4F0IA

Crystal structure of apo trka
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
284
Chain Sequence
CVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPDKMLVAVKALKSARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords High affinity nerve growth factor receptor
publication title The Crystal Structures of TrkA and TrkB Suggest Key Regions for Achieving Selective Inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 284
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f0iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f0iA01
5M51A 2XYUA 4HOKA 2HELA 4O0WA 4DFNA 5J1VA 2J6MA 2ZMDA 3OF0A 4ALVA 3EH9A 5CQWA 4D5HA 4KRDA 3VHEA 1BKXA 4MHAA 3UYSA 3VBTA 4J98A 5CS6A 5TT7A 3ZU7A 4AZTA 3MA3A 4LGHA 4R7HA 5HESA 3R7UA 3NUUA 3O17A 3TZMA 3A7FA 2CKEA 4L44A 4ZSAA 3IOPA 4WKQA 5FTOA 3QHWA 2J90A 3OCSA 5AUVA 4DFUA 2CLXA 3BHVA 4ZP5A 3PJ2A 4PTEA 3NMUF 4IX5A 4K6ZA 4N70A 3UNKA 3WILA 2YAKA 2Z7SA 4JS8A 4JAJA 4G6LA 4I6BA 1ZOHA 2PMNX 4PRJA 2X8DA 5HE0A 4FV5A 3DBDA 4FT7A 1Q61A 3UQGA 4YZBA 4DFLA 4JBOA 4K8AA 4RFMA 3QRIA 4QTBA 1B38A 3PPKA 4FKLA 4R3PA 3VQUA 5AUTA 4OTDA 3TTIA 2C4GA 4O6EA 4O1PA 4LG4A 5CENA 5GZAA 3QFVA 3UDBA 4ZTMA 1WBOA 3WF9A 3BQRA 1BI8A 3UOLA 4U9AA 4U7ZA 4QQJA 2QOHA 4YJSA 3NGAA 2ZV8A 4JQ7A 2YM8A 3IW6A 2G15A 3VIDA 1Y6BA 4GMYA 3MJ2A 4S34A 3R8VA 4FE2A 3MY5A 2VWYA 5IQCA 5CF4A 3MB7A 4FTJA 2ACXA 3GFEA 2JAMA 3V3VA 3ZDIA 2QHMA 3DJ7A 4FOCA 3VBXA 2C1AA 4PNKA 2J2IB 2UW5A 5IEVA 3BKBA 4EH4A 2V55A 4F64A 3QCYA 2R3NA 4QNAA 2JC6A 2X6EA 3HRFA 5D12A 3JS2A 4CXAA 4XV1A 4KIKA 5AP0A 4AU8A 4FKOA 3R7IA 4PY1A 4C58A 4A7CA 4AW5A 1JBPE 3NCZA 3QX2A 5HVJA 1WMKA 4O0UA 3L8SA 5I9YA 2ITUA 5M06A 1PW2A 1W83A 2QU5A 3MIAA 5DLSA 5L6OA 3U4UA 4H1MA 3W8LA 4ZY4A 5EDQA 2UVYA 2CSNA 5HKMA 4I24A 1OECA 1E9HA 3RPOA 3LOKA 5C8MA 1KV1A 4KB8A 4LFIA 2OICA 5AR8A 3RK5A 4CMTA 1V1KA 3MH2A 4O91A 5AR5A 5K0XA 4NU1A 4E8AA 1IEPA 3V5JA 2P2HA 4YUQA 2CKPA 1OKZA 2FSLX 4BTMA 1PMUA 1UV5A 3FXWA 1ZOGA 3PVWA 3QZHA 4I6QA 4EONA 3ZONA 3IO7A 3KXZA 3WYXA 1F3MC 1ZMWA 3R8ZA 1JLUE 4MWIA 3R1SA 4KNBA 4AGCA 4N0SA 1YWNA 3DK3A 4R5YA 3OUNB 3HKOA 4HZRA 3KXHA 2ZB1A 3UYTA 1OM1A 5M4FA 2EWAA 4M97A 4Q2AA 4L52A 5H3QA 2EUFB 4PTCA 2X4FA 3E5AA 5C1QB 1G8SA 4FV7A 3LMHA 1TQIA 4Q9SA 4EORA 4IIRA 4KKGA 2A4LA 3UIBA 3KQ7A 5E7RA 3LW0A 4JQ8A 2G2FA 4WG3A 5LWMA 1MP8A 3AC5A 4RC2A 3AOXA 3E8NA 5L8KA 3HUCA 3UQFA 2OXYA 4DTAA 3FLNC 1YDTE 3E3PA 3EQIA 4E4MA 1Q8YA 2YIXA 2ZV2A 2QOBA 3I1AA 4A4XA 2HAKA 2BMCA 2PTKA 2J0JA 4ZTNA 2OZAB 3N9XA 4AFEA 3OD6X 3UOHA 5CU4A 5GHVA 1JOWB 4R3CA 4N4SA 2F7ZE 3KVWA 5DWRA 4JQEA 4H39A 2WOTA 3HZTA 3LIJA 4OTIA 4DITA 4KA3A 5CSXA 5EM5A 3Q5IA 4MVFA 5EQYA 5CEOA 4CQGA 3OBJA 5BVFA 5HICA 5EDPA 1OIQA 2YN8A 2X39A 1JSVA 4O7YA 3UP7A 3AXWA 1ZARA 4U79A 5KHWA 3C51A 4IAZA 4LYNA 4O1OA 3WZJA 4MD9E 4ASZA 2Z02A 1O6KA 4BDAA 3ZYAA 5AP3A 2PVNA 5BYLA 1WBWA 5CI6A 2QOCA 2I40A 4FA2A 4QMQA 2R3KA 3BEAA 3MW1A 4FVRA 5LMAA 1H8FA 4YZCA 3JVRA 2FSTX 4FT9A 4UZHA 4XG7A 1XBCA 4K2RA 3MH1A 5KBQA 2WU7A 3TIZA 2CGWA 3ORLA 1U5RA 3VBYA 5DMZA 5J9LA 2RKUA 5LJJA 4B6LA 1PYXA 1HOWA 2QONA 3UC3A 2WMUA 4GT4A 3UZPA 5CAUA 4DT9A 2B4SB 4PMTA 2PULA 2E9VA 2YERA 4OLIA 2XIXA 4RIWB 4EK6A 3VRZA 4EC8A 4FEUA 3Q9ZA 2FSOX 4GUBA 1B39A 5CEMA 5GINE 2OJGA 5ANOA 3VBWA 3FHIA 3GCUA 2PVHA 4RG0A 2GHGA 4XLIA 3ZFMA 2VRXA 2XIKA 3OS3A 1OIYA 3UGCA 3R9NA 3LLTA 2Q0NA 5DI1A 4BCMA 2VGOA 3NAYA 4YURA 3NIEA 4QTDA 2PUUA 4YJOA 1R0PA 4BICA 4D2SA 4EOSA 1FINA 3BHTA 3F7WA 4LI5A 1UU3A 2YM6A 4BTKA 5IISA 4EOJA 4IFGA 4WG4A 1FVTA 5E9EA 5IH4A 1ZYDA 4EJ7A 4RVTA 5BVNA 2PMIA 3QCXA 2Y6OA 4LMNA 3OWPA 4NT4A 4BHNA 3FMMA 3F9NA 3FKOA 4LGGA 4FOBA 3QC9A 3UG1A 5L6WL 2P4IA 4S30A 5G6VA 2F2CB 4PL3A 4DA5A 5I9WA 3ZLXA 2JEDA 3UQCA 2VWUA 5AV4A 3A4OX 2XVDA 4MBIA 2YM3A 4ARKA 5IH5A 1CKJA 5J1WA 1GZ8A 3AMAA 3BPRA 4FT0A 4J99A 2JDSA 4NCTA 5D11A 3NR9A 3B2WA 3KN6A 1TQMA 2O3PA 4FK6A 1OKYA 4CRSA 1NA7A 3DAEA 3GBZA 4JOAA 4M68A 4OBQA 4UXQA 3ZH8A 2R3HA 4B8MA 3O51A 5J87A 4XG8A 3UO6A 2H6DA 4PDOA 3RAKA 3SOAA 3WE4A 4DF3A 2I7QA 5T3QA 3KEXA 3HRCA 4GCJA 2BKKA 4X3FC 4X6RA 4Z7HA 3QLFA 5AAGA 1UKIA 4C4GA 2J51A 4QMXA 3PY1A 4L68A 1K2PA 1GZOA 2W1EA 3PVUA 5M4UA 4YP8A 4JX3A 5EYMA 4CLJA 4FGRA 4OGRA 2XJ0A 4LUEA 3AT4A 4U80A 2X8IA 5CU3A 3Q9YA 1U54A 5FXRA 2NPQA 5B0XA 4AFJA 5ETAA 5KNJA 2W5BA 3IDPA 4M0ZA 4WRGA 3NYNA 4RLLA 2R3OA 2XKEA 4H1JA 4NK9A 4AN9A 2PPQA 1I44A 3TIYA 5LVLA 5ACKA 3TDWA 4JX7A 4UYAA 2XNOA 3F3TA 4G6NA 3RALA 4A9SA 2PHKA 2VN9A 1GZKA 4YJPA 3NUXA 5EM6A 3OCBA 4TT7A 3OZ6A 1CM8A 2X8EA 4IEBA 3CS9A 4JIAA 1SVHA 4QMVA 3FHRA 2OIQA 2C5YA 4I21A 4MXYA 5CX9A 5ETFA 2QKWB 1G8AA 1JSTA 5IMEA 4H36A 5CALA 1XKKA 5CEKA 3DCVA 1Q8WA 2QR7A 3D2KA 1JSUA 4L43A 3FZPA 3CIKA 4U3YA 3TZ7A 2BALA 1BI7A 2OIBA 4MXCA 4FX3A 4JG6A 5E92A 5IQHA 5DE2A 4BWKA 2UW6A 2ZOQA 2ONLC 1U4DA 3G51A 3VBVA 3ZFXA 4XP3A 3QCSA 3L9NA 1NY3A 4ZIMA 3LFNA 4CZUA 3FLQA 4B9DA 4E6CA 3D5XA 3W2PA 3RWQA 3MH3A 5DNRA 4HCTA 3EQBA 4O82A 3GC7A 4GIHA 5IA5A 3U87A 4E20A 4UMTA 5JMSA 1B6CB 3QTXA 4AZSA 3TUDA 4DEHA 4RX7A 1DM2A 4R5SA 2XYNA 2C5XA 2WMBA 2WMRA 4O2ZA 4EK8A 5ANGA 4ACHA 5IQAA 4O0XA 2EB2A 4GL9A 4MD8E 3E88A 1L3RE 4BL1A 4PP7A 2CCHA 2WTIA 1WBPA 2IZSA 4QP2A 3EZVA 3DDQA 1H1PA 1GZNA 4IM2A 3KY2A 4E7WA 4QMYA 2REIA 4BI1A 2F9GA 2F4JA 4XNEA 2VX3A 4YZMA 3Q9XA 4I22A 2Q83A 3TDVA 3DPKA 4I0SA 4TWOA 1P4FA 4U45A 5KUPA 4QYHA 2UVZA 1OMWA 3ZRKA 3QKKA 4RVKA 4V0GB 4O7TA 4U43A 4JT3A 3UBDA 2JBPA 3QWKA 3ZO3A 4H3PA 4RJ7A 2QKRA 2VWWA 4IQ6A 4WBOA 2WD1A 2UW0A 4M7IA 5DRDA 1JWHA 4FNZA 2BZKB 5JGDA 3BV2A 4JBVA 3RMFA 4AGWA 3OWKA 3RAHA 3E8CA 3OOGA 2O65A 2HXLA 2VX1A 2BROA 3QTQA 4D4VA 4TWCA 5IA1A 5KMNA 1OGUA 4XH6A 3FKLA 5CY3A 3MWUA 3QC4A 4RX9A 4BRXA 4DBXA 3PJ1A 4CZYB 4YHJA 3SW7A 3OUKA 4TNDA 5GJFA 3FLYA 3IW7A 1RDQE 5LVNA 4UEUA 1SNXA 2V22A 2DQ7X 4BCFA 2W4KA 2EXCX 3I7CA 2EXEA 3E93A 3QD2B 4KIKB 1OKVA 2DYLA 3QLGA 3QZGA 2IZTA 1A48A 5KBRA 5HNBA 4YJQA 5FP6A 4Z16A 1AD5A 4BY9E 3RHXA 5E91A 1V0PA 3LXKA 2G9XA 4EQMA 4LV8A 4BGGA 2QO9A 2B53A 3NX8A 4XG2A 1KWPA 4HVHA 5HTCA 4PV0A 3A7IA 4QP4A 4O22A 4EK5A 2OFUA 4FKPA 4QMLA 4UWCA 3TWJA 4CYJA 4DEBA 3QA8A 3BHHA 1E1XA 1XBAA 5CVHA 5AUWA 3G9LX 5LVOA 1ZZLA 2W1CA 4P7EA 4RZWA 4YGAA 4FTIA 3W2CA 4PPAA 4YO4A 4R6VA 3TT0A 4HCVA 4BDDA 4IHPA 3VS0A 4FZAB 2LGCA 4G5PA 5IQIA 1O6YA 5HO6A 3RK9A 3V5TA 3G6HA 4GS6A 5D10A 3ZLWA 3R00A 3QRJA 4JNWA 5KX8A 2RGPA 5AEPA 4NTTA 5A4CA 3C9WA 4BDIA 5M56A 2YEXA 3L8VA 4GT3A 4IZYA 4CTBA 4ZK5A 1YXVA 4RWKA 3C50A 5EH0A 4FICA 3HX4A 5KMMA 4AGUA 1J1BA 4YLJA 3PLAE 2W06A 3GU5A 4MWHA 2VTOA 1FMOE 4QMSA 3HUBA 1QPDA 3C4FA 4FF8A 4O0YA 1P4OA 2CJMA 4BKYA 1XH6A 3GCSA 4C2WA 4NZWB 4QMOA 2JKKA 4B99A 2OF2A 1T46A 4FUXA 5LWNA 4XHKB 2WO6A 1CMKE 4YR8A 1GY3A 5BMMA 1XH4A 3RZFA 2WEVA 4MBLA 3Q60A 5H8BA 4O7VA 5IU2A 5HG7A 3TNQB 1YXXA 3RAIA 4HNFA 1FVRA 1KE9A 3OROA 3HV3A 1ZY4A 4FUYA 5JH6A 3R7GA 3VS5A 3HECA 3A4PA 3F5PA 3OVVA 4PQNA 5H9BA 3QA0A 2YISA 4O83A 5GZ8A 5I9VA 4I4EA 5FEEA 3F2NA 2ZM1A 3WF6A 1V0BA 3LJ2A 4DEEA 2OJJA 4HNIA 1ATPE 4IVDA 3UOJA 4M67A 3HGKA 5M55A 4BDKA 4AA0A 4GVJA 1VYWA 3C7QA 2QO2A 4PX6A 3HMMA 2YHVA 5AM6A 4AA5A 5EI6A 5FTQA 4XRLA 4AN3A 4GJ2A 2RG5A 3A7GA 2OH4A 4RFYA 4CKIA 3KVXA 3MVHA 4BDJA 2B9JA 4ANBA 3AMBA 4AS0A 2F7XE 4DT8A 1MQ4A 2VTQA 2QU6A 2W0JA 3BHYA 1TVOA 3POOA 4ITHA 4K9YA 4TWNA 4CEGA 5AA8A 1A06A 3E92A 5CVGA 4IAIA 3EKNA 2SRCA 5A6NA 4O2PA 3PP0A 4WO5A 2HIWA 4X6QC 4C35A 2QLQA 3FV8A 3W55A 1PHKA 2QOOA 3GU7A 3HLLA 3KXXA 4IC8A 4AW1A 3G6GA 3Q4TA 2UW3A 3ZC6A 3D83A 5HCZA 4CG8A 4BZOA 3HAVA 3BZ3A 4JDHA 2PE2A 5M08A 3BRBA 3LXPA 3V6RA 3VUKA 3WZDA 4I0TA 4UALA 5A6OA 4MBJA 4A9UA 2YWVA 4YJRA 1H26A 3OC1A 4CV9A 3TI1A 3IOKA 1MRUA 4OTQA 2W1FA 4C59A 2XK6A 5HIBA 4BTFA 4F7SA 2BRBA 1Y57A 1PXNA 2QHNA 3O8PA 4IACA 4X3FA 2WMAA 2I0YA 3COIA 3PWDA 4I6HA 3DZOA 3KB7A 3OW4A 1LPUA 3IONA 2IVUA 3Q4UA 4P2KA 4WUAA 5ICPA 4F1MA 2UZNA 5AP1A 4BCIA 4GFGA 3U6IA 3GNIB 3GGFA 1O9UA 3QZFA 4KIOA 2VTIA 4ANMA 5CF8A 4E26A 2PUNA 4D4YA 4AW0A 4OTHA 2IVVA 2XJ2A 4I5PA 4R1YA 4L7FA 2I0HA 4EBVA 5BQ0A 4QP1A 2YIQA 4MNFA 2R5TA 4G3EA 4F9BA 3JY0A 1VJYA 4U8ZA 2OSCA 2VO6A 4L3JA 2VWXA 3ODZX 5G1XA 2C3KA 1Q3DA 4PWNA 1WBVA 5AIKA 4FV3A 5AIRA 1WBTA 3RI1A 4CFFA 1OIRA 4WA9A 5AADA 4RA4A 1PXOA 2YLEA 2GQRA 4NM5A 5FLFA 3KRRA 5E8TA 3MB6A 4TWPA 5IEXA 2BRHA 3GP0A 2H8HA 4G34A 4ZSEA 1Y91A 1F0QA 4BI0A 3NUPA 5FP5A 3P7CA 2QVSE 5EHLA 1QL6A 5AM7A 5GJGA 4EZ7A 4Y83A 3P4KA 3R1YA 4XP2A 5DT0A 2Y4IC 2OBJA 3BU3A 3BYOA 2W1IA 2FA2A 3PJCA 5I3OA 3EMGA 4YC6A 4C37A 4XV2A 5EHOA 4FG8A 5FM3A 3RBWA 3V51A 4A07A 4AOIA 3MIYA 4AZVA 4OTPA 5C8NA 5IPJA 1Q99A 4DC2A 5EKNA 2ZAZA 5EHYA 2JKQA 3HA6A 1OPJA 4NW5A 4EWQA 3TZ9A 3PVBA 3PTGA 4W4WA 3L1SA 5IQDA 3OXIA 1Z57A 4EUTA 2OLCA 3DK6A 3DDPA 2EVAA 2X7FA 2VO3A 2XBJA 3PSDA 5CXZA 1U54B 3SOCA 2XKCA 3EQPA 4IZAA 2E2BA 4YZ9A 4AXAA 4AP7A 2CNUA 3QRKA 4DH5A 2GS7A 3KULA 1KE8A 3DLSA 4PP9A 3ORMA 5HVYA 3Q32A 4YJTA 4QP9A 2R3GA 4U3ZA 3SA0A 2C6DA 3BBTB 3M2WA 3RJCA 2ZJWA 1S9JA 3QU0A 4NIFA 3VVHA 2HZNA 3FBVA 3NLBA 3NW7A 3UTOA 4TL0A 2UZVA 3IKAA 4YO6A 3EYHA 2C1BA 4I41A 2V62A 1YWVA 1BL7A 2XEYA 5BPYA 3DNEA 4HGSA 3A60A 2XK9A 5FXQA 4C3RA 5IF1A 4DAWA 2W1HA 3SQQA 1PKGA 3AGLA 4RJ4A 3IDCA 2F7EE 4QP8A 4M69A 2YJSA 3G5DA 3LFEA 5CTPA 4BWXA 4F0FA 2UUEA 3MVMA 4W8EA 5M57A 3MVLA 3P5KA 3F5UA 3F2RA 4I93A 4G3DA 3FSFA 3C4EA 5DOSA 5C9CA 3Q9WA 1Z5MA 4EH7A 4OAUC 2BAQA 4TPTA 4APPA 2GNIA 5FEQA 4DCAA 4IANA 5CAPA 4WNPA 1GIHA 5K4IA 3N4VA 4FK3A 3HYHA 3VS2A 4W4XA 2P33A 4UV0A 4QMUA 3ENMA 4LUDA 4I5CA 3ZOSA 2FO0A 5DHJA 3W18A 2B0QA 1TKIA 3ZXZA 3BEGA 4GK3A 5E8UA 5AP2A 2PMLX 2Y0AA 5BVOA 2CNVA 2IG7A 2BZJA 3UNZA 3SAYA 4ZSGA 3DZQA 3SG8A 2WZJA 4Y73A 3JYAA 1YHSA 3CGOA 1H4LA 5DEYA 4IZ7A 2V7AA 3O7LB 5HE3A 1KE5A 5CAQA 3Q52A 3F7ZA 3UVPA 4FV9A 2GNJA 2WIHA 2Z60A 4TTHB 3THBA 1Y6AA 3JY9A 3WF8A 3C4ZA 2VWIA 3QHRA 4JG7A 4MKCA 1VYZA 1M2RA 5CSWA 3TV4A 5JQ5A 5CZHA 4A06A 2W99B 3KRXA 3O8TA 4RJ3A 5CWZA 2GNHA 2ITPA 2QQ7A 5JFXA 4QMWA 3E3BX 2Q0BA 2JDVA 4XG3A 4AOTA 3U51A 3L9LA 4FSNA 1K9AA 5JFWA 4XEYA 4ENXA 1RJBA 4EOPA 5K4JA 4MF0A 2XKFA 1OKWA 3GU6A 3EN5A 1LP4A 2VNYA 5F20A 4C3PA 2PY3A 2J50A 3OT3A 5AA9A 3A99A 3CTJA 4O84A 4V0GA 2X9FA 4DEIA 2HENA 4Q5EA 4EYMA 3VF8A 2C6OA 4QP7A 1IASA 1SNUA 3EFKA 1W8CA 2CN8A 2ITOA 4D9UA 4PUZA 3ZSIA 2GFCA 2PE1A 4FT5A 2YWPA 2W96B 3E87A 2ZM4A 4FTMA 4J53A 1J91A 4WNOA 4IJPA 3BQCA 3DA6A 3Q96A 4L6QA 5LVPA 1ZY5A 3TNWA 4DG3E 5IQFA 1H25A 5J8IA 3ET7A 4CD0A 4ZJJA 4IDVA 5I9ZA 4CMOA 2QOIA 5AUXA 4Z3VA 3VJNA 4E1ZA 5EYCA 3PA4A 3BLQA 4DTBA 4ONAA 2XS0A 5J7HA 2EXMA 3FQHA 4UYNA 2CGVA 3OBGA 4YTIA 2CHLA 3PYYA 2C0OA 3FZSA 1PXLA 3EYGA 4H3QA 4BN1A 4O6LA 3N4TA 3TNIA 4PDPA 2WTKC 4G3FA 5A4TA 3W2OA 2ETKA 4QYGA 4FEWA 4CSVA 3G33A 3F3WA 2J5FA 3C4XA 3KRJA 4GEOA 4NW6A 4JAIA 3FJQE 5HOAA 2XNGA 3A8WA 5FBNC 3KMUA 4RWIA 3QUEA 2C3JA 3UZRA 4FKJA 5JKGA 1OL2A 3FMJA 4FIEA 3DQWA 3SLSA 4BI2A 2IJMA 5LCJA 3FL4A 4GYIA 2PVYA 5E8YA 4EK3A 4DG2E 5D7AA 3ZM4A 3EWHA 5JZNA 2W7XA 3P7AA 2GFSA 3QRTA 4C61A 5HLWA 2E9OA 2KTYA 2GCDA 5JRSA 1J7IA 4NKSA 4TRLA 1Q4LA 3TL8A 1W7HA 2XIRA 2P55A 2X2LA 4TN6A 4RBLA 5EKOA 3T8OA 2XMYA 4O38A 3VS3A 4EK4A 4KSQA 3AD4A 3PXFA 4OBPA 3CEKA 4M13A 1RQQA 3OY1A 2HY0A 5AUZA 2IVTA 3ZCLA 3NEWA 4F9AA 1Y8GA 3QRUA 2R3FA 4R1VA 4AGDA 5C27A 4RVLA 4G1WA 4HYIA 5C4KA 5AX3A 3DFCB 4EI4A 2P3GX 5FTGA 3LFQA 1Q97A 3O23A 3Q6UA 3MH0A 3O50A 4ZEGA 1KOAA 1OPLA 5H2UA 3ROYA 5JQ8A 3DBFA 3GOKA 4FSZA 4FZ6A 4W8DA 3BIZA 4GRBA 5HTIA 5DA3A 1AGWA 2IZUA 1WAKA 3D94A 4FL1A 4QYYA 2BTSA 3ACJA 3RVGA 4D5KA 5F94A 3L8XA 4YHTA 2UW9A 2WQMA 3MPAA 3UC4A 4BGHA 4EZ3A 1URWA 4QD6A 2IW6A 3CCNA 1HCLA 1J7UA 4GG5A 2QNJA 2WTVA 4IZ5A 4CYIA 4MXAA 3NVKI 1G3NA 3V6SA 5BMSA 2GSFA 5C03A 4BYIA 3GOPA 2GDOA 1R3CA 3BE9A 4M84A 4UZDA 2JIUA 3OTUA 1H1WA 3IPHA 3EN6A 2BIYA 4HYSA 4LL0A 1OUYA 4NEUA 5BYZA 4JRVA 3SVVA 5BVWA 1XH9A 3I4BA 4PMMA 5HD4A 3NWWA 3QD4A 2OJIA 2OGVA 2DS1A 3BELA 5TE0A 3CKXA 4O7ZA 5CSVA 3PJ8A 5EM7A 1Q41A 1GIJA 4GU6A 4HW7A 2WTJA 5TO8A 5HNIX 2QD9A 2VUWA 2WMVA 3E64A 4A9TA 2DWBA 4XG4A 2F49A 1U5QA 4FL2A 5C8KA 3HP5A 2W1ZA 2YCQA 4G6OA 3P1AA 1KOBA 3LCDA 3PA5A 3PIYA 3BX5A 4GK4A 4X3FB 4ZTQA 5TKDA 4BDBA 4BCKA 3FI8A 2VGPA 4UB7A 4QO9A 4PPCA 3DJ5A 5B2KA 3R22A 4EZ5A 3FYKX 2I0EA 3U6JA 2X6DA 2XP2A 2ZVAA 3Q3BA 1XBBA 4B4LA 1IA8A 2BKZA 4IWOA 3PY0A 2QOFA 4F9YA 3Q4CA 2ITVA 4USFA 2CN5A 4I92A 2UZLA 3MPTA 4RIYA 3DAKA 4FZDB 1Q8ZA 3IGOA 4M66A 4CFWA 4HVIA 5HORA 3H9RA 3MFTA 1SYKA 2WELA 4I23A 5GNKA 3S95A 1PXPA 4DYMA 3EFWA 3KMMA 5IQBA 4RC4A 5LARA 3EJ1A 5EW8A 5HD7A 3BV3A 4BCPA 1OIUA 1SMHA 4HZSA 3I79A 5A4QA 4CFNA 3LXLA 1VZOA 1BYGA 1H00A 1M52A 4E4XA 5CNOA 5L4QA 4PPBA 4Z55A 1YXUA 4DEAA 3T9IA 3PVGA 3NUAA 3HV7A 4ANSA 4O0SA 4FSMA 5IUIA 2H9VA 2XKDA 3FC1X 4WOVA 3R8UA 3ULZA 2UZBA 1Q8UA 5CEIA 3I5ZA 4A4OA 3NRMA 2XB7A 3PRIA 2PU8A 3TM0A 2WMWA 5CT7A 2R3IA 5AR2A 4C7TA 3V5PA 4DGMA 2FH9A 3UVQA 2RL5A 4DN5A 1ZWSA 5KKRC 3ORZA 4YNOA 3TNHA 3BLRA 4D1XA 4BZNA 5IKWA 2QG5A 2HZ4A 4GSBA 3R2BA 5IA4A 4X21A 5HI2A 4F0IA 3E7OA 3H0ZA 3CPCA 2C6MA 3LFDA 4CNHA 4UMPA 4J71A 4JL9A 3ANQA 2C5VA 2RIOA 4H58A 3ATSA 1ZMVA 3D14A 1H08A 4HGLA 2W4OA 3PDTA 4NJDA 5AAFA 3A7JA 4FKSA 3QX4A 4C34A 5KZIA 3LMIA 4FIGA 3T9TA 4DGOA 3KULB 3RTPA 1PXMA 3D2IA 3FXXA 5CU2A 5H8GA 1JKLA 3DV3A 3C0GA 4WSYA 3NUNA 4C4EA 3FLZA 5BUEA 3VW6A 4C4JA 4NIFB 3JVSA 5JFVA 4BCGA 2R3RA 2WTDA 3R1QA 3CXWA 4FYOA 1SM2A 3WZKA 5J7BA 4JDIA 3CD8A 1OBGA 3KU2A 2UZUE 1MUOA 2IZRA 4RVMA 4O7RA 3VHKA 2HCKA 3MN3A 3CTQA 4WBBB 4OW8A 3JUHA 5DH3A 5H8EA 5EG3A 5KMJA 3UJGA 4DEDA 2R3MA 2VTPA 2XZSA 2HW7A 4GIIA 3A61A 3FZTA 4L67A 4M69B 3W10A 3F66A 5M53A 1Q8TA 2UW8A 5F95A 3KKVA 4D2RA 1P2AA 2ITTA 4O21A 3FMNA 4D2VA 5CSPA 4QMTA 4XG9A 2A27A 3F61A 3QF9A 4GKIA 3QQFA 1R39A 2VZ6A 1IAHA 4O0VA 3A7HA 4IB5A 4EOLA 1YW2A 3NNUA 3ZSHA 2VNWA 3BBWA 3CLYA 2B9FA 3OT8A 2FYSA 1PMEA 2W17A 5LMBA 4TYIA 5E90A 3KXNA 5JFSA 4XX9A 4LRMA 4BWPA 5ANIA 3MGYA 2ERZE 3NS9A 3PE1A 5BX0A 2PVFA 2BR1A 3CY3A 4FTQA 4LOOA 3LAUA 1OPKA 4LOQA 3TKIA 5L2WA 4XS2A 4XBRA 3V8SA 3C5UA 3NYVA 2WTCA 3LQ5A 2A1AB 3LLAA 4K11A 3VUMA 3L8PA 3VS7A 2VAGA 2P0CA 1E1VA 4FKRA 3UP2A 2XK8A 4Y85A 3ORNA 3TUCA 3Q2MA 3M11A 4D2WA 4U41A 3TJDA 5A4LA 3IECA 5LQFA 4NFMA 5HTBA 4DINA 3NW6A 3SW4A 2J0MB 3OXZA 4YU2A 4HGEA 4QPSA 5DG5A 4JXFA 2C6KA 2WMTA 4I3ZA 4OT6A 3ZZEA 3QYWA 3HMPA 2ZB0A 4FTLA 3CTHA 4D4SA 5M07A 4QYEA 4R7IA 2VD5A 3RPRA 2I1MA 3O2MA 4DLJA 3DQXA 5A46A 3UZTA 2IPXA 4HJOA 4F99A 1OUKA 5D1JA 4ASDA 4UMUA 1QMZA 2QODA 3BU5A 3EL7A 4I5MA 1JAMA 3CQWA 2DUVA 3PG3A 4QMNA 2PVRA 3UO4A 2HZ0A 3KK8A 3F3VA 3NAXA 5DN3A 5AP7A 2O2UA 4NH1A 3W2RA 3ZC5A 2B52A 4YTFA 4QTAA 5CF6A 2WMXA 1YOLA 3TUBA 2UZEA 2HK5A 3T3UA 3S0OA 4W4YA 4EOMA 4H3BA 4R78A 4ANQA 3ZO1A 3D15A 2WQBA 2JKOA 4IB3A 3CPBA 2GMXA 2WEIA 4FTKA 3WI6A 5FG8A 2V0DA 2BDWA 4P5QA 4O7WA 5LOHA 3HAMA 1PKDA 3R63A 2JFLA 1P5EA 2Z2WA 2ZDTA 2WMQA 4FKTA 4C4FA 4D9TA 3LM5A 3LM0A 1APME 4FVPA 4QP3A 3GCVA 5EK7A 4IVCA 4K33A 3HMNA 5CYIA 3UNJA 5HE2A 4J7BA 3RAWA 4FV1A 2R3LA 4CCUA 3PLSA 4QPAA 4F7NA 3RNIA 4IH8A 3P23A 5E8ZA 3IW4A 3I6WA 4ACDA 4KIPA 1ND4A 3ZRLA 3U4WA 3Q4ZA 2YZLA 5I5ZA 2UV2A 3IQ7A 1M2QA 5DFPA 3COKA 3KN5A 3QUPA 3F82A 3M1SA 3BU6A 4LV5A 3WF7A 3PXQA 3ZMMA 2C3IB 2GQGA 3SRVA 4DFBA 1F5QA 4FKQA 4FNXA 4OR5A 4BYJA 5CEPA 3FLSA 3WZEA 4CFUA 1V0OA 5HG8A 3W16A 1ZLTA 2W5AA 3AGMA 4ITJA 3RHKA 3U6HA 2VWZA 3MY1A 3WIKA 3DAJA 5HVKA 3L9MA 5HIDA 2XM8A 1YI4A 1ZYJA 2PL0A 1IR3A 4FEVA 2OH0E 3ENHA 3WBLA 3BGZA 4JVGA 4JR3A 2CGXA 4K0YA 4E6QA 1GOLA 3CP9A 4AN2A 1XH5A 3II5A 3LCSA 2FVDA 3DK7A 3QKLA 3BWFA 4EOKA 3S00A 3QD3A 5K5XA 4MTAA 4CFXA 3Q2JA 4W9WA 3PPJA 3MYGA 4GFMA 4IC7A 3ZZWA 4E5BA 4XCUA 3EFJA 1H1SA 3T3VA 4P5ZA 4C8BA 3DB8A 4B7TA 2O63A 3RZBA 4NL0A 1KV2A 3VF9A 2BDFA 4XLVA 3KK9A 4HCUA 4YSMA 5HBHA 3ACKA 3V01A 5JN2A 4YLLA 1NT2A 4I94A 3HDMA 3I60A 3HDNA 3V5WA 1Q24A 3DTCA 3MFSA 3C0IA 4N57A 1UU9A 2O64A 2RSVA 2VTMA 3UG2A 3N51A 4GKHA 4U81A 5KMOA 4XYFA 2VWBA 3DY7A 3LFCA 2W4JA 4M3QA 4IX6A 3NW5A 4PTGA 1WCCA 4RWJA 4AG8A 3U54A 3CE3A 3IDBA 4L3PA 3SD0A 3OTVA 2AYPA 1XO2B 3CY2A 3O7LD 2BFXA 2UW7A 5IA3A 3HEGA 3S3IA 2WB8A 2HW6A 3WZUA 4AE9A 4MAOA 4QNYA 4E4NA 4CLIA 1T45A 3PSCA 2G01A 2VTAA 2WMSA 4E3CA 4YC8A 1JKTA 3QQUA 5TR6A 4ASXA 2Y9QA 4YJUA 3RPSA 3UE4A 3ZO2A 4AWIA 5C4LA 1UU8A 3MTFA 3AC8A 2GHMA 4F09A 3UPZA 2C68A 5DVRA 4CMUA 4NWMA 3NVMB 3E62A 2J4ZA 3EN4A 5HCYA 5IQEA 3NPCA 4IXPA 1S9IA 4N6YA 3B2TA 4PDSA 4S33A 3UODA 3VBQA 1M7NA 3ODYX 2Y4IB 5KMIA 4MH7A 2XF0A 2OWBA 2CKOA 1BL6A 3QTIA 4WG5A 5IUHA 4OTFA 3OOMA 3BLHA 2FUMA 3LXNA 4ZZOA 2IO6A 2YABA 2W5HA 2KULA 2QOQA 3PY3A 4D4RA 5I3RA 3DXQA 2YLFA 2QI8A 3D7ZA 3RNYA 3VUGA 3D5VA 1J3HA 3CJFA 4IVBA 4KSPA 4QQ5A 4F1TA 4GFOA 5F4NA 4ZAUA 3ZSGA 2B7AA 2XRWA 1PF8A 4RIYB 4C33A 2YA9A 3Q04A 2V7OA 3UOKA 3ERKA 4FKUA 4AF3A 3R8PA 3MPMA 4FZFB 3QWJA 3CR0A 4F6UA 1OL6A 4L45A 3TJCA 4WSQA 4JDKA 4Y72A 3D7TA 4EKKA 3C1XA 3CKWA 1M2PA 3COMA 3KGAA 2C0IA 4ZTSA 4IE9A 4IJ9A 3L9PA 1WBNA 1J1CA 3NZ0A 4X2FA 4DGGA 5M4IA 3SGCA 3BCEA 3PJ3A 4FIIA 4YPDA 5I9UA 3ROCA 4C38A 4I5HA 5CVFA 3LPBA 4RLKA 4CGAA 4ZMFA 3P7BA 4QOXA 2Y8OA 2XK3A 4IADA 5HIEA 4NYEA 2XNNA 4OT5A 4WD5A 1WVXA 1ZYLA 3Q53A 4D0XA 1IRKA 1W84A 4IX3A 4FT3A 2RFDA 3ORTA 1BUHA 4XG6A 4J52A 4RA5A 5M44A 2VTSA 2WIPA 3OFMA 1WVWA 3OEZA 3EN7A 5FD2A 1ZAOA 4W4VA 4J1RA 4AAAA 3JR1A 5HU3A 5IDNA 1UWHA 1PYEA 3LFSA 3GC9A 1FVVA 3EFLA 1GAGA 4GV1A 4YLKA 4EOOA 2IWIA 3CQEA 1XH7A 4CFMA 4E73A 4EH3A 4ZZNA 2XUUA 2OI4X 2C3LA 3ALNA 2XCHA 5FBOA 3ULIA 4AOJA 2GHLA 4RGJA 5CI7A 4BDCA 4MXOA 5AJQA 2P2IA 3TXOA 4X2KA 4QMPA 4BKJA 3DXNA 3KXMA 4YBKA 5AP6A 1BX6A 2JD5A 2OW3A 5IDPA 4IDTA 3GU8A 3HNGA 4FSQA 4HVDA 3OCGA 5AV2A 5CEQA 4EBWA 3SG9A 4IM0A 2JIVA 2J7TA 2BIKB 2GTNA 3DJ6A 3EKKA 3QTRA 3MESA 3NCGA 2E9PA 5A54A 4HGTA 4UWYA 1UKHA 2Z7RA 4J97A 3PXKA 3ZXTA 4BVUA 3FQEA 1JPAA 5A14A 3VNTA 4JI9A 3ANRA 3EQGA 3HV5A 1R78A 4J96A 3VUHA 2XCKA 4YHFA 3EOCA 3R9HA 5CU6A 3JPVA 5DYJA 3E8EA 3DLZA 2C6IA 4IAYA 2NP8A 3MI9A 2W9FB 5TF9A 4HPTE 3QXOA 3G15A 3TG1A 1WZYA 4MEDA 4ANNA 4EUUA 5I4NA 4H05A 2YM4A 2RF9A 4MNEA 1UU7A 2ITXA 2XNBA 2PZIA 2WKMA 4FG9A 4U44A 3U9CA 4JBPA 3ZBFA 3M42A 4YJNA 4MF1A 4YPSA 3RPYA 4I1ZA 3LHJA 5BNJA 4QP6A 4E6DA 4ZY5A 2WHBA 1PJKA 4DTKA 3EL8A 2PSQA 5T6KA 4EQCA 5CAVA 3R8MA 4YC3A 1NXKA 1U46A 1UNLA 3D4QA 4U5JA 3F2AA 2UVXA 4LRKA 3DS6A 1ZMUA 3SDJA 3EIDA 3RP9A 3PFQA 4EC9A 4EWHA 1YWRA 3KFAA 4FVQA 4RMZA 5CZIA 3HMOA 4G3CA 5AUYA 2XH5A 3BHUA 3VUTA 3I0OA 4F63A 4APCA 5F1ZA 3D5WA 3F88A 2JFMA 4RJ8A 4C36A 5FUTA 4FZ7A 2VTNA 2OXDA 3KCFA 4RC3A 2GS2A 4FC0A 1SZMA 1H01A 1ZYSA 2YIYA 2R0IA 4RQVA 5ETCA 2NNWB 3H4JA 4ZTRA 3ETAA 3LFAA 4BGQA 5HO7A 3QKMA 3SXRA 2JKMA 2X81A 3AMYA 5DPVA 4FIHA 1SVEA 3MTLA 4KD1A 2X7OA 3MY0A 3R9DA 3RM6A 5K5NA 3HL7A 2WTKB 4G16A 2PVLA 1YOMA 3UIXA 4P4CA 2W1GA 4FYNA 3ZUUA 1PRYA 2RFEA 4BIBA 4K18A 3QTZA 4ACCA 5JEBA 1CTPE 4X0MA 5DR9A 4D28A 4ZLZA 4CKRA 3TNPC 4CRLA 5HCXA 3VWAA 4XMOA 1CKIA 2X7GA 2ITWA 3U9NA 3P9JA 4RWLA 5EFQA 4FI1A 2NO3A 2YCSA 3AC3A 2JGZA 2W1DA 4ZTHA 5ANJA 3O71A 3R2YA 5AMNA 4DH1A 4ENYA 3UPXA 4ZOGA 3QAME 4BC6A 4MXZA 3S2PA 4M12A 4XP0A 3LE6A 3R7YA 2FB8A 2JIIA 4KINA 4EHGA 5J79A 3DBQA 1WBSA 3GFWA 3O0GA 3OMVA 3PXZA 2UW4A 3KC3A 1DS5A 2UZWE 4I4FA 2FGIA 3GC8A 5FRIA 3VRYA 4BBMA 1W82A 4RJ6A 4EL9A 3FXZA 4R77A 3P08A 4FKIA 3R04A 3EZRA 3UIMA 5LMKC 3LJ1A 2H96A 3NUYA 2XEZA 4B0GA 3PWYA 4KWPA 3ZS5A 2QG7A 3FMKA 3R30A 4IX4A 3GI3A 1DI8A 1OZ1A 4J8NA 4QRCA 2PE0A 5C01A 2BCJA 2NRUA 4MK0A 3VC4A 4C3FA 4Q9ZA 5J5TA 3DBCA 3AD6A 3GQIA 4RPVA 1FOTA 2BVAA 3F6XA 1UA2A 2ZV9A 4PF4A 4Z9LA 2IW8A 2R3QA 4BBEA 2ESMA 3B8RA 4ACGA 4O27B 3SRVB 4DFYA 3WOWA 4X2GA 5AP4A 4E5WA 3MFRA 4XV3A 3BI6A 3PP1A 4NFNA 4ZTLA 4CQEA 3QCQA 4CV8A 3C13A 4EQUA 5K3YA 1WVYA 1OI9A 4YNEA 1YXSA 3GCQA 2OIDA 2GTMA 2PYWA 4NM7A 1YDSE 1NVQA 3VS6A 4AW2A 3WIGA 1L8TA 3G0FA 1H0WA 4LMUA 3R7VA 3RGFA 3WF5A 3P0MA 4J95A 3RPVA 5AP5A 5EI8A 4IBMA 3GVUA 3I0QA 4JG8A 3DKFA 2F57A 4FODA 4EYJA 5HU9A 2R64A 4ZY6A 4N6ZA 2J0KA 2AUHA 1G5SA 1QPJA 2BHEA 1PY5A 3KL8A 3FMLA 2EB3A 4QQCA 5AR3A 3FPQA 4CVAA 1UWJA 3GXLA 3TCPA 3NNVA 4FSYA 3IG7A 5D41A 2YM5A 3AT3A 4G3GA 4FTRA 2OU7A 4L42A 3VO3A 2ETMA 4ALUA 5M4CA 2R3JA 3PA3A 1J7LA 3OHTA 4IAKA 4M8TA 4AT3A 5B7VA 3AD5A 4E5AX 4USDA 2JBOA 2CGUA 4E6AA 2BRMA 3EN9A 5L2SA 3MFUA 3WE8A 4S2ZA 2PVJA 5AV3A 2HY81 1CKPA 2Z7LA 2ZYBA 3PZEA 3QQHA 4JDJA 3LVPA 2WQNA 5CANA 3OW3A 3FMHA 1Z9XA 5CNNA 4AA4A 5CASA 1YQJA 4LQMA 5HBEA 4NSTA 1PXIA 1YRPA 4F70A 3U8WA 4WUNA 3C0HA 2HOGA 4FIJA 3AG9A 5EOLA 4OTRA 4C57A 5KMKA 4YSJA 4A9RA 3SKCA 2YITA 2A19B 3P79A 3WARA 4F6WA 2C6TA 5L8JA 2YACA 3DT1A 3HVCA 2C0TA 3R28A 4MX9A 4Y5QA 4JBQA 2PZRA 4ZS0A 4Q5HA 4UX9A 1GNGA 5L2TA 5AR7A 4I0RA 3CD3A 5FGKA 3OEFX 4GW8A 2I0VA 3H9FA 1W98A 5IMXA 4GG7A 5KO1A 4IWQA 4O96A 4QTCA 2YDJA 3H30A 2ZDUA 3R6XA 4ERKA 3ELJA 4OTWA 3RCDA 2VTLA 3G0EA 3SXSA 1OL5A 4ORKA 3CJGA 4QTEA 1XHAA 3GU4A 4FNYA 3R0TA 2PMOX 2A2AA 2WQOA 2WXVA 4L3LA 5KKRB 1ZZ2A 3G9NA 4TYEA 4F9CA 4R7BA 2JLDA 3KCKA 4MCVA 4F9WA 1JKSA 5HG9A 3K54A 4LGDA 4TZRA 4C4HA 4ZMEA 5EQEA 3ORXA 5A3XA 3FC2A 3QTWA 4CT2A 3OY3A 4WRSA 1BMKA 3BYMA 4KABA 1GIIA 3NUSA 2ITYA 4HVSA 2C5OA 2F2UA 2XM9A 5J5SA 1XH8A 3FQSA 2R2PA 3EQHA 4L53A 4E93A 2B1PA 3D7TB 1FQ1B 3E7VA 4LRJA 4Y5HA 2UZTA 4BCNA 4IB0A 1MRVA 1ZOEA 2ZMCA 4ZLOA 4DFXE 4FTTA 3MDYA 3D0EA 3SV0A 2W9ZB 4CTCA 4FEXA 4DGLC 3DKOA 3EB0A 2VWVA 2EU9A 3ZBXA 2C5NA 4GK2A 3Q6WA 2PUPA 1H1RA 3CQUA 4CT1A 5E8SA 3SXFA 2B9HA 4KKHA 1YHWA 4QQTA 1KUTA 2GNLA 3DKCA 4F6SA 4FL3A 1ERKA 3HV4A 3LQ8A 1R1WA 4GUEA 4X2JA 5CT0A 3POZA 5IG1A 3W2QA 4AQCA 1REJA 4FKWA 5JGBA 3ALOA 4R8QA 2PUIA 3BGPA 2QO7A 3GEQA 4AT4A 3QQKA 4YZDA 5L2QA 5CU0A 1CSNA 4RIXB 3R71A 4TYHA 2Z7QA 1NW1A 1ZYCA 4PL5A 1QPCA 4XBUA 4F7LA 4EJNA 2X2MA 5FM2A 3LJ0A 3QGYA 3LFFA 2XNPA 3O96A 5IZFA 4R3RA 1M14A 4L9IA 4L7SA 5E8XA 4BCHA 2HWPA 4HYHA 3RWPA 3MA6A 5CAOA 4IMYA 4XV9A 4XRJA 2JDRA 4WNMA 3CC6A 2BHHA 4HPUE 5HQ0A 3MBLA 2OZOA 5FDXA 3QYZA 3ID6C 4S32A 1XQZA 4FEQA 4V04A 1PMNA 4BB4A 2GNFA 4XUFA 2X0GA 2YZAA 3AC4A 3N4UA 5BYYA 4BHZA 4FR4A 3R01A 3BGQA 4UMRA 4DLIA 1ZRZA 2JAVA 1AQ1A 3R9OA 3LCKA 4ZZMA 4TY1A 3ITZA 4F4PA 4ASEA 3COHA 1FGIA 3C4CA 4BZDA 4X2NA 2E9NA 2R7IA 1YKRA 2V5QA 2CMWA 3IS5A 3R21A 2PZ5A 5C26A 4MNEB 2XJ1A 2VTHA 3S1HA 4OAVB 3PPZA 4ZJIA 2RFNA 4KKEA 4FSTA 1VEBA 3KF4A 5E8VA 5KE0A 3WYYA 5BUIA 4XJ0A 5DRBA 5HO8A 2R4BA 4D55A 4D1SA 3QALE 4NUSA 4K77A 1UNGA 3NDMA 4IB1A 2OXXA 5EM8A 2VTRA 5IA0A 3FWQA 2WGJA 4C02A 4NTSA 3TTJA 3LFBA 4RSSA 1LUFA 1GJOA 1M17A 5DT3A 2PZYA 5FQDC 3TACA 4A4LA 4AE6A 4F7JA 1I09A 3RM7A 3R02A 3VUIA 1TQPA 5GJDA 3UVRA 3HP2A 1A9UA 4Y95A 1EH4A 3FPMA 2YFXA 4PL4A 4PDYA 2J5EA 3AC1A 2PK9A 5ANKA 4O7SA 5HX8A 5LMKA 4G31A 2Y4PA 2YIWA 2YDKA 4BCOA 3NYXA 5J9ZA 3IGGA 3QQGA 3FZOA 1YI6A 1OL1A 4DBNA 3HA8A 2JDTA 5I9XA 3DU8A 3FI3A 2X1NA 3ZFYA 4C62A 4FV6A 5AV0A 1YXTA 3FSKA 4DH3A 4EKLA 5GIOE 1H1QA 4YTHA 3FKNA 5L8LA 4EH8A 5KMLA 3SX9A 5HBJA 4U42A 1LEWA 3DGKA 2XK4A 3TZ8A 2BZIB 3FE3A 5FWKK 2WU6A 1LR4A 4IWDA 1YI3A 3K5VA 2J9MA 2QURA 3FYJX 2WNTA 2QR8A 2BFYA 5BUJA 2AC3A 3A62A 3NNWA 5EOBA 3ORKA 1W0XC 3CSVA 1FMKA 4BKZA 3R7OA 3F3ZA 2JITA 2IN6A 5EYKA 1H27A 4CCBA 4FSUA 4EH2A 2YCFA 2GNGA 2YIRA 3F3UA 3FL5A 2VX0A 3EHAA 3PRFA 1DAWA 3VS4A 4DH8A 5JSMA 3BYUA 4O0TA 2Y7JA 2GQSA 2XNEA 3H10A 2HWOA 5B2MA 5KCVA 2CDZA 4BFMA 2RG6A 4F65A 2GU8A 4MQ1A 2X2KA 4DHFA 3ZDUA 3VW8A 2A0CX 3SHEA 2HYYA 3P86A 5FXSA 4FSRA 3GB2A 4IVAA 3LCOA 2CNQA 2CKQA 2ITNA 2C6LA 3FMEA 3TV7A 5J95A 4EHZA 5K9IA 4C2VA 4ALWA 2B54A 4RQKA 1KE6A 2G1TA 3MJ1A 5CLPA 3ZM9A 3OG7A 3KXGA 1REKA 3I7BA 3E8DA 3RINA 3KA0A 4MQ2A 4FGBA 4FTNA 2BRGA 3AT2A 4RZVA 3ZEPA 5E1SA 1OL7A 2O0UA 2X9EA 4LOPA 4JLCA 3AC2A 4E4LA 3F69A 5ETIA 2H34A 4BIDA 4B8LA 3S4QA 1MRYA 4FMQA 4YJVA 4HYUA 5CQUA 5A9UA 4USEA 3PSBA 3V8TA 3U55A 5E1EA 4FBXA 4BIEA 4MXXA 5BVKA 3ZEWA 3FI4A 4L01A 1OBDA 2JDOA 1UNHA 4L46A 2NRYA 3KREA 4NJ3A 4ACMA 4BDGA 5HGIA 3G90X 3ZLSA 4FV2A 1URCA 3VJOA 5AAEA 1UVRA 4ID7A 4QYFA 2XBAA 3GQLA 5AWMA 3QQLA 3FDNA 5A4EA 3K3IA 2YJRA 3OP5A 4RIOA 4YMJA 2BTRA 4C0TA 4CFVA 4UBAA 4IFCA 4W9XA 2HXQA 2ITZA 3I81A 3DOGA 2OJ9A 4G9CA 5DBXA 5JRQA 4P90A 4U6RA 4F1OA 3QGWA 4KBKA 2YDIA 5F9EA 4QMZA 2YM7A 4JRNA 4DG0E 4D58A 2WFYA 5HEZA 5DR6A 4WNKA 3BYSA 3DKGA 3VAPA 3I6UA 4DE4A 1KE7A 3QL8A 2C6EA 2QLUA 3V5LA 4BF2A 5IA2A 5DEWA 3PUPA 5IH6A 1O6LA 2BDJA 5EYDA 1PXKA 2VTJA 4F0GA 2C69A 3KF7A 3V04A 5L2IA 4BCJA 2G2IA 5HHWA 2UZDA 1Y8YA 1K3AA 4FTAA 4ZSLA 1XWSA 5M09A 4PMSA 4QMMA 2BILB 4IM3A 5HG5A 1X8BA 5AX9A 3ORIA 3REPA 2R0UA 3W33A 4GVAA 4DGNA 3MS9A 3FUPA 3RCJA 3FAAA 3GT8A 4AT5A 4LM5A 5AV1A 3FLWA 3TN8A 3K5UA 4ZSJA 1JKKA 4KIQA 3R9RA 2BZHB 5CXHA 4BBFA 3QZIA 4RFZA 2J0IA 4IWPA 3W2SA 4EH5A 2VV9A 2BPMA 3TKUA 2O8YA 3KMWA 3LKMA 4U97A 1YOJA 2BAKA 3QBNA 2WTWA 3VUDA 4JJRA 2XNMA 4GH2A 2AC5A 2X4ZA 2YCRA 4KAOA 3LQ3A 2YAAA 2OF4A 4F08A 3ZLYA 4G5JA 4IW0A 3ATTA 2ZV7A 2WOUA 3D5UA 4FNWA 1QPEA 5FEDA 2PZPA 1Q3WA 2VU3A 3BYVA 4XOYA 5ANEA 1SVGA 3UMWA 3VQHA 1WFCA 4EOQA 4O7LA 3NNXA 4S31A 2XK7A 3D9VA 1H0VA 3MSSA 3W1FA 4YBJA 4O81A 3HRBA 2VO0A 1R0EA 2XIZA 4UY9A 4AX8A 1ZXEA 5HE1A 4FV8A 3PE2A 3TV6A 2GS6A 4A9YA 2R3PA 4KUJA 4D2PA 2CLQA 2ERKA 3MV5A 4BDFA 2OKRA 2R9SA 5LVMA 5E4HA 1H28A 4L00A 4DCEA 2E9UA 3GCPA 5EI2A 1RE8A 3BE2A 1IA9A 4KBCA 3QD0A 2OFVA 3HMIA 3DTWA 3GUBA 4MYGA 1JNKA 1JVPP 4RRVA 4AZFA 4Z7GA 3NIZA 4X7QA 3W8QA 4FV4A 4AUAA 3Q5ZA 5CSHA 5EDRA 1BLXA 5AUUA 3IK3A 3PIZA 3SC1A 2C30A 3FZ1A 3OXTA 2I6LA 5FDPA 5HLNA 1OVEA 2GPHA 1OITA 2OJFE 3DFAA 4G17A 2OO8X 4AZEA 3FZRA 3AQVA 3DXPA 1KSWA 2BRNA 4BTJA 3PZHA 4KS8A 4GT5A 4O86A 3FI2A 1HCKA 5B2LA 1NVRA 3OWLA 4NM0A 3GC0A 4TW9A 4EEVA 1M7QA 3R8LA 1YDRE 5HNGA 4TYHB 4IAFA 1QCFA 1PXJA 4I20A 1FGKA 4U0IA 4AACA 3V5QA 2IW9A 2OZAA 5IUGA 3EQRA 4BCQA 2VTTA 1H07A 2QCSA 4ERWA 4FTOA 3A8XA 4II5A 4EHEA 2QC6A 3NSZA 3IW8A 2J0LA 3W32A 4ZS4A 3H9OA 5CF5A 4BDHA 1XR1A 4BR3A 4G9RA 4ANOA 4KBAA 4QPMA 3K2LA 5LCKA 4O0RA 5BVEA 3ORPA 4QT1A 3FEGA 5JT2A 4D2TA 3DB6A 2QOLA 4Y8DA 5AFVA 4RIXA 1NVSA 3UO5A 3NYOA 4RT7A 2WPAA 2VO7A 5ANDA 4PMPA 3LMGA 3F5XA 1LEZA 4FIFA 4YZNA 4O7NA 4C4IA 5I0BA 4PNIA 2ETRA 3ZTXA 3R7EA 4J8MA 4WIHA 5ACBC 2W05A 4OTGA 1DI9A 5HLPA 5JGAA 3O8UA 5KZ0A 5EW9A 1Q5KA 4V01A 4M0YA 3QUDA 4X3JA 3UIUA 4EH9A 4RIWA 3B8QA 2B55A 3E63A 2PWLA 3FMDA 3FY2A 4NM3A 5J9YA 4FTCA 4M15A 2BUJA 4FKGA 4YTCA 4V05A 4DEGA 3BWJA 4CKJA 3PXYA 5HX6A 5D7VA 3PXRA 4EOIA 3IW5A 4GYGA 3HV6A 4TYGA 3R83A 4NKAA 3UMXA 5DGZA 3VULA 4ANLA 5DIAA 5L3AA 4D0WA 1U59A 4U40A 5JK3A 2OK1A 5K0KA 5GIPE 1IAJA 4JR7A 4EH6A 1DAYA 2OG8A 2R7BA 2ONLA 2XIYA 4FG7A 4LL5A 4L8MA 4UXLA 5KHXA 5TOZA 1RW8A 4M14A 1H24A 4HVGA 2CCIA 3VN9A 4RX5A 2FSMX 3H0YA 4DH7A 2G2HA 3TEIA 2PVMA 3EQDA 2ZM3A 1JQHA 1STCE 4KS7A 3VS1A 1CDKA 3QTUA 4ZLYA 4TKSA 3F5GA 1XJDA 3H3CA 3I5NA 4FKVA 3TKHA 4UWBA 4WT6A 4UN0C 3R1NA 4ZJVA 4I6FA 1IG1A 4JIKA 2IVSA 3JXWA 3C5IA 3ZRMA 3RKBA 3DBEA 2XRUA 2C47A 2O5KA 4MD7E 3QQJA 4OUCA 5T68A 5AR4A 2WQEA 3RK7A 4CG9A 4KRCA 5EQPA 4TNBA 4RJ5A 3PG1A 2B9IA 4GU9A 2RFSA 5DT4A 5HZNA 5IQGA 3ZHPC 5GZ9A 1P14A 3DNDA 3OWJA 3R73A 3ZUTA 3GENA 4WHZA 5BVDA 4FV0A 3KRWA 3V8WA 2ITQA 2XA4A 3EQFA 5DR2A 3CGFA 3QXPA 4EHVA 5L6PA 4GJ3A 4XOZA 4Y46A 3EQCA 3A2CA 3MVJA 4TYJA 1FPUA 2LAVA 5ITAA 1FBNA 4RX8A 3K3JA 4OBOA 4BDEA 4IAAA 1YHVA 4AZWA 4DFZE 2CPKE 3LZBA 3P78A 4ZXTA 5EW3A 1MQBA 2QOKA 2Z8CA 2UZOA 1VR2A 4G2FA 4UMQA 4K1BA 5JZJA 4CZTA 1Q62A 2HZIA 2PVKA 3ZO4A 5D9HA 2WAJA 5LXMA 1YVJA 3KRLA 4NCTC 3CBLA 3LCTA 1OB3A 3QTSA 5E8WA 5IEYA 3PIXA 4TXCA 3G2FA 1PMVA 3ZUVA 3C4WA 3FY0A 4FTUA 2BAJA 2Y6MA 4FSWA 4ITIA 4D1ZA 3OCTA
chains in the Genus database with same CATH superfamily
5M51A 2XYUA 4HOKA 2HELA 4O0WA 4DFNA 5J1VA 2J6MA 2ZMDA 3OF0A 4ALVA 3EH9A 5CQWA 4D5HA 4KRDA 3VHEA 1BKXA 4MHAA 3UYSA 3VBTA 4J98A 5CS6A 5TT7A 3ZU7A 4AZTA 3MA3A 4LGHA 4R7HA 5HESA 3R7UA 3NUUA 3O17A 3TZMA 3A7FA 2CKEA 4L44A 4ZSAA 3IOPA 4WKQA 5FTOA 3QHWA 2J90A 3OCSA 5AUVA 4DFUA 2CLXA 3BHVA 4ZP5A 3PJ2A 4PTEA 3NMUF 4IX5A 4K6ZA 4N70A 3UNKA 3WILA 2YAKA 2Z7SA 4JS8A 4JAJA 4G6LA 4I6BA 1ZOHA 2PMNX 4PRJA 2X8DA 5HE0A 4FV5A 3DBDA 4FT7A 1Q61A 3UQGA 4AXEA 4YZBA 4DFLA 4JBOA 3PUFC 4K8AA 4RFMA 3QRIA 4QTBA 1B38A 3PPKA 4FKLA 4R3PA 3VQUA 5AUTA 4OTDA 3TTIA 2C4GA 4O6EA 4O1PA 4LG4A 5CENA 5GZAA 3QFVA 3UDBA 4ZTMA 1WBOA 3WF9A 3BQRA 1BI8A 3UOLA 4U9AA 4U7ZA 4QQJA 2QOHA 4YJSA 3NGAA 2ZV8A 4JQ7A 1W2FA 2YM8A 2G15A 3IW6A 3VIDA 1Y6BA 4GMYA 3MJ2A 4S34A 3R8VA 4FE2A 3MY5A 2VWYA 5IQCA 5CF4A 3MB7A 4FTJA 2ACXA 3GFEA 2JAMA 3V3VA 3ZDIA 2QHMA 3DJ7A 4FOCA 3VBXA 2C1AA 4PNKA 2J2IB 2UW5A 5IEVA 3BKBA 4EH4A 2V55A 4F64A 3QCYA 2R3NA 4QNAA 2JC6A 2X6EA 3HRFA 5D12A 3JS2A 4CXAA 4XV1A 4KIKA 1W2CA 5AP0A 4AU8A 4FKOA 3R7IA 4PY1A 3BLAA 4C58A 4A7CA 4AW5A 1JBPE 3NCZA 3QX2A 5HVJA 1WMKA 4O0UA 3L8SA 5I9YA 2ITUA 5M06A 1PW2A 1W83A 2QU5A 3MIAA 5DLSA 5L6OA 3U4UA 4H1MA 3W8LA 4ZY4A 5EDQA 4AXDA 2UVYA 2CSNA 5HKMA 4I24A 1OECA 1E9HA 3RPOA 3LOKA 5C8MA 1KV1A 4KB8A 4LFIA 2OICA 5AR8A 3RK5A 4CMTA 1V1KA 3MH2A 4O91A 5AR5A 5K0XA 4NU1A 4E8AA 1IEPA 3V5JA 2P2HA 4YUQA 2CKPA 1OKZA 2FSLX 4BTMA 1PMUA 1UV5A 3FXWA 1ZOGA 3PVWA 3QZHA 4I6QA 4EONA 3ZONA 3IO7A 3KXZA 3WYXA 1F3MC 1ZMWA 3R8ZA 1JLUE 4MWIA 3R1SA 4KNBA 4AGCA 4N0SA 1YWNA 3DK3A 4R5YA 3OUNB 3HKOA 4HZRA 3KXHA 2ZB1A 3UYTA 1OM1A 5M4FA 2EWAA 4M97A 4Q2AA 4L52A 5H3QA 2EUFB 4PTCA 2X4FA 3E5AA 5C1QB 1G8SA 4FV7A 3LMHA 1TQIA 4Q9SA 4EORA 4IIRA 2XANA 4KKGA 2A4LA 3UIBA 3KQ7A 5E7RA 3LW0A 4JQ8A 2G2FA 4WG3A 5LWMA 1MP8A 3AC5A 4RC2A 3AOXA 3E8NA 5L8KA 3HUCA 3UQFA 2OXYA 4DTAA 3FLNC 1YDTE 3E3PA 3EQIA 4E4MA 1Q8YA 2YIXA 2ZV2A 2QOBA 3I1AA 4A4XA 2HAKA 2BMCA 2PTKA 2J0JA 4ZTNA 2OZAB 3N9XA 4AFEA 3OD6X 3UOHA 5CU4A 5GHVA 1JOWB 4R3CA 4N4SA 2F7ZE 3KVWA 5DWRA 4JQEA 4H39A 2WOTA 3HZTA 3LIJA 4OTIA 4DITA 4KA3A 5CSXA 5EM5A 3Q5IA 4MVFA 5EQYA 5CEOA 4CQGA 3OBJA 5BVFA 5HICA 5EDPA 1OIQA 2YN8A 2X39A 1JSVA 4O7YA 3UP7A 3AXWA 1ZARA 4U79A 5KHWA 3C51A 4IAZA 4LYNA 4O1OA 3WZJA 4MD9E 4ASZA 2Z02A 1O6KA 4BDAA 3ZYAA 5AP3A 2PVNA 5BYLA 1WBWA 5CI6A 2QOCA 2I40A 4FA2A 4QMQA 2R3KA 3BEAA 3MW1A 4FVRA 5LMAA 1H8FA 4YZCA 3JVRA 2FSTX 4FT9A 4UZHA 4XG7A 1XBCA 4K2RA 3MH1A 5KBQA 2WU7A 3TIZA 2CGWA 3ORLA 1U5RA 3VBYA 5DMZA 5J9LA 2RKUA 5LJJA 4B6LA 1PYXA 1HOWA 2QONA 3UC3A 2WMUA 4GT4A 3UZPA 5CAUA 4DT9A 2B4SB 4PMTA 2PULA 2E9VA 2YERA 4OLIA 2XIXA 4RIWB 4EK6A 3VRZA 4EC8A 4FEUA 3Q9ZA 2FSOX 4GUBA 1B39A 5CEMA 2XAMA 5GINE 2OJGA 5ANOA 3VBWA 3FHIA 3GCUA 2PVHA 4RG0A 2GHGA 4XLIA 3ZFMA 2VRXA 2XIKA 3OS3A 1OIYA 3UGCA 3R9NA 3LLTA 2Q0NA 5DI1A 4BCMA 2VGOA 3NAYA 4YURA 3NIEA 4QTDA 2PUUA 4YJOA 1R0PA 4BICA 4D2SA 4EOSA 1FINA 3BHTA 3F7WA 4LI5A 1UU3A 2YM6A 4BTKA 5IISA 4EOJA 4IFGA 4WG4A 1FVTA 5E9EA 5IH4A 4BJJB 1ZYDA 4EJ7A 4RVTA 4DHJA 5BVNA 2PMIA 3QCXA 2Y6OA 4LMNA 3OWPA 4NT4A 4BHNA 3FMMA 3F9NA 3FKOA 4LGGA 4FOBA 3QC9A 3UG1A 5L6WL 2P4IA 4S30A 5G6VA 2F2CB 4PL3A 4DA5A 5I9WA 3ZLXA 2JEDA 3UQCA 2VWUA 5AV4A 3A4OX 2XVDA 4MBIA 2YM3A 4ARKA 5IH5A 1CKJA 5J1WA 1GZ8A 3AMAA 3BPRA 4FT0A 4J99A 2JDSA 4NCTA 5D11A 3NR9A 3B2WA 3KN6A 1TQMA 2O3PA 4FK6A 1OKYA 4CRSA 1NA7A 3DAEA 3GBZA 4JOAA 4M68A 4OBQA 4UXQA 3ZH8A 2R3HA 4B8MA 3O51A 5J87A 4XG8A 3UO6A 2H6DA 4PDOA 3RAKA 3SOAA 3WE4A 4DF3A 4O4BB 2I7QA 5T3QA 3KEXA 3HRCA 4GCJA 2BKKA 4X3FC 4X6RA 4Z7HA 3QLFA 5AAGA 1UKIA 4C4GA 2J51A 4QMXA 3PY1A 4L68A 1K2PA 1GZOA 2W1EA 3PVUA 1W2DA 5M4UA 4YP8A 4JX3A 5EYMA 4CLJA 4FGRA 4OGRA 2XJ0A 4LUEA 3AT4A 4U80A 2X8IA 5CU3A 3Q9YA 1U54A 5FXRA 2NPQA 5B0XA 4AFJA 5ETAA 5KNJA 2W5BA 3IDPA 4M0ZA 4WRGA 3NYNA 4RLLA 2R3OA 2XKEA 4H1JA 4NK9A 4AN9A 2PPQA 1I44A 3TIYA 5LVLA 5ACKA 3TDWA 4JX7A 4UYAA 2XNOA 3F3TA 4G6NA 3RALA 4A9SA 2PHKA 2VN9A 1GZKA 4YJPA 3NUXA 5EM6A 3OCBA 4TT7A 3OZ6A 1CM8A 2X8EA 4IEBA 3CS9A 4JIAA 1SVHA 4QMVA 3FHRA 2OIQA 2C5YA 4I21A 4MXYA 5CX9A 5ETFA 2QKWB 1G8AA 1JSTA 5IMEA 4H36A 5CALA 1XKKA 5CEKA 3DCVA 1Q8WA 2QR7A 3D2KA 1JSUA 4L43A 3FZPA 3CIKA 4U3YA 3TZ7A 2BALA 1BI7A 2OIBA 4MXCA 4FX3A 4JG6A 5E92A 5IQHA 5DE2A 4BWKA 2UW6A 2ZOQA 2ONLC 1U4DA 3G51A 3VBVA 3ZFXA 4XP3A 3QCSA 3L9NA 1NY3A 4ZIMA 3LFNA 4CZUA 3FLQA 4B9DA 4E6CA 3D5XA 3W2PA 3RWQA 3MH3A 5DNRA 4HCTA 3EQBA 4O82A 3GC7A 4GIHA 5IA5A 3U87A 4E20A 4UMTA 5JMSA 1B6CB 3QTXA 4AZSA 3TUDA 4DEHA 4RX7A 1DM2A 4R5SA 2XYNA 2C5XA 2WMBA 2WMRA 4O2ZA 4EK8A 5ANGA 4ACHA 5IQAA 4O0XA 2EB2A 4GL9A 4MD8E 3E88A 1L3RE 2X0QA 4BL1A 4PP7A 2CCHA 2WTIA 1WBPA 2IZSA 4QP2A 3EZVA 3DDQA 1H1PA 1GZNA 4IM2A 3KY2A 4E7WA 4QMYA 2REIA 4BI1A 2F9GA 2F4JA 4XNEA 2VX3A 4YZMA 3Q9XA 4I22A 2Q83A 3O5AA 3TDVA 3DPKA 4I0SA 4TWOA 1P4FA 4U45A 5KUPA 4QYHA 2UVZA 1OMWA 3ZRKA 3QKKA 4RVKA 4V0GB 4O7TA 4U43A 4JT3A 3UBDA 2JBPA 3QWKA 3ZO3A 4H3PA 4RJ7A 2QKRA 2VWWA 4IQ6A 4WBOA 2WD1A 2UW0A 4M7IA 5DRDA 1JWHA 4FNZA 2BZKB 5JGDA 3BV2A 4JBVA 3RMFA 4AGWA 3OWKA 3RAHA 3E8CA 3OOGA 2O65A 2HXLA 2VX1A 2BROA 3QTQA 4D4VA 4TWCA 5IA1A 5KMNA 1OGUA 4XH6A 3FKLA 5CY3A 3MWUA 3QC4A 4RX9A 4BRXA 4DBXA 3PJ1A 4CZYB 4YHJA 3SW7A 3OUKA 4TNDA 5GJFA 3FLYA 3IW7A 1RDQE 5LVNA 4UEUA 1SNXA 2V22A 2DQ7X 4BCFA 2W4KA 2EXCX 3I7CA 2EXEA 3E93A 3QD2B 4KIKB 1OKVA 2DYLA 3QLGA 3QZGA 2IZTA 1A48A 5KBRA 5HNBA 4YJQA 5FP6A 4Z16A 1AD5A 4BY9E 3RHXA 5E91A 1V0PA 3LXKA 2G9XA 4EQMA 4LV8A 4BGGA 2QO9A 2B53A 3NX8A 4XG2A 1KWPA 4HVHA 5HTCA 4O4CA 4PV0A 3A7IA 4QP4A 4O22A 4EK5A 2OFUA 4FKPA 4QMLA 4UWCA 3TWJA 4CYJA 4DEBA 3QA8A 3BHHA 1E1XA 3W0NA 1XBAA 5CVHA 5AUWA 3G9LX 5LVOA 1ZZLA 2W1CA 4P7EA 4RZWA 4YGAA 4FTIA 3W2CA 4PPAA 4YO4A 4R6VA 3TT0A 4HCVA 4BDDA 4IHPA 3AKJA 3VS0A 4FZAB 2LGCA 4G5PA 5IQIA 1O6YA 5HO6A 3RK9A 3V5TA 3G6HA 4GS6A 5D10A 3ZLWA 3R00A 3QRJA 4JNWA 5KX8A 2RGPA 5AEPA 4NTTA 5A4CA 3C9WA 4BDIA 5M56A 2YEXA 3L8VA 4GT3A 4IZYA 4CTBA 4ZK5A 1YXVA 4RWKA 3C50A 5EH0A 4FICA 3HX4A 5KMMA 4AGUA 1J1BA 4YLJA 4QEBA 2W06A 3GU5A 4MWHA 3PLAE 2VTOA 1FMOE 4QMSA 3HUBA 1QPDA 3C4FA 4FF8A 4O0YA 1P4OA 2CJMA 4BKYA 1XH6A 3GCSA 4C2WA 4NZWB 4QMOA 2JKKA 4B99A 2OF2A 1T46A 4FUXA 5LWNA 4XHKB 2WO6A 1CMKE 4YR8A 1GY3A 5BMMA 1XH4A 3RZFA 2WEVA 4MBLA 3Q60A 5H8BA 4O7VA 5IU2A 5HG7A 3TNQB 1YXXA 3RAIA 4HNFA 1FVRA 1KE9A 3OROA 3HV3A 1ZY4A 4FUYA 5JH6A 3R7GA 3VS5A 3HECA 3A4PA 3F5PA 3OVVA 4PQNA 5H9BA 3QA0A 2YISA 4O83A 5GZ8A 5I9VA 4I4EA 5FEEA 3F2NA 2ZM1A 3WF6A 1V0BA 3LJ2A 4DEEA 2OJJA 4HNIA 1ATPE 4IVDA 3UOJA 4M67A 3HGKA 5M55A 4BDKA 4AA0A 4GVJA 1VYWA 3C7QA 2QO2A 4PX6A 3HMMA 2YHVA 5AM6A 4AA5A 5EI6A 5FTQA 4XRLA 4AN3A 4GJ2A 2RG5A 3A7GA 2OH4A 4RFYA 4CKIA 3KVXA 3MVHA 4BDJA 2B9JA 4ANBA 3AMBA 4AS0A 2F7XE 4DT8A 1MQ4A 2VTQA 2QU6A 2W0JA 3BHYA 1TVOA 3POOA 4ITHA 4K9YA 4TWNA 4CEGA 5AA8A 1A06A 4LV7A 3E92A 5CVGA 4IAIA 3EKNA 2ZFYA 2SRCA 5A6NA 4O2PA 3PP0A 4WO5A 2HIWA 4X6QC 4C35A 2QLQA 3FV8A 3W55A 1PHKA 2QOOA 3GU7A 3HLLA 3KXXA 4IC8A 4AW1A 3W0MA 3G6GA 3Q4TA 2UW3A 3ZC6A 3D83A 5HCZA 4CG8A 4BZOA 3HAVA 3BZ3A 4JDHA 2PE2A 5M08A 3BRBA 3LXPA 3V6RA 3VUKA 3WZDA 4I0TA 4UALA 5A6OA 4MBJA 4A9UA 2YWVA 4YJRA 1H26A 3OC1A 4CV9A 3TI1A 3IOKA 1MRUA 4OTQA 2W1FA 4C59A 2XK6A 5HIBA 4BTFA 4F7SA 2BRBA 1Y57A 1PXNA 2QHNA 3O8PA 4IACA 4X3FA 2WMAA 2I0YA 3COIA 3PWDA 4I6HA 3DZOA 3KB7A 3OW4A 1LPUA 3IONA 2IVUA 3Q4UA 4P2KA 4WUAA 5ICPA 4F1MA 2UZNA 5AP1A 4BCIA 4GFGA 3U6IA 3GNIB 3GGFA 1O9UA 3QZFA 4KIOA 2VTIA 4ANMA 5CF8A 4E26A 2PUNA 4D4YA 4AW0A 4OTHA 2IVVA 2XJ2A 4I5PA 4R1YA 3NFGB 4L7FA 2I0HA 4EBVA 5BQ0A 4QP1A 2YIQA 4MNFA 2R5TA 4G3EA 4F9BA 3JY0A 1VJYA 4U8ZA 2OSCA 2VO6A 4L3JA 2VWXA 4AXCA 3ODZX 5G1XA 2C3KA 1Q3DA 4PWNA 1WBVA 5AIKA 4FV3A 5AIRA 1WBTA 3RI1A 4CFFA 2XALA 1OIRA 4WA9A 5AADA 4RA4A 1PXOA 2YLEA 2GQRA 4NM5A 5FLFA 3KRRA 5E8TA 3MB6A 4TWPA 5IEXA 2BRHA 3GP0A 2H8HA 4G34A 4ZSEA 1Y91A 1F0QA 4BI0A 3NUPA 5FP5A 3P7CA 2QVSE 5EHLA 3PFYA 1QL6A 5AM7A 5GJGA 4EZ7A 4Y83A 3P4KA 3R1YA 4XP2A 5DT0A 2Y4IC 2OBJA 3BU3A 3BYOA 2W1IA 2FA2A 3PJCA 5I3OA 4BJJA 3EMGA 4YC6A 4C37A 4XV2A 5EHOA 4FG8A 5FM3A 3RBWA 3V51A 4A07A 4AOIA 3MIYA 4AZVA 4OTPA 5C8NA 5IPJA 1Q99A 4DC2A 5EKNA 2ZAZA 5EHYA 2JKQA 3HA6A 1OPJA 4NW5A 4EWQA 3TZ9A 3PVBA 3PTGA 4W4WA 3L1SA 5IQDA 3OXIA 1Z57A 4EUTA 2OLCA 3DK6A 3DDPA 2EVAA 2X7FA 2VO3A 2XBJA 3PSDA 3AKLA 5CXZA 1U54B 3SOCA 2XKCA 3EQPA 4IZAA 2E2BA 4YZ9A 4AXAA 4AP7A 2CNUA 3QRKA 4DH5A 2GS7A 3KULA 1KE8A 3DLSA 4PP9A 3ORMA 5HVYA 3Q32A 4YJTA 4QP9A 2R3GA 4U3ZA 3SA0A 2C6DA 3BBTB 3M2WA 3RJCA 2ZJWA 1S9JA 3QU0A 4NIFA 3VVHA 2HZNA 3FBVA 3NLBA 3NW7A 3UTOA 4TL0A 2UZVA 3IKAA 4YO6A 3EYHA 2C1BA 4I41A 2V62A 1YWVA 3UDSA 1BL7A 2XEYA 5BPYA 3DNEA 4HGSA 3A60A 2XK9A 5FXQA 4C3RA 5IF1A 4DAWA 2W1HA 3SQQA 1PKGA 3AGLA 4RJ4A 3IDCA 2F7EE 4QP8A 4M69A 2YJSA 3G5DA 3LFEA 5CTPA 4BWXA 4F0FA 2UUEA 3MVMA 4W8EA 5M57A 3MVLA 3P5KA 3F5UA 3F2RA 4I93A 4G3DA 3FSFA 3C4EA 5DOSA 5C9CA 3Q9WA 1Z5MA 4EH7A 4OAUC 2BAQA 4TPTA 4APPA 2GNIA 5FEQA 4DCAA 4IANA 5CAPA 4WNPA 1GIHA 5K4IA 3N4VA 4FK3A 3HYHA 3VS2A 4W4XA 2P33A 4UV0A 4QMUA 3ENMA 4LUDA 4I5CA 3ZOSA 2FO0A 5DHJA 3W18A 2B0QA 1TKIA 3ZXZA 3BEGA 4GK3A 4QDEA 5E8UA 5AP2A 2PMLX 2Y0AA 5BVOA 2CNVA 2IG7A 2BZJA 3UNZA 3SAYA 4ZSGA 3DZQA 3SG8A 2WZJA 4Y73A 3JYAA 1YHSA 3CGOA 1H4LA 5DEYA 4IZ7A 2V7AA 3O7LB 5HE3A 1KE5A 5CAQA 3Q52A 3F7ZA 3UVPA 4FV9A 2GNJA 2WIHA 2Z60A 4TTHB 3THBA 1Y6AA 3JY9A 3WF8A 3C4ZA 2VWIA 3QHRA 4JG7A 4MKCA 1VYZA 1M2RA 5CSWA 3TV4A 5JQ5A 3W0QA 5CZHA 4A06A 2W99B 3KRXA 3O8TA 4RJ3A 5CWZA 2GNHA 2ITPA 2QQ7A 5JFXA 4QMWA 3E3BX 2Q0BA 2JDVA 4XG3A 4AOTA 3U51A 3L9LA 4FSNA 1K9AA 5JFWA 4XEYA 4ENXA 1RJBA 4EOPA 5K4JA 4MF0A 2XKFA 1OKWA 3GU6A 3EN5A 1LP4A 2VNYA 4O4FA 5F20A 4C3PA 2XAOA 2PY3A 2J50A 3OT3A 5AA9A 3A99A 3CTJA 4O84A 4V0GA 2X9FA 4DEIA 2HENA 4Q5EA 4EYMA 3VF8A 2C6OA 4QP7A 1IASA 1SNUA 3EFKA 1W8CA 2CN8A 2ITOA 4D9UA 4PUZA 3ZSIA 2GFCA 2PE1A 4FT5A 2YWPA 2W96B 3E87A 2ZM4A 4FTMA 4J53A 1J91A 4WNOA 4IJPA 3BQCA 3DA6A 3Q96A 4L6QA 5LVPA 1ZY5A 3TNWA 4DG3E 5IQFA 1H25A 5J8IA 3ET7A 4CD0A 4ZJJA 4IDVA 5I9ZA 4CMOA 2QOIA 5AUXA 4Z3VA 3VJNA 4E1ZA 5EYCA 3PA4A 3BLQA 4DTBA 4ONAA 2XS0A 5J7HA 2EXMA 3FQHA 4UYNA 2CGVA 3OBGA 4YTIA 2CHLA 3PYYA 2C0OA 3FZSA 1PXLA 3EYGA 4H3QA 4BN1A 4O6LA 3N4TA 3TNIA 4PDPA 2WTKC 4G3FA 5A4TA 3W2OA 2ETKA 4QYGA 4FEWA 4CSVA 3G33A 3F3WA 2J5FA 3C4XA 3KRJA 4GEOA 4NW6A 4JAIA 3FJQE 5HOAA 2XNGA 3A8WA 5FBNC 3KMUA 4RWIA 3QUEA 2C3JA 3UZRA 4FKJA 5JKGA 1OL2A 3FMJA 4FIEA 3DQWA 3SLSA 4BI2A 2IJMA 5LCJA 3FL4A 4GYIA 2PVYA 5E8YA 4EK3A 4DG2E 5D7AA 3ZM4A 3EWHA 5JZNA 2W7XA 3P7AA 2GFSA 3QRTA 4C61A 5HLWA 2E9OA 2KTYA 3P5JC 2GCDA 5JRSA 1J7IA 4NKSA 4TRLA 1Q4LA 3TL8A 1W7HA 2XIRA 2P55A 2X2LA 4TN6A 4RBLA 5EKOA 3T8OA 2XMYA 4O38A 3VS3A 4EK4A 4KSQA 3AD4A 3PXFA 4OBPA 3CEKA 4M13A 1RQQA 3OY1A 2HY0A 5AUZA 2IVTA 3ZCLA 3NEWA 4F9AA 1Y8GA 3QRUA 2R3FA 4FRFA 4R1VA 4AGDA 5C27A 4RVLA 4G1WA 4HYIA 5C4KA 5AX3A 3DFCB 4EI4A 2P3GX 5FTGA 3LFQA 1Q97A 3O23A 3Q6UA 3MH0A 3O50A 4ZEGA 1KOAA 1OPLA 5H2UA 3ROYA 5JQ8A 3DBFA 3GOKA 4FSZA 4FZ6A 4W8DA 3BIZA 4GRBA 5HTIA 5DA3A 1AGWA 2IZUA 1WAKA 3D94A 4FL1A 4QYYA 2BTSA 3ACJA 3RVGA 4D5KA 5F94A 3L8XA 4YHTA 2UW9A 2WQMA 3MPAA 3UC4A 4BGHA 4EZ3A 1URWA 4QD6A 2IW6A 3CCNA 1HCLA 1J7UA 4GG5A 2QNJA 2WTVA 4IZ5A 4CYIA 4MXAA 3NVKI 1G3NA 3V6SA 5BMSA 2GSFA 5C03A 4BYIA 3GOPA 2GDOA 1R3CA 3BE9A 4M84A 4UZDA 2JIUA 3OTUA 1H1WA 3IPHA 3EN6A 2BIYA 4HYSA 4LL0A 1OUYA 4NEUA 5BYZA 4JRVA 3SVVA 5BVWA 1XH9A 3I4BA 4PMMA 5HD4A 3W0RA 3NWWA 3QD4A 2OJIA 2OGVA 2DS1A 3BELA 5TE0A 3CKXA 4O7ZA 5CSVA 3PJ8A 5EM7A 1Q41A 1GIJA 4GU6A 4HW7A 4DDIA 2WTJA 5TO8A 5HNIX 2QD9A 2VUWA 2WMVA 3E64A 4A9TA 2DWBA 4XG4A 2F49A 1U5QA 4FL2A 5C8KA 3HP5A 2W1ZA 2YCQA 4G6OA 3P1AA 1KOBA 3LCDA 3PA5A 3PIYA 3BX5A 4GK4A 4X3FB 4ZTQA 5TKDA 4BDBA 4BCKA 3FI8A 2VGPA 4UB7A 4QO9A 4PPCA 3DJ5A 5B2KA 3R22A 4EZ5A 3FYKX 2I0EA 3U6JA 2X6DA 2XP2A 2ZVAA 3Q3BA 1XBBA 4B4LA 1IA8A 2BKZA 4IWOA 3PY0A 2QOFA 4F9YA 3Q4CA 2ITVA 4USFA 2CN5A 4I92A 2UZLA 3MPTA 4RIYA 4AAYA 3DAKA 4FZDB 1Q8ZA 3IGOA 4M66A 4CFWA 4HVIA 5HORA 4MUQA 3H9RA 3MFTA 1SYKA 2WELA 4I23A 5GNKA 3S95A 1PXPA 4DYMA 3EFWA 3KMMA 5IQBA 4RC4A 5LARA 3EJ1A 5EW8A 5HD7A 3BV3A 4BCPA 1OIUA 1SMHA 4HZSA 3I79A 5A4QA 4CFNA 3LXLA 1VZOA 1BYGA 1H00A 1M52A 4E4XA 5CNOA 5BV3A 5L4QA 4PPBA 4Z55A 1YXUA 4DEAA 3T9IA 3PVGA 3NUAA 3HV7A 4ANSA 4O0SA 4FSMA 5IUIA 2H9VA 2XKDA 3FC1X 4WOVA 3R8UA 3ULZA 2UZBA 1Q8UA 5CEIA 3I5ZA 4A4OA 3NRMA 2XB7A 3PRIA 2PU8A 3TM0A 2WMWA 5CT7A 2R3IA 5AR2A 4C7TA 3V5PA 4DGMA 2FH9A 3UVQA 2RL5A 4DN5A 1ZWSA 5KKRC 3ORZA 4YNOA 3TNHA 3BLRA 4D1XA 4BZNA 5IKWA 2QG5A 2HZ4A 3AKKA 4GSBA 3R2BA 5IA4A 4X21A 5HI2A 4F0IA 3E7OA 3H0ZA 3CPCA 2C6MA 3LFDA 4CNHA 4UMPA 4J71A 4JL9A 3ANQA 2C5VA 2RIOA 4H58A 3ATSA 1ZMVA 3D14A 1H08A 4HGLA 2W4OA 3PDTA 4NJDA 5AAFA 3A7JA 4FKSA 3QX4A 4C34A 5KZIA 3LMIA 4FIGA 3T9TA 4DGOA 3KULB 3RTPA 1PXMA 3D2IA 3FXXA 5CU2A 5H8GA 1JKLA 3DV3A 3C0GA 4WSYA 3NUNA 4C4EA 3FLZA 5BUEA 3VW6A 4C4JA 4NIFB 3JVSA 5JFVA 4BCGA 2R3RA 2WTDA 3R1QA 3CXWA 4FYOA 1SM2A 3WZKA 5J7BA 4JDIA 3CD8A 1OBGA 3KU2A 2UZUE 1MUOA 2IZRA 4RVMA 4O7RA 3VHKA 2HCKA 3MN3A 3CTQA 4WBBB 4OW8A 3JUHA 5DH3A 5H8EA 5EG3A 5KMJA 3UJGA 4DEDA 2R3MA 2VTPA 2XZSA 2HW7A 4GIIA 3A61A 3FZTA 4L67A 4M69B 3W10A 3F66A 5M53A 1Q8TA 2UW8A 5F95A 3KKVA 4D2RA 1P2AA 2ITTA 4O21A 3FMNA 4D2VA 5CSPA 4QMTA 4XG9A 2A27A 3F61A 3QF9A 4GKIA 3QQFA 1R39A 2VZ6A 1IAHA 4O0VA 3A7HA 4IB5A 4EOLA 1YW2A 3NNUA 3ZSHA 2VNWA 3BBWA 3CLYA 2B9FA 3OT8A 2FYSA 1PMEA 2W17A 5LMBA 4TYIA 5E90A 3KXNA 5JFSA 4XX9A 4LRMA 4BWPA 5ANIA 3MGYA 2ERZE 3NS9A 3PE1A 5BX0A 2PVFA 2BR1A 3CY3A 4FTQA 4LOOA 3LAUA 1OPKA 4LOQA 3TKIA 5L2WA 4XS2A 4XBRA 3V8SA 3C5UA 3NYVA 2WTCA 3LQ5A 2A1AB 3LLAA 4K11A 3VUMA 3L8PA 3VS7A 2VAGA 2P0CA 1E1VA 4FKRA 3UP2A 2XK8A 4Y85A 3ORNA 2AEGA 3TUCA 3Q2MA 3M11A 4D2WA 4U41A 3TJDA 5A4LA 3IECA 5LQFA 4NFMA 5HTBA 4DINA 3NW6A 3SW4A 2J0MB 3OXZA 4YU2A 4HGEA 4QPSA 5DG5A 4JXFA 1VLRA 2C6KA 2WMTA 4I3ZA 4OT6A 3ZZEA 3QYWA 3HMPA 2ZB0A 4FTLA 3CTHA 4D4SA 5M07A 4QYEA 4R7IA 2VD5A 3RPRA 2I1MA