4IZAA

Structure of dually phosphorylated erk2 bound to the pea-15 death effector domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
348
structure length
346
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLEVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Structure of ERK2 bound to PEA-15 reveals a mechanism for rapid release of activated MAPK.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 346
sequence length 348
chains with identical sequence C
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4izaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4izaA01
3CD3A 1GIJA 2J90A 4G9CA 4GW8A 2UVZA 3E87A 5HIBA 4W4VA 2ESMA 1P4OA 3R04A 4TW9A 2WGJA 3HEGA 3GVUA 2ZV2A 3VBTA 1QCFA 5AA8A 4IC7A 3TM0A 2ZMDA 1PY5A 4OTIA 5AIRA 4NEUA 3UP2A 4KIQA 4QQCA 3NYNA 3QA0A 3FI2A 5JFXA 3HDMA 5KMLA 4W8EA 3L8VA 5AV1A 4KD1A 2WTCA 3F7ZA 3KQ7A 1KV2A 1H0WA 4EH3A 5AP2A 5HTCA 4JX7A 2YCFA 4ZSAA 4BF2A 2Q83A 4BZNA 2HXLA 5AP0A 2OF4A 3R8PA 3LLTA 4O7SA 2ITNA 4FTNA 1JOWB 2OIDA 5E8XA 3TJCA 3SGCA 1TQIA 2VGPA 2P2IA 3DJ5A 3PPJA 1BKXA 5BMMA 5HE1A 3PLSA 1QPDA 3V8WA 2ZOQA 3C5UA 4FKSA 4EK6A 4O0UA 2OFVA 4DG3E 4FMQA 4W9XA 1OZ1A 4CFVA 4CMTA 4TRLA 4FIJA 1DAWA 5L8JA 4QMMA 1SNUA 4EOMA 2OH0E 4V0GB 3BYOA 4IWPA 4WNPA 4F64A 3SXRA 3UQCA 5AIKA 4QMPA 3CPCA 3F7WA 4R3CA 4BCKA 5HNIX 2YM3A 2CNVA 3JXWA 4K1BA 4MVFA 5CYIA 4IWQA 1DS5A 4WSQA 3ZBFA 3ZS5A 5DEYA 2VAGA 3NLBA 2RFNA 5AAGA 3IPHA 1YOLA 4RC2A 4J97A 1OI9A 3Q4ZA 4QYHA 4ZSGA 3AT4A 2EB3A 2W4KA 3LXNA 4QP6A 4D2TA 2QKRA 2PE0A 3QTWA 4L01A 4FTIA 2J0JA 2GMXA 2WAJA 3E8DA 3RJCA 2CGVA 4ID7A 3RHKA 4QP2A 3QHRA 4XRJA 4EYMA 2GHGA 2GNJA 3MYGA 4BDBA 4EQUA 4DTAA 5AV2A 1IRKA 3MJ1A 3H10A 4L8MA 2H6DA 2VWYA 3CTQA 1W0XC 5CT7A 1H4LA 3AC5A 3D2KA 2XNBA 5L8LA 4M13A 5ANEA 3V5LA 1OL2A 4XP0A 3QYWA 5EW9A 1JSTA 3R7IA 4QRCA 2FH9A 2JEDA 4GFGA 4DC2A 4YO4A 3SW7A 2ZB1A 4ZJJA 2NNWB 5A4EA 3G6HA 4YR8A 2FGIA 4JLCA 4XRLA 3OWPA 2X7OA 3SD0A 4EORA 3BPRA 4S34A 4C3PA 2W1FA 4H1MA 3DBDA 3DKCA 3RKBA 3R00A 5CY3A 3RM7A 5KUPA 2GS7A 2Y8OA 3NCGA 4FL2A 5L2IA 2REIA 3M2WA 4CKJA 3KCKA 4QP9A 4AW1A 3DK6A 4GIHA 4X2NA 5HORA 3BYUA 4A9RA 4BCJA 1BLXA 3DBCA 3ZBXA 4BI0A 4YJSA 3BE9A 4EOQA 4XX9A 3UPZA 3WE4A 3C5IA 4ASXA 1K2PA 5BVWA 4FIGA 4RC4A 5AR7A 1APME 5AP5A 1SZMA 3ORTA 4LGGA 4YTCA 4IZ7A 2XNMA 4FT7A 4IM2A 5AEPA 4QD6A 3TG1A 4MNEB 1G8SA 4MNFA 4KSQA 1FPUA 3NNVA 3E62A 4DYMA 3BV2A 3LMGA 4RRVA 3DT1A 4UN0C 5CASA 5JQ5A 5DR2A 4A9YA 2J9MA 2V5QA 5HBEA 3NYVA 4M0ZA 2PVFA 4XMOA 4IAIA 3UIUA 4GK2A 3K2LA 3GU4A 4YNOA 4TYGA 4BDIA 4DG2E 3BEAA 3VUHA 5G1XA 5I9VA 2O63A 3R1NA 2PMLX 3CD8A 1SYKA 4X3JA 3MB6A 3UBDA 1ZYJA 4BCHA 2QOCA 4BGGA 4WIHA 3ZZWA 1IASA 2PU8A 5FXSA 5IQEA 3CQWA 4WNOA 4DH1A 1XBBA 1GNGA 1M7NA 2QNJA 3ZLWA 1PW2A 2ZVAA 3PXQA 5AR5A 4C61A 3A7IA 3I7CA 4XEYA 5HBHA 3RZBA 3EKKA 2PUPA 4CFXA 2C3LA 4ZEGA 3N9XA 2XS0A 2GPHA 3A62A 2G2FA 5EK7A 5K0KA 3P1AA 4ANLA 4DGLC 4FSMA 5CXZA 1XH8A 1YXTA 2O3PA 3AT2A 3NAYA 2IW8A 4DGGA 4UWYA 2I7QA 3DBEA 3JVSA 3HA6A 3W8LA 3KK8A 3R8LA 4U9AA 3DXPA 5IQIA 3QZGA 2R3PA 5HKMA 3SXSA 3VS2A 4AZSA 4C7TA 2OIQA 3F5XA 1T45A 3WARA 5L2TA 5J1WA 4YJNA 3OT3A 3VJNA 3VUTA 1CDKA 2V62A 3EIDA 2J5EA 4M8TA 1Q62A 4OBOA 5CLPA 3E92A 5HO7A 4EZ7A 4S2ZA 3OWLA 2YITA 5AX9A 4ASEA 4EZ3A 3OD6X 5IMXA 3VS6A 4R78A 2FA2A 4QTBA 5BVEA 4QMQA 3UOHA 2IZRA 2QI8A 4XP3A 3L9PA 5FDPA 2BAJA 4NWMA 4FZFB 1KE9A 4DFNA 5B2LA 4J8NA 3MI9A 4RIYA 4E6DA 4HPUE 4HVDA 4GT3A 5IQGA 4PL5A 3DKOA 3VBYA 1ZMUA 2OXYA 5CEOA 4G3FA 5LARA 1UU7A 1H1QA 2CCHA 3KL8A 2V22A 4Z7HA 2F57A 3QRJA 3NZ0A 4JDHA 2WEVA 2WMVA 2GS6A 4O0YA 3JY9A 5AP6A 3ROYA 5GIPE 3VF9A 1U59A 5HICA 2ERKA 1Y6AA 1JAMA 4OLIA 4EOSA 4GK3A 3MN3A 4GT4A 4CNHA 5E7RA 3QZIA 2B55A 3UVPA 1H1WA 2XEYA 3AC8A 4LUDA 2C4GA 5DLSA 2B7AA 5DN3A 2HWOA 2JKOA 4CFFA 2OZAB 4GEOA 3JY0A 4QMTA 2JGZA 4DFBA 3FMJA 3B2WA 4J52A 1YRPA 2CNQA 5CAUA 2A19B 1Q97A 2JFMA 3R7UA 3LCOA 4BDDA 4E26A 3ZUTA 3E63A 4R7IA 3KN5A 1J7IA 2XM9A 2QOOA 3B8RA 3E7OA 3TIYA 3SX9A 3ZRMA 4BDHA 2W99B 1FINA 2OK1A 2ZMCA 3E88A 1Z5MA 4NFNA 4OTQA 2GHLA 4QTAA 4DEHA 5J9ZA 4Y5HA 2GFCA 4GKHA 4CG9A 3PIZA 5GJFA 5GNKA 2B9JA 4DH7A 2WTKB 3CJFA 3OW3A 5JZNA 1Q24A 4RX5A 3HV3A 4TKSA 3P7AA 4QOXA 4RMZA 5TOZA 3VQUA 3Q53A 2W1CA 5L3AA 4AW5A 5JRQA 4I24A 4HYHA 1PMUA 5HE2A 3GC8A 4JS8A 3PJ8A 4AGCA 5C4KA 5KCVA 3U9CA 5FXRA 3DQXA 4YC3A 3FLNC 2VWXA 4AACA 4MX9A 3ERKA 1Q99A 3GUBA 3PXZA 2PVNA 4AN2A 2OXXA 4AW2A 2B9HA 2VTLA 5AAFA 5M56A 3IOKA 4P7EA 2PULA 1SVHA 1WCCA 2Z7SA 1YHSA 3LJ2A 4MK0A 4O21A 4QMVA 4UB7A 4LUEA 4CCUA 4XCUA 4TWNA 3UVQA 3DU8A 2OU7A 4FOCA 3D5WA 4I6QA 3W16A 1MQ4A 3FJQE 3KN6A 5HLWA 4CV8A 3LW0A 2VTOA 2F7EE 3RK5A 4HCUA 5CU4A 4II5A 3H4JA 3MVJA 4M3QA 5DPVA 2O8YA 2RIOA 2XNNA 3IW4A 5TT7A 3SA0A 4G16A 2AC5A 2B4SB 4IWDA 3I0QA 4TL0A 3V01A 4N0SA 2XMYA 3Q5IA 2BHHA 4YJTA 2WU6A 1OITA 2GS2A 1H0VA 3GCUA 3F61A 5DR6A 1ZXEA 4GYIA 4FT3A 5E90A 3BHVA 3LLAA 4F9CA 3HYHA 5AP3A 3AC1A 2GQGA 4HJOA 5H2UA 4FSYA 3FMDA 4ACCA 1Q61A 5D1JA 4HZRA 5IQBA 4NJDA 4YJPA 3ENHA 2XIZA 3ORKA 4DGOA 4FV8A 4HVGA 4RWIA 4TYEA 2JDRA 3Q2JA 3G90X 3GC0A 1BX6A 2W1HA 4QQTA 4NCTC 3VS7A 3MH2A 4FGBA 2ZM3A 3BYSA 3VUGA 4D4VA 3ORNA 4XG8A 2I0VA 3BX5A 5ETIA 2C30A 3DCVA 3ETAA 4BCGA 2PYWA 3VS3A 2WTJA 3O2MA 4RX9A 4WKQA 2XIRA 4FKUA 5D12A 3U4WA 5ANDA 5HQ0A 2A2AA 5FM2A 4EOOA 2UZEA 2H96A 4GS6A 1UNHA 1JKTA 3FE3A 3G0EA 3TV4A 2OJGA 3O7LB 2WD1A 5EKNA 2J50A 3IW7A 4L9IA 4L7SA 4O1PA 4YBJA 3PJ2A 3TNIA 3QRTA 5BNJA 4TPTA 4H3PA 2YM5A 3C4FA 3KRXA 4IMYA 4F0IA 4TWCA 1URCA 1UV5A 2GNHA 2IZSA 3VN9A 1A9UA 4KKEA 2HW7A 4S33A 3KREA 3TKIA 2Y4IB 2BRNA 4M84A 4C38A 4R3RA 5E8UA 2W1EA 3PE1A 4XBUA 3P0MA 2E2BA 3R63A 3LPBA 4K11A 1OGUA 1QPEA 2OI4X 4IQ6A 3W2PA 2DS1A 4EUTA 3BQCA 4JIAA 3P9JA 4EEVA 3I79A 4LI5A 3F2RA 2WMBA 3KFAA 4FTRA 5CAQA 4MWIA 4QTCA 4FV6A 4N6YA 4IZAA 4O91A 4B99A 5CF5A 1NXKA 3H3CA 4YJOA 3UVRA 5C8KA 3IG7A 4FEQA 5HIEA 3KXNA 2XNGA 4DH5A 4EUUA 3QQFA 4C3FA 3COIA 4C4EA 4DCAA 4L00A 4B9DA 1OBDA 4EOKA 3DXQA 3S00A 1YDRE 4DCEA 3ROCA 4F9WA 5BQ0A 3PLAE 3O51A 4J96A 3VAPA 4NCTA 4KINA 1H28A 2J2IB 4MD9E 4A7CA 2O64A 4BIEA 1PYXA 3QXPA 4FVRA 2UV2A 4RJ8A 3ZXZA 2P3GX 5K3YA 3VHEA 3W2QA 4O7LA 4C57A 3F2AA 3F5GA 3MTLA 4XG4A 4AXAA 3QD4A 3R7EA 4CMOA 4D5KA 4BIBA 1QPJA 3CKXA 2X81A 4BI1A 4UWCA 3EHAA 4PMTA 4GYGA 4FTMA 2OZOA 2Y4PA 1E1VA 2F9GA 4G3GA 3ZLXA 1J91A 4UXQA 3RWQA 3DJ7A 2QOKA 3BU3A 3UIBA 1NW1A 1ZYLA 2W1ZA 3S2PA 1ERKA 4L7FA 4O2PA 3QKMA 4BDKA 4QYYA 2UZTA 5EM5A 5ICPA 3MPTA 5C8MA 3AD4A 5GINE 4UZDA 4D28A 4F9AA 1LEWA 4RIOA 4ZZOA 4K2RA 4EJNA 1ZWSA 3FPQA 4IC8A 4CG8A 3R8ZA 4U3YA 3RNIA 5IUHA 3EQFA 5ACKA 2X7GA 5D11A 2BVAA 3RINA 2GSFA 3E64A 4IAFA 5HU9A 2C3JA 3BHYA 3ORIA 2DWBA 4PPAA 2XK9A 2PE2A 4BY9E 5AADA 3R2BA 4F9YA 4AG8A 2ZAZA 3F6XA 4XYFA 3DLZA 5GZAA 2YAAA 1RE8A 4HYUA 5F1ZA 4XV3A 2VRXA 4UXLA 3FBVA 1KV1A 3R6XA 2RKUA 4YP8A 4EQCA 3EYGA 3OHTA 3E5AA 2QHMA 2VWWA 2X8DA 4ZP5A 4DEAA 4KBCA 4E1ZA 4CLJA 4PPBA 4BKYA 5HBJA 4I0SA 5AAEA 1GIHA 4NW6A 5CZIA 4BKJA 4NM7A 5FTQA 4ERWA 1OUYA 3R1QA 4HVSA 3R2YA 5LWNA 3IK3A 2WOTA 5HNBA 3BU6A 2F2CB 3AMAA 1Y8YA 4FOBA 3W10A 4QQ5A 3I6UA 1IG1A 2UUEA 4UMRA 4GV1A 2G2HA 1OKVA 3CQUA 3RMFA 3BWJA 2EU9A 4CQEA 5D7AA 5FGKA 5JFVA 2YM7A 1YKRA 1O9UA 2YAKA 1CMKE 4EHEA 4U7ZA 4RVKA 5CEMA 4EYJA 3K3IA 5JZJA 1FMOE 3KVWA 3I4BA 2R3JA 4FKRA 5BUJA 4TYJA 2QHNA 2OBJA 4CMUA 4JBOA 1ZYDA 4JR3A 4YPSA 1JBPE 4C2VA 3LFBA 1MRUA 2BRGA 5FWKK 4NYEA 2XJ1A 5KBQA 4IE9A 3PXFA 4KS7A 4WNKA 3UC3A 3MV5A 2WEIA 4Q9ZA 3BLQA 5FUTA 2GU8A 4IAZA 3C9WA 2ITPA 2QONA 3LCSA 4CZTA 3L9NA 2XKCA 2YACA 4KIKA 4FV5A 4ANMA 3AD5A 5KKRC 4HGLA 4ACGA 4AZTA 2R3QA 4E7WA 1F5QA 4FV1A 4GK4A 3OCTA 3SG9A 2X2MA 4FG7A 5AM7A 2XA4A 5AA9A 4ITIA 3VRZA 2J6MA 5CQUA 5BUIA 2EWAA 4FYOA 2JLDA 1BI7A 4AA4A 3CBLA 4EBVA 2I40A 3MVHA 1O6YA 2X6EA 3PWYA 3ZLSA 4XG9A 4K77A 1IR3A 3C4XA 4EZ5A 4YZNA 2HCKA 3KRJA 3BKBA 4EL9A 3LFQA 3UOLA 4AUAA 5I9XA 4DEBA 2BUJA 2I1MA 3UZPA 4I93A 4PRJA 4XJ0A 3PXKA 2VTPA 4XS2A 1Q41A 3MIYA 1PJKA 1STCE 3O17A 5HCYA 4M12A 4GCJA 3W55A 4QP1A 5HX6A 4OUCA 2FVDA 3QTRA 3TUBA 3FSFA 4PTGA 3V5TA 2OSCA 4M66A 1H08A 3F2NA 4MH7A 5EDPA 1HOWA 2UZLA 3R7YA 2BZKB 2J0IA 2YM8A 4QMUA 3CY3A 3H9RA 5LOHA 2ZDTA 3G9LX 3OVVA 4O84A 4HGSA 1WVWA 2XZSA 3NIEA 4O7ZA 4FR4A 1PMVA 5I0BA 4TNBA 2XRWA 1U4DA 3WZUA 2YIQA 3GCPA 5IQAA 3ELJA 4LV8A 1ZYCA 4IX6A 3P5KA 3MGYA 2R2PA 3UC4A 5IQCA 4KAOA 4MQ2A 2VU3A 3OF0A 4KBKA 2XCHA 3BIZA 3LFEA 5J5TA 3KVXA 4EJ7A 2UZOA 5CTPA 3ULIA 4H39A 3VVHA 2JDTA 1JWHA 3QFVA 4IIRA 4IW0A 3D9VA 5FG8A 3C13A 2XNPA 3NNWA 5IA0A 4ENXA 2XYUA 2XK7A 4C8BA 1PXLA 3KB7A 4MKCA 3EB0A 4YZMA 3DAEA 2YCSA 5JT2A 4FKTA 2PUIA 4G3EA 4LMUA 5C9CA 5A4CA 5KMMA 4YC8A 4FKQA 4XV2A 4KSPA 4ZXTA 3UG1A 3FLZA 4CFUA 2J51A 3R0TA 4AN3A 4I5CA 4L44A 3KRWA 5CWZA 4YZCA 4D4SA 1QL6A 4L67A 5AUUA 3NSZA 4FK3A 3W33A 1IEPA 2I0HA 3OCSA 1NA7A 3LFFA 3Q6UA 3RM6A 4AZWA 4EH5A 5IUGA 4BBEA 4V04A 3ZYAA 4Q5EA 5H8BA 4U79A 3D5VA 4JQ7A 1KUTA 3OTUA 5ETFA 4JJRA 4U41A 3B2TA 4FKIA 5IPJA 4A4OA 4NUSA 2XBJA 3ZO2A 3NW5A 4A9UA 4BR3A 5KNJA 3VULA 1DI8A 4U80A 4E20A 5K5NA 4ACDA 4ASZA 1Q5KA 3MPMA 5HD4A 1LUFA 3NMUF 1M2QA 2YIYA 4IZYA 3HMMA 2ZV9A 3C51A 3I0OA 2HZNA 3LFNA 1JNKA 3UQFA 3ZFMA 3HMNA 4S32A 4FSTA 3UOKA 4RJ5A 4C36A 2CGUA 4USEA 3MA3A 4I4EA 4E4XA 5CSVA 4F6UA 2X2KA 4ZMFA 2EXCX 2YJRA 4OTFA 4OT6A 3VHKA 2IZTA 3GT8A 3NW6A 5JQ8A 2X2LA 4RWJA 5JRSA 1L3RE 4E93A 4R7HA 4AFEA 5DRDA 3RPYA 4P5QA 4DFYA 3RI1A 3BBWA 5ITAA 1R39A 4I21A 4H58A 5G6VA 3I6WA 2YCQA 3ZSIA 4ZAUA 2OXDA 3EQIA 3P4KA 4AE9A 2WQBA 1YQJA 5A6NA 3QQLA 5AUTA 3OTVA 4RIXB 4XOYA 4G17A 4BYJA 4FV7A 5AR3A 4WG5A 3UYSA 1LEZA 4HOKA 2JAVA 4H36A 4AGDA 3R8VA 3G15A 4BTKA 5CVFA 3H0YA 1YWVA 4GJ2A 3EN4A 3QZHA 3CSVA 4F08A 5B0XA 2JIVA 5IA3A 3MA6A 4DBNA 2UZWE 3DFAA 2HIWA 2QU6A 4EQMA 4BCQA 2CPKE 4WG3A 4GMYA 3ZO1A 2XJ2A 3FZSA 4OAUC 3VS0A 3TDVA 1YXSA 4JIKA 2WMQA 3R83A 3GENA 2XM8A 1U5QA 3DK3A 2KTYA 4E4LA 2C6EA 4ALWA 1AQ1A 1YVJA 4I0RA 1L8TA 4LGDA 5BVKA 3PP0A 4B6LA 2PZIA 4C4IA 3HGKA 4U44A 1OMWA 3NNUA 2YWPA 2OIBA 4JNWA 5DFPA 2C1AA 4F9BA 2C0TA 3WF8A 3EZRA 3QXOA 3IGGA 3OMVA 3ZFYA 3PUPA 5GJDA 3DNDA 4YJUA 3B8QA 3K3JA 2VWIA 2ZJWA 1UNGA 3ALNA 4LRJA 3PA4A 3HV6A 4QMZA 3D5UA 4JDJA 3EL8A 3IW6A 4NTSA 5ANIA 1Y91A 4G5PA 3RCDA 4HPTE 4A4LA 3GC7A 4CV9A 2R3GA 5EW8A 5DI1A 5M51A 3V3VA 4C59A 3FZTA 3HV4A 4TYHA 2YJSA 2BIKB 5A14A 4NL0A 1PXNA 1XH4A 3PSBA 5HTBA 5HG9A 4X21A 4BDAA 1W8CA 5CF8A 2BPMA 1CKPA 3QC9A 4RX8A 3TCPA 4CSVA 3U8WA 4X2GA 5H3QA 2QR8A 1T46A 3RAHA 3ZTXA 1VZOA 2XB7A 2UVXA 2IG7A 4EHZA 3UOJA 5CEKA 2A27A 2QOQA 1XH5A 2AUHA 4LL5A 5HE3A 3TV6A 1ZY5A 1KE5A 1R0EA 3FKLA 3V5WA 2VWUA 3PZEA 2JC6A 3I81A 3UQGA 1YHVA 4RIWA 5IDNA 4TZRA 4PF4A 4ZMEA 2PVMA 4ENYA 1H07A 3QCSA 3BCEA 3R7GA 4I22A 2BR1A 3TNPC 2WTIA 4C4GA 4CVAA 1VR2A 1X8BA 2XKEA 1IAHA 2H9VA 1GY3A 2IWIA 2W1GA 1NT2A 1JSUA 1U54B 2OJIA 3CP9A 4FZAB 4CRSA 3W2CA 4RIXA 3G0FA 2CKOA 4O27B 3SHEA 3IECA 2GDOA 3UMXA 4FNXA 4QPMA 4M14A 4QMOA 5DG5A 5I3RA 3F3WA 3NEWA 1PXOA 3EN5A 2BIYA 1LR4A 4M69B 5EHYA 3A7HA 5HVKA 3SW4A 2R3LA 4OT5A 2YFXA 5AUYA 4O82A 1Q8ZA 4IM0A 4MQ1A 2X4ZA 5GIOE 3ZC6A 4PY1A 1XWSA 5EI8A 3AC2A 5C1QB 3A7FA 3KULB 4ASDA 2C68A 2JKMA 3MSSA 4J7BA 4XBRA 3VO3A 2QD9A 3LQ8A 3PA5A 4C35A 2C3IB 5HU3A 4MXCA 2XK4A 5D10A 4QP4A 3PG1A 1K9AA 1JLUE 4RVLA 4BHNA 3QALE 1R78A 3KRLA 4O7WA 3TIZA 3V5QA 2XIYA 5BVNA 4V0GA 4F1MA 4FTTA 4EKLA 3QA8A 1O6LA 5EM6A 2C6LA 4FTUA 1FOTA 4EK3A 3VW6A 5M4FA 3VQHA 3U55A 1UU8A 1EH4A 5L2QA 2C5VA 3SOCA 2VTQA 3ZONA 4U97A 4FEUA 3Q52A 4EH6A 3HP2A 1GZNA 3MY1A 4FBXA 3ZLYA 4DLJA 3NUNA 3S4QA 3V8TA 4FKJA 4CXAA 3RALA 4DFLA 5DMZA 5LWMA 3DV3A 3EJ1A 1LP4A 1OB3A 3D15A 1RJBA 3BYMA 2WIHA 3KXGA 1GZKA 4BGQA 4F0GA 2WTWA 1J7UA 4DHFA 5IU2A 4BB4A 3KGAA 4RC3A 4BL1A 5E8TA 3A7GA 5F95A 3D83A 1AD5A 4IAYA 4ZK5A 4XUFA 4BCFA 3KF7A 4CRLA 4RX7A 2F4JA 3IONA 3CGFA 3NVKI 2NO3A 3VBQA 5K4IA 3BGZA 3V5PA 2BROA 4WD5A 1M52A 4C4JA 3IOPA 3ZOSA 4CYIA 5DWRA 2QQ7A 3FQSA 4M0YA 5HGIA 4AA5A 5EQPA 1H1PA 2J7TA 3ZHPC 3ZEWA 4K18A 5HEZA 3CIKA 3FLQA 4E5BA 2UW9A 2C6MA 2BTSA 4BWKA 3NUUA 5DBXA 1YI4A 4KRCA 4DT8A 4BCOA 3ANRA 4AOTA 2NPQA 3OC1A 4JL9A 4FZ6A 2WMAA 2UW7A 3OUNB 5AM6A 1YI3A 3QX2A 3CKWA 4UEUA 5CENA 4M15A 5HOAA 4FEWA 2W06A 3CE3A 3FY2A 3I7BA 5CQWA 3A7JA 3I5ZA 4E8AA 2R4BA 3RWPA 2CLQA 2PVHA 3F9NA 2QOHA 4EWQA 5C4LA 3DZOA 5IQHA 1JKLA 4F09A 4AAAA 5GZ8A 3TTJA 2O0UA 3UIXA 4C58A 4MNEA 3VF8A 5L2SA 2YERA 2W7XA 2W4JA 2E9NA 4DFUA 5ANKA 5J7BA 5HVJA 4YTIA 4EBWA 2QO2A 3FHIA 4IAKA 2W4OA 4R1VA 1ZLTA 3QRKA 4IX3A 3QC4A 2FO0A 5AFVA 3E93A 3C4ZA 3WF7A 4EH2A 3M42A 1OKWA 5CU6A 4K6ZA 1J7LA 3PY3A 5IEVA 2E9UA 2F7ZE 3LCTA 1JSVA 4G34A 3E3BX 4D4YA 2GTMA 1J1CA 1F3MC 2ZM4A 5AP1A 2OLCA 4XG6A 3BI6A 3GEQA 3OP5A 2W05A 4AWIA 1PMNA 3MH3A 3Q32A 3IO7A 4KUJA 3EFLA 1OVEA 4RLLA 3QKKA 1H25A 5CSWA 4QMYA 5E1EA 2BHEA 4DBXA 1OUKA 2OJ9A 5AUVA 1NVSA 5IF1A 4DEDA 1OM1A 4EONA 2Z2WA 3EH9A 3ZDUA 3ID6C 1W84A 4IB0A 3FC2A 4BTMA 3FAAA 3MY5A 5HO6A 5ETCA 5CEPA 3PXRA 2JD5A 2B9IA 5CNNA 4HYSA 2BRBA 3Q4CA 3HAVA 5H8GA 5DEWA 3NRMA 5H8EA 3VS1A 4F1OA 5KE0A 3QCXA 4X0MA 3C0GA 1OPLA 4P5ZA 3S3IA 3WZEA 3EZVA 2HY0A 3ZZEA 3NDMA 4ANBA 4FIFA 1CM8A 4MF1A 3RPVA 3PIXA 1M2PA 5A4TA 4PP7A 3PP1A 4NK9A 2QKWB 3BYVA 4BI2A 5FEQA 4BDEA 5IUIA 3O50A 5KMOA 5DA3A 2IW9A 4FTJA 2C1BA 4W8DA 2E9OA 2UW6A 1GZ8A 4QP3A 4IZ5A 5C8NA 4GVJA 4WRGA 3NUAA 4FE2A 3PFQA 3D7TB 2UVYA 5J5SA 2HXQA 2WTKC 4IVDA 3GGFA 1OKZA 2WMRA 4XP2A 4BWXA 4YTFA 4W4YA 1WMKA 4DE4A 2WIPA 3TNQB 3KY2A 5B2MA 3G6GA 4BVUA 4QTEA 3JPVA 4D1XA 1YWNA 4YUQA 2C6KA 3HDNA 2R3RA 4GVAA 4NTTA 4RBLA 4R7BA 5EYDA 2OG8A 3DNEA 5DE2A 5J9YA 4U43A 4DAWA 3QF9A 1WVXA 5HG8A 4FZDB 4MYGA 3NS9A 2JAMA 1P5EA 5I5ZA 4L45A 4Y5QA 1IA8A 3RPRA 3H0ZA 2BMCA 4YLLA 1BMKA 3KU2A 4G5JA 2ETMA 4D0XA 4NFMA 3U4UA 2BFYA 4TNDA 2X4FA 5EOLA 2VO0A 4C62A 3IDBA 4FG8A 3WZDA 5E8YA 2OWBA 2ETKA 2QODA 2RFSA 2CKEA 4JI9A 3OY3A 5FQDC 3HV7A 3R1YA 2OZAA 2YIXA 4KWPA 5AV3A 2E9PA 2QVSE 3BBTB 3MW1A 5KHWA 2YEXA 2ITTA 4CT1A 1URWA 3MH0A 2BDFA 4KB8A 1WAKA 2FUMA 2RSVA 4LM5A 3G9NA 4AP7A 4ITJA 2ACXA 3BV3A 1P2AA 3L8PA 2PY3A 5DRBA 5ANJA 5FRIA 5TO8A 4LGHA 3WOWA 2YDJA 3GBZA 4E73A 1WBVA 2GTNA 3A60A 3QTUA 4D2SA 2ITYA 1REJA 1VJYA 4HCTA 4RA5A 5M4UA 4AZFA 2X6DA 4O86A 5F20A 3QWJA 2B52A 2WELA 2Z7RA 4DF3A 2FSTX 4NIFB 1ZMWA 5CNOA 4AGUA 4R6VA 2UW5A 3GU5A 3VNTA 1KOBA 4AS0A 2LAVA 1A06A 3DPKA 1YWRA 3OCBA 3OROA 2BILB 4IHPA 5CF4A 4ZIMA 2WMXA 4D0WA 4AZVA 4W4WA 4ZTNA 3R1SA 4FODA 4I3ZA 3ITZA 3V51A 2CDZA 4E6CA 3CXWA 3UNJA 1SVEA 2QR7A 2Z7LA 2J0LA 2WO6A 5HZNA 2XJ0A 3S0OA 1OL1A 3UP7A 3V6SA 3QQHA 3POOA 1FVRA 5CAOA 3D0EA 1I09A 3FL5A 1TQPA 3MY0A 3OXTA 4JX3A 4G6OA 4OR5A 3QBNA 4WOVA 1BUHA 2HZ0A 5HTIA 2Z02A 2C6OA 3HRCA 1V0OA 4DGMA 3P78A 2BCJA 2I6LA 4X7QA 3FYKX 2E9VA 4WUNA 1M17A 1PXJA 3VIDA 4RWKA 4AOJA 4EHVA 5KHXA 4GJ3A 2C5YA 5IA1A 5JSMA 4HYIA 3TZ9A 3ORZA 2EXEA 4Q9SA 5M55A 4O6LA 5BVFA 4X2FA 4ZLZA 1RDQE 3MS9A 3WF6A 1BL7A 2Y4IC 5CU3A 2ITWA 3OOMA 4J53A 3VJOA 1XR1A 3N4UA 3DJ6A 4K9YA 1E1XA 4RSSA 5LVLA 3RHXA 3U6HA 3GU8A 1BL6A 2J4ZA 3EFKA 3SKCA 2WKMA 5LXMA 2G2IA 3BEGA 3E8NA 4L52A 3DZQA 4ZSJA 2VWVA 2CKQA 3A8WA 3Q04A 4YGAA 2X8IA 5TKDA 4YLKA 5H9BA 4PV0A 3R9HA 5CXHA 4D2VA 2IO6A 4OTRA 4U45A 4QPSA 3ZH8A 4FV0A 4ONAA 3KXMA 5KMIA 3PPZA 2RFEA 5CU0A 2EVAA 3THBA 4C0TA 5K0XA 2UZBA 2VD5A 3VBXA 5DH3A 4CFNA 5E91A 3SRVB 2WMTA 4YZ9A 4CKRA 5M07A 3IQ7A 4GG7A 4KBAA 4DT9A 2OFUA 3AD6A 5A4QA 2PE1A 4K0YA 4LV5A 2C6DA 3A8XA 3QQGA 5M44A 4DEGA 2SRCA 2VTMA 1HCLA 5D9HA 3QAME 3LXKA 1UNLA 5CANA 4JBQA 2QOBA 3TV7A 4M68A 3QTIA 2XNEA 4FSUA 4NIFA 2XNOA 3W2RA 4YBKA 4MAOA 4ZJIA 5LMBA 5LQFA 4E6AA 4X3FB 4IDVA 3ZSGA 4BCIA 4YZDA 4FEXA 4FNWA 3GXLA 1KE7A 3KXZA 4R5YA 3EN6A 5EOBA 4YU2A 3UO4A 3GCSA 3T3UA 1FVTA 3MFSA 3W8QA 5AX3A 4ACMA 2DYLA 4D1ZA 4CCBA 5IG1A 3LJ1A 4RFMA 1JVPP 2JIUA 5KZ0A 4RGJA 3IKAA 1MRVA 3BQRA 3QZFA 4LOQA 4DA5A 1PXIA 1CKJA 3KEXA 3MPAA 1TVOA 3LFDA 4XG2A 5CVHA 4BDJA 3ODYX 4J8MA 2BAKA 3PRFA 4Q5HA 5KMJA 1Y57A 3CJGA 2CN8A 1UU9A 2I0YA 3EOCA 4CTCA 1W98A 1QMZA 1WBSA 2ITUA 2WMWA 4GU6A 4O1OA 4PMSA 4QYGA 2VTHA 2Y7JA 4RZWA 2WHBA 2EB2A 4U5JA 5KBRA 3QTSA 3L9MA 2RG6A 3Q9ZA 4PTCA 2ITOA 4QYEA 4FIIA 2ITQA 4C33A 3PPKA 4KRDA 5AV4A 4TY1A 1G5SA 3MVLA 4AOIA 1PMEA 3ORMA 4EH7A 4U81A 1PXPA 1FMKA 2C69A 3BGPA 4ZSLA 2R7BA 3FZ1A 3QL8A 4BCNA 1ZARA 3LXLA 5LCJA 4F63A 2G01A 1E9HA 1YOJA 2YA9A 3OG7A 3HAMA 2VNYA 3RPSA 3CY2A 4GFMA 5IA2A 2PMNX 3RBWA 1WBOA 4GU9A 4RVTA 5BVDA 3T8OA 3P86A 3O8UA 3NUXA 5FDXA 3ZUUA 4RG0A 2BAQA 2XVDA 3ZXTA 3NVMB 4FKWA 4DINA 1WBWA 3SAYA 4LRMA 1JQHA 4XHKB 5KMNA 2XK8A 4M97A 3QWKA 2Q0BA 3AXWA 5FBNC 4S31A 4MHAA 3ALOA 4ZTQA 4F7SA 2EUFB 5HCXA 2PVKA 4Z9LA 4KS8A 3IS5A 4EOLA 4PDPA 2VTJA 3T9TA 3AC4A 3KRRA 3EL7A 2WXVA 4JOAA 2OF2A 5CF6A 4L3PA 1YOMA 4B0GA 4QQJA 5AR2A 2IZUA 2R3OA 3A99A 3FMEA 3HL7A 4DITA 5LVMA 5EH0A 5AR4A 5E9EA 4Y46A 5M08A 4M67A 4DG0E 3VS4A 1OBGA 3NYXA 4NKAA 4ERKA 1UWHA 2VX3A 4FV2A 3FMHA 5IEYA 2B0QA 2PUNA 1SNXA 4G6NA 1UA2A 3FSKA 3AMBA 4ZTSA 4LYNA 2QLUA 3ZMMA 4D1SA 2J5FA 4YPDA 5AP4A 2ZB0A 5LMKC 3KXXA 1CKIA 5LMAA 3TNWA 5JK3A 4V05A 5EDRA 3PSDA 4DFZE 4O7YA 4J95A 5CAVA 2P55A 3AGLA 4CEGA 2BZJA 3MFRA 4XLIA 4JRNA 5T3QA 1H24A 1MRYA 3OBJA 3P7CA 2PZ5A 2HENA 3OWJA 4FTCA 5AP7A 2LGCA 3QGWA 3RCJA 2WTVA 5DT4A 2B53A 2ONLC 5E4HA 1YDTE 4DTKA 2Z8CA 4DFXE 3VWAA 3VUIA 3WF5A 3UO5A 3PVGA 3ZO3A 3K5UA 2YISA 4IBMA 5F94A 3ZCLA 2W96B 3O23A 4XH6A 4YURA 1KOAA 4YHJA 3CR0A 3LFSA 4RJ4A 3ZO4A 4D9TA 1FQ1B 3CTHA 3OS3A 4XOZA 4WA9A 5HD7A 4FKGA 5EYCA 5EM8A 3Q6WA 2BDJA 2A4LA 2IVUA 3F88A 3FWQA 1XQZA 3JVRA 3OOGA 3BZ3A 4PTEA 4YHTA 2H34A 4A4XA 5M06A 3VUKA 4MD8E 1JPAA 2PHKA 3PJCA 4IFGA 4FSQA 5BMSA 1B39A 3HUBA 3FDNA 3FMMA 3ORXA 3QD3A 5B2KA 2UW3A 3O96A 3COKA 3EQCA 4APCA 4BC6A 4OBQA 3U51A 4O81A 4QNYA 4D58A 4FL3A 3ACJA 3L8XA 1V1KA 3C50A 4EH9A 3VS5A 3P79A 4NM5A 2W9ZB 2UW4A 1JKSA 4PP9A 4QO9A 1PRYA 5IH5A 3HA8A 3OY1A 2X7FA 2I0EA 3SLSA 4F4PA 1LPUA 4FTLA 5EM7A 5EFQA 3ATTA 4IVCA 4BRXA 3IDCA 5LMKA 2RF9A 3VW8A 5K5XA 3I60A 4LQMA 1DM2A 3MTFA 4MD7E 1OL6A 5IA5A 4GRBA 4MBIA 2FSLX 5K4JA 3KMWA 4NT4A 3QLGA 2PVLA 5ANOA 3HLLA 4BCMA 1PHKA 3LMIA 1Y6BA 4LOPA 1ZOEA 3AT3A 5L8KA 3Q9XA 5HVYA 3RAKA 4UYNA 2QO7A 2ONLA 4G2FA 2OICA 2VTSA 4GUEA 5CEQA 1IAJA 1F0QA 3I5NA 5AV0A 3MFTA 2GHMA 2PUUA 3F3VA 3W18A 4YC6A 2Q0NA 3DDQA 3FZRA 4O0VA 4IADA 3HZTA 3EQHA 1PYEA 2OJFE 3Q9YA 5DNRA 1ZY4A 3DB8A 5M4CA 1ND4A 3FZPA 1DAYA 2YABA 4O7TA 2Z7QA 4HVHA 3EFJA 2CJMA 3UTOA 5B7VA 4FT5A 2H8HA 3PYYA 4KIOA 2UZDA 4R1YA 5T6KA 3QX4A 1REKA 4AA0A 2NRYA 4BIDA 4RPVA 1XJDA 4DEIA 2HZ4A 4R5SA 1RW8A 3AGMA 5BPYA 1SMHA 2WMUA 4QTDA 2WFYA 5FP6A 3MH1A 2UZUE 2VWBA 2CSNA 5DGZA 4I5HA 2YLEA 1SVGA 3HVCA 4A07A 3PVBA 5LVNA 3POZA 4F7JA 4YZBA 2QOLA 2C47A 2WU7A 4ZSEA 4BYIA 4JG6A 3UDBA 4BFMA 4P2KA 3OWKA 3TDWA 1OPKA 4UWBA 3TZ8A 2ITXA 1M7QA 2AC3A 4EK4A 5ACBC 2BTRA 2R9SA 2OGVA 3DA6A 5EKOA 4AU8A 4CGAA 3PZHA 3C0IA 4PPCA 2O65A 2ZYBA 4U42A 5E8VA 5GHVA 3UMWA 4ZLYA 1XO2B 3SXFA 1VYWA 3NPCA 4GKIA 1UWJA 4O7RA 4X6RA 3OEZA 1UVRA 2VO7A 2UW0A 4FX3A 3QUPA 3VBWA 2YIWA 4NJ3A 4E6QA 2WOUA 1GIIA 2YZAA 3L1SA 3O8TA 4UZHA 5J9LA 2CKPA 3D5XA 5IISA 2G1TA 5DVRA 3EFWA 3G5DA 3OW4A 2VO6A 4FC0A 4I5MA 3QU0A 4JVGA 4UV0A 3DAJA 3FKNA 4NSTA 2HYYA 3TL8A 3RTPA 3TXOA 4UY9A 4JRVA 1MP8A 3VUDA 1TKIA 2HY81 2R3HA 2RG5A 2XIXA 3LIJA 4PDYA 4AFJA 1ZZLA 4PWNA 4L68A 4DN5A 3FXZA 2CNUA 3LM5A 4L6QA 5I4NA 4MXOA 2VGOA 3C7QA 1GAGA 4WT6A 3UNZA 4FZ7A 3BHHA 4X2KA 3EKNA 5CX9A 2Y6OA 4CQGA 4O0RA 4RJ7A 3ZUVA 3Q96A 1WFCA 5EI2A 4F65A 3PA3A 2UW8A 2R64A 3VBVA 3FYJX 3R22A 3KMMA 3QQUA 4CKIA 4D2WA 4ARKA 4U3ZA 2YDKA 3N4TA 4NZWB 2WZJA 3DQWA 4Y85A 2WQOA 2BDWA 5C03A 4EI4A 2R3FA 3RGFA 1NY3A 4QMSA 3UZTA 3SQQA 2IPXA 3EQDA 4N57A 3HECA 5TE0A 3DS6A 5CI7A 1A48A 2W17A 1W83A 4FTAA 1Q3WA 1YXUA 2GNFA 2UZVA 3PY0A 1OIRA 3UG2A 3FMNA 4GG5A 3PE2A 4HNIA 4FV3A 4F7LA 2KULA 4Z16A 3ZU7A 2ZM1A 2J0KA 4RLKA 2IVVA 5CEIA 3BHUA 2YM6A 3V5JA 4D2RA 4GIIA 5EG3A 3FMKA 3R01A 4F7NA 2JKKA 2QC6A 3GB2A 4J71A 3W2SA 1Q3DA 1GJOA 4FF8A 4G3DA 3LZBA 3Q3BA 3DTWA 4FK6A 4KA3A 4NH1A 5CI6A 3UO6A 3COHA 4MXYA 1VYZA 2ITVA 4WHZA 2HW6A 3FPMA 3OUKA 3QTQA 2GQRA 4D5HA 1H27A 3WI6A 5AR8A 4UALA 2HWPA 3HP5A 4JT3A 4OAVB 4PL4A 3CGOA 3TUCA 3KKVA 4FTOA 4RIYB 3KF4A 2PMOX 5DIAA 1XBCA 3S95A 3GOPA 4EOPA 2QLQA 4GT5A 4I41A 4N6ZA 2GCDA 5CZHA 4O22A 4USFA 4GL9A 3UODA 4DEEA 4FIEA 2HAKA 5HNGA 4WSYA 3SDJA 3RNYA 4RT7A 4FVQA 3WYYA 5EI6A 1NVQA 2YHVA 4WNMA 5BYYA 1OIUA 3W2OA 3DAKA 5J95A 5E8SA 5AJQA 5CALA 3NR9A 5DOSA 4FKOA 5HIDA 4UMUA 1V0BA 4XLVA 1ATPE 3FLYA 3REPA 4C3RA 3EQGA 2IJMA 2A0CX 3QD0A 4FTKA 5HE0A 1XH6A 3W32A 3DOGA 1JKKA 4K8AA 5JGAA 4UMPA 1FBNA 4CYJA 1ZAOA 5L6WL 4BBMA 4AW0A 3HMIA 3HX4A 3QQJA 4OTDA 4APPA 2GQSA 2XEZA 4EH8A 4ZTHA 3FY0A 1M14A 5FEEA 3DFCB 2VX1A 3GU7A 5DR9A 3E8EA 4H3BA 3QQKA 3KMUA 3SV0A 3WYXA 5CT0A 2CHLA 3HV5A 5I9ZA 3Q9WA 3SC1A 2BZIB 3FXWA 3KXHA 3O71A 1U46A 3PVWA 4FSRA 3R21A 5FM3A 1XH9A 3OEFX 4IXPA 2W1IA 1QPCA 3LVPA 5J79A 4EOJA 3PDTA 3P23A 4Y8DA 4BTJA 3PJ3A 3MDYA 4LG4A 5CVGA 4IX4A 3RK7A 4KABA 2P0CA 3GQIA 4L43A 3A61A 4QPAA 5L2WA 3ORLA 2W1DA 4O0XA 1ZYSA 1NVRA 3L8SA 3DBFA 3N4VA 2CCIA 4U40A 4X6QC 5CSPA 4ZZMA 4YJVA 2XH5A 4Z55A 2YCRA 2CMWA 4L53A 3PJ1A 1H1RA 4RVMA 3RZFA 4YJRA 3U54A 3OCGA 3FMLA 3C4WA 1OPJA 3UZRA 3EYHA 2QOIA 2R3MA 3SOAA 3ACKA 3BLHA 4C34A 4G3CA 3QKLA 5ETAA 2W5HA 2Y0AA 4CLIA 3S1HA 2WQNA 1OKYA 4HGEA 4U6RA 4OW8A 2PK9A 1U54A 4FG9A 5AUXA 3VC4A 3TZ7A 2ZV8A 1V0PA 2WNTA 3JR1A 1U5RA 5FD2A 3C1XA 3QYZA 5AUWA 3LAUA 4EH4A 3MWUA 1TQMA 3PVUA 4N4SA 4BBFA 1ZZ2A 3FZOA 3NUYA 5FXQA 3M11A 5J8IA 4MBJA 4AF3A 3TKHA 3LCDA 4M69A 3WIKA 2WQEA 2XIKA 2PSQA 5FEDA 4KKGA 4PL3A 1H1SA 4DLIA 4FIHA 3DK7A 3LKMA 3KULA 3UPXA 4D55A 3FEGA 2DUVA 4FKVA 4BTFA 3U6JA 5L6PA 3R7OA 4ANNA 5HG7A 4CD0A 4JDIA 3OXIA 5JN2A 3O7LD 4O96A 2VTIA 4H05A 2UZNA 3R8MA 3FXXA 3GFEA 1OIQA 2IVTA 5BX0A 3LE6A 4TN6A 3EQRA 2PTKA 2R3KA 5HESA 1UU3A 4XG7A 5IDPA 3ZC5A 3R9DA 4E4MA 3EMGA 4EOIA 3M1SA 3R02A 3D7ZA 2YDIA 4JXFA 4YSJA 4RJ3A 2XYNA 3FLWA 2OKRA 4XV9A 5AMNA 3GC9A 2V55A 5HO8A 4C02A 4FTQA 4WG4A 5E1SA 3ORPA 4BGHA 4BZDA 2PPQA 5CSXA 4K33A 4TT7A 3AOXA 2PMIA 4LFIA 2VO3A 3T9IA 4BN1A 3NNXA 1XHAA 2ZV7A 2X9EA 3CLYA 3D14A 4ZLOA 3QTZA 3AC3A 4DGNA 3OXZA 2PZRA 4G9RA 2DQ7X 3IGOA 5TR6A 3IW5A 4YSMA 3VRYA 5M4IA 5A6OA 1Q8TA 4ZZNA 3CPBA 4I6HA 2GNIA 3AQVA 2QG7A 3AG9A 1PF8A 3FC1X 4MXAA 4GUBA 4PMMA 1YW2A 2JITA 4IANA 4IH8A 3UYTA 2VTTA 5KZIA 3GI3A 1WVYA 2WTDA 5FTOA 2YWVA 4PDSA 5EYKA 4PUZA 1KE8A 4G6LA 4L3LA 3EN9A 1Q8UA 3F5UA 4TTHB 2X39A 2VV9A 2YM4A 3HUCA 3PG3A 4J99A 4Y72A 1VEBA 4W9WA 4AT3A 4HZSA 2VTNA 4G31A 4ALUA 2G9XA 4FT9A 4C37A 3LFAA 4UYAA 5F9EA 1ZRZA 4W4XA 3U87A 4ZY6A 1FGIA 4AZEA 4I6FA 4WRSA 3NAXA 2C6IA 4HW7A 5CAPA 4G1WA 3EN7A 1XH7A 4I23A 1YXVA 3BE2A 3F3ZA 3LQ5A 4FNYA 5LCKA 4QNAA 3H9FA 4U8ZA 5C01A 4FSNA 4D2PA 4UX9A 4DH8A 2CLXA 1OIYA 4M7IA 4F0FA 4O7NA 1YI6A 3WBLA 4FKPA 4ZTMA 4IFCA 5HCZA 3F5PA 4NW5A 5EQYA 4AT4A 5TF9A 4LRKA 4D4RA 5IA4A 4MTAA 4IWOA 4U0IA 2PVJA 4RQVA 3E8CA 1AGWA 4LOOA 1WBPA 2A1AB 1PKGA 3PSCA 2PZYA 3TNHA 4DTBA 3O8PA 4NM3A 2JDOA 1XBAA 2XKDA 3GQLA 4F6WA 4NKSA 4QP8A 2Y6MA 2CGXA 1I44A 4JG8A 4A9TA 4RJ6A 4JR7A 4HNFA 1ZOHA 3F66A 4IB3A 2VUWA 2V7AA 5GJGA 4AE6A 4EK8A 2ETRA 3BWFA 3FQHA 4FUYA 5BUEA 3LOKA 2YIRA 4CTBA 4O7VA 4WUAA 1IA9A 4PDOA 3G33A 5I9WA 1Z9XA 2JDVA 3NWWA 2JBOA 3V8SA 3KC3A 1FVVA 1R0PA 5A9UA 5KX8A 3ZRLA 3SVVA 3II5A 4Y73A 2X9FA 2X1NA 3NGAA 5J7HA 5JKGA 3H9OA 4XG3A 5I9YA 1Q8YA 3PTGA 1CTPE 3TTIA 4O0WA 2YN8A 3HRFA 2AYPA 2C6TA 4IVBA 4RWLA 2VN9A 4P90A 1PXKA 2W9FB 4N70A 1G3NA 4WO5A 1CSNA 4JDKA 3F3UA 5DT0A 3KA0A 2XKFA 3C4CA 2B54A 2VNWA 2PVRA 2JKQA 3BU5A 3OBGA 4B8MA 5L4QA 4CZUA 3R9NA 4BICA 2FSOX 5CS6A 2XBAA 5BVOA 3GCVA 3JS2A 3R73A 4FSWA 4ANSA 3DGKA 3QUEA 5LVOA 1WBNA 4YHFA 4FNZA 5JGBA 2R0UA 2OH4A 4IACA 3D2IA 3D7TA 4YTHA 3GCQA 2R3IA 2V0DA 5BYZA 2QG5A 2BKZA 3QRIA 4BDCA 4BWPA 3W1FA 3WE8A 4MBLA 5EQEA 1BI8A 3DY7A 4JBVA 1XKKA 2BFXA 3GP0A 2WB8A 4TYIA 4DH3A 4EC9A 3TEIA 4S30A 4CFMA 3HRBA 1B38A 3JYAA 3ZSHA 2CGWA 3I1AA 4ALVA 4ZY4A 3OT8A 3FHRA 1PKDA 4MWHA 4AX8A 4BDGA 5JH6A 5K9IA 5JFSA 1WZYA 3MB7A 5HHWA 2C5XA 5DT3A 2HELA 1R3CA 3UIMA 4FICA 4L42A 4BKZA 2C0IA 2JIIA 3ZDIA 4HVIA 5T68A 4ZJVA 2XRUA 5DHJA 5C27A 3SG8A 4PMPA 4KIPA 1ZMVA 3ZM4A 1KSWA 4JAJA 3Q60A 2BZHB 4V01A 5CU2A 3VUMA 5A4LA 2QO9A 5IQDA 3H30A 3FQEA 4E5WA 4YO6A 3R28A 4IAAA 3RK9A 4IJ9A 1BYGA 3TWJA 1PXMA 3JUHA 3ATSA 4ACHA 3PRIA 4ZOGA 4O83A 4H1JA 1J3HA 3E3PA 3O0GA 2GNLA 3RPOA 4X2JA 3C4EA 4KIKB 3MBLA 1UKHA 4R8QA 3LXPA 4UMQA 2EXMA 2QOFA 3DBQA 3R30A 4BHZA 3HMPA 3QCQA 4PNKA 5J1VA 2P2HA 3IDPA 4I6BA 4QMLA 5JFWA 3EWHA 4IM3A 3R9RA 2W5BA 3BHTA 3PY1A 4OTHA 1FGKA 3NYOA 5KMKA 3T3VA 3MFUA 3KCFA 1OL7A 4WBBB 4FKLA 5M53A 4OTWA 2VZ6A 4F99A 1KE6A 4FT0A 4I94A 4J98A 3E7VA 3QGYA 4I1ZA 5HLNA 1YHWA 3A4OX 4RQKA 3Q2MA 4MCVA 1S9IA 4LMNA 3R9OA 3V04A 5ANGA 4A06A 4F1TA 1YDSE 2RGPA 3LHJA 2F2UA 4Y83A 2PWLA 3RVGA 4Z3VA 3LM0A 5I9UA 1Z57A 5HI2A 2IW6A 2WPAA 4ZS0A 4FA2A 4RFZA 5HLPA 3NCZA 4ZY5A 4GSBA 2X8EA 2RL5A 2Y9QA 3GFWA 3WIGA 2FYSA 1H26A 2QURA 4B8LA 4C4FA 4I20A 3WZKA 3QCYA 3CEKA 3G2FA 3ZEPA 3ET7A 4IB5A 4YNEA 3Q4UA 4I0TA 1H8FA 4X3FC 3DB6A 5IMEA 4O0TA 4PNIA 3A4PA 3UGCA 1H01A 4L3JA 3CTJA 2R7IA 3N51A 3DKFA 4IDTA 4YJQA 5JEBA 2FSMX 5JGDA 4CT2A 5KKRB 1G8AA 3OZ6A 2C5NA 4TWOA 5FLFA 2F7XE 3NX8A 4YLJA 2JBPA 4ZTLA 2R0IA 2QU5A 2RFDA 4FL1A 5FP5A 4IX5A 5EHLA 3NUSA 4I5PA 2P4IA 1R1WA 4IB1A 4JAIA 2ZDUA 3NUPA 3QD2B 3TZMA 5L6OA 4A9SA 4XV1A 2CN5A 3TUDA 4FVPA 5A54A 5M09A 4AT5A 2JDSA 3CC6A 5HX8A 4ZTRA 1Y8GA 3DKGA 5D7VA 3GNIB 3TKUA 3IW8A 2XCKA 3TI1A 4O0SA 2XP2A 3FKOA 3QUDA 3DLSA 2C5OA 5I3OA 2B1PA 4MXZA 5A3XA 3LCKA 3SRVA 5LVPA 4D9UA 2PZPA 3FUPA 4FEVA 3F82A 3R8UA 4R77A 4F70A 2C0OA 2XUUA 5FBOA 3L9LA 5FTGA 5BYLA 3QTXA 4J1RA 3DDPA 3ZM9A 4P4CA 2PVYA 2XK3A 3BGQA 4JG7A 2P33A 4F6SA 1DI9A 1MQBA 2O2UA 4QMWA 4Y95A 1O6KA 3PXYA 4Q2AA 1J1BA 5EYMA 3RAIA 4X3FA 3OFMA 4CZYB 3GOKA 4PX6A 4IEBA 2C3KA 3FI3A 5F4NA 3UE4A 4OBPA 4QYFA 4TWPA 2HK5A 3D4QA 4AN9A 3PIYA 4AQCA 3C0HA 4FI1A 3TT0A 1KWPA 2W0JA 4H3QA 4ANOA 4JQ8A 2IN6A 2XF0A 1YXXA 2NRUA 1OL5A 4LL0A 4MEDA 3ULZA 4JQEA 3WILA 2ITZA 3BRBA 1SM2A 3MVMA 5E92A 5E8WA 4GH2A 3QRUA 3R71A 3WZJA 4I4FA 3QHWA 5KO1A 4MF0A 3P08A 3F3TA 2BKKA 2R5TA 2JFLA 1HCKA 3DTCA 3MIAA 2VTRA 3HMOA 2R3NA 4FSZA 5IQFA 4JBPA 5LJJA 3F69A 4NM0A 3GU6A 5DYJA 4IVAA 5IEXA 1MUOA 2WMSA 1RQQA 3Q4TA 4FYNA 3UNKA 4ZS4A 4QMXA 3LJ0A 5AWMA 3G51A 4KNBA 2QCSA 4O38A 3U6IA 3PWDA 3U9NA 1UKIA 5EHOA 3Q5ZA 5J87A 4R3PA 5EDQA 3LFCA 3DXNA 2B9FA 4IJPA 5CSHA 4BDFA 2WQMA 1B6CB 2GNGA 4Z7GA 3CS9A 2BRMA 2YLFA 4L46A 4EK5A 5IH4A 4FUXA 4FGRA 3P7BA 3KK9A 3LMHA 4TXCA 4HCVA 3HKOA 2YZLA 2ERZE 4XNEA 2VWZA 3CQEA 2HZIA 1P14A 2OO8X 3HNGA 4RA4A 3ZRKA 4EWHA 5IZFA 4EKKA 2FB8A 4EC8A 4QP7A 4B4LA 5A46A 2NP8A 3A2CA 4O2ZA 2J0MB 4RFYA 2O5KA 4ITHA 5AUZA 3RAWA 3ANQA 2X0GA 4O6EA 3ENMA 4GFOA 3ZFXA 4E5AX 1GOLA 4BZOA 5M57A 3EQBA 3UJGA 4BCPA 3NW7A 4RZVA 1GZOA 4UBAA 1M2RA 2IVSA 3EQPA 4OTPA 3TACA 1Q4LA 2V7OA 1K3AA 3RP9A 2VTAA 5HG5A 3ODZX 3TJDA 4FV9A 4AGWA 1S9JA 3BLRA 4HGTA 4C4HA 3D94A 2F49A 2VX0A 3V6RA 2XK6A 3LQ3A 4WBOA 4CFWA 3MJ2A 4TYHB 2HOGA 2W5AA 5EW3A 4USDA 3R7VA 3AMYA 1Q8WA 1H00A 1W82A 3CCNA 5E8ZA 2OJJA 5IKWA 4QMNA 4KKHA 4OTGA 1ZOGA 3FV8A 3K5VA 1P4FA 3BELA 4MXXA 4ANQA 3TN8A 4E3CA 5IH6A 2GFSA 3FI8A 4YMJA 4C2WA 3FI4A 3FLSA 3MESA 2BALA 5D41A 5C26A 2OW3A 3NIZA 4FV4A 4E4NA 1OECA 3FL4A 3QLFA 2BRHA 2G15A 1W7HA 5JMSA 4UMTA 4B7TA 4EHGA 4QT1A 4ORKA 4PQNA 4RIWB 2PL0A 3K54A 4NU1A 1WBTA 2Z60A 4OGRA 3WF9A 3COMA 5GZ9A 4I92A
chains in the Genus database with same CATH superfamily
3CD3A 1GIJA 2J90A 4G9CA 4GW8A 2UVZA 3E87A 5HIBA 4W4VA 2ESMA 1P4OA 3R04A 4TW9A 2WGJA 3HEGA 3GVUA 2ZV2A 3VBTA 1QCFA 5AA8A 4IC7A 3TM0A 2ZMDA 1PY5A 4OTIA 5AIRA 4NEUA 3UP2A 4KIQA 4QQCA 3NYNA 3QA0A 3FI2A 5JFXA 3HDMA 5KMLA 4W8EA 3L8VA 5AV1A 4KD1A 2WTCA 3F7ZA 3KQ7A 1KV2A 1H0WA 4EH3A 5AP2A 5HTCA 4JX7A 2YCFA 4ZSAA 4BF2A 2Q83A 4BZNA 2HXLA 5AP0A 2OF4A 3R8PA 3LLTA 4O7SA 2ITNA 4FTNA 1JOWB 2OIDA 5E8XA 3TJCA 3SGCA 1TQIA 2VGPA 2P2IA 3DJ5A 3PPJA 1BKXA 5BMMA 5HE1A 3PLSA 1QPDA 3V8WA 2ZOQA 3C5UA 4FKSA 4EK6A 4O0UA 2OFVA 4DG3E 4FMQA 4W9XA 1OZ1A 4CFVA 4CMTA 4TRLA 4FIJA 1DAWA 5L8JA 4QMMA 1SNUA 4EOMA 2OH0E 4V0GB 3BYOA 4IWPA 4WNPA 4F64A 3SXRA 3UQCA 4DHIB 5AIKA 4QMPA 3CPCA 3F7WA 4R3CA 4BCKA 5HNIX 2YM3A 2CNVA 3JXWA 4K1BA 4MVFA 5CYIA 4IWQA 1DS5A 4WSQA 3ZBFA 3ZS5A 5DEYA 2VAGA 3NLBA 2RFNA 5AAGA 3IPHA 3P5JC 1YOLA 4RC2A 4J97A 1OI9A 3Q4ZA 4QYHA 4ZSGA 3AT4A 2EB3A 2W4KA 3LXNA 4QP6A 4D2TA 2QKRA 2PE0A 3QTWA 4L01A 4FTIA 2J0JA 2GMXA 2WAJA 3E8DA 3RJCA 2CGVA 4ID7A 3RHKA 4QP2A 3QHRA 4XRJA 4EYMA 2GHGA 2GNJA 3MYGA 4BDBA 4EQUA 4DTAA 5AV2A 1IRKA 3MJ1A 3H10A 4L8MA 2H6DA 2VWYA 3CTQA 1W0XC 5CT7A 1H4LA 3AC5A 3D2KA 2XNBA 5L8LA 4M13A 5ANEA 3V5LA 1OL2A 4XP0A 3QYWA 5EW9A 1JSTA 3R7IA 4QRCA 2FH9A 2JEDA 4GFGA 4DC2A 4YO4A 3SW7A 2ZB1A 4ZJJA 2NNWB 5A4EA 3G6HA 4YR8A 2FGIA 4JLCA 4XRLA 3OWPA 2X7OA 3SD0A 4EORA 3BPRA 4S34A 4C3PA 2W1FA 4H1MA 3DBDA 3PFYA 3DKCA 3RKBA 3R00A 5CY3A 3RM7A 5KUPA 2GS7A 2Y8OA 3NCGA 4FL2A 5L2IA 2REIA 3M2WA 4CKJA 3KCKA 4QP9A 4AW1A 3DK6A 4GIHA 4X2NA 5HORA 3BYUA 4A9RA 4BCJA 1BLXA 3DBCA 3ZBXA 4BI0A 4YJSA 3BE9A 4EOQA 4XX9A 3UPZA 3WE4A 3C5IA 4ASXA 1K2PA 5BVWA 4FIGA 4RC4A 5AR7A 1APME 5AP5A 1SZMA 3ORTA 4LGGA 4YTCA 4IZ7A 2XNMA 4FT7A 4IM2A 4O4DA 4QD6A 3TG1A 4MNEB 1G8SA 4MNFA 4O4BB 4KSQA 1FPUA 3NNVA 3E62A 4DYMA 3BV2A 3LMGA 4RRVA 3DT1A 4UN0C 5CASA 5JQ5A 5DR2A 4A9YA 2J9MA 2V5QA 5HBEA 3NYVA 4M0ZA 2PVFA 4XMOA 4IAIA 3UIUA 4GK2A 3K2LA 3GU4A 4YNOA 4TYGA 4BDIA 4DG2E 3BEAA 3VUHA 5G1XA 5I9VA 2O63A 3R1NA 2PMLX 3CD8A 1SYKA 4X3JA 3MB6A 3UBDA 1ZYJA 4BCHA 2QOCA 4BGGA 4WIHA 3ZZWA 1IASA 2PU8A 5FXSA 5IQEA 3CQWA 4WNOA 4DH1A 1XBBA 1GNGA 1M7NA 2QNJA 3ZLWA 3VONA 1PW2A 2ZVAA 3PXQA 5AR5A 4C61A 3A7IA 3I7CA 4XEYA 5HBHA 3RZBA 3EKKA 2PUPA 4CFXA 2C3LA 4ZEGA 3N9XA 2XS0A 2GPHA 3A62A 2G2FA 5EK7A 5K0KA 3P1AA 4ANLA 4DGLC 4FSMA 5CXZA 1XH8A 1YXTA 2O3PA 3AT2A 3NAYA 2IW8A 4DGGA 4UWYA 2I7QA 3DBEA 3JVSA 3HA6A 3W8LA 3KK8A 3R8LA 4QEBA 4U9AA 3DXPA 5IQIA 3QZGA 2R3PA 5HKMA 3SXSA 3VS2A 4AZSA 4C7TA 2OIQA 3F5XA 1T45A 3WARA 5L2TA 5J1WA 2XARA 4YJNA 3OT3A 3VJNA 3VUTA 1CDKA 2V62A 3EIDA 2J5EA 4M8TA 1Q62A 4OBOA 5CLPA 3E92A 5HO7A 4EZ7A 4S2ZA 3OWLA 2YITA 5AX9A 4ASEA 4EZ3A 3OD6X 5IMXA 3VS6A 4R78A 2FA2A 4QTBA 5BVEA 4QMQA 3UOHA 2IZRA 2QI8A 4XP3A 3L9PA 5FDPA 2BAJA 4NWMA 4FZFB 1KE9A 4DFNA 5B2LA 4J8NA 3MI9A 4RIYA 4E6DA 4HPUE 4HVDA 4GT3A 5IQGA 4PL5A 3DKOA 3VBYA 1ZMUA 2OXYA 5CEOA 4G3FA 5LARA 1UU7A 1H1QA 2CCHA 3KL8A 2V22A 4Z7HA 2F57A 3QRJA 3NZ0A 4JDHA 2WEVA 2WMVA 2GS6A 4O0YA 3JY9A 5AP6A 3ROYA 5GIPE 3VF9A 1U59A 5HICA 2ERKA 1Y6AA 1JAMA 4OLIA 4EOSA 4GK3A 3MN3A 4GT4A 4CNHA 5E7RA 3QZIA 2B55A 3UVPA 1H1WA 2XEYA 3AC8A 4LUDA 2C4GA 5DLSA 2B7AA 5DN3A 2HWOA 5BV3A 2JKOA 4CFFA 2OZAB 4GEOA 3JY0A 4QMTA 2JGZA 4DFBA 3FMJA 3B2WA 4J52A 1YRPA 2CNQA 5CAUA 2A19B 4DDIA 1Q97A 2JFMA 3R7UA 3LCOA 4BDDA 4E26A 3ZUTA 3E63A 4R7IA 3KN5A 1J7IA 2XM9A 2QOOA 3B8RA 3E7OA 3TIYA 3SX9A 3ZRMA 4BDHA 2W99B 1FINA 2OK1A 2ZMCA 3E88A 1Z5MA 4NFNA 4OTQA 2GHLA 4QTAA 4DEHA 5J9ZA 4Y5HA 2GFCA 4GKHA 4CG9A 3PIZA 5GJFA 5GNKA 2B9JA 4DH7A 2WTKB 3CJFA 3OW3A 5JZNA 1Q24A 4RX5A 3HV3A 4TKSA 3P7AA 4QOXA 4RMZA 5TOZA 3VQUA 3Q53A 2W1CA 5L3AA 4AW5A 5JRQA 4I24A 4HYHA 1PMUA 5HE2A 3GC8A 4JS8A 3PJ8A 4AGCA 5C4KA 5KCVA 3U9CA 5FXRA 3DQXA 4YC3A 3FLNC 2VWXA 4AACA 4MX9A 3ERKA 1Q99A 3GUBA 3PXZA 2PVNA 4AN2A 2OXXA 4AW2A 2B9HA 2VTLA 5AAFA 5M56A 3IOKA 4P7EA 2PULA 1SVHA 1WCCA 2Z7SA 1YHSA 3LJ2A 4MK0A 4O21A 4QMVA 4UB7A 4LUEA 4CCUA 4XCUA 4TWNA 3UVQA 3DU8A 2OU7A 4FOCA 3D5WA 4I6QA 3W16A 1MQ4A 3FJQE 3KN6A 5HLWA 4CV8A 3LW0A 2VTOA 2F7EE 3RK5A 4HCUA 5CU4A 4II5A 3H4JA 3MVJA 4M3QA 5DPVA 2O8YA 2RIOA 2XNNA 3IW4A 5TT7A 3SA0A 4G16A 2IEWA 2AC5A 2B4SB 4IWDA 3I0QA 4TL0A 3V01A 4N0SA 2XMYA 3Q5IA 2BHHA 4YJTA 2WU6A 1OITA 2GS2A 1H0VA 3GCUA 3F61A 5DR6A 1ZXEA 4GYIA 4FT3A 5E90A 3BHVA 3LLAA 4F9CA 3HYHA 5AP3A 3AC1A 2GQGA 4HJOA 5H2UA 4FSYA 3FMDA 4ACCA 1Q61A 5D1JA 4HZRA 5IQBA 4NJDA 4YJPA 3ENHA 2XIZA 3ORKA 4DGOA 4FV8A 4HVGA 4RWIA 4TYEA 2JDRA 3Q2JA 3G90X 3GC0A 1BX6A 2W1HA 4QQTA 4NCTC 3VS7A 3MH2A 4FGBA 2ZM3A 3BYSA 3VUGA 4D4VA 3ORNA 4XG8A 2I0VA 3BX5A 5ETIA 2C30A 3DCVA 3ETAA 4BCGA 2PYWA 3VS3A 2WTJA 3O2MA 4RX9A 4WKQA 2XIRA 4FKUA 5D12A 3U4WA 5ANDA 5HQ0A 2A2AA 5FM2A 4EOOA 2UZEA 2H96A 4GS6A 1UNHA 1JKTA 1XMLA 3FE3A 3G0EA 3TV4A 2OJGA 3O7LB 2WD1A 5EKNA 2J50A 3IW7A 4L9IA 4L7SA 4O1PA 4YBJA 3PJ2A 3NFGB 3TNIA 3QRTA 5BNJA 3UDSA 4TPTA 4H3PA 2YM5A 3W0RA 3C4FA 3KRXA 4IMYA 4F0IA 4TWCA 1URCA 1UV5A 2GNHA 2IZSA 3VN9A 1A9UA 4KKEA 2HW7A 4S33A 4DHZA 3KREA 3TKIA 2Y4IB 2BRNA 4M84A 4C38A 4R3RA 5E8UA 2W1EA 3PE1A 4XBUA 3P0MA 2E2BA 3R63A 3LPBA 4K11A 1OGUA 1QPEA 2OI4X 4IQ6A 3W2PA 2DS1A 4EUTA 3BQCA 4JIAA 3P9JA 4EEVA 3I79A 4LI5A 3F2RA 2WMBA 3KFAA 4FTRA 5CAQA 4MWIA 4QTCA 4FV6A 4N6YA 4IZAA 4O91A 4B99A 5CF5A 1NXKA 3H3CA 4YJOA 3UVRA 5C8KA 3IG7A 4FEQA 5HIEA 3KXNA 2XNGA 4DH5A 4EUUA 3QQFA 4C3FA 3COIA 4C4EA 4DCAA 4L00A 4B9DA 1OBDA 4EOKA 3DXQA 3S00A 1YDRE 4DCEA 3ROCA 4F9WA 5BQ0A 3PLAE 3O51A 4J96A 3VAPA 3W0OA 4NCTA 4KINA 1H28A 2J2IB 4MD9E 4A7CA 2O64A 4BIEA 1PYXA 3QXPA 4FVRA 2UV2A 4RJ8A 3ZXZA 2P3GX 5K3YA 3VHEA 3W2QA 4O7LA 4C57A 3F2AA 3F5GA 3MTLA 4XG4A 4AXAA 3QD4A 3R7EA 4CMOA 4D5KA 4BIBA 1QPJA 3CKXA 2X81A 4BI1A 4UWCA 3EHAA 4PMTA 4GYGA 4FTMA 2OZOA 2Y4PA 1E1VA 2F9GA 4G3GA 3ZLXA 1J91A 4UXQA 3RWQA 3DJ7A 2QOKA 3BU3A 3UIBA 1NW1A 1ZYLA 2W1ZA 3S2PA 1ERKA 4L7FA 4O2PA 3QKMA 4BDKA 4QYYA 2UZTA 5EM5A 5ICPA 3MPTA 5C8MA 3AD4A 5GINE 4UZDA 4D28A 4F9AA 1LEWA 4RIOA 4ZZOA 4K2RA 4EJNA 1ZWSA 3FPQA 4IC8A 4CG8A 3R8ZA 4U3YA 3RNIA 5IUHA 3EQFA 5ACKA 2X7GA 5D11A 2BVAA 3RINA 2GSFA 3E64A 4IAFA 5HU9A 2C3JA 3BHYA 3ORIA 2DWBA 4PPAA 2XK9A 2PE2A 4BY9E 5AADA 3R2BA 4F9YA 4AG8A 2ZAZA 3F6XA 4XYFA 3DLZA 5GZAA 2YAAA 1RE8A 4HYUA 5F1ZA 4XV3A 2VRXA 4UXLA 3FBVA 1KV1A 3R6XA 2RKUA 4YP8A 4EQCA 3EYGA 3OHTA 3E5AA 2QHMA 2VWWA 2X8DA 4ZP5A 4DEAA 4KBCA 4E1ZA 4CLJA 4PPBA 4BKYA 5HBJA 4I0SA 5AAEA 1GIHA 4NW6A 5CZIA 4BKJA 4NM7A 5FTQA 4ERWA 1OUYA 3R1QA 4HVSA 3R2YA 5LWNA 3IK3A 2WOTA 5HNBA 3BU6A 2F2CB 3AMAA 1Y8YA 4FOBA 3W10A 4QQ5A 3I6UA 1IG1A 2UUEA 4UMRA 4GV1A 2G2HA 1OKVA 3CQUA 3RMFA 3BWJA 2EU9A 4CQEA 5D7AA 5FGKA 5JFVA 2YM7A 4AXDA 1YKRA 1O9UA 2YAKA 1CMKE 4EHEA 4U7ZA 4RVKA 5CEMA 4EYJA 3K3IA 5JZJA 1FMOE 3KVWA 3I4BA 2R3JA 4FKRA 5BUJA 4TYJA 3UDZA 2QHNA 2OBJA 4CMUA 4JBOA 1ZYDA 4JR3A 4YPSA 1JBPE 4C2VA 3LFBA 1MRUA 2BRGA 5FWKK 4NYEA 2XJ1A 5KBQA 4IE9A 3PXFA 4KS7A 4WNKA 3UC3A 3MV5A 2WEIA 4Q9ZA 3BLQA 5FUTA 2GU8A 4IAZA 3C9WA 2ITPA 2QONA 3LCSA 4CZTA 3L9NA 2XKCA 2YACA 4KIKA 4FV5A 4ANMA 3AD5A 5KKRC 4HGLA 4ACGA 4AZTA 2R3QA 4E7WA 1F5QA 4FV1A 4GK4A 3OCTA 3SG9A 2X2MA 4FG7A 5AM7A 2XA4A 5AA9A 4ITIA 3VRZA 2J6MA 5CQUA 5BUIA 2EWAA 4FYOA 2JLDA 1BI7A 4AA4A 3CBLA 4EBVA 2I40A 3MVHA 1O6YA 2X6EA 3PWYA 3ZLSA 4XG9A 4K77A 1IR3A 3C4XA 4EZ5A 4YZNA 2HCKA 3KRJA 3BKBA 4EL9A 3LFQA 3UOLA 4AUAA 5I9XA 4DEBA 2BUJA 2I1MA 3UZPA 4I93A 4PRJA 4XJ0A 3PXKA 2VTPA 4XS2A 1Q41A 3MIYA 1PJKA 1STCE 3O17A 5HCYA 4M12A 4GCJA 3W55A 4QP1A 5HX6A 4OUCA 2FVDA 3QTRA 3TUBA 3FSFA 4PTGA 3V5TA 2OSCA 4M66A 1H08A 3F2NA 4MH7A 5EDPA 1HOWA 2UZLA 3R7YA 2BZKB 2J0IA 2YM8A 4QMUA 3CY3A 3H9RA 5LOHA 2ZDTA 3G9LX 3OVVA 4O84A 4HGSA 1WVWA 2XZSA 3NIEA 4O7ZA 4FR4A 1PMVA 5I0BA 4TNBA 2XRWA 1U4DA 3WZUA 2YIQA 3GCPA 5IQAA 3ELJA 4LV8A 1ZYCA 4IX6A 3P5KA 3MGYA 2R2PA 3UC4A 5IQCA 4KAOA 4MQ2A 2VU3A 3OF0A 4KBKA 2XCHA 3BIZA 3LFEA 5J5TA 3KVXA 4EJ7A 2UZOA 5CTPA 3ULIA 4H39A 3VVHA 2JDTA 1JWHA 3QFVA 4IIRA 4IW0A 3D9VA 5FG8A 3C13A 2XNPA 3NNWA 5IA0A 4ENXA 2XYUA 2XK7A 4C8BA 1PXLA 3KB7A 4MKCA 3EB0A 4YZMA 3DAEA 2YCSA 5JT2A 4FKTA 2PUIA 4G3EA 4LMUA 5C9CA 5A4CA 5KMMA 4YC8A 4FKQA 4XV2A 4KSPA 4ZXTA 3UG1A 3FLZA 4CFUA 2J51A 3R0TA 4AN3A 4I5CA 4L44A 3KRWA 5CWZA 4YZCA 4D4SA 1QL6A 4L67A 5AUUA 3NSZA 4FK3A 3W33A 1IEPA 2I0HA 3OCSA 1NA7A 3LFFA 3Q6UA 3RM6A 4AZWA 4EH5A 5IUGA 4BBEA 4V04A 3ZYAA 4Q5EA 5H8BA 4U79A 3D5VA 4JQ7A 1KUTA 3OTUA 5ETFA 4JJRA 4U41A 3B2TA 4FKIA 5IPJA 4A4OA 4NUSA 2XBJA 3ZO2A 3NW5A 4A9UA 4BR3A 5KNJA 3VULA 1DI8A 4U80A 4E20A 5K5NA 4ACDA 4ASZA 1Q5KA 3MPMA 5HD4A 1LUFA 3NMUF 1M2QA 2YIYA 4IZYA 3HMMA 2ZV9A 3C51A 3I0OA 3BL7A 2HZNA 3LFNA 1JNKA 3UQFA 3ZFMA 3HMNA 4S32A 4FSTA 3UOKA 4RJ5A 4C36A 2CGUA 4USEA 3TMOA 3MA3A 4I4EA 4E4XA 5CSVA 4F6UA 2X2KA 4ZMFA 2EXCX 2YJRA 4OTFA 4OT6A 3VHKA 2IZTA 3GT8A 3NW6A 5JQ8A 2X2LA 4RWJA 5JRSA 1L3RE 4E93A 4R7HA 4AFEA 5DRDA 3RPYA 4P5QA 4DFYA 3RI1A 3BBWA 5ITAA 1R39A 4I21A 4H58A 5G6VA 3I6WA 2YCQA 3ZSIA 4ZAUA 3W0SA 2OXDA 3EQIA 3P4KA 4AE9A 2WQBA 1YQJA 5A6NA 3QQLA 5AUTA 3OTVA 4RIXB 4XOYA 4G17A 4BYJA 4FV7A 5AR3A 4WG5A 3UYSA 1LEZA 4HOKA 2JAVA 4H36A 4AGDA 3R8VA 3G15A 4BTKA 5CVFA 3H0YA 1YWVA 4GJ2A 3EN4A 3QZHA 3CSVA 4F08A 5B0XA 2JIVA 5IA3A 3MA6A 4DBNA 2UZWE 3DFAA 2HIWA 2QU6A 4EQMA 4BCQA 2CPKE 4WG3A 4GMYA 3ZO1A 2XJ2A 3FZSA 4OAUC 3VS0A 3TDVA 1YXSA 4JIKA 2WMQA 3R83A 3GENA 2XM8A 1U5QA 3DK3A 2KTYA 4E4LA 2C6EA 4ALWA 1AQ1A 1YVJA 4I0RA 1L8TA 3BLAA 4LGDA 4AAYA 5BVKA 3PP0A 4B6LA 2PZIA 4C4IA 3HGKA 4U44A 1OMWA 3NNUA 2YWPA 2OIBA 4JNWA 5DFPA 2C1AA 4F9BA 2C0TA 3WF8A 3EZRA 3QXOA 3IGGA 3OMVA 3ZFYA 3PUPA 5GJDA 3DNDA 4YJUA 3B8QA 3K3JA 2VWIA 2ZJWA 1UNGA 3ALNA 4LRJA 3PA4A 3HV6A 4QMZA 3D5UA 4JDJA 3EL8A 3IW6A 4NTSA 5ANIA 1Y91A 4G5PA 3RCDA 4HPTE 4A4LA 3GC7A 4CV9A 2R3GA 5EW8A 5DI1A 5M51A 3V3VA 4C59A 3FZTA 3HV4A 4TYHA 2YJSA 2BIKB 5A14A 4NL0A 1PXNA 1XH4A 3PSBA 5HTBA 5HG9A 4X21A 4BDAA 1W8CA 5CF8A 2BPMA 1CKPA 3QC9A 4RX8A 3TCPA 4CSVA 3U8WA 4X2GA 5H3QA 2QR8A 1T46A 3RAHA 3ZTXA 1VZOA 2XB7A 2UVXA 2IG7A 4EHZA 3UOJA 5CEKA 2A27A 1W2FA 1XH5A 2AUHA 2QOQA 4LL5A 5HE3A 3TV6A 1ZY5A 1KE5A 1R0EA 3FKLA 3V5WA 2VWUA 3PZEA 2JC6A 3I81A 3UQGA 1YHVA 4RIWA 5IDNA 4TZRA 4PF4A 4ZMEA 4BJJB 2PVMA 4ENYA 1H07A 3QCSA 3BCEA 3R7GA 4I22A 2BR1A 3TNPC 2WTIA 4C4GA 4CVAA 1VR2A 1X8BA 2XKEA 1IAHA 2H9VA 1GY3A 2IWIA 2W1GA 1NT2A 1JSUA 1U54B 2OJIA 3CP9A 4FZAB 4CRSA 3W2CA 4RIXA 3G0FA 2CKOA 4O27B 3SHEA 3IECA 2GDOA 3UMXA 4FNXA 4QPMA 4M14A 4QMOA 5DG5A 5I3RA 3F3WA 3NEWA 1PXOA 3EN5A 2BIYA 1LR4A 4M69B 5EHYA 3A7HA 5HVKA 3SW4A 2R3LA 4OT5A 2YFXA 5AUYA 4O82A 1Q8ZA 4IM0A 4MQ1A 2X4ZA 5GIOE 3ZC6A 4PY1A 1XWSA 5EI8A 3AC2A 5C1QB 3A7FA 3KULB 4ASDA 2C68A 2JKMA 3MSSA 4J7BA 4XBRA 3VO3A 2QD9A 3LQ8A 3PA5A 4C35A 2C3IB 5HU3A 4MXCA 2XK4A 5D10A 4QP4A 3PG1A 1K9AA 1JLUE 4RVLA 4BHNA 3QALE 1R78A 3KRLA 4O7WA 3TIZA 3V5QA 2XIYA 5BVNA 4V0GA 4F1MA 1G8JA 4FTTA 4EKLA 3QA8A 1O6LA 5EM6A 2C6LA 4FTUA 1FOTA 4EK3A 3VW6A 5M4FA 3VQHA 3U55A 1UU8A 1EH4A 5L2QA 2C5VA 3SOCA 2VTQA 3ZONA 4U97A 4FEUA 3Q52A 4EH6A 3HP2A 1GZNA 3MY1A 4FBXA 3ZLYA 4DLJA 3NUNA 3S4QA 3V8TA 4FKJA 4CXAA 3RALA 4DFLA 5DMZA 5LWMA 3DV3A 3EJ1A 1LP4A 1OB3A 3D15A 1RJBA 3BYMA 2WIHA 3KXGA 1GZKA 4BGQA 4F0GA 2WTWA 1J7UA 4DHFA 5IU2A 4BB4A 3KGAA 4RC3A 4BL1A 5E8TA 3A7GA 5F95A 3D83A 1AD5A 4IAYA 4ZK5A 4XUFA 4BCFA 4AXCA 3KF7A 4CRLA 4RX7A 2F4JA 3IONA 3CGFA 3NVKI 2NO3A 3VBQA 5K4IA 3BGZA 3V5PA 2BROA 4WD5A 1M52A 4C4JA 3IOPA 3ZOSA 4CYIA 5DWRA 2QQ7A 3FQSA 4M0YA 5HGIA 4AA5A 5EQPA 1H1PA 2J7TA 3ZHPC 3ZEWA 4K18A 5HEZA 3CIKA 3FLQA 4E5BA 2UW9A 2C6MA 2BTSA 4BWKA 3NUUA 5DBXA 1YI4A 4KRCA 4DT8A 4BCOA 3ANRA 4AOTA 2NPQA 3OC1A 4JL9A 3PUFC 4FZ6A 2WMAA 2UW7A 3OUNB 5AM6A 1YI3A 3QX2A 3CKWA 4UEUA 5CENA 4M15A 5HOAA 4FEWA 2W06A 3CE3A 2X0OA 3FY2A 3I7BA 5CQWA 3A7JA 3I5ZA 4E8AA 2R4BA 3RWPA 2CLQA 2PVHA 3F9NA 2QOHA 4EWQA 2AEGA 3DZOA 5C4LA 5IQHA 1JKLA 4F09A 4AAAA 5GZ8A 3TTJA 2O0UA 3UIXA 4C58A 4MNEA 3VF8A 5L2SA 2YERA 2W7XA 2W4JA 2E9NA 4DFUA 5ANKA 5J7BA 5HVJA 4YTIA 4EBWA 2QO2A 3FHIA 4IAKA 2W4OA 4R1VA 1ZLTA 3QRKA 4IX3A 3QC4A 2FO0A 5AFVA 3E93A 3C4ZA 3WF7A 4EH2A 3M42A 1OKWA 5CU6A 4K6ZA 1J7LA 3PY3A 5IEVA 2E9UA 2F7ZE 3LCTA 1JSVA 4G34A 3E3BX 4D4YA 2GTMA 1J1CA 1F3MC 2ZM4A 5AP1A 2OLCA 4QDEA 4XG6A 3BI6A 3GEQA 3OP5A 2W05A 4AWIA 1PMNA 3MH3A 3Q32A 3IO7A 4KUJA 3EFLA 1OVEA 4RLLA 3QKKA 1H25A 5CSWA 4QMYA 5E1EA 2BHEA 4DBXA 1OUKA 2OJ9A 5AUVA 1NVSA 5IF1A 4DEDA 1OM1A 4EONA 2Z2WA 3EH9A 3ZDUA 3ID6C 1W84A 4IB0A 3FC2A 4BTMA 3FAAA 3MY5A 5HO6A 5ETCA 5CEPA 3PXRA 2JD5A 2B9IA 5CNNA 4HYSA 2BRBA 3Q4CA 3HAVA 5H8GA 5DEWA 3NRMA 5H8EA 3VS1A 4F1OA 5KE0A 3QCXA 4X0MA 3C0GA 1OPLA 4P5ZA 3S3IA 3WZEA 3EZVA 2HY0A 3ZZEA 3NDMA 4ANBA 4FIFA 1CM8A 4MF1A 3RPVA 3PIXA 1M2PA 5A4TA 4PP7A 3PP1A 4NK9A 2QKWB 3BYVA 4BI2A 5FEQA 4BDEA 5IUIA 3O50A 5KMOA 5DA3A 2IW9A 4FTJA 2C1BA 4W8DA 2E9OA 2UW6A 1GZ8A 4QP3A 4IZ5A 5C8NA 4GVJA 4WRGA 3NUAA 4FE2A 3PFQA 3D7TB 2UVYA 5J5SA 2HXQA 2WTKC 4IVDA 3GGFA 1OKZA 2WMRA 4XP2A 4BWXA 4YTFA 4W4YA 1WMKA 4DE4A 2WIPA 3TNQB 3KY2A 5B2MA 3G6GA 4BVUA 4QTEA 3JPVA 4D1XA 1YWNA 4YUQA 2C6KA 3HDNA 2R3RA 2IF8A 4GVAA 4NTTA 4RBLA 4R7BA 5EYDA 2OG8A 3DNEA 5DE2A 5J9YA 4U43A 4DAWA 3QF9A 1WVXA 5HG8A 4FZDB 4MYGA 3NS9A 3NFFB 2JAMA 1P5EA 5I5ZA 4L45A 4Y5QA 1IA8A 3RPRA 3H0ZA 2BMCA 4YLLA 1BMKA 3KU2A 4G5JA 2ETMA 4D0XA 4NFMA 3U4UA 2BFYA 4TNDA 2X4FA 5EOLA 2VO0A 4C62A 3IDBA 4FG8A 3WZDA 5E8YA 2OWBA 2ETKA 2QODA 2RFSA 2CKEA 4JI9A 3OY3A 5FQDC 3HV7A 3R1YA 2OZAA 2YIXA 4KWPA 5AV3A 2E9PA 2QVSE 3BBTB 3MW1A 5KHWA 2YEXA 2ITTA 4CT1A 1URWA 3MH0A 4FRFA 2BDFA 4KB8A 1WAKA 2FUMA 2RSVA 4LM5A 3G9NA 4AP7A 4ITJA 2ACXA 3W0QA 3BV3A 1P2AA 3L8PA 2PY3A 5DRBA 5ANJA 5FRIA 5TO8A 4LGHA 3WOWA 2YDJA 3GBZA 4E73A 1WBVA 2GTNA 3A60A 3QTUA 4D2SA 2ITYA 1REJA 1VJYA 4HCTA 4RA5A 5M4UA 4AZFA 2X6DA 4O86A 5F20A 3QWJA 2B52A 2WELA 2Z7RA 4DF3A 2FSTX 4NIFB 1ZMWA 5CNOA 4AGUA 4R6VA 2UW5A 3GU5A 3VNTA 1KOBA 4AS0A 2LAVA 1A06A 3DPKA 1YWRA 3OCBA <