XA 4CEGA 3BIZA 3HV6A 3CP9A 3ULIA 4QMSA 4AW1A 4J99A 1F0QA 2WMWA 4LG4A 4DGNA 4YU2A 4FYOA 2PUNA 4RX5A 3W2RA 5D11A 5DNRA 3UQFA 1IAHA 2XCKA 4IVDA 4XJ0A 4CCBA 3Q2JA 3D4QA 4KAOA 1YHVA 5AUUA 4KRCA 4XHKB 5DMZA 3SW7A 2J0JA 2F7XE 4QPMA 4AT3A 4JDKA 3HRCA 1V1KA 3R7VA 3SDJA 4RA5A 5I3RA 3WF9A 4G3EA 2R3NA 3M42A 2GSFA 3NFFB 2XEYA 4F9WA 3BGPA 3WBLA 4IAKA 4AXDA 3CTQA 2R3MA 3PLSA 4JAIA 4PDSA 1FQ1B 4BDAA 5LMKC 4L7FA 1OIRA 2UZLA 4DFNA 3FMMA 5KNJA 3HAMA 3WOWA 2X9FA 4FIGA 4NCTC 4BCNA 3NAYA 5G6VA 5L2QA 1WZYA 3SRVB 3BZ3A 2PVYA 5ANOA 3VS4A 3IS5A 5HQ0A 2J6MA 3E87A 2W9FB 5CAOA 3CD3A 3AKKA 1KE5A 4PX6A 5CU2A 4IB1A 3LLTA 4H1MA 2H9VA 4YJVA 4YGAA 5EYDA 2VAGA 5HG7A 4BZDA 1G8AA 4AN2A 5EK7A 3JY9A 3BI6A 1BL7A 3LFCA 3PXKA 3UOHA 5IMEA 4QTBA 4BCQA 4IAIA 2R7IA 2WQOA 4EBVA 1Q24A 4QMMA 3E92A 4Z9LA 5ETIA 1OBGA 4QOXA 4GJ2A 3F66A 4C4HA 3QUPA 2NP8A 1O6YA 2W7XA 3DZOA 3UOKA 3LM0A 3FXWA 4AZWA 3GUBA 4FI1A 4FKSA 1P14A 2JIIA 5DG5A 1Q97A 3QWKA 3ZCLA 4OBQA 3ZS5A 5HU3A 5CAPA 2C5YA 1YOMA 2PZRA 4QYHA 3PVWA 3BU5A 1ZAOA 1A48A 4PNIA 3R8VA 1ZZLA 2QD9A 2PWLA 2E2BA 3PZEA 3EWHA 2BZJA 2IO6A 3TL8A 4F78A 5H2UA 3BV2A 3ZFXA 3AOXA 2UW8A 4WNMA 4D0WA 4RX7A 1NA7A 2X1NA 4YSMA 4ZMEA 2BVAA 2OO8X 5GZ8A 4FV4A 5AUYA 5IQEA 5ITAA 1YXSA 3AG9A 5IQIA 4R3CA 4IX3A 4EYMA 5KMIA 1V0OA 2GPHA 4IQ6A 2UVXA 4L42A 4CXAA 1OM1A 1H01A 3W16A 4IWOA 1DM2A 5L2WA 2R0IA 4V01A 3KIOC 3PY1A 4PL3A 4ZJJA 3MTFA 5BVOA 1XH7A 5L2TA 3FMLA 3R73A 3VJOA 2E9OA 3EQPA 2ITNA 3ZRMA 1URWA 4MQ1A 2ZDUA 4D1ZA 2IEWA 2YIYA 3FQSA 3DY7A 2B9JA 5AV3A 4CFFA 4MX9A 4FOBA 1JBPE 1ZOHA 4CVAA 5KMKA 2PE1A 3DKOA 3ORIA 1UWJA 5M4IA 4YHTA 3AC1A 3KREA 4BDHA 3P5KA 1WVYA 3DCVA 5KZIA 1W83A 2JKQA 3ZFMA 1Q3DA 2RKUA 5CSWA 2ETMA 5L2IA 2QLQA 3HDMA 4AT4A 4AT5A 4QP4A 3FMEA 2OXYA 3DK3A 5HHWA 4D1SA 1ZMUA 4EQMA 5CEQA 2BDWA 5KMMA 1TKIA 3BX5A 3AMYA 2QU5A 3DJ6A 5CU4A 3TG1A 4NSTA 3BQCA 4XOYA 2FUMA 5D7AA 3RK7A 5L2SA 3LXKA 4O0YA 3ROCA 2PVFA 1IRKA 1Q8UA 3A4OX 4YC6A 3IW7A 4MD9E 5IH5A 4FEXA 3LHJA 2UUEA 4GW8A 4H05A 5C4KA 2XAMA 1BL6A 1OGUA 2PVMA 2QCSA 4HPUE 3ZBXA 4HW7A 4GV1A 4I24A 1IASA 2OBJA 2OJFE 3FDNA 5H3QA 4NH1A 1SVGA 2RG5A 2UW6A 5D41A 4BHZA 3UNKA 5F1ZA 3IKAA 5LVOA 4MF1A 3A7FA 3TNHA 3EL7A 3LVPA 3Q9WA 5HD7A 4RLKA 5IA1A 4V05A 3SOCA 4EH3A 3PIXA 4QQ5A 2W1HA 2XKFA 4FKTA 5FRIA 1WBTA 3VJNA 2XF0A 5BVDA 5JQ5A 3LFNA 4G9CA 3LZBA 3U54A 4GCJA 2XYUA 3QC9A 4D5HA 2V55A 3OT8A 5EHOA 4O4BB 3UJGA 1QPJA 4XP2A 3LIJA 1U54A 2PZPA 2VO3A 5FXRA 4P2KA 4M68A 3H9OA 2GNLA 3CXWA 4D28A 2YIQA 5I9XA 3R7UA 2GHGA 1JSUA 4M3QA 5CVHA 2R3JA 3I6WA 4FKOA 4I92A 4WNKA 5J7HA 4DT8A 3QD0A 3D5XA 5KKRB 4AF3A 2HW7A 4Z3VA 4IZ7A 4FSTA 5IQCA 2H34A 5CSHA 1GIHA 3F5GA 5CU0A 5IU2A 1PXPA 4FC0A 3BPRA 3Q6UA 2PVLA 2WTDA 4DT9A 5DT3A 3D2KA 4O0WA 3DB8A 4JX7A 2CN8A 1Z57A 2O0UA 4N57A 4N0SA 5CNNA 2BZIB 4FSMA 4GJ3A 5HEZA 4TYHA 5KX8A 1W8CA 3ELJA 3PVGA 5HNGA 3OHTA