4F0IA

Crystal structure of apo trka
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
284
Chain Sequence
CVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPDKMLVAVKALKSARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords High affinity nerve growth factor receptor
publication title The Crystal Structures of TrkA and TrkB Suggest Key Regions for Achieving Selective Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 284
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f0iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f0iA01
2R3FA 2PYWA 1OKVA 4K6ZA 1B38A 2WEVA 2X4ZA 2YAKA 3L8SA 4C33A 4O84A 2VN9A 4BZOA 4DEIA 5D7VA 2XYUA 3FSKA 2QR7A 2VNWA 4IZ7A 3TTIA 1VYZA 3F66A 3JYAA 3PXFA 3D5WA 2QNJA 4TKSA 3NUUA 2PUPA 4QTBA 3OFMA 3UNKA 1TQIA 2B4SB 4BIDA 4M84A 3W33A 2WTVA 4FT0A 2HK5A 4GEOA 4H36A 2ERZE 4FV3A 3RBWA 4JBPA 4NW6A 3QD4A 5HNBA 1JNKA 1M14A 1FVTA 1G5SA 4HCVA 4CV8A 3AG9A 5ANIA 3FY2A 2R5TA 5GIPE 4XUFA 4E3CA 4NTSA 3PVUA 2EUFB 4EHZA 5HCZA 2ONLA 1OECA 3VS7A 5JGAA 3UOJA 4BI2A 1GY3A 3FZPA 1UWJA 3JS2A 3JVSA 4EH2A 4EKLA 4BCJA 2YACA 3QL8A 4O38A 3CXWA 2O8YA 3WF7A 3OXZA 2O5KA 3V01A 2GNGA 4ERKA 2R3HA 3BGPA 2PUNA 3RK9A 4NYEA 2C47A 3LKMA 4I0SA 3NNWA 3QGYA 5A14A 4FF8A 5EDRA 3DZOA 3DFCB 2WMRA 4FTCA 4D2PA 4LRJA 4W4WA 4IDTA 1OBDA 5HVKA 5CEOA 1GIHA 2YCQA 3M11A 3PXYA 3R8ZA 5IEVA 2P2HA 4OBOA 2P4IA 2H6DA 3O96A 5IA5A 1CTPE 3QA0A 4AOJA 5T3QA 3V6RA 3RINA 4U7ZA 1OBGA 4FV6A 2OG8A 5AP5A 1R0PA 2GMXA 4FL3A 2XF0A 3UG2A 4FSZA 5FWKK 2GNLA 5ETFA 3ZO4A 4FR4A 1OM1A 3MA3A 3U9NA 1Z57A 3HRCA 3NW6A 4R6VA 2NRYA 3DXQA 4XRLA 4AFEA 4O7ZA 4FOBA 4JDHA 3O7LB 3SLSA 4BIEA 3QTQA 3ORMA 2Z7LA 4WNOA 1LUFA 5LMAA 5HE3A 2GQSA 1YWRA 3DA6A 2W1GA 4PTGA 4HYUA 1UV5A 3ZTXA 3LQ3A 3R00A 4GU9A 2OFUA 5GJFA 3SXFA 4M97A 3TNHA 3AXWA 3O71A 3FHIA 1OITA 2WIPA 2UV2A 3KVWA 4KINA 5IUHA 2OU7A 3E88A 3QCQA 1XO2B 4B8MA 5AR2A 1PXPA 4TYIA 4HW7A 3ATTA 2ITOA 4DEBA 5I9UA 4USFA 4FVRA 3PJ8A 4L68A 3ZSIA 1UWHA 3FI4A 3VS4A 3AMYA 3FKLA 4ZTHA 4EH5A 3TDVA 5JQ8A 3B8RA 4LUEA 4RZWA 1YHVA 1ZYDA 2WFYA 2YFXA 4YZMA 5CSPA 3MIYA 2W4JA 3NLBA 5ICPA 3K3JA 1ZYLA 4OBPA 3R0TA 3JY9A 1VZOA 4MNEB 1H8FA 1OPLA 4JX7A 1RQQA 1V0OA 3KXGA 5FGKA 1YI3A 3Q9XA 3P9JA 1L8TA 4CEGA 2QOQA 4IJ9A 5CU6A 4DGLC 3HYHA 5AADA 1L3RE 1KE6A 2X2LA 2GDOA 3P1AA 3V5JA 4CFVA 4QP2A 2YJRA 5AM7A 3QQHA 2B0QA 1RE8A 4O7SA 4KAOA 4G34A 3VWAA 4ZY4A 1FOTA 4CLIA 4XHKB 3EMGA 3EFJA 5HTBA 3II5A 4RVLA 3SQQA 4JAIA 2NRUA 2C6TA 4YO4A 5FEEA 5FP6A 4QYGA 1GIJA 4IDVA 3NMUF 3IS5A 3EH9A 3KF4A 5BVOA 1J7LA 5FEQA 2X81A 4RC3A 4K9YA 4LV8A 4F0GA 3EJ1A 4A9RA 4HGEA 2PVKA 5L2IA 4NWMA 3DXNA 5LCKA 3R7OA 3CEKA 3CJGA 3QZFA 4FT9A 5DEWA 3VRYA 3VBWA 4ASZA 4TYHB 3BBTB 2HOGA 2PVLA 4IADA 3KCKA 1GZOA 2OF2A 4CKRA 2YM6A 4XOYA 3KF7A 3BYUA 3LXNA 4JOAA 4F0FA 1U5RA 4JLCA 5HHWA 4C61A 3TG1A 5HD7A 1KUTA 2YZAA 4WD5A 5KX8A 2BHEA 3R7IA 3QD0A 3VQHA 2B1PA 3MH3A 3S3IA 4BBFA 2O3PA 4YO6A 5ACKA 4AGWA 1GJOA 5EI8A 5JSMA 4OTDA 3BWJA 5BVEA 4EZ3A 4YURA 3NW5A 3LOKA 2YCSA 4MNEA 4CYJA 5A4TA 3N4VA 3RP9A 3RK5A 5H8GA 4Z7HA 4P4CA 4P5QA 4RJ6A 4S32A 5LQFA 1PXLA 3NYXA 2WMQA 3QCXA 4FX3A 3ODZX 4D2WA 4CT2A 3PZEA 3QXPA 4C57A 4DITA 4D4YA 4EOSA 3VUHA 5EOLA 2HENA 5GZAA 2ITXA 3GEQA 4F7NA 4IVBA 4ZLZA 4G9CA 4OTFA 1SMHA 3KGAA 2NP8A 2GS2A 3Q9ZA 3L1SA 1BL7A 3D7TB 4L42A 4J99A 3WE8A 4DGMA 5E9EA 1Q5KA 4DFUA 4ZJVA 4L3PA 1NA7A 3TUBA 1G3NA 3A4PA 3MESA 3TWJA 3OWKA 4I5MA 3W2QA 4GIIA 2AYPA 5D41A 3RZBA 4BKZA 2B55A 3CTJA 2PK9A 4WBOA 4JDKA 3ODYX 4YPSA 5HICA 3UP2A 3VJNA 1H1RA 2C6KA 3BYMA 4V01A 2UW0A 5JRQA 3NPCA 4X6RA 3RCDA 4IEBA 2X6DA 3MVMA 1HCKA 4YGAA 3RNYA 4AS0A 1LEZA 4I3ZA 4QYYA 3RTPA 3TEIA 2UZBA 3VNTA 3D5UA 1JVPP 1WFCA 4EOLA 4YJQA 2C5VA 2C6EA 3GU4A 3FL5A 5HOAA 3N4TA 3CD3A 1CSNA 2BZHB 3QD3A 5M51A 4LGHA 4RWLA 4DBXA 4EYJA 5K3YA 2YM8A 4BBMA 3ZUTA 5DR6A 1CKIA 1GNGA 4IAKA 3FV8A 2CSNA 5HCXA 3QRJA 5TKDA 3NNXA 4FTLA 4AZTA 4BCMA 4C7TA 4F7SA 5IQDA 5IISA 4S34A 3HMMA 2RG5A 3PXZA 5GZ9A 5A4LA 3EB0A 3LCOA 4ZSEA 4DTKA 3NSZA 4YTCA 4ONAA 2ZV7A 4GK3A 2J5FA 2WTKB 3TCPA 1XHAA 4JR3A 4QMSA 2CGWA 2ITZA 3PWDA 3MTLA 2WMXA 4A4XA 3R1YA 3NUYA 4FNYA 1S9JA 1ZARA 2IZSA 5HLNA 5IQAA 4DH7A 1WZYA 3KRJA 3OCGA 2Z7QA 3HDNA 4EQMA 4N4SA 4PPAA 4IX3A 1WCCA 3MPTA 3D7TA 2F49A 3AT3A 3B8QA 1SNXA 4HNIA 4QOXA 1XJDA 3FMNA 5AUYA 2W5AA 3OWPA 4JG8A 1KOAA 5HBHA 4FI1A 4IB1A 1JKSA 2PMNX 3RGFA 2IG7A 1G8AA 2VNYA 4FTRA 4O0YA 4WHZA 5DA3A 2R0IA 4X3FB 4M15A 5AWMA 5GJGA 5L3AA 3FI8A 4C3RA 3EQGA 3LMGA 4J71A 2F7EE 4O7WA 3U9CA 1YQJA 4EOQA 5CEKA 5IH6A 1FBNA 4Y85A 3ZC6A 2NO3A 1YXVA 3DK6A 4NM3A 4ZS0A 2XH5A 3R8PA 2C1AA 2HZ0A 1XBCA 2UZOA 4U45A 3RWQA 4XG8A 4F09A 1NY3A 2IZRA 4U79A 2BIYA 5JRSA 4DG0E 2PMOX 3ZEPA 2OLCA 4LM5A 4YZBA 3UP7A 4O91A 4KRDA 4IACA 4QTDA 3HAVA 5JQ5A 4X2FA 3K3IA 4QQTA 4L3JA 5DR2A 3QHWA 2OGVA 5I9VA 2XNBA 4ZTSA 1FINA 2XUUA 5M57A 5DMZA 5J7BA 4F0IA 3ANQA 2WIHA 2BZJA 2GNIA 3C4XA 3KXHA 4QYEA 4BDFA 3RPOA 3BBWA 2VO6A 4D2SA 3R28A 2XZSA 4O22A 2JITA 2J4ZA 1UKHA 2JIUA 4OTPA 4RZVA 2RFDA 4N6YA 4DFZE 3QQJA 4XLIA 3RK7A 3QTZA 4AXAA 5KE0A 1AQ1A 3CD8A 4AZVA 2BIKB 2QOFA 5E7RA 4I4FA 2B9HA 3E7OA 3F3TA 4FKUA 3HAMA 4NSTA 3CE3A 4OT6A 4A4LA 5J5TA 5M56A 3A60A 3TNPC 4CQEA 1APME 2VD5A 4EKKA 5B0XA 1U5QA 3DU8A 4RIYB 4IAZA 1H1SA 2C3IB 3IW5A 4CTCA 1Q3WA 5HO7A 4UWCA 2C6DA 1M2RA 3T3UA 5LCJA 2ZVAA 2BKZA 2DS1A 2BRGA 4MF1A 4XS2A 3KRXA 4D58A 4FNZA 4G6NA 2UZDA 3QD2B 3HA6A 3V8WA 4E4NA 3GGFA 3LQ5A 3R8LA 3U51A 3WIGA 3BHYA 2J5EA 5CEIA 3UOKA 2BAJA 1H28A 5KZIA 2UUEA 3OY3A 4BWKA 4QNAA 5C03A 3IPHA 1LPUA 3ALNA 4N0SA 4TN6A 4GS6A 5FG8A 5TF9A 4E4MA 4EJNA 5HU9A 3KRLA 5I9ZA 3UO4A 3PA4A 4YR8A 2F57A 2YEXA 3QQUA 1YHSA 3IW8A 3V5TA 4AW5A 4AZEA 4XP2A 2IW8A 3Q4TA 3DLSA 3FC2A 4FKJA 3NNVA 3GUBA 5FTQA 5L2SA 1KE8A 2O63A 3QZHA 5AV2A 4ITHA 2OK1A 5FBNC 3U8WA 3A8WA 1J1BA 2A2AA 4RBLA 3ZFYA 2QKWB 1YWVA 1ERKA 1H1WA 3C1XA 3F69A 4FTNA 4I6FA 4JIKA 4MH7A 2ACXA 3EFKA 3PIXA 2Y6OA 3CY3A 4GT5A 4QD6A 4PUZA 4QYHA 4RC4A 2UW8A 1PF8A 2QOIA 3BHUA 1MRYA 3V04A 5GZ8A 4BDEA 2BVAA 3LXPA 1YWNA 4YC3A 2Y9QA 5AR4A 3NNUA 1Z9XA 2WTJA 5HNGA 5EYDA 3VW8A 5IEXA 4AA5A 5DT0A 3CJFA 4O7TA 1P5EA 1Q3DA 3L8VA 3IDCA 4K18A 2EVAA 2UW7A 4I6QA 5CWZA 2G9XA 4CRSA 5I9YA 4NEUA 4Y46A 2VZ6A 1MQ4A 4TRLA 3WF5A 2P55A 4NU1A 4Q5HA 4ZSAA 4OTWA 3G2FA 2J0MB 3ZZWA 4RIWB 2QO2A 4AW1A 4AG8A 5JN2A 4CD0A 1OIQA 5BYZA 4CZYB 5E91A 2AUHA 4J98A 3MY0A 3G9NA 2W7XA 3ZMMA 3MDYA 4J8MA 4TNDA 5AP1A 5KMOA 2VTOA 3TV7A 2I0EA 4UMTA 2WELA 3EKNA 2PHKA 4Z16A 3E8CA 2BKKA 4YJPA 1PMNA 2UVZA 4FC0A 3NCGA 4U44A 3G9LX 1H1PA 1YOMA 3O7LD 3HP5A 3QTSA 3UBDA 1URCA 5J9YA 2YIYA 5J95A 3AD5A 1U54B 4GJ3A 3PG1A 5E8XA 3WIKA 4XOZA 5CAVA 4K1BA 1P2AA 2JBOA 4RFYA 4EZ5A 2KULA 4FKGA 3FI2A 4F9YA 1REKA 3HX4A 3PY0A 4Y5HA 3UYTA 4F6SA 2GU8A 3EQHA 3SRVA 5DPVA 3LFDA 4PF4A 3HMIA 3FQHA 1FMOE 2WD1A 4GG5A 2PVMA 4Y5QA 3KU2A 4I93A 4IFCA 4QMTA 4BDCA 3GXLA 3SG8A 5M08A 3C4EA 3TZ7A 3VS1A 5BPYA 3PLAE 3RNIA 4CFWA 3H0YA 4J97A 5CU3A 4AGCA 4DEGA 4PP7A 4CXAA 3TDWA 3OZ6A 1F5QA 3D94A 3LIJA 2XK8A 1JKLA 3GQIA 3OXIA 4FVQA 2BRMA 4RX7A 5AP6A 4UY9A 2YDJA 4O7YA 2BFYA 4ALUA 4GKIA 3GBZA 3V51A 4FKTA 4FEWA 4ASDA 5AUZA 2PE1A 4IWQA 4LUDA 5CF8A 4A9YA 4G5PA 5DYJA 3V3VA 1ZRZA 1Y8YA 3O2MA 5EYCA 1OL5A 1OIRA 2OJJA 4DFYA 4C0TA 4AUAA 3MA6A 4PNIA 3UC4A 2IZUA 4X3JA 4CCUA 4NKAA 3C51A 2E9NA 2WPAA 3KULB 4FT7A 2ESMA 5DT4A 4O0TA 3UNJA 3RHXA 4YZCA 4YJNA 4ANBA 4DEHA 3DJ5A 4NH1A 5JH6A 1BYGA 4O81A 3D5XA 3CPCA 2E9PA 3P78A 4I23A 4QP9A 4V0GA 3RALA 3V5LA 2IZTA 3MY5A 4WUNA 2CN8A 2X1NA 4NL0A 3IGGA 4FVPA 2VX1A 3O17A 3TJDA 4QMMA 2CHLA 3Q53A 4UXQA 4PTEA 3VAPA 4JI9A 3HL7A 5E8VA 3ZO3A 2BROA 3I1AA 4RA4A 3I81A 1JSTA 2RGPA 4QP3A 4YHTA 4DEAA 4EZ7A 3UO5A 3IW7A 3OY1A 3N51A 3DBCA 4HOKA 4C8BA 4AZWA 2OH0E 3HDMA 3QYZA 2FO0A 1U4DA 1BMKA 4X2JA 2G01A 1Q8YA 4WO5A 3S95A 4ZSGA 3EQCA 5CSXA 1JBPE 4B99A 3VS3A 2R3IA 4C02A 3TV4A 3W8QA 3QXOA 2QOCA 4GJ2A 2W96B 3CKXA 5CY3A 3ACJA 4FSQA 2IPXA 4Y8DA 5AR8A 3T3VA 3FY0A 4H58A 4IWOA 2ZYBA 4CVAA 4PMMA 5CEMA 3BKBA 2CNQA 3UMWA 4AU8A 3UVPA 4O0XA 3OF0A 3FMJA 3I7BA 4L3LA 2X9FA 4IAIA 3NWWA 4YTHA 4EOMA 4CT1A 3DS6A 5AR5A 2IO6A 2OF4A 1ZWSA 3O8TA 3VBXA 3LCTA 3OOGA 4J8NA 3UTOA 1JSVA 4D4SA 4FIFA 5ANKA 5AIRA 4QMYA 5KKRB 4AT5A 3REPA 2QHNA 4HJOA 4J96A 4KIKB 4GK4A 2P2IA 2HWPA 4BHZA 1Q8TA 3MB7A 5IQGA 5HO6A 3KB7A 3Q9YA 2DWBA 3EHAA 4IZAA 4DGGA 4TZRA 4D55A 4E26A 4U6RA 3F6XA 3PP1A 5K9IA 5KMLA 3HA8A 4PY1A 4PDYA 4O83A 2J7TA 2H96A 4O6EA 4P2KA 4Y72A 4BDJA 3D7ZA 4ZMFA 3QRTA 4MD8E 4KB8A 2XNEA 4BGHA 3IW4A 2PZIA 4R3CA 5K5NA 2Y4IC 3F88A 3JR1A 4D28A 4WSQA 1Q8UA 4E6DA 4UYNA 2W1IA 4W8EA 3AT4A 4BICA 4CMUA 2HELA 4CQGA 5DN3A 4XLVA 5DEYA 5JMSA 4APPA 5FD2A 3F5PA 5CF4A 5M07A 1Q8ZA 3TXOA 4WNMA 2PUUA 5HU3A 1H0VA 1OUKA 3I6WA 4DC2A 1NVRA 1OZ1A 5C8KA 3DTCA 3HLLA 3BGQA 3A99A 4PWNA 4FTJA 5E1EA 2H34A 2BZKB 4TL0A 1OKZA 2UVXA 3H10A 4G3GA 3VBYA 3D15A 2ITVA 5E8TA 2IVUA 4DN5A 4EHEA 5B2MA 2XIYA 4DTBA 4JBQA 5E4HA 4N57A 5BMSA 4M69B 2WNTA 4P90A 4PL4A 4FOCA 2R9SA 2UZNA 5BVWA 4C4JA 5AUVA 4C62A 1XH5A 2QCSA 4F4PA 1Q41A 2BTRA 5IA1A 2YDIA 4TYEA 3COHA 4IAAA 3KK9A 4FTAA 3LMIA 1OL1A 4FSRA 3S4QA 2E9OA 4PX6A 4XJ0A 2I40A 4J95A 2GCDA 5GJDA 4UX9A 2FUMA 3PRFA 1XWSA 3UPZA 2CKEA 3D0EA 3O8PA 2BR1A 3R6XA 3C13A 3MJ1A 1HOWA 3EQRA 3FZTA 4I41A 3QQFA 3IOKA 4FEVA 4QP7A 4ERWA 4AX8A 1M7QA 1QL6A 2EXMA 2HZ4A 3EKKA 2CGVA 3I4BA 4GT3A 2P3GX 4U3YA 5HNIX 5C4KA 2EWAA 4AOIA 2Z2WA 2VWUA 3KL8A 4Q9SA 3RPVA 2QQ7A 4NM7A 2OZOA 2ZMDA 2F7ZE 4FKPA 2BDWA 2EU9A 4R77A 5M06A 2VTAA 4EK6A 3ZLYA 3W2SA 3L9PA 3PTGA 4MBJA 5AX9A 3R8MA 3QBNA 3R63A 4LRKA 5IA4A 2QI8A 2WQMA 3BCEA 4OW8A 4RWJA 5K5XA 5D1JA 5DI1A 1REJA 3WF6A 2YM3A 5AP2A 1VEBA 3A7HA 3KRWA 2J0IA 2C30A 3V8TA 2OICA 5HIDA 1NW1A 5E1SA 3A4OX 4HZSA 3LFBA 2HZNA 3QKMA 3BQRA 1UNHA 4CZUA 2CNUA 4MXAA 3QFVA 2ITUA 3Q4UA 2XNPA 4YZ9A 5F94A 1XH7A 2JBPA 2UW3A 2CLXA 2NPQA 3PJCA 4RJ7A 1J1CA 3Q96A 4NJ3A 2XM9A 3FZSA 2GFSA 4TXCA 4F64A 3U6HA 4NJDA 2PY3A 1P4FA 4O82A 5EW8A 4BCPA 1J7IA 2F2CB 4BCGA 2Q0BA 2R3RA 5LWMA 5IMXA 5ACBC 4UV0A 3MB6A 2WO6A 4QMNA 4RG0A 5E8UA 2VO7A 2O2UA 3FQSA 5FXQA 3FSFA 3CCNA 4YLJA 4QP4A 4AZSA 2CGUA 2E2BA 2X7FA 3D2KA 3PJ1A 3MY1A 3E7VA 3IONA 5B7VA 4KS8A 4GYGA 3R2YA 4OAUC 2C3LA 2XIZA 1H27A 3D2IA 2ETRA 3TL8A 4USEA 4WOVA 2X7OA 5DG5A 1PJKA 4KS7A 2WHBA 2I0HA 3UPXA 3R73A 4UEUA 3LFQA 2JIVA 4F1MA 2VV9A 4L8MA 4CFMA 4E4LA 2W4KA 2GQRA 4DLJA 4JG6A 5JZNA 3G33A 5IA2A 2ZDTA 2OJ9A 4I6BA 4FIJA 3F2RA 5AJQA 5F95A 1DS5A 2R3KA 3WZKA 4KABA 4MXYA 3BEAA 4DINA 2FSMX 3FE3A 4PDSA 2F4JA 3MFSA 2GNHA 3OT8A 2XVDA 2V22A 2VTIA 3R2BA 3LFAA 4IAFA 5DOSA 4CG9A 5AV4A 3UIBA 3C0IA 2QLUA 2HY81 1XKKA 3F7WA 4K0YA 4NIFB 4ZLYA 1YXXA 1KE7A 3GFEA 5DH3A 4QP1A 1PXJA 2J90A 2PVNA 4FV5A 4X21A 4O0VA 3SW7A 5JZJA 4AWIA 3SA0A 1AD5A 3I0QA 4ZMEA 2PVHA 3NYNA 3TNQB 2YIQA 4KBCA 3HMOA 3PXKA 3DKGA 4QMPA 4D1ZA 1FVRA 1WBSA 3TUCA 1B39A 3DBFA 4HCTA 2GHLA 3GCPA 4LYNA 4AGUA 5K0KA 3MVHA 2J0LA 3CTHA 4LOOA 3F3ZA 4HYHA 3MTFA 4YPDA 2J2IB 4DEDA 3GU6A 3THBA 3UIUA 3BRBA 3IO7A 3ZFMA 3E92A 2WMBA 3KREA 3DNDA 4TT7A 3DKCA 5HGIA 3G51A 5ANJA 1QPEA 2JGZA 3NVMB 3QTRA 5L8KA 3UQCA 1R39A 3PE1A 4FV9A 2ZM3A 3TACA 3W55A 1GZ8A 4GVAA 3R8UA 2RG6A 2V7AA 3FLWA 4DTAA 4QPMA 3BLQA 2GNJA 5CYIA 5HIEA 2FA2A 4MBLA 4ENYA 5F4NA 2FVDA 4RT7A 4IMYA 4ZEGA 3CP9A 4ANMA 4RQKA 3CC6A 3QTUA 2VO0A 4IC8A 4ID7A 2YN8A 2WOTA 5H2UA 4BCHA 4YC8A 2CCIA 3UZRA 2QOLA 1ZOHA 3RAHA 4O7NA 3E3BX 5HG7A 4L7FA 3W2CA 1UU3A 3IQ7A 4QNYA 4XP3A 4DG2E 3DK3A 4FSTA 5TOZA 2OIQA 3P5KA 4NFMA 1DI9A 5AV3A 3NX8A 5IKWA 3FXZA 3UIMA 3RMFA 5L6OA 4C4HA 3FWQA 4BL1A 2W99B 2IW9A 3KVXA 4O6LA 3E64A 2Q0NA 3RZFA 3DV3A 3FMMA 4FGBA 4BB4A 5LXMA 2ZB0A 4YZNA 1NXKA 4OTHA 4RA5A 3DAEA 5AR7A 3CGOA 3TI1A 4WSYA 3GCQA 4QQJA 4ZTQA 3Q4CA 4ZY5A 3KCFA 3EOCA 4E73A 1M52A 2C5YA 3V6SA 3E93A 2OI4X 4BYJA 3SOCA 5LMKA 4IM3A 1YI6A 3ROCA 2KTYA 3HRFA 1A48A 3WYXA 3C4FA 4I0RA 3SVVA 4LGGA 3KK8A 1S9IA 4AN9A 4W4XA 4BWXA 1GZNA 3A7GA 4FG7A 1ZMUA 2G1TA 5AMNA 3BWFA 4FZDB 3U55A 4BTFA 2J0JA 2R3OA 2XNMA 4PMTA 3Q9WA 1Q4LA 4BCNA 3NCZA 4G9RA 5C1QB 3PE2A 5A4QA 3MN3A 3CR0A 2FSTX 4K8AA 3OD6X 4BVUA 5L2TA 3ZUUA 5HTCA 2IJMA 3LLAA 3C4WA 4I0TA 3R7UA 5JGBA 3Q60A 3PVWA 4YHJA 2JFLA 4IW0A 4DH8A 3UVQA 2BILB 3G0FA 5TE0A 2BDJA 3DNEA 3DAKA 4I94A 1V1KA 1LEWA 3A7JA 3GI3A 3LLTA 5AV1A 2G2FA 2FH9A 4BYIA 3EN4A 3FBVA 3F2AA 3FHRA 3KXMA 4Q2AA 1PKGA 3DY7A 3LFEA 5CALA 2FB8A 4I5HA 4W8DA 4IH8A 3BHVA 3EFWA 2W9ZB 3EN6A 3NUXA 1QPCA 2QLQA 5KMJA 4BDIA 3E63A 5FTOA 3LHJA 3Q3BA 4I21A 4F7LA 5EDPA 1ZY5A 3ZBFA 1Y6AA 1W7HA 4MKCA 4ZIMA 4U41A 2VTTA 3S00A 2QG7A 4O27B 3I5ZA 4F9CA 2H8HA 3GFWA 4ZOGA 3VUTA 4DE4A 5IUIA 5M4IA 2X2MA 3FI3A 3G6GA 3VULA 5KUPA 5C27A 2XBJA 3KXXA 3L9LA 3RVGA 1H26A 4CNHA 2YERA 1PXMA 2PZ5A 3OW3A 4EYMA 4ACDA 4H05A 1E1XA 1Q24A 2EXEA 4ARKA 4D5KA 5CANA 3B2TA 4DLIA 4IHPA 1QPDA 1JLUE 1DAYA 5BYLA 3ID6C 4QQ5A 3F5GA 5CXZA 3BYSA 3TIZA 2VTQA 3A7IA 3CTQA 5HEZA 4LGDA 3D14A 4A9TA 4F08A 4TYHA 3PPKA 2BZIB 4JBVA 2R3PA 1MP8A 4PPCA 3BLHA 1YOLA 3E87A 3VHKA 1OMWA 5AP4A 4IWDA 3DDQA 4W4YA 2YCFA 3UNZA 3BPRA 2R7BA 5IA0A 4U40A 2GFCA 4M14A 3GOKA 1WBOA 3R7EA 3UQGA 3C0HA 4QMXA 4ZTRA 4E7WA 4F65A 4XRJA 4IVAA 3I6UA 3EQPA 3QC9A 2XCKA 3MFTA 2ITPA 3QU0A 1LP4A 3EN5A 3Q5ZA 4CG8A 3QWKA 4QMWA 1P14A 2ZJWA 3AC5A 5L2QA 4H3QA 4D1XA 4S31A 3RI1A 2VWWA 4MF0A 4QTEA 3CIKA 2PZRA 3MS9A 1OL2A 3MIAA 4H3PA 3IECA 1GOLA 3TZ8A 3U4UA 3BU6A 2UW6A 5AX3A 3VC4A 3RKBA 3KMUA 3BEGA 3FLNC 4QMZA 2AC3A 5AUXA 3OROA 3EQDA 2BHHA 2ZDUA 5LOHA 3PPZA 2A27A 3LJ2A 3WYYA 1SM2A 4AT4A 3OVVA 3KY2A 4MBIA 5CZIA 3WZDA 1WVXA 3ZOSA 2XK4A 2HCKA 3TT0A 2C5NA 4FEXA 3R9DA 3EFLA 3OS3A 4YU2A 5HX6A 2J51A 1IA9A 2REIA 3HP2A 1MRUA 5HI2A 4FTTA 4K33A 2PULA 5HG9A 3P0MA 4EWHA 2VGPA 1W84A 2Y7JA 3COMA 2C69A 2J9MA 5G1XA 3VS0A 3DKOA 3PPJA 2X39A 3SD0A 4DA5A 3GCUA 3EIDA 3R30A 4YNOA 1QCFA 1Z5MA 4EHGA 3H9RA 2WXVA 5LWNA 2SRCA 5E8WA 3DGKA 5HESA 2Y8OA 4GSBA 4FE2A 2JFMA 3Q5IA 4U42A 3QX2A 2PZPA 2XK6A 4XG7A 3ACKA 5F9EA 3PZHA 4KKEA 4NW5A 4F1TA 4MD9E 2R3GA 5CAPA 3MGYA 5AUWA 1HCLA 3LM0A 3QALE 2C0TA 3NR9A 3U6JA 2R64A 4R8QA 3SKCA 2C6MA 3BQCA 1PY5A 2YCRA 3LFNA 3HRBA 3ITZA 2ITYA 4FNWA 3UZTA 3ATSA 2PE0A 4AGDA 5JK3A 5H8EA 1O6YA 3OWLA 4CFNA 2W06A 2R7IA 3ROYA 4PNKA 1SVEA 2ZV9A 2RFEA 1JQHA 3DBDA 4E5WA 4UXLA 4GV1A 5KBRA 5M4CA 2FGIA 2PL0A 3NYOA 2VTHA 3AOXA 4F9AA 4X2NA 3P08A 1B6CB 3NUAA 3AMAA 4OAVB 3BE2A 3LM5A 3R22A 1WMKA 2PMLX 2W9FB 4W9WA 5CI7A 3MYGA 5J7HA 3ZO1A 4YJRA 4HVIA 3COKA 4B9DA 3NUNA 4IX6A 4TNBA 5EQEA 3CY2A 4BI1A 4FSUA 4ZXTA 2X2KA 3R9RA 2IVSA 1ZXEA 3V5QA 3PRIA 2XS0A 4B8LA 2OW3A 3UJGA 4FSWA 4EOJA 3Q6UA 3HGKA 4X3FA 3T9IA 4Y83A 1VR2A 2B54A 3JVRA 5EHOA 3ZS5A 4FNXA 1Y57A 3MW1A 4ZAUA 5AFVA 4FYOA 4BCKA 4F70A 5A6NA 3DKFA 1YRPA 3ULIA 3ZONA 5IH4A 4BDAA 4U8ZA 4BDBA 4L46A 5JT2A 4FT3A 4FKQA 4TY1A 5DFPA 3ORNA 3DPKA 4YHFA 4DHFA 2C6OA 4OTGA 5HCYA 2JAVA 3AC1A 3ALOA 1H0WA 3BV2A 4A7CA 4HYIA 2VWZA 3BYVA 4RFMA 4DBNA 3UE4A 3RHKA 3NUSA 3NIEA 4ZTNA 2X8DA 1E9HA 4YZDA 4YTFA 3OCBA 5T6KA 2W1DA 4IAYA 1JPAA 1UU8A 1ZYCA 3HV7A 3KN6A 4ACGA 2C1BA 4ORKA 5I0BA 3MH2A 3WILA 4FL2A 4APCA 3A2CA 1SVHA 3OCTA 5C8NA 2XB7A 1R0EA 3C4CA 3POOA 4HVDA 3R02A 4MX9A 4HCUA 1XH4A 5CEQA 5M44A 4EH6A 3H3CA 4FIEA 5AM6A 2FSOX 3HEGA 1W82A 3MI9A 3ORZA 4HGLA 1TQPA 3K2LA 3OP5A 4AT3A 4BZNA 4RFZA 5CSVA 3PLSA 3RWPA 3PVGA 5J9ZA 4D0XA 1SVGA 4G16A 3MBLA 5FBOA 4U81A 3LE6A 5D9HA 5EW3A 2YM7A 5HE0A 5DGZA 2ERKA 2V0DA 3ET7A 3H9OA 4OTIA 5DE2A 3FPQA 4E6CA 4G17A 2OBJA 5EHYA 2WQEA 4RIYA 4M68A 4FTOA 4LRMA 5KMKA 4FYNA 3S0OA 5KKRC 4YLLA 5CU2A 5M4UA 4ANSA 4QTAA 5JFWA 3QZGA 4HNFA 5C4LA 3P23A 5HE1A 3R1QA 5J9LA 4TWCA 1R1WA 1IRKA 2VRXA 2XEYA 2CCHA 5I4NA 2JDVA 4FUXA 1TKIA 4RSSA 4FSYA 3R04A 4XYFA 4AF3A 4PRJA 4TYGA 4FK3A 3FJQE 2RF9A 2W1HA 3ETAA 4JX3A 3UQFA 5I5ZA 4FEQA 4PL3A 5CXHA 3S2PA 5EM7A 3ZU7A 2OIBA 2VO3A 3JUHA 5AP0A 2R4BA 3EZRA 3NVKI 4RX8A 4M67A 4UBAA 5CVGA 3DDPA 1UA2A 4UMRA 1YHWA 4BR3A 1QPJA 5CI6A 4BTKA 4EJ7A 3VUGA 4F9WA 5TT7A 4NT4A 3TNIA 3C0GA 4X2KA 4BFMA 4LI5A 3GC0A 4JDIA 5DVRA 5EDQA 4K11A 3F2NA 2CMWA 3ZRKA 4KUJA 1H1QA 4RJ8A 1KE5A 3LCSA 4C38A 1OUYA 4GCJA 2B9JA 3QUDA 3W2PA 3VRZA 1ZMVA 3ZXZA 4IVCA 4EH3A 3CS9A 4CFXA 2W1ZA 2R2PA 2E9UA 4AW2A 2VWBA 4Q5EA 5E92A 5LVLA 2ZV8A 3R7YA 4ITIA 4BCIA 4JS8A 4MQ1A 3PJ2A 4MQ2A 5HBEA 4B6LA 4AACA 2QOHA 3W16A 4DCEA 4CKJA 3SDJA 4C59A 1CMKE 5CSWA 3M1SA 4RIWA 3R01A 1X8BA 4L6QA 2B9IA 4XG2A 2XKCA 1ZAOA 1BKXA 2UVYA 3ZSHA 4ZP5A 3ZLSA 4O0WA 3OT3A 4PL5A 3ORPA 4BDGA 3E5AA 4P5ZA 3C5IA 5EYKA 4FKIA 4FIGA 2CLQA 3W8LA 4BY9E 4JG7A 1U54A 2CKPA 1PXIA 4AW0A 2HYYA 4TYJA 4GL9A 5CEPA 3I0OA 2WTWA 2E9VA 3A7FA 4CLJA 4UZDA 4X6QC 4QMLA 4BTJA 1Y91A 3ZEWA 5BVNA 4B4LA 5LMBA 3CBLA 3BI6A 2JKQA 3CQEA 3O51A 3QF9A 3R71A 2UZVA 1CKJA 5IUGA 1YXSA 5HD4A 2WMAA 3KFAA 5ANOA 2B9FA 2IVVA 3GCSA 4DAWA 4U0IA 5HLWA 2WU6A 4RIXB 5AAEA 4G3DA 3HUCA 4NZWB 4BZDA 4XV9A 4L44A 5DT3A 3HZTA 5ETAA 4A06A 2W1CA 3QTIA 3QGWA 3LFCA 1XR1A 2PVFA 4O0SA 1OL7A 4NUSA 3LFSA 3R9HA 2ZMCA 5BYYA 2GHMA 2IWIA 5HIBA 2GS6A 5AP3A 3PY1A 5EH0A 2UZUE 5KBQA 3V5WA 1ZY4A 3TV6A 1XH9A 4I22A 4UZHA 4GKHA 5IQFA 2F9GA 4YTIA 3LMHA 1K9AA 1GAGA 4L67A 4IZYA 2IVTA 1DI8A 4IWPA 4KBAA 1PYXA 3QYWA 3DZQA 4MCVA 3I7CA 4BBEA 5IMEA 1Y6BA 4WUAA 5IEYA 3KULA 3TIYA 4BDKA 2RIOA 4R1YA 2YZLA 2QU6A 4CGAA 3ZXTA 4L52A 1P4OA 1VYWA 4CV9A 4G6OA 3ZH8A 4ZK5A 2AC5A 2Q83A 3Q6WA 1O9UA 5EFQA 2GNFA 5TR6A 3G6HA 3DLZA 3FQEA 3MFUA 3OTVA 4PPBA 3NYVA 4G3CA 2Z02A 2WMUA 3C7QA 4PTCA 4RJ3A 5E8ZA 3TKUA 5LVOA 5D10A 1DAWA 2EXCX 4FK6A 3E8NA 4EH8A 3FMKA 1PHKA 3KMWA 4WA9A 4I92A 5JKGA 3C9WA 1KE9A 3NW7A 3WBLA 1JOWB 3GQLA 4FZ6A 5CNOA 2XJ2A 1PMEA 1PMVA 3GB2A 4R1VA 4RIXA 3PJ3A 3VBTA 1H4LA 5CQUA 3AD6A 4R7IA 4A9SA 4IX5A 1A9UA 4H1MA 1OI9A 2YIRA 5BX0A 3WZEA 3K5VA 3DK7A 4XX9A 2WKMA 2VGOA 3SHEA 2DQ7X 3NAXA 4ANOA 4MXZA 4RVMA 4LL0A 3UVRA 3A8XA 4L00A 2YIXA 4FTKA 4GU6A 4YJTA 3DQXA 2W17A 3MH0A 3DFAA 3QKKA 4X2GA 5LJJA 4LFIA 4TPTA 4TWNA 1YDTE 1YDSE 3L9NA 3P7CA 4IX4A 5CSHA 2ZV2A 3KXZA 3ZLWA 3L8PA 2XK7A 5CQWA 3DBEA 3P7BA 3H30A 4HGSA 4J52A 5EQYA 4YLKA 4DFNA 5FXRA 3ELJA 3SOAA 4F9BA 3QRIA 4KIKA 4H1JA 5M53A 1IR3A 3FYJX 1YVJA 2Z7SA 3NEWA 4YJOA 4LQMA 4UMQA 3W18A 4EK5A 5LMKC 4FIIA 3KMMA 2VTSA 3OEFX 1OGUA 5M4FA 3E62A 3RM6A 4FV4A 3P79A 3RJCA 5A6OA 3W2RA 4GVJA 2CJMA 3PIYA 2FSLX 2BDFA 2VUWA 4KSQA 4M7IA 5BUJA 4I20A 3KA0A 3IG7A 1TVOA 2ITQA 4KKHA 2GTNA 3E8DA 4O1PA 4TTHB 2WQNA 3R7VA 3UZPA 4AA0A 4A9UA 3H9FA 3MH1A 2JDTA 3SAYA 3D9VA 4WG5A 4TWOA 4FKOA 4I6HA 4KWPA 1KSWA 1W83A 1YDRE 3IKAA 1WBPA 3FMHA 2VWYA 3WZUA 5CAUA 3AC4A 1PRYA 4BTMA 3SG9A 5JFSA 3GENA 4M0ZA 4J1RA 4F7JA 5KCVA 4LG4A 2ZOQA 1UU9A 1WVYA 3VJOA 4B0GA 3CQWA 2R3LA 3VBQA 4BCOA 2VX3A 4DFBA 2WMSA 3QTWA 3CQUA 4MWIA 3IDPA 2P0CA 2VWVA 4GUEA 4M69A 4O2PA 3AC2A 1YXUA 1OPJA 4A07A 3F5UA 4EOKA 1KWPA 4MD7E 5J87A 4DGOA 2QKRA 5J79A 2PZYA 3FKNA 5HVYA 2X4FA 3UOLA 3QQLA 5BMMA 2IN6A 3R9OA 2PTKA 3DB8A 4GMYA 3V8SA 2XIXA 2V62A 3EN9A 3D83A 2QOBA 2YA9A 4OBQA 2XKEA 1H01A 4JNWA 2RFSA 3U54A 5HORA 3SV0A 4RPVA 4XG9A 3D5VA 1T45A 4YP8A 2Y4PA 4RLLA 4BKJA 5EKNA 2C3KA 1JKTA 4RLKA 2XJ1A 3K5UA 2PVYA 2W0JA 1KOBA 3BHTA 1WBWA 3FZ1A 3TJCA 3ZRMA 4O7VA 1YXTA 3LFFA 5DIAA 2J0KA 4LMNA 4NCTA 4EK8A 3GNIB 4ZJIA 5A9UA 4KA3A 4K77A 5FXSA 4EK3A 2EB2A 4IIRA 5EM6A 3A61A 3RPYA 3HECA 4ZZMA 4AE9A 5C26A 2OO8X 2WOUA 3AT2A 4ZSJA 1AGWA 3WF8A 2ITWA 3MPMA 3WE4A 3ORIA 4D1SA 4ZZNA 2B52A 1R78A 4M0YA 2F2UA 2QU5A 4FV0A 4G3FA 2LGCA 4PV0A 4OLIA 3QRKA 4GG7A 2HW6A 5H9BA 4AP7A 4D0WA 5K0XA 2ETKA 2YIWA 3ZYAA 1KV2A 4ZS4A 4AQCA 2QO7A 3F3VA 3QC4A 4HPTE 4RC2A 3OTUA 3EZVA 3L9MA 4C4GA 5CVFA 2Y4IB 1H07A 4H39A 5EK7A 3LAUA 2GTMA 4KBKA 1GZKA 4GRBA 3FZRA 5HLPA 5M09A 4HPUE 4EQUA 4EOPA 3GU8A 2W1EA 4G5JA 4MYGA 2XNNA 4Y73A 5CASA 5HKMA 2V55A 5I9XA 2YWVA 5AA8A 3DJ6A 3KRRA 4XH6A 2QONA 4ZJJA 3QUPA 5E8SA 2XMYA 5J8IA 5CZHA 2ITTA 5IPJA 4U3ZA 1MRVA 1PKDA 4CFFA 3OMVA 1CKPA 3D4QA 4IQ6A 3VW6A 1G8SA 3O8UA 5AA9A 3BGZA 5D11A 3Q4ZA 5DWRA 4DFXE 3DB6A 4GYIA 4S2ZA 4CTBA 4NM5A 2QC6A 4II5A 2PWLA 3BU3A 3MSSA 4MXCA 3LJ1A 3AD4A 1I44A 3HNGA 5D7AA 3U4WA 2YAAA 3CSVA 5EW9A 4ITJA 1LR4A 3H0ZA 4HYSA 4KD1A 4YJSA 3PVBA 5ANEA 5ETCA 4FZ7A 4Y95A 3BZ3A 1FVVA 1J91A 3I60A 4EOIA 5C9CA 3HKOA 2OFVA 1OIUA 3EQIA 4EL9A 2JLDA 4ACHA 3R83A 1F3MC 5FTGA 1FGIA 5KMMA 2WZJA 5FP5A 5DLSA 4LOQA 2PMIA 4PDOA 4NIFA 4QPAA 4NFNA 4CFUA 3KEXA 1IASA 1BUHA 4KKGA 3MWUA 4PMPA 2WMVA 4KRCA 3V5PA 1JAMA 3NAYA 3ZM4A 1OIYA 3PY3A 3R1NA 4R78A 5IQEA 3UIXA 4DCAA 4LOPA 2G2IA 2WTKC 4ASXA 2WTCA 4N6ZA 2QOOA 3VS5A 3BELA 1GIIA 3LPBA 2OKRA 3PXRA 2A19B 5CAQA 3LXLA 5D12A 5B2LA 2VTMA 2VTNA 4XG4A 3BIZA 5A46A 4D4RA 3GT8A 3QWJA 4E5AX 2UZTA 3GC8A 4RGJA 4FTMA 5GIOE 5L2WA 4DT8A 1BI8A 4WBBB 2XA4A 2BPMA 3QCSA 4EWQA 4E6QA 1PXKA 3OW4A 4PMSA 4JQ8A 5EOBA 4X3FC 2IW6A 3ZC5A 5KO1A 2RSVA 3PYYA 2YWPA 1ZYJA 1URWA 4J53A 3VVHA 2UZWE 1UVRA 1V0PA 4FTUA 4F99A 1MUOA 4L53A 4WRGA 4UWBA 4ACMA 4FKRA 4L43A 5LVMA 4FIHA 2O65A 2W5BA 3EWHA 5GINE 4IB0A 2XK9A 4D2TA 1K2PA 3F61A 3PXQA 3VO3A 2QOKA 3IK3A 3QKLA 1ZZ2A 4JQ7A 5IDNA 2O64A 1RDQE 4QP6A 5CU0A 4UN0C 1YKRA 4GH2A 4F6WA 5EM5A 1UNGA 2FYSA 4EI4A 1IAHA 3KC3A 1M2QA 3VQUA 5J5SA 4FTQA 2WB8A 4MVFA 4ZZOA 3Q52A 4HGTA 3PA3A 2QG5A 1H25A 3FXXA 4FV7A 4ASEA 4BN1A 3DQWA 4FV8A 2VTPA 2WTDA 3NS9A 4O0UA 4L45A 3ZUVA 2JDRA 5EI6A 3HV3A 4GT4A 4BRXA 5AR3A 3ZO2A 2ZB1A 1PYEA 5CT0A 4U80A 1JWHA 4YMJA 1IAJA 2RKUA 3GC9A 4TW9A 4XV2A 2ZM4A 2OH4A 4F6UA 3JXWA 3HV5A 5A4CA 5CAOA 1STCE 4G2FA 2VAGA 5HTIA 1JKKA 2G2HA 4FGRA 3BV3A 5FRIA 2WU7A 2BRHA 2CNVA 2XCHA 4QMOA 5KHXA 1ZOEA 2DUVA 3DBQA 1U46A 3NDMA 4M66A 4BI0A 4A4OA 2C6IA 3C5UA 1TQMA 3ZFXA 5EQPA 3KQ7A 2C5OA 4XNEA 2BUJA 1W98A 4XBRA 3G5DA 2R3JA 2GPHA 4BCFA 4GW8A 3A62A 4R5SA 4Q9ZA 3ZZEA 1WAKA 5A4EA 5KMIA 1MQBA 4G31A 2C0IA 4YBKA 3SXRA 2OJFE 3MFRA 4YUQA 3W2OA 4RX9A 4ANNA 4HVGA 3GP0A 1ZZLA 3EL8A 5L4QA 5KNJA 4JDJA 1KV1A 2H9VA 2X8IA 1WBTA 3NRMA 3LZBA 5AUUA 4OTQA 3FXWA 5AP7A 4EQCA 4AFJA 2C5XA 4JIAA 4R7BA 4X7QA 4I4EA 3HMPA 3WOWA 3Q2MA 2PSQA 4CRLA 3GU5A 4M12A 3VS2A 5IG1A 3FMLA 4EC8A 3PG3A 4QMVA 2J50A 1PW2A 3QX4A 4IANA 3FYKX 5EG3A 2HW7A 3ZRLA 3CGFA 2QD9A 1UKIA 3HMNA 4C3PA 4GK2A 2VU3A 2YHVA 2YITA 2YLFA 5CENA 2I6LA 1W0XC 2X0GA 2HWOA 3N9XA 2Z8CA 4FUYA 4G3EA 4S33A 4UB7A 3R9NA 4IJPA 2OXYA 3TTJA 3POZA 3ZCLA 4WRSA 3RCJA 2R3QA 3U6IA 4JBOA 2BRBA 2C68A 2W4OA 3PUPA 4FT5A 2I0YA 3GU7A 4FZFB 4E5BA 1CDKA 3DAJA 4EUTA 1UNLA 2JD5A 2GQGA 4LL5A 4XG3A 1YOJA 2QURA 2Z60A 4DF3A 4KIPA 3GCVA 4DH3A 3M2WA 4RX5A 4EK4A 4EOOA 1BX6A 4RVKA 3FL4A 4PDPA 4ZTLA 3WARA 2HXLA 2XNOA 5BUEA 2Y0AA 1IA8A 5CTPA 4Z55A 4ALVA 2ZM1A 4YC6A 4RIOA 1M7NA 3P4KA 4XP0A 1A06A 1XH8A 2G15A 3R8VA 4GFMA 4QP8A 4V04A 3DXPA 3EL7A 5JEBA 3WZJA 2XNGA 5HVJA 3BLRA 4FSMA 2XRUA 2BCJA 4FV1A 4I24A 4BKYA 4W9XA 3F3UA 4FV2A 4QO9A 1H24A 2OXDA 2YM5A 4MAOA 3QAME 5M55A 4AOTA 2XKFA 2XK3A 5IDPA 3T8OA 3QTXA 4YSJA 5IQIA 1Y8GA 1PXOA 3KXNA 3GC7A 4WIHA 3DTWA 5GHVA 2A4LA 2WQOA 4FKLA 4RJ4A 5DHJA 1ZMWA 5L8LA 2V5QA 4RMZA 5L6PA 3MPAA 3P86A 4M13A 4UYAA 2XM8A 3NIZA 4DH5A 3HUBA 4E93A 4GFOA 3ZLXA 1H08A 2QVSE 4FSNA 4O7LA 2JC6A 4MXXA 3OC1A 4EBVA 4QTCA 3LCKA 2C3JA 4XG6A 4E6AA 4B7TA 5BVDA 4IB5A 4C4EA 3I79A 4F63A 1ZLTA 3QZIA 3PWYA 2YDKA 2V7OA 3W32A 1CM8A 4C4FA 4C3FA 3VS6A 4C34A 4OTRA 2P33A 2OSCA 5EKOA 5JFXA 2O0UA 2OWBA 3AGLA 4OGRA 3ORKA 5JFVA 3VUMA 1Q8WA 1Q97A 2OZAB 3R1SA 3OCSA 4R5YA 2GS7A 5HBJA 3AQVA 2HIWA 5FEDA 4S30A 3Q04A 3DCVA 5I9WA 3JY0A 5IQBA 1ZYSA 3F82A 4DGNA 1YI4A 2I7QA 3FLSA 1IG1A 4C2WA 1XQZA 2WMWA 2XEZA 5BQ0A 2NNWB 2JAMA 3AC8A 3TZMA 4X0MA 4E8AA 1OPKA 1BL6A 1F0QA 3OUNB 4EBWA 3FAAA 1BLXA 1FGKA 2QHMA 4WKQA 3AC3A 4IBMA 4UMUA 2PE2A 1NVQA 4G1WA 3TZ9A 3FZOA 2X7GA 4EH4A 1Q99A 2YABA 3NUPA 3TNWA 4OT5A 1JSUA 5FDXA 4CMOA 3SXSA 5JGDA 5CNNA 4EORA 2HY0A 2RFNA 5I3RA 4JRVA 4MNFA 3FPMA 3HVCA 1OL6A 3E8EA 1FMKA 3UMXA 4O1OA 5DNRA 1FQ1B 3PSCA 2R3NA 3QUEA 3EYHA 3DJ7A 4FKWA 4MTAA 3QA8A 3PDTA 3UODA 3IDBA 4NK9A 4LMUA 4BIBA 5KHWA 4ANQA 5C01A 3SRVB 5DBXA 4RRVA 5AUTA 3ENMA 1U59A 2JDSA 5KMNA 5HZNA 4DH1A 4CKIA 4KIQA 3RAIA 2BRNA 3QQKA 4GIHA 4U5JA 2I1MA 3UGCA 5DRDA 3PA5A 4AZFA 3TKHA 4P7EA 3RM7A 2XKDA 4YNEA 4L01A 4BGGA 3G0EA 4Z3VA 4QRCA 5IZFA 2QR8A 2OZAA 2HZIA 2GHGA 4I5PA 4BWPA 5ITAA 2F7XE 4EONA 4O21A 4WT6A 4NM0A 3C4ZA 5F1ZA 4CMTA 2VTJA 2CKOA 5IQCA 1SZMA 1PMUA 4O86A 4WNKA 3TM0A 3VUIA 2CGXA 1ZOGA 2R0UA 5IU2A 5CVHA 5K4JA 4QMQA 4UALA 1RJBA 3BU5A 3UC3A 4WG4A 1UU7A 2CPKE 5A3XA 3PIZA 3H4JA 5BNJA 1O6LA 5EI2A 5FM2A 4AAAA 3SW4A 2XYNA 4V0GB 4ALWA 5TO8A 4D9UA 3OHTA 1XBBA 2X8EA 3EN7A 4EUUA 4JXFA 3I5NA 2XRWA 3GVUA 4O2ZA 3N4UA 4IE9A 2CN5A 1ATPE 2PUIA 1WVWA 1R3CA 3FMEA 3GOPA 1WBVA 2OJGA 4QPSA 4E20A 4YJUA 4EHVA 2PPQA 3WI6A 2OXXA 2PVRA 4FICA 2Z7RA 2HAKA 2WAJA 2W1FA 2HXQA 3F3WA 4BF2A 3MVLA 4C37A 1W8CA 4ZTMA 2JDOA 1QMZA 3DT1A 3FLQA 5C8MA 2C4GA 3PSBA 5FQDC 3G90X 4FZAB 4Z9LA 5IH5A 3HV6A 5H3QA 2UZEA 3LCDA 3SC1A 3OBJA 4PP9A 3RAWA 3U87A 5EM8A 2BAQA 4FMQA 3K54A 3RAKA 3SGCA 3F5XA 4AE6A 5LARA 4H3BA 3FUPA 5I3OA 4O96A 4D4VA 1WBNA 3TKIA 3BX5A 1OKYA 3ZDIA 3E3PA 5HE2A 5BVFA 3CLYA 2C6LA 2JIIA 2Y6MA 5L6WL 4UMPA 3CKWA 5IA3A 5CLPA 3ZHPC 3ORLA 4NCTC 2BAKA 3ULZA 4EC9A 3OG7A 4M8TA 2VWXA 3S1HA 3RPSA 2WQBA 2XP2A 3VUKA 5L8JA 2PU8A 5LVPA 2PVJA 3VHEA 5IQHA 3ZSGA 4EH9A 3LJ0A 3PFQA 5AIKA 5AV0A 4E1ZA 3FEGA 3TUDA 2LAVA 2CDZA 5HG8A 3MVJA 4L9IA 3OUKA 1I09A 3O23A 3RPRA 4V05A 4C4IA 4KIOA 2WEIA 3KKVA 4ENXA 4USDA 5FDPA 2YLEA 5CF5A 3W10A 3ENHA 3UOHA 4YBJA 3VUDA 5E8YA 3QLFA 1K3AA 3LW0A 2ONLC 4MK0A 4D2RA 2X6EA 3EQBA 3VF8A 1Q61A 3EYGA 4NKSA 3VIDA 3ORXA 3G15A 4RJ5A 4KNBA 2ITNA 3UYSA 5ANDA 1J7UA 3VF9A 4HVSA 3OOMA 4AN3A 4CSVA 4HVHA 5LVNA 2I0VA 2W5HA 4E4XA 4DG3E 5EHLA 4EH7A 1M2PA 4R7HA 1OVEA 5J1WA 2ZAZA 1XH6A 4JR7A 4IXPA 5DRBA 4RQVA 4JT3A 2WGJA 3BYOA 5F20A 2X9EA 4DEEA 4DT9A 2J6MA 5FLFA 5GNKA 3O0GA 4DFLA 4O7RA 4D5HA 4IM0A 4C36A 3LVPA 4L7SA 4BGQA 4ZLOA 1YW2A 3QCYA 4NTTA 4C2VA 1Q62A 4JAJA 1PXNA 2QODA 3AGMA 2YISA 4JJRA 5HX8A 1SYKA 4U9AA 3QLGA 4IC7A 4QT1A 4YSMA 4FG9A 3P7AA 4JVGA 1NT2A 3PSDA 3EQFA 1OKWA 1VJYA 2JKMA 3M42A 3Q32A 4EEVA 2JEDA 3FDNA 4FBXA 4MEDA 4D2VA 3BHHA 3IW6A 4FKSA 4R3PA 5CT7A 4AA4A 4FA2A 4XV1A 4ZY6A 5CF6A 3NGAA 5DR9A 4BDHA 2UW4A 4FODA 4WNPA 3C50A 3T9TA 3ZDUA 2XIRA 2UZLA 2ETMA 4MHAA 3IOPA 3FC1X 4XCUA 4C58A 5B2KA 3OWJA 4FG8A 1IEPA 2BMCA 3Q2JA 3FLZA 4I1ZA 5A54A 4RVTA 2VWIA 3FMDA 3OXTA 2B7AA 2BTSA 4XBUA 2YJSA 4J7BA 4M3QA 4IZ5A 4O0RA 5ANGA 3MJ2A 5K4IA 3OBGA 4R3RA 5AAGA 3DOGA 4QYFA 3VN9A 4OR5A 3LXKA 5FM3A 4FL1A 2R3MA 3BE9A 3F7ZA 3KN5A 4ANLA 1BI7A 3SX9A 2VTRA 4IM2A 2XJ0A 2EB3A 3L8XA 3ZBXA 4IFGA 4PQNA 1M17A 2JKKA 3LQ8A 4OUCA 5ETIA 3QRUA 2OJIA 5HQ0A 3TN8A 4WG3A 5AEPA 5CU4A 5HG5A 4Z7GA 1H00A 2GSFA 4U43A 2BFXA 4W4VA 1T46A 5BUIA 3OEZA 4CCBA 4DYMA 4I5CA 3R21A 3HV4A 3PP0A 1O6KA 3WF9A 5H8BA 4F1OA 3AMBA 2A0CX 3O50A 5BVKA 3UDBA 2RL5A 3VBVA 2WTIA 4LV5A 4ZSLA 2UW9A 2DYLA 4QMUA 2XIKA 4CZTA 5CX9A 3ANRA 4HZRA 5CS6A 3COIA 1V0BA 2A1AB 4RWIA 4C35A 4GFGA 1J3HA 2BALA 5EYMA 3CPBA 3QQGA 3JPVA 2XBAA 3F9NA 5T68A 4D9TA 1ND4A 3B2WA 1E1VA 1FPUA 2UW5A 4MWHA 2OIDA 3FLYA 3ORTA 4UWYA 3W1FA 1OB3A 4CYIA 4AN2A 1NVSA 4JL9A 4BC6A 1EH4A 2QO9A 2WMTA 1XBAA 3QHRA 4XV3A 4JQEA 4KSPA 4JRNA 2VX0A 4N70A 3UO6A 4YJVA 5HO8A 5E90A 3ZM9A 4XMOA 3MV5A 4BCQA 4U97A 3ERKA 2C0OA 3IGOA 4FEUA 1RW8A 4GUBA 1SNUA 4IB3A 5G6VA 4BDDA 2CKQA 4QQCA 4XEYA 4FKVA 4TWPA 5KZ0A 5AAFA 3NZ0A 1DM2A 4MXOA 2YM4A 3FKOA 2W05A 2VTLA 5J1VA 4IVDA 4ACCA 4FTIA 4BHNA 4RWKA 5FUTA 3UG1A 3R7GA 5IF1A 4G6LA 2B53A 2JKOA 4K2RA
chains in the Genus database with same CATH superfamily
2R3FA 2PYWA 1OKVA 4K6ZA 1B38A 2WEVA 2X4ZA 2YAKA 3L8SA 4C33A 4O84A 2ZFYA 2VN9A 4BZOA 4DEIA 5D7VA 2XYUA 3FSKA 2QR7A 2VNWA 4IZ7A 3TTIA 1VYZA 3F66A 3JYAA 3PXFA 3D5WA 2QNJA 4TKSA 3NUUA 2PUPA 4QTBA 4DDIA 3OFMA 3UNKA 1TQIA 2B4SB 4BIDA 4M84A 3W33A 2WTVA 4FT0A 2HK5A 4GEOA 4H36A 2ERZE 4FV3A 3RBWA 4JBPA 4NW6A 3QD4A 5HNBA 1JNKA 1M14A 1FVTA 1G5SA 4HCVA 4CV8A 3AG9A 5ANIA 3FY2A 2R5TA 5GIPE 4XUFA 4E3CA 4NTSA 3PVUA 2EUFB 4EHZA 5HCZA 2ONLA 1OECA 3VS7A 5JGAA 3UOJA 4BI2A 1GY3A 3FZPA 1UWJA 3JS2A 3JVSA 4EH2A 4EKLA 4BCJA 2YACA 3QL8A 4O38A 3CXWA 2O8YA 3WF7A 3OXZA 2O5KA 3V01A 2GNGA 4ERKA 2R3HA 3BGPA 2PUNA 3RK9A 4NYEA 2C47A 3LKMA 4I0SA 3NNWA 3QGYA 5A14A 4FF8A 5EDRA 3DZOA 3DFCB 2WMRA 4FTCA 4D2PA 4LRJA 4W4WA 4IDTA 1OBDA 5HVKA 4O4CA 1GIHA 2YCQA 3M11A 3PXYA 3R8ZA 5CEOA 5IEVA 2P2HA 4OBOA 2P4IA 2H6DA 3O96A 5IA5A 1CTPE 3QA0A 3W0QA 4AOJA 5T3QA 3V6RA 3RINA 4U7ZA 1OBGA 4FV6A 2OG8A 5AP5A 1R0PA 2GMXA 4FL3A 2XF0A 3UG2A 4FSZA 5FWKK 2GNLA 5ETFA 3ZO4A 4FR4A 1OM1A 3MA3A 3U9NA 1Z57A 3HRCA 3NW6A 4R6VA 2NRYA 3DXQA 4XRLA 4AFEA 4O7ZA 4FOBA 4JDHA 3O7LB 3SLSA 4BIEA 3QTQA 3ORMA 2Z7LA 1TFFA 4WNOA 1LUFA 5LMAA 5HE3A 2GQSA 1YWRA 3DA6A 2W1GA 4PTGA 4HYUA 1UV5A 3ZTXA 3LQ3A 3R00A 4GU9A 2OFUA 5GJFA 3SXFA 4M97A 3TNHA 3AXWA 3O71A 3FHIA 1OITA 2WIPA 2UV2A 3KVWA 4KINA 5IUHA 2OU7A 3E88A 3QCQA 1XO2B 4B8MA 5AR2A 1PXPA 4TYIA 4HW7A 3ATTA 2ITOA 4DEBA 5I9UA 4USFA 4FVRA 3PJ8A 4L68A 3ZSIA 1UWHA 3FI4A 3VS4A 3AMYA 3FKLA 4ZTHA 4EH5A 3TDVA 5JQ8A 3B8RA 4LUEA 4RZWA 1YHVA 2YFXA 1ZYDA 2WFYA 2X0OA 4YZMA 3MIYA 2W4JA 5CSPA 3NLBA 5ICPA 1G8JA 3K3JA 1ZYLA 4OBPA 3R0TA 3JY9A 1VZOA 4MNEB 1H8FA 1OPLA 4JX7A 1RQQA 1V0OA 3KXGA 5FGKA 1YI3A 3Q9XA 3P9JA 1L8TA 4CEGA 2QOQA 4IJ9A 5CU6A 4DGLC 3HYHA 5AADA 1L3RE 1KE6A 2X2LA 2GDOA 3P1AA 3V5JA 4CFVA 4QP2A 2YJRA 5AM7A 3QQHA 2B0QA 1RE8A 4O7SA 4KAOA 4G34A 4O4BB 3VWAA 4ZY4A 1FOTA 4CLIA 4XHKB 3EMGA 3EFJA 5HTBA 3II5A 4RVLA 3SQQA 4LV7A 4JAIA 2NRUA 2C6TA 4YO4A 5FEEA 5FP6A 4QYGA 1GIJA 4IDVA 3NMUF 3IS5A 3EH9A 3KF4A 5BVOA 1J7LA 5FEQA 2X81A 4RC3A 4K9YA 4LV8A 4F0GA 3EJ1A 4A9RA 4HGEA 2PVKA 5L2IA 4NWMA 3DXNA 5LCKA 3R7OA 3CEKA 3CJGA 3QZFA 4FT9A 5DEWA 3VRYA 3VBWA 4ASZA 4TYHB 3BBTB 2HOGA 2PVLA 4IADA 3KCKA 1GZOA 2OF2A 4CKRA 2YM6A 4XOYA 3KF7A 3BYUA 3LXNA 4JOAA 4F0FA 1U5RA 4JLCA 5HHWA 4C61A 3TG1A 5HD7A 1KUTA 2YZAA 4WD5A 5KX8A 2BHEA 3R7IA 3QD0A 3VQHA 2B1PA 3MH3A 3S3IA 4BBFA 2O3PA 4YO6A 5ACKA 4AGWA 3W0PA 1GJOA 5EI8A 5JSMA 4OTDA 3BWJA 5BVEA 4EZ3A 4YURA 3NW5A 3LOKA 2YCSA 4MNEA 4CYJA 5A4TA 3N4VA 3RP9A 3RK5A 3UDZA 5H8GA 4Z7HA 4P4CA 4P5QA 4RJ6A 4S32A 5LQFA 1PXLA 3NYXA 2WMQA 3QCXA 4FX3A 3ODZX 4D2WA 4CT2A 3PZEA 3QXPA 4C57A 4DITA 4D4YA 4EOSA 3VUHA 5EOLA 2HENA 5GZAA 2ITXA 3GEQA 4F7NA 4IVBA 4ZLZA 4G9CA 4OTFA 2XARA 1SMHA 3KGAA 2NP8A 2GS2A 3Q9ZA 3L1SA 1BL7A 3D7TB 4L42A 4J99A 3WE8A 4DGMA 5E9EA 1Q5KA 4DFUA 4ZJVA 4L3PA 1NA7A 3TUBA 1G3NA 3A4PA 3MESA 3TWJA 3OWKA 4I5MA 3W2QA 4GIIA 2AYPA 5D41A 3RZBA 4BKZA 2B55A 3CTJA 2PK9A 4WBOA 4JDKA 3ODYX 4YPSA 5HICA 3UP2A 3VJNA 1H1RA 2C6KA 3BYMA 4V01A 2UW0A 5JRQA 3NPCA 4X6RA 3RCDA 4IEBA 2X6DA 3MVMA 1HCKA 4YGAA 3RNYA 3BL7A 4AS0A 1LEZA 4I3ZA 4QYYA 3RTPA 3TEIA 2UZBA 3VNTA 3D5UA 1JVPP 1WFCA 4EOLA 4YJQA 2C5VA 2C6EA 3GU4A 3FL5A 5HOAA 3N4TA 3CD3A 1CSNA 2BZHB 3QD3A 5M51A 4LGHA 4RWLA 4DBXA 4EYJA 5K3YA 2YM8A 4BBMA 3ZUTA 5DR6A 1CKIA 1GNGA 4IAKA 3FV8A 2CSNA 5HCXA 3QRJA 5TKDA 3NNXA 4FTLA 4AZTA 4BCMA 4C7TA 4F7SA 5IQDA 5IISA 4S34A 3HMMA 2RG5A 3PXZA 5GZ9A 5A4LA 3EB0A 3LCOA 4ZSEA 4DTKA 3NSZA 4YTCA 4ONAA 2ZV7A 4GK3A 2J5FA 2WTKB 3TCPA 1XHAA 4JR3A 4QMSA 2CGWA 2ITZA 3PWDA 3MTLA 2WMXA 4A4XA 3R1YA 3NUYA 4FNYA 1S9JA 1ZARA 2IZSA 5HLNA 5IQAA 4DH7A 1WZYA 3KRJA 3OCGA 2Z7QA 3HDNA 4EQMA 4N4SA 4PPAA 4IX3A 1WCCA 3MPTA 3D7TA 2F49A 3AT3A 3B8QA 1SNXA 4HNIA 4QOXA 1XJDA 3FMNA 5AUYA 2W5AA 3OWPA 4JG8A 1KOAA 5HBHA 4FI1A 4IB1A 1JKSA 2PMNX 3RGFA 2IG7A 1G8AA 2VNYA 4FTRA 4O0YA 4WHZA 5DA3A 2R0IA 4X3FB 4M15A 5AWMA 5GJGA 5L3AA 3FI8A 4C3RA 3EQGA 3LMGA 4J71A 2F7EE 4O7WA 3U9CA 1YQJA 4EOQA 5CEKA 5IH6A 1FBNA 4Y85A 3ZC6A 2NO3A 1YXVA 3DK6A 4NM3A 4ZS0A 2XH5A 3R8PA 2C1AA 2HZ0A 1XBCA 2UZOA 4U45A 3RWQA 4XG8A 4F09A 1NY3A 2IZRA 4U79A 2BIYA 5JRSA 4DG0E 2PMOX 3ZEPA 2OLCA 4LM5A 4YZBA 3UP7A 4O91A 4KRDA 4IACA 4QTDA 3HAVA 5JQ5A 4X2FA 3K3IA 4QQTA 4L3JA 5DR2A 3QHWA 2OGVA 5I9VA 2XNBA 4ZTSA 1FINA 2XUUA 5M57A 5DMZA 5J7BA 4F0IA 3ANQA 2WIHA 2BZJA 2GNIA 3C4XA 3KXHA 4QYEA 4BDFA 3RPOA 3BBWA 2VO6A 4D2SA 3R28A 2XZSA 4O22A 2JITA 2J4ZA 1UKHA 2JIUA 4OTPA 4RZVA 2RFDA 4N6YA 4DFZE 3QQJA 4XLIA 3RK7A 3QTZA 4AXAA 5KE0A 1AQ1A 3CD8A 4AZVA 2BIKB 2QOFA 5E7RA 4I4FA 2B9HA 3E7OA 3F3TA 4FKUA 3HAMA 4NSTA 3CE3A 4OT6A 4A4LA 5J5TA 5M56A 3A60A 3TNPC 4CQEA 1APME 2VD5A 4EKKA 5B0XA 1U5QA 3DU8A 4RIYB 4IAZA 1H1SA 2C3IB 3IW5A 4CTCA 1Q3WA 5HO7A 4UWCA 2C6DA 1M2RA 3T3UA 5LCJA 2ZVAA 2BKZA 2DS1A 2BRGA 4MF1A 4XS2A 3KRXA 4D58A 4FNZA 4G6NA 2UZDA 3QD2B 3HA6A 3V8WA 4E4NA 3GGFA 3LQ5A 3R8LA 3U51A 3WIGA 3BHYA 2J5EA 5CEIA 3UOKA 2BAJA 1H28A 5KZIA 3KIOC 2UUEA 3OY3A 4BWKA 4QNAA 5C03A 3IPHA 1LPUA 3ALNA 4N0SA 4TN6A 4GS6A 5FG8A 5TF9A 4E4MA 4EJNA 5HU9A 3KRLA 5I9ZA 3UO4A 3PA4A 4YR8A 3W0NA 2F57A 2YEXA 3QQUA 1W2DA 1YHSA 3IW8A 3V5TA 4AW5A 4AZEA 4XP2A 2IW8A 3Q4TA 3DLSA 3FC2A 4FKJA 3NNVA 3GUBA 5FTQA 5L2SA 1KE8A 2O63A 3QZHA 5AV2A 4ITHA 2OK1A 5FBNC 3U8WA 3A8WA 1J1BA 2A2AA 4RBLA 3ZFYA 2QKWB 1YWVA 1ERKA 1H1WA 3C1XA 3F69A 4FTNA 4I6FA 4JIKA 4MH7A 2ACXA 3EFKA 3PIXA 2Y6OA 3CY3A 4GT5A 4QD6A 4PUZA 4QYHA 4RC4A 2UW8A 1PF8A 2QOIA 3BHUA 1MRYA 3V04A 5GZ8A 1VLRA 4BDEA 2BVAA 3LXPA 1YWNA 4YC3A 2Y9QA 5AR4A 3NNUA 1Z9XA 2WTJA 5HNGA 5EYDA 3VW8A 5IEXA 4AA5A 5DT0A 3CJFA 4O7TA 4QDEA 1P5EA 1Q3DA 3L8VA 3IDCA 4K18A 2EVAA 2UW7A 4I6QA 5CWZA 4AXEA 2G9XA 4CRSA 5I9YA 4NEUA 4Y46A 2VZ6A 1MQ4A 4TRLA 3WF5A 2P55A 4NU1A 4Q5HA 4ZSAA 4OTWA 3G2FA 2J0MB 3ZZWA 4RIWB 2QO2A 4AW1A 4AG8A 5JN2A 4CD0A 1OIQA 5BYZA 4CZYB 5E91A 2AUHA 4J98A 3MY0A 3G9NA 3VONA 2W7XA 3ZMMA 3MDYA 4J8MA 4TNDA 5AP1A 5KMOA 2VTOA 3TV7A 2I0EA 4UMTA 2WELA 3EKNA 2PHKA 4Z16A 3E8CA 2BKKA 4YJPA 1PMNA 3BLAA 2UVZA 4FC0A 3NCGA 4U44A 3G9LX 1H1PA 1YOMA 3O7LD 3HP5A 3QTSA 3UBDA 1URCA 5J9YA 2YIYA 5J95A 3AD5A 1U54B 4GJ3A 3PG1A 5E8XA 3WIKA 4XOZA 5CAVA 4K1BA 1P2AA 2JBOA 4RFYA 4EZ5A 2KULA 4FKGA 3FI2A 4F9YA 1REKA 3HX4A 3PY0A 4Y5HA 3UYTA 4F6SA 2GU8A 3EQHA 3SRVA 5DPVA 3LFDA 4PF4A 3HMIA 3FQHA 1FMOE 2WD1A 4GG5A 2PVMA 4Y5QA 3KU2A 4I93A 4IFCA 4QMTA 4BDCA 3GXLA 3P5JC 3SG8A 3C4EA 3TZ7A 3VS1A 5BPYA 5M08A 3RNIA 4CFWA 3H0YA 4J97A 5CU3A 4AGCA 4DEGA 4PP7A 4CXAA 3TDWA 3OZ6A 1F5QA 3D94A 3LIJA 2XK8A 1JKLA 3GQIA 3OXIA 4FVQA 2BRMA 4RX7A 5AP6A 4UY9A 2YDJA 4O7YA 2BFYA 4ALUA 4GKIA 3GBZA 3V51A 4FKTA 4FEWA 4ASDA 5AUZA 2PE1A 4IWQA 4LUDA 5CF8A 4A9YA 4G5PA 5DYJA 3V3VA 1ZRZA 1Y8YA 3O2MA 5EYCA 1OL5A 1OIRA 2OJJA 4DFYA 4C0TA 4AUAA 3MA6A 4PNIA 3UC4A 2IZUA 4X3JA 4CCUA 4NKAA 3C51A 2E9NA 2WPAA 3KULB 4FT7A 2ESMA 5DT4A 4O0TA 3UNJA 3RHXA 4YZCA 4YJNA 4ANBA 4DEHA 3DJ5A 4NH1A 5JH6A 1BYGA 4O81A 3D5XA 3CPCA 2E9PA 3P78A 4I23A 4QP9A 4V0GA 3RALA 3V5LA 2IZTA 3MY5A 4WUNA 2CN8A 2X1NA 4NL0A 3IGGA 4FVPA 2VX1A 3O17A 3TJDA 4QMMA 2CHLA 3Q53A 4UXQA 4PTEA 3VAPA 4JI9A 3HL7A 5E8VA 3ZO3A 2BROA 3I1AA 4RA4A 3I81A 1JSTA 2RGPA 4QP3A 4YHTA 4O4EA 4DEAA 4EZ7A 3IW7A 3UO5A 3OY1A 3N51A 3DBCA 4HOKA 4C8BA 4AZWA 2OH0E 3HDMA 3QYZA 2FO0A 1U4DA 1BMKA 4X2JA 2G01A 1Q8YA 4WO5A 1ST4A 3S95A 4ZSGA 3W0RA 3EQCA 5CSXA 1JBPE 4B99A 3VS3A 2R3IA 4C02A 3TV4A 3W8QA 3QXOA 2QOCA 4GJ2A 2W96B 3CKXA 5CY3A 3ACJA 4FSQA 2IPXA 4Y8DA 5AR8A 3T3VA 3FY0A 4H58A 4IWOA 2ZYBA 1XMLA 4CVAA 4PMMA 5CEMA 3BKBA 2CNQA 3UMWA 4AU8A 3UVPA 4O0XA 3OF0A 3FMJA 3I7BA 4L3LA 2X9FA 4IAIA 3NWWA 4YTHA 4EOMA 4CT1A 3DS6A 5AR5A 2IO6A 2OF4A 1ZWSA 3O8TA 3VBXA 3LCTA 3OOGA 4J8NA 3UTOA 1JSVA 4D4SA 4FIFA 5ANKA 5AIRA 4QMYA 5KKRB 4AT5A 3REPA 2QHNA 4HJOA 4J96A 4KIKB 4GK4A 2P2IA 2HWPA 4BHZA 1Q8TA 3MB7A 5IQGA 5HO6A 3KB7A 3Q9YA 2DWBA 3EHAA 4IZAA 4DGGA 4TZRA 4D55A 4E26A 4U6RA 3F6XA 3PP1A 5K9IA 5KMLA 3HA8A 4PY1A 4PDYA 4O83A 2J7TA 2H96A 2A98A 4O6EA 4P2KA 4Y72A 3D7ZA 4BDJA 3QRTA 4ZMFA 4MD8E 4KB8A 2XNEA 4BGHA 3IW4A 2PZIA 4R3CA 5K5NA 2Y4IC 3F88A 3JR1A 4D28A 4WSQA 1Q8UA 4E6DA 4UYNA 2W1IA 4W8EA 3AT4A 4BICA 4CMUA 2HELA 4CQGA 5DN3A 4XLVA 5DEYA 5JMSA 4APPA 5FD2A 3F5PA 5CF4A 5M07A 1Q8ZA 3TXOA 4WNMA 2PUUA 5HU3A 1H0VA 1OUKA 3I6WA 4DC2A 1NVRA 1OZ1A 5C8KA 3DTCA 3HLLA 3BGQA 3A99A 4PWNA 4FTJA 5E1EA 2H34A 2BZKB 4TL0A 1OKZA 2UVXA 3H10A 4G3GA 3VBYA 3D15A 2ITVA 5E8TA 2IVUA 4DN5A 4EHEA 5B2MA 2XIYA 4DTBA 4JBQA 5E4HA 4N57A 5BMSA 4M69B 2WNTA 4P90A 4PL4A 4FOCA 2R9SA 2UZNA 5BVWA 4C4JA 5AUVA 4C62A 1XH5A 2QCSA 4F4PA 1Q41A 2BTRA 5IA1A 2YDIA 2XAOA 4TYEA 3COHA 4IAAA 3KK9A 4FTAA 3LMIA 1OL1A 4FSRA 3S4QA 2E9OA 4PX6A 4XJ0A 2I40A 4J95A 2GCDA 5GJDA 4UX9A 2FUMA 3PRFA 1XWSA 3UPZA 2CKEA 3D0EA 3O8PA 2BR1A 3R6XA 3C13A 3MJ1A 1HOWA 3EQRA 3FZTA 4I41A 3QQFA 3IOKA 3O5AA 4FEVA 4QP7A 4ERWA 4AX8A 1M7QA 1QL6A 2EXMA 2HZ4A 3EKKA 2CGVA 3I4BA 4GT3A 2P3GX 4U3YA 5HNIX 5C4KA 2EWAA 4AOIA 2Z2WA 2VWUA 3KL8A 4Q9SA 3RPVA 2QQ7A 4NM7A 2OZOA 2ZMDA 2F7ZE 4FKPA 2BDWA 2EU9A 4R77A 5M06A 2VTAA 4EK6A 3ZLYA 3W2SA 3L9PA 3PTGA 4MBJA 5AX9A 3R8MA 3QBNA 3R63A 4LRKA 5IA4A 2QI8A 3NFGB 2WQMA 3BCEA 4OW8A 4RWJA 5K5XA 5D1JA 5DI1A 1REJA 3WF6A 2YM3A 5AP2A 1VEBA 3A7HA 3KRWA 2J0IA 2C30A 3V8TA 2OICA 5HIDA 1NW1A 5E1SA 3A4OX 4HZSA 3LFBA 2HZNA 3QKMA 3BQRA 1UNHA 4CZUA 2CNUA 4MXAA 3QFVA 2ITUA 3Q4UA 2XNPA 4YZ9A 5F94A 1XH7A 2JBPA 2UW3A 2CLXA 2NPQA 3PJCA 4RJ7A 1J1CA 3Q96A 4NJ3A 2XM9A 3FZSA 2GFSA 4TXCA 4F64A 3U6HA 4NJDA 2PY3A 1P4FA 4O82A 5EW8A 4BCPA 1J7IA 2F2CB 4BCGA 2Q0BA 2R3RA 5LWMA 5IMXA 5ACBC 4UV0A 3MB6A 2WO6A 4QMNA 3W0MA 4RG0A 5E8UA 2VO7A 2O2UA 3FQSA 5FXQA 3FSFA 3CCNA 4YLJA 4QP4A 4AZSA 2CGUA 2E2BA 2X7FA 3D2KA 3PJ1A 3MY1A 3E7VA 3IONA 5B7VA 4KS8A 4GYGA 3R2YA 4OAUC 2C3LA 2XIZA 1H27A 3D2IA 2ETRA 3TL8A 4USEA 4WOVA 2X7OA 5DG5A 1PJKA 4KS7A 2WHBA 2I0HA 3UPXA 3R73A 4UEUA 3LFQA 2JIVA 4F1MA 2VV9A 4L8MA 4CFMA 4E4LA 2W4KA 2GQRA 4DLJA 4JG6A 5JZNA 3G33A 5IA2A 2ZDTA 2OJ9A 4I6BA 4FIJA 3F2RA 5AJQA 5F95A 1DS5A 2R3KA 3WZKA 4KABA 4MXYA 3BEAA 4DINA 2FSMX 3FE3A 4PDSA 2F4JA 3MFSA 2GNHA 3OT8A 2XVDA 2V22A 2VTIA 3R2BA 3LFAA 4IAFA 5DOSA 4CG9A 5AV4A 3UIBA 3C0IA 2QLUA 2HY81 1XKKA 3F7WA 4K0YA 4NIFB 4ZLYA 1YXXA 1KE7A 3GFEA 5DH3A 4QP1A 1PXJA 2J90A 2PVNA 4FV5A 4X21A 4O0VA 3SW7A 5JZJA 4AWIA 3SA0A 1AD5A 3I0QA 4ZMEA 2PVHA 3NYNA 3TNQB 2YIQA 4KBCA 3HMOA 3PXKA 3DKGA 4QMPA 4D1ZA 1FVRA 1WBSA 3TUCA 1B39A 3DBFA 4HCTA 2GHLA 3GCPA 4LYNA 4AGUA 5K0KA 3MVHA 2J0LA 3CTHA 4LOOA 3F3ZA 4HYHA 3MTFA 4YPDA 2J2IB 4DEDA 3GU6A 3THBA 3UIUA 3BRBA 3IO7A 3ZFMA 3E92A 2WMBA 3KREA 3DNDA 4TT7A 3DKCA 5HGIA 3G51A 5ANJA 1QPEA 2JGZA 3NVMB 3QTRA 5L8KA 3UQCA 1R39A 3PE1A 4FV9A 2ZM3A 3TACA 3W55A 1GZ8A 4GVAA 3R8UA 2RG6A 2V7AA 3FLWA 4DTAA 4QPMA 3BLQA 2GNJA 5CYIA 5HIEA 2FA2A 4MBLA 4ENYA 5F4NA 2FVDA 4RT7A 4IMYA 4ZEGA 3CP9A 4ANMA 4RQKA 3CC6A 3QTUA 2VO0A 4IC8A 4ID7A 2YN8A 2WOTA 5H2UA 4BCHA 4YC8A 2CCIA 3UZRA 2QOLA 1ZOHA 3RAHA 4O7NA 3E3BX 5HG7A 4L7FA 3W2CA 1UU3A 3IQ7A 4QNYA 4XP3A 4DG2E 2X0QA 3DK3A 4FSTA 5TOZA 2OIQA 3P5KA 4NFMA 1DI9A 5AV3A 3NX8A 5IKWA 3FXZA 3UIMA 3RMFA 5L6OA 4C4HA 3FWQA 4BL1A 2W99B 2IW9A 3KVXA 4O6LA 3E64A 2Q0NA 3RZFA 3DV3A 3FMMA 4FGBA 4BB4A 5LXMA 2ZB0A 4YZNA 1NXKA 4OTHA 4RA5A 3DAEA 5AR7A 3CGOA 3TI1A 4WSYA 3GCQA 4QQJA 4ZTQA 3Q4CA 4ZY5A 3KCFA 3EOCA 4E73A 1M52A 2C5YA 3V6SA 3E93A 2OI4X 4BYJA 3SOCA 5LMKA 4IM3A 1YI6A 3ROCA 2KTYA 3HRFA 1A48A 3WYXA 3C4FA 4I0RA 3SVVA 4LGGA 3KK8A 1S9IA 4AN9A 4W4XA 4BWXA 1GZNA 3A7GA 4FG7A 1ZMUA 2G1TA 5AMNA 3BWFA 4FZDB 3U55A 4BTFA 2J0JA 2R3OA 2XNMA 4PMTA 3Q9WA 1Q4LA 4BCNA 3NCZA 4G9RA 5C1QB 3PE2A 5A4QA 3MN3A 3CR0A 2FSTX 4K8AA 3OD6X 4BVUA 5L2TA 3ZUUA 5HTCA 2IJMA 3LLAA 3C4WA 4I0TA 3R7UA 5JGBA 3Q60A 3PVWA 4YHJA 2JFLA 4IW0A 4DH8A 3UVQA 2BILB 3G0FA 5TE0A 2BDJA 3DNEA 3DAKA 4I94A 1V1KA 1LEWA 3A7JA 3GI3A 3BL9A 3LLTA 5AV1A 2G2FA 2FH9A 4BYIA 3EN4A 3FBVA 3F2AA 3FHRA 3KXMA 4Q2AA 1PKGA 3DY7A 3LFEA 5CALA 2FB8A 4I5HA 4W8DA 4IH8A 3BHVA 3EFWA 2W9ZB 3EN6A 3NUXA 1QPCA 2QLQA 5KMJA 4BDIA 3E63A 5FTOA 3LHJA 3Q3BA 4I21A 4F7LA 5EDPA 1ZY5A 3ZBFA 1Y6AA 1W7HA 4MKCA 4ZIMA 4U41A 2VTTA 3S00A 2QG7A 4O27B 3I5ZA 4F9CA 2H8HA 3GFWA 4ZOGA 3VUTA 4DE4A 5IUIA 5M4IA 2X2MA 3FI3A 3G6GA 3VULA 5KUPA 5C27A 2XBJA 3KXXA 3L9LA 3RVGA 1H26A 4CNHA 2YERA 1PXMA 2PZ5A 3OW3A 4EYMA 4ACDA 4H05A 1E1XA 1Q24A 2EXEA 4ARKA 4D5KA 5CANA 3B2TA 4DLIA 4IHPA 1QPDA 1JLUE 1DAYA 5BYLA 3ID6C 4QQ5A 3F5GA 5CXZA 3BYSA 3TIZA 2VTQA 3A7IA 3CTQA 5HEZA 4LGDA 3D14A 4A9TA 4F08A 4TYHA 3PPKA 2BZIB 4JBVA 2R3PA 1MP8A 4PPCA 3BLHA 1YOLA 3E87A 3VHKA 1OMWA 5AP4A 4IWDA 3DDQA 4W4YA 2YCFA 3UNZA 3BPRA 2R7BA 5IA0A 4U40A 2GFCA 4M14A 3GOKA 1WBOA 3R7EA 3UQGA 3C0HA 4QMXA 4ZTRA 4E7WA 4F65A 4XRJA 4IVAA 3I6UA 3EQPA 3QC9A 4BJJB 2XCKA 3MFTA 2ITPA 3QU0A 1LP4A 3EN5A 3Q5ZA 4CG8A 3QWKA 4QMWA 1P14A 2ZJWA 3AC5A 5L2QA 4H3QA 4D1XA 4S31A 3RI1A 2VWWA 4MF0A 4QTEA 3CIKA 2PZRA 3MS9A 1OL2A 3MIAA 4H3PA 3IECA 1GOLA 3TZ8A 3U4UA 3BU6A 2UW6A 5AX3A 3VC4A 3RKBA 3KMUA 3BEGA 3FLNC 4QMZA 2AC3A 5AUXA 3OROA 3EQDA 2BHHA 2ZDUA 5LOHA 3PPZA 2A27A 3LJ2A 3WYYA 1SM2A 4AT4A 3OVVA 3KY2A 4MBIA 5CZIA 3WZDA 1WVXA 3ZOSA 2XK4A 2HCKA 3TT0A 2C5NA 4FEXA 3R9DA 3EFLA 3OS3A 4YU2A 5HX6A 2J51A 1IA9A 2REIA 3HP2A 1MRUA 5HI2A 4FTTA 4K33A 2PULA 5HG9A 3P0MA 4EWHA 2VGPA 1W84A 2Y7JA 3COMA 2C69A 2J9MA 5G1XA 3VS0A 3DKOA 3PPJA 2X39A 3SD0A 4DA5A 3GCUA 3EIDA 3R30A 4YNOA 1QCFA 1Z5MA 4EHGA 3H9RA 2WXVA 5LWNA 2SRCA 5E8WA 3DGKA 5HESA 2Y8OA 4GSBA 4FE2A 2JFMA 3Q5IA 4U42A 3QX2A 2PZPA 2XK6A 4XG7A 3ACKA 5F9EA 3PZHA 4KKEA 4NW5A 4F1TA 4MD9E 2R3GA 5CAPA 3MGYA 5AUWA 1HCLA 3LM0A 3QALE 2C0TA 3NR9A 3U6JA 2R64A 4R8QA 3SKCA 2C6MA 3BQCA 1PY5A 2YCRA 3LFNA 3HRBA 3ITZA 2ITYA 4FNWA 3UZTA 3ATSA 2PE0A 4AGDA 5JK3A 5H8EA 1O6YA 3OWLA 4CFNA 2W06A 2R7IA 3ROYA 4PNKA 1SVEA 2ZV9A 2RFEA 1JQHA 3DBDA 4E5WA 4UXLA 4GV1A 5KBRA 5M4CA 2FGIA 2PL0A 3NYOA 2VTHA 3AOXA 4F9AA 2XALA 4X2NA 3P08A 1B6CB 3NUAA 3AMAA 4OAVB 3BE2A 3LM5A 3R22A 1WMKA