4IZAA

Structure of dually phosphorylated erk2 bound to the pea-15 death effector domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
348
structure length
346
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLEVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Structure of ERK2 bound to PEA-15 reveals a mechanism for rapid release of activated MAPK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 116
structure length 346
sequence length 348
chains with identical sequence C
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4izaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4izaA01
5E4HA 4CV9A 3V5WA 3IW8A 2I1MA 2JDRA 4RFZA 3MTFA 4BDKA 5CTPA 1ZXEA 1OIQA 2OK1A 3Q4UA 5E8UA 3FQSA 3QA8A 2P0CA 4PL4A 4NYEA 4C4HA 5J5SA 4U44A 3WBLA 3L1SA 3Q9YA 2QOOA 4IWDA 3BEAA 3B8QA 4FE2A 1V0BA 4HZSA 2CKOA 3UVPA 4AWIA 3L8SA 2QOQA 3CCNA 4GH2A 4LV8A 1OL6A 1PXNA 4BTKA 4FOBA 2VNYA 5HQ0A 2GSFA 5CVGA 5IA3A 4BI2A 3GGFA 4Z7GA 1KE6A 4BGGA 4F6UA 3Q4TA 2QURA 1PF8A 3FHRA 1Y91A 3HA6A 4CKIA 1ZWSA 3FKNA 4AZTA 2BAJA 2VTOA 2YIYA 1MRUA 4F9AA 4BDBA 4IX3A 5AIKA 5D7VA 1CM8A 3MBLA 4MQ1A 4RX7A 3ZO3A 4CVAA 5DI1A 2F9GA 3PIXA 2XKFA 4ZY6A 2C5OA 4O0SA 3O17A 4B8MA 4WT6A 3OWPA 4M14A 5CF6A 5J9ZA 3MI9A 3PPJA 3GU4A 2WMQA 3IGGA 1WVXA 4L8MA 4F6SA 3NNWA 3RPRA 3QTQA 2XEYA 4LM5A 3TV7A 4TL0A 2W1FA 4I6QA 3VHEA 4AN2A 5BNJA 4MF0A 2Y0AA 3JYAA 4OTRA 3A7JA 4XP3A 2ZDUA 4AA5A 4JNWA 3QD2B 2JBPA 3SDJA 5HZNA 3QRJA 2V55A 3VW6A 5J79A 3H0YA 4FTKA 4E4MA 5IUHA 2WMRA 4YNEA 3ZC5A 2YDIA 3QZHA 4RC4A 3P7CA 4FV8A 4QTAA 4CLJA 4O83A 4FT9A 4FTUA 4GUEA 5KMNA 2DYLA 2QHNA 2W7XA 2XNPA 4KIKA 4J1RA 3QA0A 1UWHA 2HZNA 4WNMA 3EQPA 4NUSA 4XOZA 4ZP5A 3VF8A 4PRJA 2Y4IC 3R9DA 4AP7A 4D2RA 2UZVA 2HZ4A 4J99A 2EU9A 3AT3A 2A0CX 3M11A 2B52A 2HXLA 3PJ3A 4BBMA 5IA4A 2XYNA 4CZUA 4U42A 5M56A 2XB7A 1P2AA 2PSQA 2WNTA 3Q2JA 1KOBA 3FWQA 4KAOA 4FKJA 3PY1A 4FKOA 1JSVA 1OKYA 3PPZA 4NK9A 2FSTX 2VTPA 1NW1A 1YWVA 4KKHA 2JIVA 4MK0A 2J0IA 3GU7A 3E88A 2A2AA 4GUBA 4ACDA 5CZHA 2YWPA 4WIHA 5CF5A 2J90A 1ZAOA 2YFXA 3UOHA 1KWPA 4RJ6A 2HZ0A 1PYEA 4MAOA 4WBBB 3Q04A 2WQBA 4AW1A 4YLLA 5KBRA 4I24A 4YPDA 4B9DA 1RJBA 3QKLA 3W18A 4Y85A 2ONLC 2PK9A 4XG8A 4ZJIA 3FZTA 4G5JA 4DH5A 3DBDA 3VS4A 1PMEA 3R9OA 3NCGA 3A61A 3R7VA 3RPOA 4PQNA 4BWXA 3BV3A 5HX6A 2XKDA 2RFSA 3CBLA 3QZIA 3VF9A 3KRRA 3U6HA 4KUJA 4KD1A 5L3AA 4D4RA 1O6KA 2QO9A 3UZRA 4C36A 1ZARA 3MH0A 4U5JA 4XUFA 3QLGA 3CJFA 4MYGA 3NVKI 4CSVA 2CDZA 2BRMA 3N51A 3REPA 3BGZA 3C4EA 3EL7A 4G3EA 4ARKA 3HDMA 5H2UA 5HCZA 3WYYA 4EH5A 4ZSEA 4Q9SA 2WKMA 5DWRA 3A7HA 3LFNA 3SKCA 2I0VA 2PZYA 5AWMA 3RK5A 3SXFA 2LAVA 5CASA 4OAVB 1L8TA 5JGAA 3JPVA 1IR3A 2PMNX 2XH5A 4USDA 3TNIA 4O7TA 3HX4A 4CKJA 4LGDA 4BYJA 2ZV9A 4DFLA 4Z3VA 5C8NA 3UPXA 4IZYA 4IANA 2WOUA 5CSXA 4EKKA 4NT4A 2C1BA 3FL5A 4JR7A 4ZMFA 4FC0A 2HENA 2WQEA 4WBOA 5F20A 5H3QA 4BF2A 3L8VA 3NRMA 4BCIA 1DAWA 4HGTA 4QMQA 5M09A 3DS6A 4UEUA 3SXRA 4X2GA 3V5PA 3HLLA 4FTJA 4O81A 2UZLA 3E7OA 1YXVA 4IB0A 4C61A 3LJ2A 2PZRA 4LUEA 4IAFA 4IZAA 4QRCA 4R1YA 3TL8A 4FSUA 1AGWA 3QCXA 4RRVA 5EI6A 5JRQA 3PVBA 3TKUA 4UYNA 2VWZA 5IH5A 4PDOA 3RZBA 4IX4A 3C7QA 2FVDA 4KIQA 3ZDUA 3NUYA 3DZOA 3FLQA 1U54B 3CTHA 3PJCA 4R78A 3FZOA 2O64A 3MB6A 3VVHA 3TV6A 1ZYLA 4FV3A 1SMHA 4LV5A 2PMOX 3HKOA 4GFOA 4YJNA 4ZSGA 2JDVA 3OP5A 3WE8A 1PKGA 3WZUA 4PPCA 2BIKB 5FG8A 5L8LA 4DTBA 5T68A 4TRLA 2UW6A 2PUIA 2QOLA 3QLFA 3P23A 4RSSA 1JQHA 3S95A 2F7ZE 2P2HA 4NWMA 4JBQA 3PIZA 3QD0A 1WBSA 2F57A 5FBOA 2OGVA 4QP6A 4MXYA 5KO1A 4UMTA 3FEGA 5J9YA 3GQLA 2R7BA 1PXMA 4NM7A 4GG5A 4BCOA 4EC8A 2HWPA 4XHKB 3F5PA 2YCSA 5CNNA 4XRJA 4H3QA 2EB3A 5HCXA 1H01A 1XHAA 3H9OA 3MS9A 2VTJA 3THBA 1GOLA 2C1AA 3MH2A 4AGCA 4XP0A 3QXPA 4LUDA 2H6DA 3SVVA 2UZNA 4ZS4A 4W9XA 5AV3A 2BALA 4C37A 2JDOA 3FZSA 4JG7A 4LFIA 4EQMA 3OEFX 5KMJA 4HNIA 5AP4A 3VUTA 4ERWA 3FI2A 1JWHA 3NS9A 3ZLWA 1OMWA 4O1PA 4EYMA 3OCTA 1QPJA 2WMAA 2FSMX 4EHZA 1ZZ2A 1R39A 3KCFA 3R7EA 2CKPA 3NUPA 3IW4A 2GTMA 4EUUA 3UPZA 3F5XA 4FG7A 5J7BA 3MJ1A 2XKEA 4FSYA 3PXZA 5IEXA 2FSLX 4RT7A 4RIYA 5FRIA 3W55A 2OW3A 3FSKA 4JI9A 5DA3A 4C0TA 3O96A 2EXMA 2O3PA 5EFQA 2YZAA 5TKDA 3EN9A 2IVTA 5GIOE 5LQFA 3CGOA 2WQNA 2X6DA 3KL8A 4G6OA 5EI8A 5IUIA 4RFYA 1LR4A 2PUNA 5J8IA 3UTOA 4F64A 3QALE 4JDJA 3H4JA 4FNYA 4IX6A 4O2ZA 3GCSA 4ALUA 1SM2A 3T3VA 4MQ2A 3DV3A 2J0MB 4GVJA 4OUCA 4KIPA 4LRJA 3RM6A 5H9BA 5A46A 3W16A 4E4XA 2CNVA 1CKIA 4RFMA 4S2ZA 4FEQA 4TKSA 3GOKA 1H1QA 3GEQA 5B2KA 4JG6A 2AUHA 2PUPA 4MTAA 1IEPA 4FTOA 4IVCA 5I3RA 4PL5A 4QP1A 1F0QA 3R00A 3VS7A 3PRIA 4EHVA 5DMZA 1DAYA 3SV0A 3BRBA 1PRYA 2VX3A 5EW9A 2I0YA 1PMVA 2OSCA 3LOKA 4MD9E 2IVVA 3UO5A 4RVKA 3FKLA 1Q8YA 3QCSA 4XV1A 2WU7A 5AX3A 5CQUA 5L2QA 3SRVB 3TUCA 3LM0A 4QYHA 3UIXA 2ZVAA 1Q41A 4FKLA 3R1QA 2XIXA 2P2IA 4ZEGA 1OBGA 3VO3A 3IDPA 3ZLSA 4BTJA 5DG5A 2XK9A 1Y6AA 2CLQA 3EIDA 3DKFA 2GPHA 4ACHA 3DAKA 3UIBA 3WIKA 3JY0A 4A4LA 3ODYX 4I4FA 2FYSA 1Q24A 4W4YA 2BKZA 4HNFA 1FBNA 2JDTA 3T3UA 2OF4A 4AOTA 4JLCA 5HE3A 4D5KA 5CU3A 4EH8A 4Y83A 3LFCA 3GUBA 5HIBA 5C4LA 3GC9A 2C47A 4D2PA 3UGCA 3EFLA 4ZSAA 5M4CA 3HRFA 3FYJX 5AV4A 2HCKA 3V51A 4U9AA 2NP8A 4ZSJA 3OOMA 4Q9ZA 4ZLZA 2E9VA 3UP7A 1J91A 4IM0A 2YACA 5CSWA 1YHWA 2JKQA 2B9IA 3NVMB 3C51A 2GQGA 4V0GA 4DFYA 1HCKA 4DGOA 5M4FA 2OXDA 4YC3A 5CNOA 5CWZA 2XJ2A 3V8WA 4AUAA 4EORA 2CKQA 5B0XA 4Y5HA 3KA0A 4GL9A 4QMOA 1CMKE 5HNBA 3FQHA 3QHRA 5C8MA 3FAAA 4GW8A 2W0JA 1RE8A 4AZEA 4FNXA 4I5HA 2Y4PA 4BTFA 1UWJA 4ITJA 5H8EA 3DBQA 5HIEA 1CSNA 2C68A 4FTLA 4GU6A 3TT0A 3K2LA 4UBAA 4CCBA 4XP2A 4CFXA 2ITTA 3DGKA 3ELJA 5CYIA 4BBFA 3DOGA 3AD4A 3PFQA 4QMTA 5HKMA 2HIWA 4I3ZA 4CFFA 2VO6A 3RVGA 4HYUA 4C3RA 3E93A 3MA6A 4DFXE 4GCJA 2W4JA 5JGDA 5DPVA 5C01A 3VIDA 2WHBA 2XRUA 4U81A 4RZVA 3QC9A 3EQRA 4TTHB 4H39A 2F2CB 3I5ZA 1UKHA 3OUKA 2ZJWA 3ITZA 2W06A 3LJ0A 2XRWA 4RVMA 4L42A 1SVHA 2Q0BA 3S00A 3NAXA 4DBNA 3WF7A 2CNQA 1FGKA 2PZIA 5E92A 1OITA 2BILB 1KV1A 5BYYA 5J87A 4XV2A 1JNKA 3PA3A 4BZDA 5M44A 3BPRA 3FJQE 1CDKA 3ULZA 4ZZOA 4UMRA 1XBAA 3F82A 2R64A 3QTZA 4AXAA 5IQEA 1PMNA 3LFSA 3PZHA 5HBHA 3SGCA 4QQCA 2OFVA 1REJA 4QMMA 2CNUA 1WVYA 5C27A 2QNJA 4G2FA 1RQQA 1VJYA 4EL9A 3QTRA 5FEQA 3V8TA 4DG3E 2R3LA 3VHKA 4U97A 3R8LA 3PXFA 5DT0A 1Z5MA 4QPMA 3RBWA 4HGLA 4A06A 4ANLA 5ANDA 4AW5A 5EM7A 3Q4CA 3VS5A 1IASA 4OTQA 4IE9A 3CY2A 4YJVA 3F3WA 2PE0A 5FP5A 2GTNA 2XK6A 1MQ4A 5I9WA 5D10A 3TG1A 4FEUA 5AFVA 2X1NA 4DTKA 2UW7A 3E63A 4F0IA 5HORA 4IM2A 3OXZA 3VQHA 3VS0A 4P5QA 2GU8A 3SX9A 4AZWA 1H0VA 3DPKA 4L7FA 3UIUA 3WIGA 2C0OA 4I6FA 2XK7A 1OIRA 1SZMA 4AW2A 4BRXA 3R71A 4QQ5A 4NTSA 5ETFA 5I9ZA 3FPMA 4B0GA 3NLBA 2IG7A 3QD4A 1U59A 3UJGA 4AOIA 4I93A 5HO6A 5EQYA 2G01A 1OIYA 5HVKA 1WVWA 1PY5A 1QCFA 4U79A 2OFUA 3KK9A 4F7NA 2ITPA 1R1WA 4FZDB 4IJPA 4I5PA 5FDXA 2QD9A 4FVQA 3FY2A 4IZ5A 3BI6A 3QRTA 4G1WA 2PZ5A 3QX2A 5DGZA 4O7ZA 4BHZA 4I21A 4UYAA 1I44A 2V5QA 3OW4A 5C1QB 1U46A 2OG8A 3D7ZA 3EKKA 4CFMA 1XR1A 3KEXA 3LFQA 3OMVA 4GK3A 2WFYA 3T9IA 3EQDA 3UYSA 5JQ8A 4ZK5A 3HEGA 4L67A 5C03A 4D4YA 3ZLYA 4G16A 4F0GA 4FSRA 1Q3DA 3PA5A 1MP8A 2G1TA 2BAKA 3O51A 3WF9A 3RK7A 5LVMA 5K4IA 2XBJA 3E8NA 3SC1A 5H8GA 3E8EA 2GCDA 4PY1A 3MSSA 3PVGA 3RAWA 5BVDA 3R9HA 1YWNA 2W5AA 4RWIA 4PMSA 3UE4A 1KUTA 3O7LD 3EQBA 2IZSA 5T6KA 2XNGA 1J1CA 4UALA 5EH0A 3R1NA 2HELA 5JQ5A 2VWIA 3CSVA 1GZKA 3F69A 3QCQA 4ITHA 3AC4A 4L46A 3AMAA 1VR2A 4RIWB 5IKWA 2YDKA 4TYHA 3AD5A 5A6OA 1W7HA 2VWVA 5CF8A 4O0UA 5LVOA 3VUIA 3GVUA 2HK5A 2HY0A 3BE2A 5KE0A 2BIYA 4CFNA 4JT3A 1H8FA 2UUEA 1YXSA 4TNDA 2E9UA 3FMLA 4C62A 2OH4A 5FM2A 3A7GA 5HG7A 4X2JA 1ZOEA 3BWFA 5I4NA 2PL0A 5CT7A 4DGNA 5IH4A 3MH3A 5HLWA 3NWWA 5EYCA 4MXAA 4ZMEA 5L6PA 2BHHA 2RSVA 4IEBA 2X2MA 4JOAA 3MJ2A 2YISA 4M66A 4RX5A 3F6XA 4JQ7A 4ZTSA 5M55A 2WIHA 1OL7A 3MFSA 3ZMMA 3DDPA 3EMGA 3FMMA 5IQIA 5IDPA 3ID6C 3D5XA 3ACJA 1OM1A 1JKKA 4KABA 4DH1A 1BL7A 2VGPA 4FV7A 2XNOA 3CD3A 2XYUA 3FL4A 4TYIA 3ZFMA 5CENA 2VO7A 2ZV2A 4K8AA 1VZOA 2C5NA 2G2IA 5IQHA 4NKSA 4XLVA 2B0QA 1O6YA 3AT4A 4C8BA 4N70A 3TUDA 4L3PA 3F2RA 3BHUA 1Q8WA 3ZRLA 3UVQA 1E1VA 2CMWA 2XIRA 3UQGA 3DJ5A 4J53A 4FTNA 3C50A 3KVWA 4EZ5A 4ZLOA 3TNHA 2PVFA 3C4XA 2IW9A 2X2LA 2YM5A 3NIZA 3N9XA 5E8XA 3C0IA 1YHSA 2ZDTA 3GB2A 4IAIA 5KKRC 3MVMA 2QKRA 3HGKA 2OF2A 3LLAA 3EYGA 4IQ6A 3EFWA 1U5RA 2X2KA 3QGWA 2PE1A 4TXCA 3KXMA 4G5PA 2YN8A 2PWLA 3IECA 3KMWA 3VWAA 4Z16A 5KMLA 3K5VA 2JKOA 4GVAA 4FIHA 4KRDA 4TW9A 3VC4A 2W05A 4BIEA 4PNKA 3M42A 3WF8A 3RTPA 3LCSA 5AV0A 4BC6A 2B53A 4V05A 5M4UA 4XYFA 3QQGA 3GC0A 2B54A 4E20A 4B8LA 2QONA 5DIAA 3IPHA 1OPJA 4PUZA 5BPYA 4FGBA 1O9UA 4FT7A 5D41A 5A4EA 5HBJA 5AADA 1YRPA 4CFWA 5GJDA 4F7JA 3RALA 4IWPA 3IOPA 4FV6A 4FL2A 3R02A 5EW3A 5HIDA 3LE6A 3E87A 5GNKA 5AP1A 4IAZA 3U51A 5L2SA 4IH8A 2QOBA 2HAKA 3BQCA 3FMNA 3UODA 1PW2A 1Q8TA 4OBPA 4DE4A 5EK7A 4C2VA 3ZO1A 2QHMA 5EDPA 4DH3A 2ZAZA 4GJ2A 1FVTA 1U54A 3R8MA 3VS6A 3UC3A 2YERA 5JMSA 3UQFA 2PPQA 3BU5A 2UZTA 2R3IA 3D5UA 3OG7A 4OTDA 3AC8A 5LMKA 4CTCA 2WD1A 5BUJA 2OJIA 4HOKA 4FSWA 3CY3A 1CKJA 2CGWA 2QR8A 5GZ8A 1SNXA 4Y95A 3ET7A 5AJQA 4YZMA 4D1XA 2F2UA 5JZNA 3LXPA 3WARA 4ZY5A 3A8WA 5FTGA 3HMIA 4F1MA 4WUAA 4ID7A 2VO3A 4E73A 4NH1A 4LOPA 3VULA 4MKCA 5KZIA 1MRYA 3FSFA 4E26A 3FMDA 4O91A 4ZTQA 4IIRA 4BKZA 1UKIA 5M51A 1YVJA 4A4OA 4QMWA 2HYYA 1PXKA 1SYKA 3CQEA 3ZH8A 4M97A 2OJGA 4AU8A 4D9UA 2GNLA 3DXPA 3NAYA 3QYWA 3VN9A 3S3IA 2VWXA 3TACA 4D2VA 4FEWA 5IEYA 5EYKA 5HI2A 4JBVA 4BDIA 3HVCA 4OR5A 4QYYA 3E92A 4A9RA 5A3XA 2ZB0A 4NM5A 2OIDA 4D28A 5KNJA 3LCOA 2B1PA 2J0KA 2NRUA 2VX0A 3C9WA 4TWNA 3O0GA 4ZTLA 2C6LA 4YURA 2BCJA 1JAMA 3W2SA 2QO2A 2J0JA 3DKCA 3IDCA 2OO8X 3PG3A 3QTIA 4YZCA 4LGGA 3VUDA 3HV7A 2OXXA 4NJ3A 5AP5A 3ROYA 3VBYA 3Q5IA 3TNWA 2R3RA 4RJ7A 3Q53A 3EB0A 3NMUF 1YOJA 1ZYJA 1OUYA 4U45A 4QNAA 4X3FB 3KVXA 5DT4A 1YDRE 3AGMA 1M14A 2BROA 3OY3A 4UXLA 3W2OA 3ZUVA 4ANSA 4D4VA 4FA2A 2IVSA 4YBJA 4YHFA 1T45A 2ETRA 5K0KA 2HWOA 3DA6A 5CU2A 2PVNA 1OL5A 3HNGA 4QP2A 3ZSGA 4GIIA 4MVFA 1ZMVA 5ANJA 2CCIA 5AP2A 4CQEA 4E5AX 3VW8A 4BDEA 2OJFE 3IGOA 2VTTA 4ITIA 4JG8A 1ZY5A 4IAKA 4FBXA 3FKOA 3QGYA 3KU2A 2ITYA 3WILA 4FKRA 3BYOA 1OIUA 4ZXTA 4AX8A 5HTIA 4YO6A 3G0FA 4V01A 4OW8A 4Y46A 1U5QA 3T8OA 3VBXA 5JK3A 1ZMUA 4WSYA 1KE7A 1P4OA 3EH9A 2VTNA 4J7BA 3ZEWA 2AC5A 2R0IA 4EK4A 4EOSA 5DYJA 1Q97A 2XP2A 4FIJA 3BHTA 2B9FA 4A9YA 4BWKA 4FIIA 4OBOA 2XEZA 3D2IA 4TWOA 3EOCA 4USEA 2YJSA 4O0TA 2FUMA 2Z7QA 3NX8A 2VX1A 2FB8A 2VTIA 3OS3A 4CT1A 4EKLA 5AEPA 4MXXA 5HLNA 4YTHA 1BLXA 4WG3A 4MNEB 5FP6A 3GT8A 4LL0A 5AUVA 4GYIA 5IUGA 2F7XE 1XBBA 2J2IB 2C3KA 5FM3A 4XG2A 2QOIA 3B8RA 4U80A 1Q8UA 2OU7A 5I5ZA 1H0WA 3QAME 4II5A 5AA8A 3P9JA 3QTXA 4HGSA 3PP0A 4CZTA 4C02A 3C4FA 5I9UA 4H58A 3KXXA 4QP8A 5EYDA 3RPSA 5JKGA 4GT5A 3UVRA 1OPKA 2Z60A 2W9ZB 3ZTXA 3FHIA 1WMKA 3I0OA 3EL8A 4FTQA 4I4EA 4PNIA 3TZ7A 1BKXA 3PUPA 3W2CA 3ZZWA 4EHEA 4WG4A 4EK8A 2ITOA 4IAYA 1EH4A 3CKXA 3ACKA 3Q9ZA 4GFGA 4G3GA 5DEWA 3LPBA 3O2MA 2YEXA 4GYGA 3HAMA 3R2BA 5AUZA 1ND4A 4MXZA 2R0UA 3MV5A 4QQTA 1DM2A 2UW3A 3E8CA 3NDMA 5E8YA 4BCFA 4OLIA 2NO3A 3PLSA 1APME 1XQZA 4L6QA 2YIQA 4RMZA 5L2WA 4H3PA 2YJRA 2Y9QA 2WMVA 4JBOA 1BI8A 3G9NA 2XCHA 3NYOA 4XV9A 3UC4A 3HAVA 1B38A 2ZB1A 1PJKA 4NKAA 3ZBFA 1XH4A 3UMWA 4RWKA 2GFCA 3W2PA 4ALWA 4D4SA 3FC2A 1YHVA 3DJ6A 4G6LA 5AAEA 4ZTHA 3ZYAA 1K2PA 5HD7A 5LMKC 4L45A 3TV4A 3WZEA 4FV9A 3ENMA 3U87A 4MHAA 3QF9A 3EWHA 5AIRA 5J7HA 3GCPA 4Y8DA 4EH4A 3C4WA 2OJ9A 1LPUA 2O2UA 4LGHA 2RL5A 4DT9A 3D5VA 4J96A 4FYOA 2YM3A 5HTBA 2QO7A 1OB3A 4L3LA 3AMYA 4O84A 4JX3A 4M69A 4F0FA 2ESMA 4CRLA 2GQSA 3ZLXA 3OD6X 4JQEA 1Y6BA 2W4KA 5K3YA 1JOWB 3QKKA 3QFVA 4FL1A 5DR2A 5LARA 1BYGA 1H25A 1GNGA 4IW0A 3GENA 3EN6A 4BDGA 3W1FA 2PVLA 4LRKA 5TF9A 3IW6A 5CS6A 2PTKA 5ACKA 3HMPA 5HHWA 5JH6A 3LHJA 4EHGA 4FV1A 2YCFA 3K54A 4FV5A 2QOFA 4BCGA 3F7ZA 3ZCLA 3CD8A 3RZFA 4ALVA 5GJFA 4EQUA 3QRIA 4GK2A 1IAJA 2R3QA 3DTCA 3CP9A 5J1VA 4IB1A 4FV0A 3N4TA 4JS8A 2W1DA 2QOHA 4ZTMA 3TTIA 4EH3A 5ETIA 3FMHA 5J1WA 1VEBA 2GFSA 4U0IA 2XNBA 3P7AA 2XKCA 3ZRMA 5HGIA 1YQJA 3CLYA 4CMUA 2ZMCA 4D55A 4QTEA 4D1SA 3POOA 2ITUA 5DT3A 3PE1A 4OTPA 4RJ3A 2BRNA 3JS2A 4ZTRA 1Q99A 3SW7A 1GZNA 2XS0A 2DUVA 3PYYA 4O38A 4A4XA 2UZBA 2X0GA 4BCHA 2IW8A 2W1IA 4CFUA 3PTGA 3EFKA 2C6OA 3OXTA 1QPDA 3PWYA 3GQIA 1OL1A 4ZIMA 3FI8A 2C30A 3FMJA 3PVUA 2I6LA 4FNZA 4EYJA 5ANEA 4QP3A 4YR8A 2PVKA 1J7UA 1JSTA 3DNEA 5JFWA 4O7NA 2WXVA 2BZHB 3KRWA 4IC7A 4EUTA 1IRKA 4IAAA 1F3MC 2UW8A 4N0SA 3A8XA 4OGRA 1NVRA 1GJOA 5A14A 1TQMA 2QODA 3EZRA 4JL9A 4QMUA 5EM8A 3HMNA 3R21A 4G3CA 4A9SA 5TE0A 5AR8A 4RIXA 3HECA 4HVHA 4DTAA 1HCLA 2OKRA 3GC7A 5AV2A 5ACBC 2BRGA 4E7WA 3PLAE 2J5FA 4DBXA 3GCVA 4UZDA 3W8QA 5CEIA 5LVNA 4I94A 1FQ1B 3KULB 3NUXA 2YCRA 3OZ6A 5AV1A 5BUIA 3CGFA 3W8LA 2XIKA 5CXHA 4OTGA 1JSUA 4B7TA 4KIOA 4IDTA 3PVWA 2GNGA 1RDQE 3OBGA 2XNNA 3ZDIA 4N57A 2IWIA 3UNKA 2HW7A 4MWHA 5AP7A 4JR3A 4W4XA 1M7QA 3V5QA 3C1XA 4WO5A 1GIHA 1M7NA 4TWCA 2RKUA 1UV5A 2VU3A 4O22A 4JDKA 4YJSA 4BZNA 1R0PA 1M2PA 3I7CA 4DAWA 5DBXA 4N6ZA 4DCEA 2RG6A 5IA1A 2H9VA 1LEZA 2PVRA 1F5QA 4PP9A 3OROA 5FTQA 4CYIA 4NZWB 5GJGA 3ANRA 5BYZA 4C34A 1V1KA 5IQBA 2GS2A 3Q52A 1NT2A 3MTLA 4KBKA 2ITVA 2VNWA 4YLJA 5DLSA 4R3PA 1GAGA 4EBWA 4WD5A 3R1SA 4A9UA 5A4TA 4YJQA 4BDDA 2VWYA 2VGOA 1URCA 4M68A 4QMVA 5T3QA 3T9TA 4RWJA 4UY9A 4HVDA 4CKRA 4AGUA 1YOMA 3D94A 3KXZA 2C5YA 4YUQA 5FQDC 3RKBA 3RGFA 5CVHA 4O6EA 4RQKA 4XBUA 1OL2A 2WTJA 2WELA 4RIWA 4Y72A 3Q3BA 3GU5A 4EOIA 5A4QA 5IZFA 2UVXA 3ZHPC 4PP7A 3Q60A 3KCKA 2LGCA 4IADA 3V04A 4IB5A 4PMTA 2BDFA 3ENHA 5AMNA 4L9IA 5EM5A 4ACCA 5HCYA 3QL8A 5C8KA 4U3YA 1BMKA 3FMEA 4FZAB 4ZS0A 2EXCX 3ZBXA 2BKKA 3KREA 1ZLTA 4RVLA 3U8WA 3MESA 3C5UA 4A7CA 2XVDA 3CQUA 3QQKA 4K33A 3E3PA 5CY3A 4UMPA 3R8UA 3VJOA 4CTBA 2FGIA 4FG9A 5CXZA 3POZA 5IA5A 4O0RA 2JDSA 1JLUE 2BDWA 3MGYA 2XF0A 3RNYA 3RM7A 4X0MA 2GNHA 2JFMA 5BMMA 4FF8A 2W1GA 3LCTA 1CTPE 4RC3A 4MD7E 5AUXA 3ZUUA 3I60A 2QLQA 4KIKB 1TQIA 4KS7A 4HGEA 4RA4A 3R0TA 3F2NA 3KY2A 1A06A 4E5BA 5EOLA 3ALOA 4F63A 1R0EA 4TZRA 4YPSA 4FKSA 3ZM9A 4ZY4A 4X7QA 4FKVA 3HZTA 1ZYCA 2W9FB 2WEVA 1P4FA 3K5UA 2QVSE 4DFZE 2Z02A 3QKMA 4EWQA 4NIFB 3BZ3A 3Q9WA 4JX7A 3F5GA 4K18A 2C6IA 3G6HA 5G1XA 4XS2A 4ASZA 1Q62A 1NXKA 2ETMA 2YIWA 4RIOA 4DEGA 3DU8A 4O86A 3CTQA 2IW6A 1FOTA 5BYLA 3ORXA 5HICA 2ZMDA 4U3ZA 1V0PA 4F4PA 1B6CB 3NW7A 4QD6A 5CAUA 3LKMA 2I0HA 3P4KA 3OT8A 3LFDA 4YZNA 4KINA 3R8VA 3DDQA 3COKA 3GFEA 3MPMA 4PDPA 4TYJA 4WNKA 2JKMA 5KHWA 3D4QA 4B4LA 3FV8A 3I1AA 5ICPA 2Y8OA 4YZDA 1M2QA 3D83A 3F9NA 3UDBA 2NPQA 3QCYA 4BCQA 3CKWA 3A7IA 2UV2A 5HEZA 2J0LA 5FDPA 2R3GA 3D7TA 4NW6A 4CFVA 4LG4A 3UG2A 4MNFA 4LOOA 1Y8GA 3MFUA 1H1SA 4C2WA 4DEBA 2X4FA 1QPCA 4EOMA 1S9JA 2C5VA 2C6MA 4XNEA 1ZYSA 5DRDA 3ZM4A 3VBVA 3TDVA 4XG6A 1M52A 2Q0NA 4EZ7A 4KSQA 4ANQA 2A27A 4BKJA 3FLYA 1PXIA 4CG8A 3H9RA 3NIEA 4O0YA 4DLJA 5M53A 3BYMA 3HRCA 3NUSA 5K5NA 2BR1A 3JXWA 2QG5A 4FNWA 1R3CA 2HXQA 5M06A 4C3PA 3HP2A 4F65A 4YZBA 4DGMA 3TNQB 2OBJA 5FGKA 3CEKA 1KE8A 3TJCA 2BFXA 3ZSIA 3FQEA 4LI5A 4CYJA 3OT3A 3CE3A 3H30A 4HVSA 3QTWA 3FY0A 4O1OA 4JIKA 4YJRA 3UBDA 3AGLA 3PSCA 2BMCA 5IQAA 5AUTA 2UZOA 3E64A 4D0WA 4FZ7A 1OVEA 2W1HA 4O0WA 3QBNA 5HG9A 2WTKC 1PXLA 5I3OA 5F9EA 5JGBA 3PPKA 4YMJA 2WMWA 3P5KA 1GZ8A 3GP0A 3E7VA 1G8AA 3NCZA 3HUBA 4WNPA 4F1OA 3CR0A 2BRBA 2ITNA 4DEEA 3ORKA 4LL5A 4IJ9A 4ZSLA 3TM0A 4AZVA 4BDHA 3OY1A 4PX6A 2WTCA 3O8TA 5J95A 4FI1A 4W4VA 4FT5A 5B7VA 3TIZA 2UZDA 4XCUA 5HU3A 3KKVA 3M1SA 2Q83A 4C58A 1J7LA 3NYVA 3KRLA 3BCEA 4USFA 4ACMA 3F3TA 4BVUA 5IEVA 1KSWA 1UNLA 4QT1A 2ZM1A 4R7HA 4BDAA 4BGHA 5E1EA 3VUMA 3UQCA 4MWIA 2CN8A 3DFCB 1H07A 4XRLA 5DEYA 5ITAA 2WMTA 1H27A 2C6DA 2C6KA 2UW0A 4GSBA 4XX9A 1XH6A 1OKVA 3BEGA 3SHEA 4CXAA 1UU9A 3G15A 5HE2A 3TWJA 5AUUA 3MIYA 3MA3A 4S33A 1YWRA 2VWBA 2WAJA 4UXQA 4FTRA 3C5IA 4X2FA 4GS6A 3TDWA 4C4JA 4DLIA 4OTHA 4DFBA 3DQXA 4YJTA 4CMOA 1OKWA 2WMXA 4CD0A 4IHPA 1XJDA 3BHVA 4F7LA 3P0MA 1PKDA 1H00A 2X7FA 4TYGA 1OPLA 4ZZNA 4W9WA 4X3FA 4FIEA 4FZFB 2XBAA 3RNIA 3KF4A 1KE9A 3NZ0A 4AT4A 4BDFA 2B55A 4FKUA 2J6MA 4PDSA 4UB7A 4L44A 1G3NA 5TOZA 3P08A 4KA3A 3ALNA 3U54A 2W96B 1I09A 2ITWA 4ASXA 4DHFA 4P7EA 4HVIA 3EHAA 1H1WA 3ORTA 2W4OA 3C13A 3R30A 5HTCA 2UW5A 2JFLA 4H05A 5FBNC 2PVHA 2YM4A 3RHKA 3CS9A 2FO0A 4E6AA 3DY7A 3BYSA 3NPCA 4Q5HA 2I40A 5HD4A 2R3FA 2QLUA 2X9EA 3OWLA 4D1ZA 2OH0E 3BV2A 4FKGA 3SOAA 2V7OA 2Y7JA 2IN6A 3BGPA 1NVQA 4QMPA 4M13A 4RIYB 2A1AB 4W8EA 2ACXA 4L7SA 4E1ZA 1ZRZA 2R3MA 4X2KA 3C4ZA 5HU9A 4RGJA 3WZJA 1OECA 3HL7A 1TQPA 1J3HA 5AR5A 3GFWA 4KB8A 2PVYA 4O7RA 2VZ6A 5EM6A 3DBFA 3GBZA 3OTVA 1WBNA 3BLRA 3OCSA 4MF1A 3LCDA 4QYGA 4X21A 3MIAA 4GIHA 3AQVA 5CEOA 4WNOA 3NYNA 3TZ9A 3IW7A 2DS1A 1OUKA 3VUGA 4PMPA 3DBEA 4DEIA 3O7LB 2IPXA 1BUHA 3SOCA 5L8JA 3QUEA 1PXJA 2B9HA 5BUEA 3QUPA 3P1AA 4S32A 4AACA 2OICA 3QWKA 4R1VA 4UX9A 2XZSA 2P33A 5LMAA 2X39A 2F7EE 3HDNA 3DQWA 3DNDA 3BKBA 1SVGA 5IQDA 3BE9A 3AT2A 4GK4A 4X6RA 3TTJA 3UNZA 4EK3A 3I81A 3IOKA 1U4DA 3PY3A 5C9CA 2P55A 1JBPE 4RBLA 5E91A 5F4NA 4BCNA 4D0XA 3AC5A 3OCGA 3EZVA 3A4OX 4JRVA 4QP4A 4YO4A 3VUHA 3OW3A 3MPAA 4OTWA 4HCUA 3PXKA 4QNYA 2J5EA 4U40A 2HW6A 3NYXA 4FV2A 5AAGA 4F7SA 4IBMA 5HNGA 4JXFA 4NCTA 4DFNA 3FLZA 1KOAA 4YNOA 4JRNA 4AN9A 4CMTA 2J7TA 1IA8A 1PXPA 4A07A 4ONAA 4XJ0A 5EW8A 5JEBA 3LQ8A 2WTIA 3JVSA 3Q5ZA 4BGQA 1ZYDA 3TEIA 3KQ7A 3FXWA 3NUUA 3LFBA 4YTFA 1J1BA 3HV4A 3D9VA 4R7BA 3ORLA 5CI7A 4BCJA 5LJJA 4JDHA 3R8ZA 1WBVA 4RLLA 1KE5A 2WQOA 3QXOA 3EYHA 4CEGA 4HZRA 4QMNA 4IWOA 4TN6A 2JAVA 3PXRA 4PF4A 4R6VA 5ANOA 1UU7A 4D58A 1YI3A 3P79A 4BTMA 4EC9A 3UYTA 4FSNA 2GNFA 3PJ2A 1A48A 4FTMA 2PMIA 4R5SA 3FBVA 1YXUA 3FXXA 5E8ZA 4BCKA 5EHLA 4NU1A 4GG7A 2R9SA 2CLXA 4MBIA 4RZWA 5AR4A 5ANGA 4YJPA 2CGXA 5HG5A 5L2IA 5H8BA 4O82A 4DFUA 3R63A 5GINE 5CAPA 5CALA 4AE6A 4R8QA 3ORMA 2Y6OA 5DE2A 5BVNA 4AS0A 4MEDA 3NNUA 4XBRA 1YI4A 3EQCA 4J52A 3HA8A 1XO2B 3CC6A 3Q32A 1QL6A 5TO8A 2W17A 3OWKA 4EOJA 2E9PA 4FR4A 4LMNA 2ZM4A 5ANIA 3UZPA 2V7AA 2WO6A 3HRBA 5E7RA 2VUWA 4I0TA 2OIBA 4YC6A 5CU0A 5L8KA 2X7OA 3D0EA 2WTDA 4BCMA 5CSHA 2V0DA 4EI4A 1Y57A 4UWYA 4UMQA 4KKEA 3RHXA 3R22A 3ORPA 3V5JA 3KGAA 2OJJA 3G5DA 2ERZE 3II5A 3O8PA 3COMA 5M07A 5CEPA 4H3BA 4WHZA 1IAHA 3ZS5A 3KB7A 3R9RA 5AR2A 3A62A 4RPVA 4OBQA 3EN7A 3FDNA 4M12A 4OTIA 4AT3A 2PMLX 2JITA 4X3FC 1UU8A 4AT5A 4Z55A 4W8DA 5DRBA 1FPUA 3FZPA 3GNIB 2ZM3A 3W10A 3ZXZA 1LP4A 3SAYA 3HMOA 4FEXA 1H26A 3ZONA 2XMYA 1LUFA 4KBAA 1GZOA 4DGGA 2XCKA 5DN3A 4JJRA 1WBTA 2E9NA 2R3KA 4FK3A 5GHVA 4F9YA 3F66A 4HCVA 2IJMA 4FIGA 4QMZA 3HP5A 2I7QA 5M08A 4J98A 4C33A 4X2NA 2V62A 5CAOA 3E3BX 3DFAA 3RPVA 4YTIA 1JKLA 3QQHA 5KKRB 2W99B 5K5XA 1QPEA 1A9UA 3K3JA 2RFEA 3KULA 4AGWA 5HNIX 2C0IA 5D9HA 2QKWB 4KS8A 1ZY4A 3DKGA 5EDRA 1WBOA 2O65A 3R1YA 3MFTA 3AOXA 3ZZEA 5I0BA 5J9LA 4TNBA 2C6TA 2B4SB 3V5TA 3L9NA 4EH2A 2V22A 3WYXA 3EN5A 4ASDA 2YITA 4GT4A 2BRHA 2YIXA 5HE1A 3TXOA 2YDJA 1WFCA 3AG9A 4EEVA 1YI6A 4TT7A 4BFMA 5L6OA 3VS1A 4AF3A 4FT3A 3ORNA 5IISA 4WKQA 3PE2A 2JIIA 4APPA 4I20A 2WTVA 3S2PA 2XIYA 2EUFB 2W1CA 3RAKA 4H1MA 2EB2A 2WB8A 4MBJA 4EJ7A 4AN3A 4P5ZA 3OOGA 3PXYA 3O8UA 2R2PA 4AOJA 4YU2A 4YHJA 3U4UA 4APCA 3VS3A 4C4GA 3GU6A 1G8SA 3QQLA 3WF6A 5FUTA 5EKOA 2XM9A 5HOAA 3WOWA 3AC1A 3C0GA 3BBWA 3CXWA 3V3VA 3VS2A 5LOHA 4O96A 5E8VA 5E8TA 5EQPA 4E6CA 3EQGA 5HE0A 4GKHA 2ZOQA 3QRKA 4RG0A 4RLKA 4EZ3A 2ZV8A 4IX5A 4EBVA 5F94A 4QPAA 4NCTC 3R28A 5AR7A 4EOQA 1STCE 4NFNA 2WGJA 4WOVA 5M4IA 1BI7A 3LM5A 3Q96A 2IZUA 5BX0A 1M17A 3EQHA 3ODZX 4BR3A 2GS6A 4FVPA 3A2CA 5IA2A 3AMBA 4ERKA 2CKEA 4N6YA 3DXNA 4RX8A 3KMUA 4FTCA 5HLPA 5GZAA 1JVPP 5A4CA 5AX9A 5AP3A 4F08A 3ORZA 2YHVA 3TZMA 3V6RA 3SRVA 5K4JA 4I0SA 4D2WA 4UN0C 4M0YA 2BUJA 3CPCA 2BZJA 5BVOA 3JUHA 3OEZA 3WZKA 2YZLA 2YIRA 4E5WA 4FSZA 3KXHA 4E6DA 4L01A 5CSVA 5JFXA 1K9AA 4HYHA 3OFMA 1CKPA 4IC8A 3FZ1A 4RJ4A 5ANKA 4Z9LA 3TKHA 4IVDA 1PYXA 3MN3A 2WMUA 3FC1X 4DEAA 2J51A 5IPJA 3JY9A 2P4IA 5BVKA 2QOCA 3GI3A 3OVVA 3QUDA 4TYHB 5EYMA 5DHJA 3ZUTA 4PTEA 3SW4A 4EQCA 5KMOA 4BBEA 2QI8A 3PJ8A 3WF5A 4W4WA 3TIYA 4G31A 2YM7A 3RWPA 3TCPA 4PMMA 4NIFA 3DKOA 2BTSA 2CSNA 2PE2A 4C3FA 3G90X 4X6QC 3L9LA 4U41A 4F9WA 5JFSA 4BWPA 2Z7RA 1Y8YA 2OZAB 2PHKA 4CGAA 1Q4LA 5IQFA 4LQMA 5C26A 1GIIA 2IVUA 5D7AA 5FD2A 5HO7A 3CJGA 2XUUA 4O27B 4OTFA 3MPTA 2YAKA 4AAAA 5KMKA 3BQRA 2C3IB 3DZQA 3OTUA 5KMIA 4FEVA 2PZPA 4HCTA 3BHHA 3QQUA 3TI1A 5IG1A 2JBOA 4AZFA 4PWNA 2B7AA 3PZEA 4HPUE 1X8BA 1VYZA 2WZJA 3MH1A 3RK9A 4HVGA 2VWWA 3MVLA 2J4ZA 3NNXA 4GEOA 5HO8A 4DGLC 4ZJVA 3JVRA 1OI9A 3BELA 5D12A 1OKZA 1SNUA 2BDJA 3GXLA 4QMXA 3BYUA 5EHOA 2R3NA 4MH7A 5F95A 4FKQA 3MY0A 1MUOA 4QO9A 1O6LA 3E8DA 4S30A 3QTUA 3C4CA 5AAFA 4BHNA 2UW9A 4IFGA 4KKGA 2VO0A 2ETKA 5KMMA 3B2TA 2GNIA 4YJOA 3SG8A 4BYIA 4MD8E 4FSTA 3D14A 4YHTA 3ZC6A 4BDCA 4O7VA 5DOSA 3C0HA 2VTRA 3DLZA 4ANOA 1E9HA 3LZBA 3DB8A 3OCBA 5E8WA 4AZSA 2BPMA 3QX4A 2Y4IB 3R83A 4C57A 5L4QA 3DB6A 2CHLA 3N4UA 4ZTNA 2QQ7A 4KWPA 4QTDA 1H28A 2F4JA 5IQGA 2CJMA 3OF0A 3RP9A 4RQVA 2KTYA 4IM3A 4WRSA 3A99A 3PP1A 5HG8A 2O5KA 3R7YA 3E62A 2YA9A 3G33A 1FMOE 2RIOA 3LXKA 2VN9A 4LRMA 2QCSA 4FZ6A 1UNHA 4BKYA 3QC4A 4AGDA 5GIPE 2I0EA 3HV5A 5AR3A 3MVHA 3QQFA 4RWLA 3S0OA 4O7YA 4DA5A 4I6BA 4QYFA 4BY9E 1MRVA 3NUNA 5IMXA 3LXLA 1AQ1A 5D1JA 2IZTA 3GCQA 4FKPA 3FPQA 1PHKA 2BAQA 2YLFA 4DC2A 1H1PA 1REKA 2OZOA 5JFVA 3LLTA 3UZTA 4BZOA 3PA4A 3M2WA 1URWA 3OXIA 3ZRKA 5HX8A 1FMKA 3BLHA 4C4EA 4K77A 4XG3A 2HZIA 2GDOA 2UZWE 3F2AA 4I41A 3V8SA 4I1ZA 4DG0E 3S1HA 1IA9A 3K3IA 4M3QA 2WEIA 4I0RA 5CF4A 5CZIA 2G2HA 4YZ9A 1YDSE 3UO6A 2XM8A 4S31A 4EOLA 1W83A 4F99A 4C7TA 1JKTA 4I5CA 1ATPE 4G9RA 3P86A 3PDTA 2W1EA 3NEWA 3HV6A 5E90A 1IG1A 1MQBA 3I6WA 4FTAA 3U4WA 3TN8A 4JVGA 2QU6A 5FWKK 3RWQA 4EK5A 5CAVA 5LMBA 4F1TA 3KF7A 4TY1A 4GMYA 3IO7A 3DAJA 5ETCA 2H96A 1M2RA 2EVAA 4FUXA 4QOXA 3U6IA 4K1BA 3GU8A 3I7BA 4V04A 2NRYA 4D2TA 4HW7A 4O2PA 2X81A 4IFCA 3RMFA 5BVFA 3O50A 2PYWA 3VBWA 2VTAA 5AM6A 1NVSA 3NNVA 4R7IA 4BIDA 4QMYA 2XNMA 5KZ0A 4QTCA 2JD5A 1YOLA 1JKSA 2X6EA 3MFRA 3L8XA 4GU9A 4I5MA 3IS5A 4DF3A 3R04A 2W5BA 1BX6A 5CLPA 2RFDA 3LIJA 2YLEA 5LVPA 2CCHA 4CQGA 4XH6A 2ERKA 3DCVA 4TYEA 4G3FA 4RA5A 5K9IA 3FUPA 3EFJA 3MW1A 3LFEA 2C6EA 3OHTA 2RGPA 4O21A 1GIJA 3AC2A 3D15A 4P4CA 4FX3A 1VYWA 2G15A 3R7GA 4YLKA 5D11A 2VV9A 4NEUA 3KRXA 4IZ7A 2JKKA 2E2BA 2RF9A 4XV3A 3TKIA 2X9FA 3FI3A 5AP0A 3KFAA 3AC3A 4E3CA 4YSJA 1W82A 3QRUA 1ERKA 5HVYA 4G3DA 2E9OA 4ANNA 2X8IA 4JIAA 4MCVA 3D5WA 3H10A 4X3JA 3ZFYA 2CN5A 3G0EA 4FSMA 4C4FA 2A4LA 2OLCA 4D2SA 5F1ZA 3LQ5A 4ENYA 2XK4A 5CU6A 4R3CA 3FMKA 3KXGA 1GY3A 4LYNA 1DI8A 5DNRA 2QC6A 4WRGA 5EI2A 4EWHA 5JSMA 5K0XA 3LMHA 4PDYA 4XMOA 1YKRA 4NSTA 2DWBA 2R7IA 1XKKA 3R6XA 4I6HA 4EH9A 4PTGA 2WOTA 1OZ1A 4PPBA 4XEYA 5BQ0A 3CTJA 5EHYA 4C4IA 4S34A 3W32A 3RAIA 1FGIA 4FSQA 3UO4A 3VJNA 5FLFA 3W33A 4O6LA 3VNTA 3MDYA 2C4GA 3G51A 3CIKA 4NJDA 2BVAA 3UP2A 2FA2A 3LMIA 3OC1A 3DK7A 5E1SA 1G5SA 2ITXA 4IMYA 5LCKA 3BLQA 1UNGA 5JRSA 3LCKA 4QQJA 3DK6A 1ZOHA 3VQUA 3NGAA 3BBTB 4RJ5A 4JQ8A 3W2RA 4G9CA 3KK8A 4M84A 4CCUA 3OBJA 3HMMA 3ZEPA 4BCPA 2R4BA 2BZIB 5FEDA 4BDJA 4EH7A 4FL3A 1W0XC 4FMQA 4K2RA 4WG5A 1WAKA 3I79A 5CSPA 3R73A 5DFPA 1Z57A 4M7IA 4NM3A 3WI6A 3AXWA 2WIPA 3G2FA 4YSMA 4YBKA 2UVYA 5KCVA 5KUPA 4F9CA 4UWCA 5IU2A 5CI6A 5G6VA 5EDQA 1ZMWA 1YXTA 3QZGA 4O0XA 4K0YA 2Z7SA 3KXNA 4UWBA 2XJ0A 4CG9A 4KBCA 3R01A 4J8NA 1FINA 2HOGA 5L6WL 3ROCA 2VAGA 4QTBA 3SA0A 5GZ9A 2J9MA 3ATSA 1UVRA 5AUYA 5FXQA 3V01A 3LQ3A 3NW5A 4EJNA 3N4VA 4EK6A 2WQMA 3R7OA 4BL1A 3LXNA 1S9IA 2J50A 2EWAA 2Y6MA 3IKAA 3ANQA 4I92A 5AM7A 4DG2E 4G6NA 2C0TA 1Q3WA 2YM6A 4P2KA 4AG8A 4LOQA 3HUCA 5IF1A 4F09A 3PXQA 3CPBA 3PWDA 4QPSA 3TJDA 3QYZA 3BYVA 4FODA 3A7FA 3E5AA 4L52A 1W8CA 2W1ZA 5HBEA 3V6SA 4FIFA 3Q2MA 2OI4X 3I0QA 3UOLA 4GKIA 5CANA 1K3AA 5L2TA 3BIZA 4IXPA 2JEDA 3H9FA 4M69B 3EQFA 1OGUA 3QHWA 4FICA 4FVRA 3MY5A 5CU4A 4DH8A 3GCUA 3PRFA 4RVTA 4Z7HA 4QP9A 3ZFXA 4EOOA 4B6LA 4L53A 3FYKX 1XH7A 1H08A 3SLSA 4YTCA 4WUNA 5CAQA 1ZZLA 3DBCA 2AYPA 2ITQA 2X8EA 2AC3A 4MX9A 2QOKA 5BVEA 4DT8A 2XK8A 4R3RA 4J8MA 4ACGA 3UOKA 5M57A 1KV2A 4GFMA 3DT1A 4FG8A 4J95A 4Q5EA 4IVBA 4FKTA 3U6JA 2F49A 4KNBA 4E4LA 4FUYA 2UZEA 4L68A 2VTLA 3ULIA 2BTRA 3WE4A 3WZDA 5E9EA 3EKNA 4C38A 4Y73A 4HYIA 1E1XA 3F61A 4YJUA 4PV0A 4JAIA 5EOBA 2QG7A 4ZZMA 3V5LA 4G34A 5DR9A 4DEDA 3ZO2A 4R5YA 4HYSA 3RINA 3FZRA 3KN6A 1NY3A 3PIYA 2C69A 5A4LA 3EJ1A 5KHXA 5AP6A 2UVZA 3HYHA 1RW8A 2KULA 3O71A 4MBLA 5FEEA 4TPTA 4CRSA 2VD5A 1P14A 5LWNA 1L3RE 1QMZA 4ZJJA 4I23A 3U9CA 4E93A 2UZUE 1W84A 4K11A 4QP7A 4U43A 3DTWA 5IMEA 4PPAA 3COHA 5LXMA 3SD0A 3OUNB 3FE3A 2B9JA 5TR6A 3H3CA 4GV1A 1XH9A 3IW5A 4E4NA 1B39A 5IH6A 2G9XA 2RG5A 3COIA 3DJ7A 3KC3A 4XG4A 1NA7A 4EOKA 2VTHA 3VBTA 4DYMA 4AE9A 2R3PA 5B2LA 1V0OA 2WPAA 4H36A 4MXCA 3MB7A 2IZRA 1OBDA 4YGAA 2JAMA 2WMSA 2CPKE 2XK3A 4RIXB 4QYEA 4NW5A 2Z2WA 3F5UA 2GHGA 3IQ7A 4Y5QA 2O0UA 3F88A 2VTQA 5ETAA 2WTWA 1DS5A 4UMUA 3ZXTA 1AD5A 2C3LA 1PXOA 1TKIA 2OIQA 2UW4A 3VAPA 3ZU7A 5AA9A 1WBWA 1ZOGA 3MY1A 3R7IA 4FTIA 2XNEA 1Q61A 3DK3A 4NFMA 5CEKA 4O7LA 5C4KA 3OWJA 3S4QA 4DINA 4KSPA 4M67A 2X7GA 3QQJA 2GHMA 2DQ7X 3SQQA 2WTKB 3H0ZA 2QU5A 3ZO4A 1WBPA 4IACA 5CEMA 4NM0A 4BIBA 4B99A 1XH5A 3CQWA 4CZYB 3FLWA 4AFEA 2Z8CA 4K9YA 5CX9A 3A60A 4F6WA 4IDVA 4YP8A 2PVJA 3A4PA 4HPTE 4O7SA 1H24A 3PG1A 4TWPA 3R7UA 4KRCA 2R5TA 4ANMA 4JBPA 3G9LX 4K6ZA 3L9PA 5DH3A 1DI9A 3ERKA 1R78A 2O8YA 3R9NA 3RJCA 4MNEA 4D9TA 1BL6A 1WZYA 1TVOA 1YDTE 3UMXA 5CVFA 2XJ1A 4FT0A 3LW0A 3VBQA 3TUBA 3F3UA 3QD3A 3L9MA 3L8PA 3TNPC 3P7BA 3SG9A 2VTSA 3BHYA 4AA0A 2JLDA 2PU8A 4BI1A 4JDIA 3I5NA 2SRCA 3O23A 4F9BA 2GS7A 3RCDA 2VTMA 2C5XA 2A19B 3PSDA 2WMBA 4XG7A 3FXZA 2RFNA 3EQIA 3KRJA 4QMSA 4ZLYA 5JN2A 4NL0A 1UA2A 3VRZA 3BU6A 1Q8ZA 3GC8A 4RJ8A 4QMLA 3IDBA 1H4LA 4CNHA 2OZAA 2BZKB 3BGQA 3I4BA 4M8TA 4ANBA 5KBQA 3F7WA 3I6UA 4FKIA 4AFJA 4DN5A 5IDNA 3PY0A 5BMSA 2CGVA 4C35A 2R3OA 3BX5A 3QWJA 3MWUA 1YW2A 5CQWA 4DH7A 2X8DA 4GJ3A 5A6NA 2PULA 2FH9A 4RC2A 3JR1A 2W5HA 1XWSA 4BB4A 5DVRA 1J7IA 2O63A 4U6RA 3MYGA 4XLIA 4HJOA 3P78A 4EH6A 5TT7A 4YC8A 5EG3A 4O0VA 3BU3A 4CV8A 4FK6A 3MVJA 5FXSA 2ZV7A 3ZOSA 4G17A 3R2YA 3UG1A 4LMUA 5FTOA 5I9XA 5J5TA 2YABA 4XOYA 5E8SA 3DLSA 3VUKA 4E8AA 4A9TA 1XBCA 1H1RA 2H8HA 3KMMA 5CT0A 2P3GX 3IG7A 4DITA 1FVRA 4J71A 4ORKA 3ATTA 3ETAA 2JC6A 4FKWA 2BFYA 4M0ZA 4V0GB 2CGUA 3LFAA 1P5EA 4XG9A 4L00A 3IONA 1W98A 1WCCA 5JT2A 4MXOA 4FV4A 3AD6A 2Z7LA 4ZOGA 4F70A 2VRXA 4IB3A 3QZFA 2XIZA 3GOPA 2GMXA 4NTTA 5FXRA 3UOJA 4BN1A 2YAAA 3NR9A 2JGZA 4WSQA 4U7ZA 3SXSA 3KN5A 3Q4ZA 4FGRA 3NSZA 5LCJA 4PL3A 3D7TB 3W2QA 2GQRA 1SVEA 2JIUA 2PUUA 3PJ1A 3U55A 1PMUA 3LVPA 4O7WA 4OT6A 2H34A 3F3ZA 4D5HA 2VWUA 4OT5A 5IA0A 4BI0A 4IWQA 3PSBA 2EXEA 4N4SA 3LFFA 4L3JA 1JPAA 2R3HA 3UIMA 2ONLA 3ZSHA 4AW0A 2G2FA 3LJ1A 4JAJA 3RPYA 4EOPA 1XH8A 4Q2AA 3RCJA 3UNJA 1UU3A 4R77A 4C59A 4CLIA 2R3JA 5I9VA 2GNJA 2BHEA 4AQCA 4CT2A 3B2WA 2YM8A 4J97A 3IK3A 5A9UA 3NUAA 5CEQA 5A54A 4UZHA 4FOCA 2FSOX 4PTCA 3QTSA 4I22A 4FTTA 5EKNA 3Q9XA 5JZJA 2ZYBA 5HESA 2C3JA 2X4ZA 2OWBA 3EN4A 2QR7A 3RAHA 3TZ8A 4ENXA 3FLSA 1Q5KA 3RI1A 4OAUC 3G6GA 5HVJA 2ITZA 4DEHA 4WA9A 2PVMA 1YXXA 2REIA 5AUWA 3U9NA 4H1JA 3Q6UA 3HV3A 4M15A 1Z9XA 3DAEA 2PY3A 3F3VA 2IO6A 3FI4A 3BWJA 3ORIA 4L43A 5BVWA 1T46A 3D2KA 5I9YA 4DCAA 3NW6A 2HY81 4FYNA 4IVAA 3R8PA 4AA4A 2GHLA 3LMGA 5LVLA 2XA4A 5DR6A 5EQEA 2YWVA 2NNWB 4GRBA 4GT3A 3Q6WA 2WU6A 5KX8A 4U8ZA 5B2MA 3VRYA 4BICA 4RX9A 4ZAUA 3LAUA 4UV0A 5LWMA 4P90A 1FVVA 4E6QA 3DXQA 3FLNC 5IQCA 3QU0A 4ASEA 2OXYA 4EONA 1HOWA 1LEWA 2YCQA
chains in the Genus database with same CATH superfamily
5E4HA 4CV9A 3V5WA 3IW8A 2I1MA 2JDRA 4RFZA 3MTFA 4BDKA 5CTPA 1ZXEA 1OIQA 2OK1A 3Q4UA 5E8UA 3FQSA 3QA8A 2P0CA 4PL4A 4NYEA 4C4HA 5J5SA 4U44A 3WBLA 3L1SA 3Q9YA 2QOOA 4IWDA 3BEAA 3B8QA 4FE2A 1V0BA 4HZSA 2CKOA 3UVPA 4AWIA 3L8SA 2QOQA 3CCNA 4GH2A 4LV8A 1OL6A 1PXNA 4BTKA 4FOBA 2VNYA 5HQ0A 2GSFA 5CVGA 5IA3A 4BI2A 3GGFA 4Z7GA 1KE6A 4BGGA 4F6UA 3Q4TA 2QURA 1PF8A 3FHRA 1Y91A 3HA6A 4CKIA 1ZWSA 3FKNA 4AZTA 2BAJA 3KIOC 2VTOA 2YIYA 1MRUA 4F9AA 4BDBA 4IX3A 5AIKA 5D7VA 1CM8A 3MBLA 4MQ1A 4RX7A 3ZO3A 4CVAA 5DI1A 2F9GA 3PIXA 2XKFA 4ZY6A 2C5OA 4O0SA 3O17A 4B8MA 4WT6A 3OWPA 4M14A 5CF6A 5J9ZA 3MI9A 3PPJA 3GU4A 2WMQA 3IGGA 1WVXA 4L8MA 4F6SA 3NNWA 3RPRA 3QTQA 2XEYA 4LM5A 3TV7A 4TL0A 2W1FA 4I6QA 3VHEA 4AN2A 5BNJA 4MF0A 2Y0AA 3JYAA 4OTRA 3A7JA 4XP3A 2ZDUA 4AA5A 4JNWA 3QD2B 2JBPA 3SDJA 5HZNA 3QRJA 2V55A 3VW6A 5J79A 3H0YA 4FTKA 4E4MA 5IUHA 2WMRA 4YNEA 3ZC5A 2YDIA 3QZHA 4RC4A 3P7CA 4FV8A 4QTAA 4CLJA 4O83A 4FT9A 4FTUA 4GUEA 5KMNA 2DYLA 2QHNA 2W7XA 2XNPA 4KIKA 4J1RA 3QA0A 1UWHA 2HZNA 4WNMA 3EQPA 4NUSA 4XOZA 4ZP5A 3VF8A 4PRJA 2Y4IC 3R9DA 4AP7A 4D2RA 2UZVA 2HZ4A 4J99A 2EU9A 3AT3A 2A0CX 3M11A 2B52A 2HXLA 3PJ3A 4BBMA 5IA4A 2XYNA 4CZUA 4U42A 5M56A 2XB7A 1P2AA 2PSQA 2WNTA 3Q2JA 1KOBA 3FWQA 4KAOA 4FKJA 3PY1A 4FKOA 1JSVA 1OKYA 3PPZA 4NK9A 2FSTX 2VTPA 1NW1A 1YWVA 2IEWA 4KKHA 2JIVA 4MK0A 2J0IA 3GU7A 3E88A 3BL9A 2A2AA 4GUBA 4ACDA 5CZHA 2YWPA 4WIHA 5CF5A 2J90A 1ZAOA 2YFXA 3UOHA 1KWPA 4RJ6A 2HZ0A 1PYEA 4MAOA 4WBBB 3Q04A 2WQBA 4AW1A 4YLLA 5KBRA 4I24A 4YPDA 4B9DA 1RJBA 3QKLA 3W18A 4Y85A 2ONLC 2PK9A 4XG8A 4ZJIA 3FZTA 4G5JA 4DH5A 3DBDA 3VS4A 1PMEA 3R9OA 3NCGA 3A61A 3R7VA 3RPOA 4PQNA 4BWXA 3BV3A 5HX6A 2XKDA 2RFSA 3CBLA 3QZIA 3VF9A 3KRRA 3U6HA 4KUJA 4KD1A 5L3AA 4D4RA 1O6KA 2QO9A 3UZRA 4C36A 1ZARA 3MH0A 4U5JA 4XUFA 3QLGA 3CJFA 4MYGA 3NVKI 4CSVA 2CDZA 2BRMA 3N51A 3REPA 3BGZA 3C4EA 3EL7A 4G3EA 4ARKA 3HDMA 5H2UA 5HCZA 3WYYA 4EH5A 4ZSEA 4Q9SA 2WKMA 5DWRA 3A7HA 3LFNA 3SKCA 2I0VA 2PZYA 5AWMA 3RK5A 3SXFA 2LAVA 5CASA 4OAVB 1L8TA 5JGAA 3JPVA 1IR3A 2PMNX 2XH5A 4USDA 3TNIA 4O7TA 3HX4A 4CKJA 4LGDA 4BYJA 2ZV9A 4DFLA 4Z3VA 5C8NA 3UPXA 4IZYA 4IANA 2WOUA 5CSXA 4EKKA 4NT4A 2C1BA 3FL5A 4JR7A 4ZMFA 4FC0A 2HENA 2WQEA 4WBOA 5F20A 5H3QA 4BF2A 3L8VA 3NRMA 4BCIA 1DAWA 4HGTA 4QMQA 5M09A 3DS6A 4UEUA 3SXRA 4X2GA 3V5PA 3HLLA 4FTJA 4O81A 2UZLA 3E7OA 1YXVA 4IB0A 4C61A 3LJ2A 2PZRA 4LUEA 4IAFA 4IZAA 4QRCA 4R1YA 3TL8A 4FSUA 1AGWA 3QCXA 4RRVA 5EI6A 5JRQA 3BL7A 3PVBA 3TKUA 4UYNA 2VWZA 5IH5A 4PDOA 3RZBA 4IX4A 3C7QA 2FVDA 4KIQA 3ZDUA 3NUYA 4AXDA 3DZOA 3FLQA 1U54B 3CTHA 3PJCA 4R78A 3FZOA 4O4CA 2O64A 3MB6A 3VVHA 3TV6A 1ZYLA 4FV3A 1SMHA 4LV5A 2PMOX 3HKOA 4GFOA 4YJNA 4ZSGA 2JDVA 3OP5A 3WE8A 1PKGA 3WZUA 4PPCA 2BIKB 5FG8A 5L8LA 4DTBA 5T68A 4TRLA 2UW6A 2PUIA 2QOLA 3QLFA 3P23A 4RSSA 1JQHA 3S95A 2F7ZE 2P2HA 4NWMA 4JBQA 3PIZA 3QD0A 1WBSA 2F57A 5FBOA 2OGVA 4QP6A 4MXYA 5KO1A 4UMTA 3FEGA 5J9YA 3GQLA 2R7BA 1PXMA 4NM7A 4GG5A 4BCOA 4EC8A 2HWPA 4XHKB 3F5PA 2YCSA 5CNNA 4XRJA 4H3QA 2EB3A 5HCXA 1H01A 1XHAA 3H9OA 3MS9A 2VTJA 3THBA 1GOLA 2C1AA 3MH2A 4AGCA 4XP0A 3QXPA 4LUDA 2H6DA 3SVVA 2UZNA 4ZS4A 4W9XA 5AV3A 2BALA 4C37A 2JDOA 3FZSA 4JG7A 4LFIA 4EQMA 3OEFX 5KMJA 4HNIA 5AP4A 3VUTA 4ERWA 3FI2A 1JWHA 3NS9A 3ZLWA 1OMWA 4O1PA 4EYMA 3OCTA 1QPJA 2WMAA 2FSMX 4EHZA 1ZZ2A 1R39A 3KCFA 3R7EA 2CKPA 3NUPA 3IW4A 2GTMA 4EUUA 3UPZA 3F5XA 4FG7A 5J7BA 3MJ1A 2XKEA 4FSYA 3PXZA 5IEXA 2FSLX 4RT7A 4RIYA 5FRIA 3W55A 2OW3A 3FSKA 4JI9A 5DA3A 4C0TA 3O96A 2EXMA 2O3PA 5EFQA 2YZAA 5TKDA 3EN9A 2IVTA 5GIOE 5LQFA 3CGOA 2WQNA 2X6DA 3KL8A 4G6OA 5EI8A 5IUIA 4RFYA 1LR4A 2PUNA 5J8IA 3UTOA 1G8KA 2XANA 4F64A 4DDGA 3QALE 4JDJA 3H4JA 4FNYA 4IX6A 4O2ZA 3GCSA 4ALUA 1SM2A 3T3VA 4MQ2A 3DV3A 2J0MB 4GVJA 4OUCA 4KIPA 4LRJA 3RM6A 5H9BA 5A46A 3W16A 4E4XA 2CNVA 1CKIA 4RFMA 4S2ZA 4FEQA 4TKSA 3GOKA 1H1QA 3GEQA 5B2KA 4JG6A 2AUHA 2PUPA 4MTAA 1IEPA 4FTOA 4IVCA 5I3RA 4PL5A 4QP1A 1F0QA 3R00A 3PFYA 3VS7A 3PRIA 4EHVA 5DMZA 1DAYA 3SV0A 3BRBA 1PRYA 2VX3A 5EW9A 2I0YA 1PMVA 2OSCA 3LOKA 4MD9E 2IVVA 3UO5A 4RVKA 3FKLA 1Q8YA 3QCSA 4XV1A 2WU7A 5AX3A 5CQUA 5L2QA 3SRVB 3TUCA 3LM0A 4QYHA 3UIXA 2ZVAA 1Q41A 4FKLA 3R1QA 2XIXA 2P2IA 4ZEGA 1OBGA 3VO3A 3IDPA 3ZLSA 4BTJA 5DG5A 2XK9A 1Y6AA 2CLQA 3EIDA 3DKFA 2GPHA 4ACHA 3DAKA 3UIBA 3WIKA 3JY0A 4A4LA 3ODYX 4I4FA 2FYSA 1Q24A 4W4YA 2BKZA 4HNFA 1FBNA 2JDTA 3T3UA 2OF4A 4AOTA 4JLCA 5HE3A 4D5KA 5CU3A 4EH8A 4Y83A 3LFCA 3GUBA 5HIBA 5C4LA 3GC9A 2C47A 4D2PA 3UGCA 3EFLA 4ZSAA 5M4CA 3HRFA 3FYJX 5AV4A 2HCKA 3V51A 4U9AA 2NP8A 3O5AA 4ZSJA 4QEBA 3OOMA 4Q9ZA 4ZLZA 2E9VA 3UP7A 1J91A 4IM0A 2YACA 5CSWA 1YHWA 2JKQA 2B9IA 3NVMB 3C51A 2GQGA 4V0GA 4DFYA 1HCKA 4DGOA 5M4FA 2OXDA 4YC3A 5CNOA 5CWZA 2XJ2A 3V8WA 4AUAA 4EORA 2CKQA 5B0XA 4Y5HA 3KA0A 4GL9A 4QMOA 1CMKE 5HNBA 3FQHA 3QHRA 5C8MA 3FAAA 4GW8A 2W0JA 1RE8A 4AZEA 4FNXA 4I5HA 2Y4PA 4BTFA 1UWJA 4ITJA 5H8EA 3DBQA 5HIEA 1CSNA 2C68A 4FTLA 4GU6A 3TT0A 3K2LA 4UBAA 4CCBA 4XP2A 4CFXA 2ITTA 3DGKA 3ELJA 5CYIA 4BBFA 3DOGA 3AD4A 3PFQA 4QMTA 5HKMA 2HIWA 4I3ZA 4CFFA 2VO6A 3RVGA 4HYUA 4C3RA 3E93A 3MA6A 4DFXE 4GCJA 2W4JA 5JGDA 3UDSA 5DPVA 5C01A 3VIDA 4DDIA 2WHBA 2XRUA 4U81A 4RZVA 3QC9A 3EQRA 4TTHB 4H39A 2F2CB 3I5ZA 1UKHA 3OUKA 2ZJWA 3ITZA 2W06A 3LJ0A 2XRWA 4RVMA 4L42A 1SVHA 2Q0BA 3S00A 3NAXA 4DBNA 3WF7A 2CNQA 1FGKA 2PZIA 5E92A 1OITA 2BILB 1KV1A 5BYYA 5J87A 4XV2A 1JNKA 3PA3A 4BZDA 5M44A 3BPRA 3FJQE 1CDKA 3ULZA 4ZZOA 4UMRA 1XBAA 3F82A 2R64A 3QTZA 4AXAA 5IQEA 1PMNA 3LFSA 3PZHA 5HBHA 3SGCA 4QQCA 2OFVA 1REJA 4QMMA 2CNUA 1WVYA 5C27A 2QNJA 4G2FA 1RQQA 1VJYA 4EL9A 3QTRA 3W0SA 5FEQA 3V8TA 4DG3E 2R3LA 3VHKA 4U97A 3R8LA 3PXFA 5DT0A 1Z5MA 4QPMA 3RBWA 4HGLA 4A06A 4ANLA 5ANDA 4AW5A 5EM7A 3Q4CA 3VS5A 1IASA 4OTQA 4IE9A 3CY2A 1XMMA 4YJVA 3F3WA 2PE0A 5FP5A 2GTNA 2XK6A 1MQ4A 5I9WA 5D10A 3TG1A 4FEUA 5AFVA 3W0NA 2X1NA 4DTKA 2UW7A 3E63A 4F0IA 5HORA 4IM2A 3OXZA 3VQHA 3VS0A 4P5QA 2GU8A 3SX9A 4AZWA 1H0VA 3DPKA 4L7FA 3UIUA 3WIGA 2C0OA 4I6FA 2XK7A 1OIRA 1SZMA 4AW2A 4BRXA 3R71A 4QQ5A 4NTSA 5ETFA 5I9ZA 3FPMA 4B0GA 3NLBA 2IG7A 3QD4A 1U59A 3UJGA 4AOIA 4I93A 5HO6A 5EQYA 2G01A 1OIYA 5HVKA 1WVWA 1PY5A 1QCFA 4U79A 2OFUA 3KK9A 4F7NA 2ITPA 1R1WA 4FZDB 4IJPA 4I5PA 5FDXA 2QD9A 4FVQA 3FY2A 4IZ5A 3BI6A 3QRTA 4G1WA 2PZ5A 3QX2A 5DGZA 4O7ZA 4BHZA 4I21A 4UYAA 1I44A 2V5QA 3OW4A 5C1QB 1U46A 2OG8A 3D7ZA 3EKKA 4CFMA 1XR1A 3KEXA 3LFQA 3OMVA 4GK3A 2WFYA 3T9IA 3EQDA 3UYSA 5JQ8A 4ZK5A 3HEGA 4L67A 5C03A 4D4YA 3ZLYA 4G16A 4F0GA 4FJVA 4FSRA 1Q3DA 3PA5A 1MP8A 2G1TA 2BAKA 3O51A 3WF9A 3RK7A 5LVMA 5K4IA 2XBJA 3E8NA 3SC1A 4O4BB 5H8GA 3E8EA 2GCDA 4PY1A 3MSSA 3PVGA 3RAWA 5BVDA 3R9HA 1YWNA 2W5AA 4RWIA 4PMSA 3UE4A 1KUTA 3O7LD 3EQBA 2IZSA 5T6KA 2XNGA 1J1CA 4UALA 5EH0A 3R1NA 2HELA 5JQ5A 2VWIA 3CSVA 1GZKA 3F69A 3QCQA 4ITHA 3AC4A 4L46A 3AMAA 1VR2A 4RIWB 5IKWA 2YDKA 4TYHA 3AD5A 5A6OA 1W7HA 2VWVA 5CF8A 4O0UA 5LVOA 3VUIA 3GVUA 2HK5A 2HY0A 3BE2A 5KE0A 2BIYA 4CFNA 4JT3A 1H8FA 2UUEA 1YXSA 4TNDA 2E9UA 3FMLA 4C62A 2OH4A 5FM2A 3A7GA 5HG7A 4X2JA 1ZOEA 3BWFA 5I4NA 2PL0A 5CT7A 4DGNA 5IH4A 3MH3A 5HLWA 3NWWA 5EYCA 4MXAA 4ZMEA 5L6PA 2BHHA 2RSVA 4IEBA 2X2MA 4JOAA 3MJ2A 2YISA 4M66A 4RX5A 3F6XA 4JQ7A 4ZTSA 5M55A 2WIHA 1OL7A 3MFSA 3ZMMA 3DDPA 3EMGA 3FMMA 5IQIA 5IDPA 3ID6C 3D5XA 3ACJA 1OM1A 1JKKA 4KABA 4DH1A 1BL7A 2VGPA 4FV7A 2XNOA 3CD3A 2XYUA 3FL4A 4TYIA 3ZFMA 5CENA 2VO7A 2ZV2A 4K8AA 1VZOA 2C5NA 2G2IA 5IQHA 4NKSA 4XLVA 2B0QA 1O6YA 3AT4A 4C8BA 4N70A 3TUDA 4L3PA 3F2RA 3BHUA 1Q8WA 3ZRLA 3UVQA 1E1VA 2CMWA 2XIRA 3UQGA 3DJ5A 1W2FA 4J53A 4FTNA 3C50A 3KVWA 4EZ5A 4ZLOA 3TNHA 2PVFA 3C4XA 2IW9A 2X2LA 2YM5A 3NIZA 3N9XA 5E8XA 3C0IA 1YHSA 2ZDTA 3GB2A 4IAIA 5KKRC 3MVMA 2QKRA 3HGKA 2OF2A 3LLAA 3EYGA 4IQ6A 3EFWA 1U5RA 2X2KA 3QGWA 2PE1A 4TXCA 3KXMA 3ML1A 4G5PA 2YN8A 2PWLA 3IECA 3KMWA 3VWAA 4Z16A 5KMLA 3K5VA 2JKOA 4GVAA 4FIHA 4KRDA 4TW9A 3VC4A 2W05A 4BIEA 4PNKA 3M42A 3WF8A 3RTPA 3LCSA 5AV0A 4BC6A 2B53A 4V05A 5M4UA 4XYFA 4BJJB 3QQGA 3GC0A 2B54A 4E20A 4B8LA 2QONA 5DIAA 3IPHA 1OPJA 4PUZA 5BPYA 4FGBA 1O9UA 4FT7A 5D41A 5A4EA 5HBJA 5AADA 1YRPA 4CFWA 5GJDA 4F7JA 3RALA 4IWPA 4QDEA 3IOPA 4FV6A 4FL2A 3R02A 5EW3A 5HIDA 3LE6A 3E87A 5GNKA 5AP1A 4IAZA 3U51A 5L2SA 4IH8A 2QOBA 2HAKA 3BQCA 3FMNA 3UODA 1PW2A 1Q8TA 4OBPA 4DE4A 5EK7A 4C2VA 3ZO1A 2QHMA 5EDPA 4DH3A 2ZAZA 4GJ2A 1FVTA 1U54A 3R8MA 3VS6A 3UC3A 2YERA 5JMSA 3UQFA 2PPQA 3BU5A 2UZTA 2R3IA 3D5UA 3OG7A 4OTDA 3AC8A 5LMKA 4CTCA 2WD1A 5BUJA 2OJIA 4HOKA 4FSWA 3CY3A 1CKJA 2CGWA 2QR8A 5GZ8A 1SNXA 4Y95A 3ET7A 5AJQA 4YZMA 4D1XA 2F2UA 5JZNA 3LXPA 3WARA 4ZY5A 3A8WA 5FTGA 3HMIA 4F1MA 4WUAA 4ID7A 2VO3A 4E73A 4NH1A 4LOPA 2NYAA 3VULA 4MKCA 5KZIA 1MRYA 3FSFA 4E26A 3FMDA 4O91A 4ZTQA 4IIRA 4BKZA 1UKIA 5M51A 1YVJA 4A4OA 4QMWA 2HYYA 1PXKA 1SYKA 3CQEA 3ZH8A 4M97A 2OJGA 4AU8A 4D9UA 2GNLA 3DXPA 3NAYA 3QYWA 3VN9A 3S3IA 2VWXA 3TACA 4D2VA 4FEWA 5IEYA 5EYKA 5HI2A 4JBVA 4BDIA 3HVCA 4OR5A 4QYYA 3E92A 4A9RA 5A3XA 2ZB0A 4NM5A 2OIDA 4D28A 5KNJA 3LCOA 2B1PA 2J0KA 2NRUA 2VX0A 3C9WA 4TWNA 3O0GA 4ZTLA 2C6LA 4YURA 2BCJA 1JAMA 3W2SA 2QO2A 2J0JA 3DKCA 3IDCA 2OO8X 3PG3A 3QTIA 4YZCA 4LGGA 3VUDA 3HV7A 2OXXA 4NJ3A 5AP5A 3ROYA 3VBYA 3Q5IA 3TNWA 2R3RA 4RJ7A 3Q53A 3EB0A 3NMUF 1YOJA 1ZYJA 1OUYA 4U45A 4QNAA 4X3FB 3KVXA 5DT4A 1YDRE 3AGMA 1M14A 2BROA 3OY3A 4UXLA 3W2OA 3ZUVA 4ANSA 4D4VA 4FA2A 2IVSA 4YBJA 4YHFA 1T45A 2ETRA 5K0KA 2AQXA 2HWOA 3DA6A 5CU2A 3PUFC 2PVNA 1OL5A 3HNGA 4QP2A 3ZSGA 4GIIA 4MVFA 1ZMVA 5ANJA 1TZDA 2CCIA 4AXEA 5AP2A 4CQEA 4E5AX 3VW8A 4BDEA 2OJFE 3IGOA 2VTTA 4ITIA 4JG8A 1ZY5A 4IAKA 4FBXA 3FKOA 3QGYA 3KU2A 2ITYA 2XAMA 3WILA 4FKRA 3BYOA 1OIUA 4ZXTA 4AX8A 5HTIA 4YO6A 3G0FA 4V01A 4OW8A 4Y46A 1U5QA 3T8OA 3VBXA 5JK3A 1ZMUA 4WSYA 1KE7A 1P4OA 3EH9A 2VTNA 4J7BA 3ZEWA 2AC5A 2X0OA 2R0IA 4EK4A 4EOSA 5DYJA 1Q97A 4AXFA 2XP2A 4FIJA 3BHTA 2B9FA 4A9YA 4BWKA 4FIIA 4OBOA 2XEZA 3D2IA 4TWOA 3EOCA 4USEA 2YJSA 4O0TA 2FUMA 2Z7QA 3NX8A 2VX1A 2FB8A 2VTIA 4DHZA 3OS3A 4CT1A 4EKLA 5AEPA 4MXXA 5HLNA 4YTHA 1BLXA 4O4FA 4WG3A 4MNEB 5FP6A 3GT8A 4LL0A 5AUVA 4GYIA 5IUGA 2F7XE 1XBBA 2J2IB 2C3KA 5FM3A 4XG2A 2QOIA 3B8RA 4U80A 1Q8UA 2OU7A 5I5ZA 1H0WA 3QAME 4II5A 5AA8A 3P9JA 3QTXA 4HGSA 3PP0A 4CZTA 4C02A 3C4FA 5I9UA 4H58A 4O4DA 3KXXA 4QP8A 5EYDA 3RPSA 5JKGA 4GT5A 3UVRA 1OPKA 2Z60A 2W9ZB 3ZTXA 3FHIA 1WMKA 3I0OA 3EL8A 4FTQA 4I4EA 4PNIA 3TZ7A 1BKXA 3PUPA 3W2CA 3ZZWA 4EHEA 4WG4A 4EK8A 2ITOA 4IAYA 1EH4A 3CKXA 3ACKA 3Q9ZA 4GFGA 4G3GA 5DEWA 3LPBA 3O2MA 2YEXA 4GYGA 3HAMA 3R2BA 5AUZA 1ND4A 4MXZA 2R0UA 3MV5A 4QQTA 1DM2A 2UW3A 3E8CA 3NDMA 5E8YA 4BCFA 4OLIA 2NO3A 3PLSA 3W0OA 1APME 1XQZA 4L6QA 2YIQA 4RMZA 5L2WA 4H3PA 2YJRA 2Y9QA 2WMVA 4JBOA 1BI8A 3G9NA 2XCHA 3NYOA 4XV9A 3UC4A 3HAVA 1B38A 2ZB1A 1PJKA 4NKAA 3ZBFA 1XH4A 3UMWA 4RWKA 2GFCA 3W2PA 4ALWA 4D4SA 3FC2A 1YHVA 3DJ6A 4G6LA 5AAEA 4ZTHA 3ZYAA 1K2PA 5HD7A 5LMKC 4L45A 3TV4A 3WZEA 4FV9A 3ENMA 3U87A 4MHAA 3QF9A 3EWHA 5AIRA 5J7HA 3GCPA 4Y8DA 4EH4A 3C4WA 2OJ9A 1LPUA 2O2UA 4LGHA 2RL5A 4DT9A 3D5VA 4J96A 4FYOA 2YM3A 5HTBA 2QO7A 1OB3A 4L3LA 3AMYA 4O84A 4JX3A 4M69A 4F0FA 2ESMA 4CRLA 2GQSA 3ZLXA 3OD6X 4JQEA 1Y6BA 2W4KA 5K3YA 1JOWB 3QKKA 3QFVA 4FL1A 5DR2A 5LARA 1BYGA 1H25A 1GNGA 4IW0A 3GENA 3EN6A 4BDGA 3W1FA 2PVLA 4LRKA 5TF9A 3IW6A 5CS6A 2PTKA 5ACKA 3HMPA 5HHWA 5JH6A 3LHJA 4EHGA 5BV3A 4FV1A 2YCFA 3K54A 4FV5A 2QOFA 4BCGA 3F7ZA 3ZCLA 3CD8A 3RZFA 4ALVA 5GJFA 4EQUA 3QRIA 4GK2A 1IAJA 2R3QA 3DTCA 3CP9A 5J1VA 4IB1A 4FV0A 3N4TA 4JS8A 2W1DA 2QOHA 4ZTMA 3TTIA 4EH3A 5ETIA 3FMHA 5J1WA 1VEBA 2GFSA 4U0IA 2XNBA 3P7AA 2XKCA 3ZRMA 5HGIA 1YQJA 3CLYA 4CMUA 2ZMCA 4D55A 4QTEA 4D1SA 3POOA 2ITUA 5DT3A 3PE1A 4OTPA 4RJ3A 2BRNA 3JS2A 4ZTRA 1Q99A 3SW7A 1GZNA 2XS0A 2DUVA 3PYYA 4O38A 4A4XA 2UZBA 2X0GA 4BCHA 2IW8A 2W1IA 4CFUA 3PTGA 3EFKA 2C6OA 3OXTA 1QPDA 3PWYA 3GQIA 1OL1A 4ZIMA 3FI8A 2C30A 3FMJA 3PVUA 2I6LA 4FNZA 4EYJA 5ANEA 4QP3A 4YR8A 2PVKA 1J7UA 1JSTA 3DNEA 5JFWA 4O7NA 2WXVA 2BZHB 3KRWA 4IC7A 4EUTA 1IRKA 4IAAA 1F3MC 2UW8A 4N0SA 3A8XA 4OGRA 1NVRA 1GJOA 5A14A 1TQMA 2QODA 3EZRA 4JL9A 4QMUA 5EM8A 3HMNA 3R21A 4G3CA 4A9SA 5TE0A 5AR8A 4RIXA 3HECA 4HVHA 4DTAA 1HCLA 2OKRA 3GC7A 5AV2A 5ACBC 2BRGA 4E7WA 3PLAE 2J5FA 4DBXA 3GCVA 4UZDA 3W8QA 5CEIA 5LVNA 4I94A 1FQ1B 3KULB 3NUXA 2YCRA 3OZ6A 5AV1A 5BUIA 3CGFA 3W8LA 2XIKA 5CXHA 4OTGA 1JSUA 4B7TA 4KIOA 4IDTA 3PVWA 2GNGA 1RDQE 3OBGA 2XNNA 3ZDIA 4N57A 2IWIA 3UNKA 2HW7A 4MWHA 5AP7A 4JR3A 4W4XA 1M7QA 3V5QA 3C1XA 4WO5A 1GIHA 1M7NA 4TWCA 2RKUA 1UV5A 2VU3A 4O22A 4JDKA 4YJSA 4BZNA 1R0PA 1M2PA 3I7CA 4DAWA 5DBXA 4N6ZA 4DCEA 2RG6A 5IA1A 2H9VA 1LEZA 2PVRA 1F5QA 4PP9A 3OROA 5FTQA 4CYIA 4NZWB 5GJGA 3ANRA 5BYZA 4C34A 1V1KA 5IQBA 2GS2A 3Q52A 1NT2A 3MTLA 4KBKA 2ITVA 2VNWA 4YLJA 5DLSA 4R3PA 1GAGA 4EBWA 4WD5A 3R1SA 4A9UA 5A4TA 4YJQA 4BDDA 2VWYA 2VGOA 1URCA 4M68A 4QMVA 5T3QA 3T9TA 4RWJA 4UY9A 4HVDA 4CKRA 4AGUA 1YOMA 3D94A 3KXZA 2C5YA 4YUQA 5FQDC 3RKBA 3RGFA 5CVHA 4O6EA 4RQKA 4XBUA 1OL2A 2WTJA 2WELA 4RIWA 4Y72A 3Q3BA 3GU5A 4EOIA 5A4QA 5IZFA 2UVXA 3ZHPC 4PP7A 3Q60A 3KCKA 2LGCA 4IADA 3V04A 4IB5A 4PMTA 2BDFA 3ENHA 5AMNA 4L9IA 5EM5A 4ACCA 5HCYA 3QL8A 5C8KA 4U3YA 1BMKA 3FMEA 4FZAB 4ZS0A 2EXCX 3ZBXA 2BKKA 3KREA 1ZLTA 4RVLA 3U8WA 3MESA 3C5UA 4A7CA 2XVDA 3CQUA 3QQKA 4K33A 3E3PA 5CY3A 4UMPA 3R8UA 3VJOA 4CTBA 2FGIA 4FG9A 5CXZA 3POZA 5IA5A 4O0RA 2JDSA 1JLUE 2BDWA 3MGYA 2XF0A 3RNYA 3RM7A 4X0MA 2GNHA 2JFMA 5BMMA 4FF8A 2W1GA 3LCTA 4DHIB 1CTPE 4RC3A 4MD7E 5AUXA 3ZUUA 3I60A 2QLQA 4KIKB 1TQIA 4KS7A 4HGEA 4RA4A 3R0TA 3F2NA 3KY2A 1A06A 4E5BA 5EOLA 3ALOA 4F63A 1R0EA 4TZRA 4YPSA 4FKSA 3ZM9A 4ZY4A 4X7QA 4FKVA 3HZTA 1ZYCA 2W9FB 2WEVA 1P4FA 3K5UA 2QVSE 4DFZE 2Z02A 3QKMA 4EWQA 4NIFB 3BZ3A 3Q9WA 4JX7A 3F5GA 4K18A 2C6IA 3G6HA 5G1XA 4XS2A 4ASZA 1Q62A 1NXKA 2ETMA 2YIWA 4RIOA 4DEGA 3DU8A 4O86A 3CTQA 2IW6A 1FOTA 5BYLA 3ORXA 5HICA 2ZMDA 4U3ZA 1V0PA 4F4PA 1B6CB 3NW7A 4QD6A 5CAUA 3LKMA