5BVFA

Tetrahydropyrrolo-diazepenones as inhibitors of erk2 kinase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
350
structure length
327
Chain Sequence
AGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVRWYRAPEIMTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Tetrahydropyrrolo-diazepenones as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 327
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bvfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bvfA01
3RAIA 4I24A 1UNHA 2VRXA 5I3RA 1APME 3KF7A 3II5A 3G90X 2GS6A 4CVAA 3ZH8A 4TWPA 5CZHA 4IMYA 3CKXA 3PZEA 3ORMA 4C8BA 4CZTA 2BHEA 5BUJA 1TQIA 1XBBA 4XP3A 1U54B 3LMHA 3ZEPA 3ORNA 5HG9A 3MPMA 5E8SA 4AA0A 4BGQA 4P5QA 3ZZEA 3R04A 3O50A 4W8EA 4KINA 1H26A 3KXZA 2PL0A 4QNAA 5HCZA 4EZ5A 4R77A 4DN5A 5FM3A 1BI8A 4Z7HA 2UZNA 2XK6A 4TTHB 4UALA 2BRHA 4DLJA 2FSMX 5JSMA 3BZ3A 3FKLA 5AP7A 2GHGA 4N6YA 4IJ9A 4FKQA 4P4CA 5FTQA 3FZOA 3N9XA 3QD3A 4K2RA 5HE0A 2AUHA 4LM5A 1X8BA 3MH1A 1UKHA 1VYWA 4O38A 4EOIA 4L7FA 2XUUA 3F61A 4GG5A 5DLSA 4V01A 4OT5A 4RC3A 2OJFE 5H8GA 3DK6A 1UWHA 4Y46A 3KU2A 4EUTA 2Z2WA 2C5NA 2PHKA 3BX5A 5C4KA 5HEZA 2F2UA 1GIHA 2X8IA 3VBWA 4PL3A 2ETKA 4F1MA 3NNUA 2Z02A 4KA3A 1UU3A 4OTRA 4R1VA 4C7TA 4PQNA 3QTWA 3Q4UA 4UWBA 3T3UA 3BU3A 1XH6A 1OKVA 3Q4CA 5IPJA 2IN6A 2PVHA 2WU7A 3R28A 2CLXA 5E8UA 5HZNA 3JXWA 3G2FA 4EK6A 4LMUA 2XIKA 2PMLX 2VX3A 3AGLA 4IAKA 5IZFA 3DJ6A 4H1MA 3TUDA 2BAJA 2ZV9A 4FV9A 4QT1A 5LMAA 4C4FA 3BPRA 5A4EA 1OL6A 5FXSA 1OMWA 4O7WA 4K1BA 3SD0A 3FYJX 4X3JA 4F0FA 3BWFA 3TCPA 4BI1A 5B7VA 4L3LA 5LMKC 4IAFA 3DK7A 3UOHA 4CG8A 1FINA 4KRCA 4F9CA 3D7ZA 2W5BA 4DG2E 3LKMA 3FXZA 2ZDUA 4MHAA 4QYYA 5T68A 3UQCA 3LVPA 2UW5A 4R7IA 3W32A 4UN0C 3VUKA 5CVGA 3HMIA 3RP9A 3DBFA 3LM5A 4QQ5A 4QMXA 2XZSA 1E9HA 2HXQA 4W8DA 3UMXA 5KX8A 5AADA 4O0VA 3U87A 4AZFA 4YZDA 2JBPA 4BRXA 3UODA 1J7UA 4E8AA 4A9TA 5CALA 4G17A 3ANQA 4CKJA 3F2RA 2WEIA 4QTDA 3QKLA 4WBOA 5M4IA 4IVDA 4C59A 3EWHA 4GMYA 3P08A 3UE4A 2PYWA 5IEVA 1J1CA 2F7EE 2OKRA 3RHKA 3EFJA 4C3FA 2A1AB 3C4ZA 3GU8A 4MXCA 3AOXA 1PMEA 2J51A 3HMOA 3L1SA 5CT0A 3LJ0A 4WSQA 3TUCA 2WTVA 2RFNA 1YVJA 4WD5A 5DT3A 3ZONA 3EQPA 5KZ0A 4LOOA 4M69A 4BCNA 5AIKA 1YOJA 2OH4A 3AT3A 3E93A 4LV5A 4V04A 1Y8YA 3KREA 2Y4IB 2W1ZA 2QOKA 5EM8A 2X7OA 3EZVA 4OTFA 4F0IA 3SXRA 3VBQA 1YDRE 2XK4A 3VS2A 4BGHA 4GFGA 3N4UA 3R9HA 3ULIA 4MXYA 4P7EA 2WQNA 3DB6A 1B38A 2ITOA 1R78A 2QODA 3ERKA 2BZHB 1W0XC 2Y6OA 3C1XA 4F9YA 5K0XA 3QXOA 3O51A 4JJRA 1H01A 4CFWA 5CU4A 5L8JA 3C4WA 1ZXEA 3OBJA 4B8MA 2HWOA 4FVPA 4U80A 4KNBA 4LMNA 5E8YA 5C27A 2XCHA 4AW1A 5EW3A 3CTJA 5BVEA 4CRLA 3LHJA 5BMMA 5E8VA 4A07A 2R3IA 4D28A 3PIXA 3K3IA 4OTWA 3G6HA 4WT6A 3R71A 4YJVA 5CY3A 1JKSA 5CANA 5L2QA 2VV9A 2GNLA 4XG2A 3PRFA 2BAQA 4RJ3A 2XNOA 2C47A 2ZMCA 3PLAE 3MBLA 5JT2A 1ZARA 4FSYA 4DAWA 3FXXA 3JY0A 3QYWA 1YWVA 1FVRA 3IOKA 1ATPE 3RVGA 4HVGA 1UA2A 1OECA 4ZMEA 1GIJA 2C4GA 4DC2A 4IWOA 4BIEA 4FSNA 3GQIA 4E6CA 2YZLA 4CV8A 3CPCA 2RL5A 4EQUA 4DEDA 3MA3A 2XNBA 5AP2A 3MPAA 4PRJA 3ZLYA 4ZLZA 4DGMA 2XIXA 3CP9A 4DH1A 2UW9A 3DXPA 2QKWB 4ZTQA 3QALE 4JVGA 5A4LA 4L46A 1V0OA 2SRCA 4U43A 4I93A 1OUKA 3N4VA 5AAEA 2ONLA 3C9WA 3QBNA 4KBCA 4M0ZA 3MV5A 3E8DA 4PNIA 4JIKA 2V0DA 5HE1A 4DF3A 4O1PA 1YI6A 4QP8A 3VQHA 4FV3A 1RJBA 4C36A 3MY1A 3KRJA 3FLZA 3HUCA 3VS1A 3K54A 4UWYA 3NYXA 5AV4A 4FEVA 5BVKA 5BYYA 2WTKB 4IZ7A 3RAWA 1OBDA 3KXMA 4CFXA 2HCKA 5LOHA 2H9VA 4FR4A 3U4UA 4AW5A 2PZIA 4FI1A 4DBXA 4B7TA 5ACBC 3NZ0A 3UQGA 1CTPE 2YM3A 1H25A 4HVDA 3VQUA 4DFZE 5A14A 5IU2A 4HOKA 4TNDA 1GAGA 4QP3A 4ACCA 2IVTA 3MY5A 2UZOA 3LQ5A 4DFLA 3QRUA 2OICA 1E1VA 5IUGA 4C57A 3QTXA 2CLQA 3R7EA 3NVMB 4O86A 5FQDC 4HZSA 3JY9A 4NCTC 4YBJA 3WE4A 3F5XA 3VUTA 4XP0A 5FTGA 4FKRA 4QPSA 1ZYJA 3VC4A 5HIBA 2E9UA 3FWQA 4YTIA 3WF5A 2VTMA 4AT5A 4D5KA 3FMJA 4JOAA 4AUAA 4BF2A 5AP6A 5AA8A 4O82A 4C62A 1OPLA 3NDMA 3DNEA 1W8CA 5E1EA 5FEQA 2VO3A 5GHVA 5IA1A 4IM2A 1Q8WA 3U54A 5CSVA 2V62A 2H6DA 5I9VA 5E1SA 5FP6A 1H1WA 3AT2A 3G51A 5M53A 2XKEA 4TYGA 5HESA 4X2FA 1P5EA 4AN2A 4WHZA 3QWKA 2X6EA 3P1AA 4NTTA 2GTNA 4O7NA 2GNGA 4RQVA 2FB8A 4NW5A 2X6DA 4AZWA 3NGAA 5HO7A 4FTJA 3C0IA 3DOGA 1L8TA 3OCGA 3V8WA 4KS8A 4L42A 5KNJA 4EK3A 4HNIA 4DG3E 4KIKA 1Q97A 2GPHA 4J71A 3DQXA 1GNGA 2ITTA 3KXNA 4FTOA 3GC0A 5EM7A 5IA5A 1H1RA 4R8QA 3PXFA 3R6XA 3PY0A 4YURA 5CNNA 4FT5A 4QMVA 3G9NA 2LAVA 3W55A 3QC9A 3CGOA 4FSUA 1YXSA 5AM7A 3TV4A 1ZMUA 5KMKA 3NW6A 2FSOX 4QP1A 1PXIA 2YHVA 1RQQA 5FLFA 1KSWA 4X21A 3UPZA 4P5ZA 5KCVA 4I22A 4XRJA 4H05A 3I81A 4L8MA 2WHBA 2JDOA 4AGUA 5HLWA 3EB0A 3UQFA 3OROA 5CVHA 1M14A 3ZFMA 5AP3A 1K9AA 3IPHA 4JQ8A 2XIRA 1OVEA 4F4PA 1ZYSA 3HYHA 2WELA 5L6WL 3UG1A 5AEPA 3CGFA 2HY81 4XOYA 3ZC5A 3FC1X 4CSVA 3MTLA 4FIHA 4HGSA 3QL8A 3ORPA 2X2LA 4IX4A 5HICA 4HPUE 4GKIA 2QOLA 4FG9A 3GENA 5D12A 1ZOEA 3GC8A 3VUGA 3SRVA 4JQEA 4YJPA 4JXFA 4AW0A 2JKOA 4FKPA 3UPXA 4CKIA 2XF0A 5IQIA 3UNJA 5EQEA 3R22A 3FSFA 5AR5A 1JSTA 3OF0A 3GOKA 4TT7A 3RPRA 2R7IA 4OTGA 4PV0A 4AA5A 1JAMA 4O96A 4GV1A 3TTJA 1Y8GA 2B0QA 1MRUA 4M3QA 4TYJA 4FA2A 3OHTA 4YJQA 5C4LA 3QCSA 2F4JA 4XLIA 3R83A 3ZHPC 1FGKA 5G1XA 3D5WA 3PXQA 5BNJA 3D14A 2PVMA 3QA0A 4ZLYA 5LQFA 4KIPA 2BAKA 2VTRA 5CEPA 5LWNA 5I0BA 3RAKA 1MQ4A 3VJOA 3WZJA 1H24A 3C4FA 3V5QA 1DI9A 4U97A 3MY0A 4YHJA 1M52A 4CGAA 5IQHA 1XH4A 2BDJA 3L8PA 3UIXA 4YSJA 5AV1A 3ETAA 3R8VA 2QLUA 2JIIA 4QMSA 3E8CA 4DFBA 2YIXA 3E64A 2YM6A 3MN3A 3QRTA 4ZEGA 1FMKA 4EHEA 1ZRZA 5K5NA 4WG3A 2YM7A 4G3GA 4LGDA 5D9HA 1OGUA 5B2KA 1PHKA 2OZAA 1YXVA 3FI8A 2W5AA 2BCJA 3UTOA 3VS5A 2ITZA 3LFSA 4W9XA 2Z7SA 5E8ZA 4APCA 3PE1A 4ZZNA 3BHHA 5GJFA 1G8SA 2PVKA 4DFXE 4EYMA 1PY5A 1BL7A 2FA2A 2R3KA 3AQVA 1A9UA 2NPQA 2O5KA 4I6FA 4NSTA 1UU9A 5ANOA 5EHYA 1IAHA 2VWIA 3NYOA 3IW8A 5EM5A 2PVLA 4XP2A 1U5QA 5GZAA 1YDSE 3ZEWA 5M4CA 2PZRA 3FZ1A 4M69B 5HHWA 3VIDA 2C3JA 3VRZA 4IWDA 3HVCA 4IE9A 4C3RA 3ENHA 3ZUUA 4BI0A 3ZM4A 3DAEA 4E4LA 4NM0A 4I5MA 4BDBA 3UC3A 1J91A 3RNYA 5LWMA 4O0RA 2R5TA 4ZAUA 5H8EA 4O7TA 5AV2A 4V0GA 3CQUA 4YTFA 5AUVA 3MPTA 1J7IA 5ANJA 5HORA 4MD8E 1JSUA 4C02A 5C1QB 2VU3A 4WA9A 1BYGA 1ZMVA 4NKAA 3F7WA 2BZJA 3BYVA 2B9JA 2WAJA 4P90A 4TY1A 4YNOA 1WAKA 3QTZA 3R7UA 4QYHA 4CT1A 4DBNA 3U6HA 2CHLA 3TIZA 4TNBA 2XYNA 4Q9ZA 2CGVA 4HYHA 4BR3A 4M14A 5DT0A 4I5HA 3VUDA 3V6RA 5L8KA 4A9RA 4MYGA 3UO6A 4BCGA 4TWOA 4F64A 2CKPA 4QYEA 5IQCA 4FG8A 4MXZA 4CFVA 3TV6A 2YLFA 3NAYA 3R2YA 2BVAA 2WO6A 1LP4A 5EW9A 3Q60A 4L6QA 2C6EA 3IGOA 4O21A 4AOTA 4EH8A 5CQWA 2WTCA 2C5YA 2ETRA 3DZOA 2JDVA 4YZCA 5C8KA 3OW4A 4O0UA 3C0GA 3DFCB 3I0QA 2ZV8A 4WUAA 2QI8A 4W4XA 4EBVA 4YJNA 2WXVA 3QAME 4OBQA 1UWJA 3C51A 3AD5A 3IW5A 3QCQA 2J9MA 4PP7A 4XJ0A 1AGWA 3UVPA 4QMOA 4GIHA 4ZXTA 3AC1A 2HAKA 1KV2A 2ERKA 3JS2A 2GNJA 3PIYA 4O81A 4M68A 4DA5A 4PMTA 4UMTA 5DMZA 4NUSA 5A46A 1HCKA 2CGXA 4IVBA 4QYGA 3DKCA 2NRYA 2PE2A 3FKNA 2B52A 1E1XA 2GDOA 3H9OA 2Z8CA 3U9CA 4U81A 4OTHA 2QQ7A 4OR5A 4DH5A 5GNKA 3TV7A 4AE6A 5CF6A 5LVLA 4MX9A 3VN9A 4TWNA 4CNHA 3AMAA 2ZJWA 4G34A 3FAAA 5L2SA 4JT3A 1QL6A 3KXXA 4UYNA 3DAKA 3AD6A 4FTQA 4YJUA 3IW7A 4RX7A 3OOMA 1JKKA 2XCKA 1LEZA 3SG9A 4K0YA 2VO7A 3SC1A 3DY7A 4YHFA 4YBKA 3RCJA 2C1AA 1M7QA 2XKCA 4YR8A 4F7JA 5IG1A 4HVSA 5M57A 3K3JA 3LQ3A 4DE4A 2IZTA 1Q5KA 4IH8A 3GU7A 4FSQA 4C34A 4FIEA 1Q3WA 4X6QC 4KKGA 3ORKA 3DKOA 1UNGA 4FV5A 4GK2A 4DT9A 3H9RA 4ZY6A 2E9VA 2PU8A 4PNKA 4ZSEA 2BRMA 3VJNA 2JEDA 3DB8A 2R3GA 3I6WA 3HA6A 2R0UA 3EN5A 4PWNA 3CD3A 2Y4PA 5AR8A 5IMXA 3QX4A 2GNIA 1BL6A 1KV1A 3BGZA 3HP5A 5EDPA 1CSNA 3SXFA 1WZYA 4ARKA 4DEEA 4ZS4A 3QZFA 1YQJA 4RSSA 2JC6A 2EU9A 3S0OA 5CXZA 3CY2A 2OI4X 3V8TA 2EVAA 3PJCA 4E3CA 4DTBA 2WMUA 3PG3A 3DXNA 4NTSA 4OT6A 2XP2A 3GQLA 2F2CB 1JNKA 4RLKA 3EMGA 3AC2A 3OT8A 4MF0A 3IGGA 4O2ZA 3UP7A 5LVNA 5IH4A 1XKKA 3BHTA 5H3QA 4MVFA 4TRLA 4D4VA 4D2RA 5KMIA 2PULA 2CN5A 5CSHA 4ERWA 2IW8A 2FO0A 2W4OA 5DVRA 1WBNA 3ODZX 2VTOA 4EOSA 3IK3A 5AAGA 4UEUA 1ZY4A 4RRVA 4GU6A 4QQJA 3HECA 4YPDA 4AGCA 2GSFA 4L3PA 2WQOA 4NIFA 2GFSA 2UZEA 4D2TA 3VW8A 1GZNA 3GOPA 3Q9XA 4XYFA 5BYZA 4CFNA 3CD8A 4KKHA 4YLJA 4EQCA 4N70A 1EH4A 2ZB1A 4D2PA 3P9JA 4FYNA 4D1ZA 5F95A 4Y72A 5AR4A 1BMKA 2Q0NA 3CR0A 4UXQA 5IDPA 1OIUA 2W1EA 4LOPA 4C0TA 4A9YA 2PK9A 3ODYX 4E1ZA 1YXXA 4A9UA 1VZOA 4OBPA 3OMVA 4DCEA 2YCRA 5GZ8A 3POZA 3TI1A 4ZLOA 5CEOA 2OK1A 2WMSA 2PZ5A 1OPJA 4FK3A 3V04A 2HK5A 4CFUA 4FNXA 5IUHA 1ND4A 3SRVB 5AJQA 3QTIA 4IB1A 3VHKA 3VHEA 1PXLA 2BIYA 3D0EA 4I5CA 1R3CA 5CX9A 2O65A 4A4LA 1PYXA 2CJMA 4YC8A 1WBWA 2Y0AA 1URWA 3HLLA 5D11A 4O0XA 4RJ8A 4WOVA 3ZMMA 4AGDA 3D5VA 1H8FA 4PDOA 2WZJA 1CKPA 3NYVA 3NYNA 3PTGA 2QOCA 3VO3A 3R9OA 4GVJA 4L00A 3QKKA 4M84A 5TE0A 2XKDA 4RLLA 3A8WA 3R00A 3A7IA 3NIEA 3L8VA 3PFQA 2ZOQA 3NUXA 3RKBA 4FKWA 4XNEA 5HE2A 5M4FA 4FSRA 4ZZMA 2XB7A 1XO2B 5ETAA 4MNFA 4XV3A 2C6IA 4W4YA 4O0SA 4PY1A 2ZDTA 4M8TA 3BI6A 2UW6A 2UW4A 4BZDA 4CQGA 4M0YA 4EK8A 2WOTA 1VYZA 3EQBA 3E3BX 2B54A 2FVDA 4GH2A 3CJFA 3RMFA 3UP2A 4XH6A 4DITA 5EK7A 4LL0A 4X3FB 2OZAB 3LFEA 3MFSA 5JK3A 5BQ0A 4QMQA 5DH3A 1UKIA 2WQEA 4PPCA 2ITVA 4E73A 4FZDB 2W1CA 4FOCA 4BFMA 5DA3A 3FPQA 3DNDA 4L52A 4RT7A 2VWWA 3DBCA 2W5HA 4CFFA 4F09A 1I44A 4RMZA 3DLZA 1OITA 1YWNA 2YIWA 4FUXA 2O2UA 2YABA 4X2KA 2OH0E 3DBEA 3LXPA 3RZFA 3TNPC 4OGRA 5CAPA 3P4KA 3HKOA 2W17A 4JDIA 3V6SA 4L44A 3HV6A 3QQLA 3M2WA 5FGKA 3ANRA 3VS7A 3DKGA 2A27A 3KRLA 4ANLA 5IH6A 4B8LA 4XBRA 5CASA 3FI2A 5LXMA 4DTAA 4EHVA 2KTYA 5D41A 5CI6A 3ZCLA 2VO0A 1LEWA 3A4OX 2F49A 3A62A 4V0GB 4F7LA 5J7HA 5CEKA 2FYSA 2GS2A 2HZNA 3BYUA 4RX8A 4RZWA 3UO4A 4ANSA 3FL4A 5FBNC 3DJ5A 3DJ7A 3KULA 2IZUA 1BUHA 3Q9ZA 5I9ZA 4EWQA 1J7LA 1K3AA 1NVQA 2Y4IC 2YN8A 3I5ZA 3PXZA 3EQCA 3GU6A 4Q9SA 2J0MB 5DR9A 2J5EA 5AA9A 5ANIA 3TXOA 1XJDA 3RJCA 5B0XA 2EXMA 3QLFA 3JUHA 5AUTA 3P79A 5CSXA 2X0GA 3KMMA 5FDPA 4HYUA 3A60A 4XUFA 3TNHA 2H34A 4FYOA 5JKGA 1OI9A 1CKIA 5JN2A 4RG0A 5M08A 5AP1A 3IDCA 4B6LA 4O7YA 5AUYA 3PVUA 1MRYA 3QTQA 3H9FA 3HV7A 5AP4A 4XMOA 2WPAA 2HWPA 3HAVA 4IAZA 4GIIA 3EIDA 4UMUA 3FMEA 2OW3A 4MH7A 3SAYA 4EH9A 1F3MC 4C37A 2NRUA 4EH7A 5L6PA 3ID6C 3SG8A 5AR2A 4WO5A 2GFCA 2YIYA 2C0TA 4FX3A 3RI1A 1OUYA 2WQMA 3RPOA 2CNQA 2JLDA 3RWQA 4EOPA 3FMHA 2FH9A 5E91A 3R8UA 2GTMA 5CLPA 4C4IA 3UZRA 5DHJA 1WBVA 3KKVA 3MH3A 5T3QA 1H1QA 3PVGA 5G6VA 4BWXA 4DEHA 4FV1A 5D7AA 3PXRA 4HYSA 2PMNX 1J1BA 1OL2A 1R1WA 3VNTA 2ZAZA 4LV8A 4FIGA 1S9JA 4FNZA 4YO4A 3O7LB 3R30A 1SVHA 2ZMDA 1Z57A 3IW4A 4D1SA 3HX4A 1ZWSA 3IG7A 4AZSA 4U40A 2ZV7A 3D4QA 4NH1A 4ACMA 3WARA 5LVOA 3I7BA 2C6TA 4FKUA 2BDWA 4QPAA 3FUPA 5ANEA 2A4LA 4G6NA 4BWPA 2E9NA 3QUEA 4OTIA 4WRGA 2V7AA 2PMIA 2GNHA 3W8QA 3QRIA 3F3TA 3DT1A 3PJ1A 5HLPA 3UIUA 2OU7A 2CNVA 3RPVA 4ZJJA 3NVKI 3W2QA 4U9AA 3AD4A 1XH7A 3ZBXA 3NW7A 4FV6A 5F20A 2XNGA 5CT7A 1PXKA 2GCDA 4ZSAA 2GHLA 4XG3A 3BU6A 2WTKC 4DT8A 5J5TA 3G0FA 2XK8A 4RFZA 5AMNA 3C4EA 4FSWA 1YDTE 3HZTA 3Q53A 4RBLA 4BCKA 4XX9A 3R8LA 4Y8DA 3VS6A 3QHWA 1IA8A 2CMWA 2QOFA 4BDGA 2J4ZA 1JOWB 1UU7A 1CDKA 3FL5A 4CRSA 3ITZA 3IS5A 1S9IA 5M4UA 1H0WA 3O96A 4O83A 2O3PA 4I5PA 2X4FA 2XEZA 3KRRA 5TF9A 4QMUA 4ZTMA 1P14A 2QOBA 4IBMA 4JX7A 4R3RA 5CVFA 5H8BA 3SOAA 3TNQB 4DINA 3I1AA 5CAQA 3HAMA 3QC4A 2X2MA 3AGMA 4H3PA 3OFMA 3V01A 3MTFA 4L67A 4BZNA 3A61A 5ETCA 2R3FA 5J7BA 2XBJA 2NNWB 4PTGA 3E87A 4MXXA 4YSMA 1RE8A 5M09A 3C0HA 4XG7A 2HY0A 3OD6X 2Y6MA 2JKKA 3AC8A 3GVUA 4LGGA 2BFXA 2GNFA 3BGPA 1OL7A 4M13A 4RIYB 3QFVA 3T8OA 1UU8A 3ATSA 1TQPA 2YIRA 4H3QA 3RHXA 4EWHA 4HW7A 4GT3A 4YLLA 3NNXA 4GUBA 1VEBA 2B9IA 4M15A 1IAJA 3EQFA 1V0PA 1ZY5A 3GC7A 2OIQA 3E62A 4ZTRA 3E92A 5JFWA 4H3BA 4HGLA 4RZVA 4BCHA 4ID7A 4BCPA 4D2VA 4FK6A 3MJ1A 3ZXTA 4NIFB 3LLAA 3QHRA 3GUBA 5AAFA 4YMJA 3VULA 4HVIA 4CZYB 1XH5A 4A4OA 5M07A 3DZQA 3VW6A 4TWCA 5JFSA 4MD9E 4J7BA 3BIZA 4PDYA 4NWMA 5M55A 3I60A 1PMUA 4D55A 2CGUA 5BVNA 3K2LA 3GFWA 1R0PA 2CDZA 4DLIA 5C03A 5K5XA 3REPA 4FGBA 3W2OA 4IX6A 2VTNA 4CYIA 3TM0A 3U6IA 2PY3A 3TEIA 4JRVA 4Q5EA 5L8LA 2YDIA 4FKSA 4BCMA 3NUYA 1YHVA 4IAYA 3ZBFA 4BYIA 4FSZA 4JR7A 4DGNA 4U0IA 3TTIA 4J97A 2J5FA 4G31A 3EYHA 4BB4A 4UMPA 5DN3A 1H00A 4Y95A 1GOLA 1AQ1A 2EWAA 4LUDA 3S4QA 3BHUA 4BDDA 4BCFA 5HBJA 5L2TA 4QPMA 3DBQA 3NUAA 3Q2JA 1M7NA 1IA9A 3OWJA 4FT3A 2P33A 2O64A 5CEQA 2YLEA 4QMMA 4EOKA 5LVPA 4YZ9A 3LMGA 3VRYA 5E8XA 1QCFA 4JAIA 4FMQA 2E9OA 4PL4A 3HL7A 3QTRA 4RJ4A 5EYKA 2XIYA 4BDEA 4D9TA 2UZWE 4KBKA 1M2QA 3F2NA 3Q32A 2R3HA 4NU1A 1NXKA 4BN1A 4FKIA 5EH0A 3TZ9A 2UUEA 3DV3A 4LI5A 5ACKA 3VUMA 3E8NA 3R0TA 4NZWB 3KN5A 3AT4A 4D0WA 3W2RA 4BDAA 4NYEA 2IJMA 4UV0A 1FQ1B 5FP5A 3FLWA 3KN6A 4S34A 4BHZA 5B2MA 5IEXA 4ZZOA 3LFDA 2QG7A 4K8AA 2YERA 3JVSA 1BI7A 1QPCA 3Q4TA 5HD4A 1NT2A 2IZRA 1H0VA 3O71A 4RVKA 4YC6A 4QD6A 5CS6A 3V5PA 4FT0A 4G1WA 4EC8A 4R7HA 3EHAA 4I1ZA 4NM7A 4R78A 1XBCA 4PPBA 3KXGA 2B55A 3QQFA 3V5TA 3PRIA 2H96A 2HZIA 5EOBA 1Q8YA 4Y83A 3DK3A 2ZV2A 3W1FA 1B39A 5JFVA 3DFAA 5KMOA 2YJSA 4FTUA 2R3PA 2X81A 4LOQA 2W1HA 1H1SA 3P7AA 4NJDA 3PVWA 4EYJA 2J0JA 5F4NA 5DG5A 4C2WA 2YCFA 3M42A 2YDJA 5TT7A 2XS0A 3IDPA 4IB5A 3UOKA 3FLSA 5LCJA 4KKEA 5EQPA 5DYJA 3R02A 3T3VA 2QOQA 3BWJA 3WZKA 3KULB 4C33A 1SNXA 2W1FA 4FTCA 1OKZA 4YLKA 4FOBA 4FZ6A 3RNIA 4XBUA 3CY3A 3HV5A 4NW6A 2HIWA 4ZTHA 2W99B 5GJGA 4GK4A 4BTFA 4O0WA 4I4EA 4XG8A 3RBWA 1XHAA 3MW1A 2HELA 5DR2A 4CD0A 3BQRA 4F1TA 4QP2A 4J1RA 4KSQA 3NNVA 4BY9E 5IKWA 3DA6A 4J52A 2DYLA 3ALNA 3FQEA 5EW8A 3O17A 2C3LA 2F9GA 2IVSA 3E8EA 4FVQA 4JI9A 4QTEA 1JBPE 3GCPA 3EN6A 2W1IA 2O8YA 4CT2A 2Z7QA 4FTKA 5FXQA 5HVKA 2XNNA 4FTIA 3R8PA 4GU9A 3HMMA 2ZYBA 2R2PA 4IVAA 3BYSA 3PSBA 3H4JA 1OL1A 4WNMA 3HP2A 4E5AX 1O9UA 1GIIA 4PL5A 5IUIA 5HG7A 3ZZWA 2QO9A 3PA5A 2HXLA 4HZRA 2IO6A 5IMEA 3Q3BA 5K3YA 5J5SA 4D9UA 1OIRA 4Y5QA 4QMPA 3RPSA 4RJ5A 2B4SB 3F82A 3EZRA 1T46A 4RWJA 5GZ9A 3S2PA 2QO2A 3FZSA 4FL3A 2OWBA 4FTTA 3PPJA 3MESA 2CNUA 5K4IA 4M66A 1GZKA 1MUOA 2WGJA 1KE7A 2OO8X 3CKWA 2FSLX 2XK7A 3UMWA 4APPA 3O8UA 4QTBA 2BR1A 2PSQA 4N6ZA 3CSVA 4KB8A 2PTKA 3KC3A 4D4SA 3OBGA 3FBVA 5BMSA 3CXWA 3QQJA 3FPMA 3R63A 2GS7A 2CSNA 4IQ6A 5KKRB 4QO9A 5TKDA 4K18A 4F9AA 1V1KA 4L3JA 2ONLC 3BU5A 4LFIA 4AX8A 5J9LA 4QYFA 4X3FA 4JG8A 3SOCA 3S00A 4D58A 1O6KA 4ZJIA 5M51A 1ZAOA 3UIMA 3JR1A 3BKBA 4IDTA 4KIOA 3SHEA 2ETMA 2OXDA 4GYIA 1Q61A 2ESMA 4JBVA 1M17A 2WTDA 4JNWA 1HCLA 2G2HA 1YKRA 2JFLA 3OC1A 4I0TA 2BILB 1FGIA 4PMMA 4S33A 3ZLSA 5KMJA 2QR8A 2OXYA 3OG7A 3OTVA 5E7RA 4DEAA 4YJOA 2BZIB 2Y8OA 1GZOA 3RINA 2IZSA 3P0MA 3DPKA 2VTJA 1MRVA 3QQUA 4JRNA 4LG4A 5ICPA 2J0LA 2FSTX 2JDRA 2CGWA 3Q04A 1OL5A 3GBZA 4USEA 5I5ZA 3NUSA 2W1GA 4OAUC 1XH8A 2AC3A 1FVTA 2OG8A 3OCTA 3BYMA 3BLQA 3TKHA 1Z5MA 4G9CA 5AUUA 1PRYA 3HMNA 3CLYA 1UNLA 2UZUE 2WIPA 4F6WA 4TW9A 1AD5A 2OIDA 3D94A 3ORXA 5BUEA 4JG6A 5AR3A 3EJ1A 4USDA 3ET7A 4BTKA 4O7SA 5DNRA 4FTRA 1R39A 2P55A 4FNWA 5EYDA 3H0YA 3QQKA 5DWRA 1KWPA 4NFMA 2ITUA 4OW8A 2P4IA 3I6UA 4QMZA 3W18A 4CCBA 5HTIA 5JZJA 3C5UA 4MBLA 3UG2A 4JBPA 4I4FA 1GJOA 3A7FA 4YTCA 2VN9A 2YM8A 4FL2A 2G15A 2R4BA 4GT4A 3C13A 3LCKA 4I20A 3NLBA 4BL1A 2I7QA 4U7ZA 2X7FA 3GEQA 2X39A 4JS8A 4AGWA 4CMTA 5BVDA 5CF4A 4IZ5A 2W96B 2XNPA 2IWIA 3H30A 4FSTA 4ASEA 2VGOA 4RIWA 4IVCA 4ALWA 3BBTB 3VBYA 4D2SA 3G33A 3CS9A 3R73A 4OLIA 4WG4A 3COHA 5CEMA 3K5VA 3PSCA 4FEQA 3RCDA 2F57A 3COMA 4ITHA 5J79A 3LFNA 1YXUA 3W16A 3BRBA 4G16A 2H8HA 1ERKA 2ZM1A 3HRCA 4OTDA 2UW7A 3LM0A 4PPAA 5IA4A 4FBXA 2VWXA 2QC6A 2OBJA 3RK9A 2VTIA 4BTJA 3LFFA 2BKZA 2X9EA 4XV2A 3P86A 3CQEA 1QPDA 1DI8A 5AX9A 4O7LA 1Y91A 4DTKA 4CFMA 2WU6A 4G2FA 2IW6A 3SA0A 4IB0A 3GCVA 4H36A 3UC4A 4AN9A 4CLJA 3UOJA 4B0GA 3MH2A 1W7HA 2W0JA 4JDHA 2NO3A 4QMYA 5ANDA 3UZPA 5FD2A 2YCQA 4MAOA 1H4LA 1IEPA 2XM8A 1DAWA 2C68A 3DQWA 5CXHA 3SW4A 1A06A 3W2PA 5J1WA 1PF8A 4FIFA 5HX6A 4L01A 4DFUA 2QHNA 5KBRA 3PLSA 5ETIA 5C01A 3OP5A 2ITXA 4OTPA 3NW5A 4BCQA 2G01A 3D7TA 3NX8A 4CTCA 4J53A 3LZBA 2X2KA 4CLIA 3G9LX 4TYEA 5H9BA 4BCOA 1HOWA 1RW8A 4AOIA 1WFCA 4EC9A 4I0RA 4C58A 3ALOA 3IDBA 2J6MA 2QHMA 1W98A 3IKAA 3WZUA 2A0CX 4D1XA 4BZOA 2YIQA 3MA6A 2PUNA 2Q0BA 3GT8A 2YCSA 1YI4A 3QZHA 2VTTA 3AC4A 4FV2A 4MNEA 4PMSA 4ZIMA 4F7SA 3EKKA 4L68A 1PXOA 4PX6A 4W4VA 5HI2A 4BBMA 1YOLA 2ERZE 1OKWA 4ZK5A 2B9HA 3C50A 2I6LA 3FXWA 1PXJA 4HGEA 3ZUTA 4FKJA 3LOKA 1KE9A 3OWKA 4BDKA 3LIJA 1GY3A 2JDSA 4YTHA 3PVBA 4E4NA 2JKMA 2RFEA 5AP0A 4NM3A 3PJ2A 4E4XA 4F1OA 3MIAA 5J9ZA 1STCE 2C6KA 4CYJA 5C9CA 4WG5A 4EH5A 5FEDA 3RZBA 2R7BA 2QCSA 4RPVA 1KUTA 4S31A 1O6LA 4HCVA 2P2HA 3E7VA 5ETFA 4ANOA 4WUNA 2C69A 2ZM3A 3LCSA 1PXNA 3M1SA 4AE9A 3A99A 5KMMA 3ORIA 4K77A 4EH3A 5CF8A 4OAVB 2HZ0A 3F88A 5AFVA 4FODA 3FY0A 3VVHA 4L45A 4RIYA 5AR7A 4JX3A 3QD2B 3TNIA 4FSMA 4RVLA 4AW2A 2QOOA 1QMZA 2UVXA 3OWPA 3F66A 2YM5A 4G3EA 4WRSA 2V7OA 5CNOA 3F2AA 3R1YA 2W06A 1KOAA 2BRGA 1KE8A 2QG5A 3FZPA 3NPCA 3PP1A 4I3ZA 4MK0A 4QP4A 2NP8A 4G3DA 3QYZA 3U8WA 3ULZA 5I4NA 4QQCA 4XG6A 4KS7A 4UZHA 3IECA 3GU5A 5CYIA 3S1HA 1SZMA 3FHRA 4ZOGA 3Q9YA 4YP8A 2RSVA 5IQGA 2UVYA 5HU3A 4IM3A 4RC2A 2J0KA 4L7SA 1H28A 4BVUA 2RG6A 3ZRLA 4YU2A 4DEIA 4AP7A 3MB6A 3TUBA 5I9UA 4Z16A 4IM0A 4EHZA 3ZSGA 1FMOE 3QWJA 1WVXA 3EQGA 3QRJA 3BLHA 3LXNA 1O6YA 1H07A 3ZOSA 2PUUA 4D4RA 2OJGA 3TN8A 4MXOA 3PPZA 2VX0A 4JQ7A 1Y6AA 3AC3A 1I09A 2JDTA 4F65A 3MB7A 5LMKA 2R0IA 4G5JA 3SX9A 1L3RE 2XJ0A 4PTEA 4ZTSA 4BIBA 2WFYA 3M11A 3QZGA 3BLRA 2RIOA 4RFYA 1REKA 5EM6A 2OJIA 2PVRA 3HGKA 4KD1A 4TKSA 1PYEA 3FHIA 3L9NA 3OXZA 3L9LA 4X2NA 4QMNA 3JVRA 4O7VA 2W4KA 3VS0A 4R5SA 4IZAA 2VNYA 4NJ3A 4U6RA 4YJTA 3FQHA 5L2IA 4OBOA 3L9MA 5DIAA 3PZHA 1OZ1A 5HD7A 4BHNA 4N4SA 4O6EA 2VZ6A 2OF4A 3GCUA 5EYMA 4USFA 1TQMA 2EXEA 2VTSA 4NK9A 3SVVA 3TZ7A 1ZLTA 3FLYA 3ZUVA 3MVLA 3CE3A 4A7CA 4MQ1A 4EKLA 4EOLA 3EH9A 4EI4A 4QTAA 4U3ZA 4AA4A 4JG7A 3B2TA 4XHKB 3H10A 4R3CA 4JL9A 4ITJA 5ANKA 3KK9A 4RJ7A 4CQEA 2RF9A 3LE6A 4ANQA 3SGCA 1XWSA 5EDQA 3D15A 1NA7A 2XRWA 3PP0A 3QU0A 5DEWA 5I9XA 5IA0A 1FBNA 2KULA 4U45A 3ZM9A 1M2RA 3ACJA 3OWLA 1YWRA 3HV3A 1ZZ2A 5LMBA 3CIKA 4O27B 3NEWA 4N57A 4F70A 3RALA 4HJOA 4BKYA 4QMWA 3GGFA 5HOAA 3SDJA 3TIYA 3DXQA 5FEEA 4ZTNA 4IAAA 5KE0A 4IFCA 2PE0A 4ANBA 3GCSA 2XMYA 5CAOA 4F6SA 3KL8A 5KHWA 4BBEA 4UXLA 4YZBA 4BCIA 2ZVAA 3G0EA 3POOA 1PKGA 5FG8A 2YISA 4XG9A 4JIAA 5E92A 2VTHA 4TZRA 4TPTA 5AV3A 4RJ6A 4G6OA 4R7BA 2HW6A 3FLQA 4RA5A 5CAUA 2REIA 5A6NA 1OM1A 5CSPA 3W33A 4PP9A 1Z9XA 4A9SA 2E9PA 3FI3A 4RWLA 4ANMA 2YACA 4MWIA 3DBDA 4EEVA 2B1PA 3ZLXA 2WMTA 3HNGA 3UO5A 5FTOA 3MVHA 1P2AA 3D5UA 1FVVA 2WD1A 3DS6A 2UZDA 3FY2A 4JBQA 2WMXA 4MQ2A 1YI3A 4DGOA 3RK7A 4KRDA 2VTPA 2C6OA 4U44A 4FGRA 3MIYA 4L9IA 5AUXA 3WF9A 2VTAA 4E5BA 2QU6A 4KABA 5ANGA 5HNBA 3VF9A 3DKFA 4HVHA 3KB7A 3TG1A 4DFNA 4H58A 5GINE 4ASDA 1OIYA 2CKEA 5BVWA 1XR1A 2QOHA 3NIZA 5J87A 1ZYDA 4C4GA 3SW7A 1K2PA 3DDQA 2R9SA 4D5HA 5FDXA 5HX8A 3ATTA 1PMVA 4FG7A 1V0BA 4FT9A 1SVGA 1Q62A 3R9RA 4RIWB 3ZO4A 2UZVA 3WI6A 3PY3A 3CJGA 3KFAA 2UZTA 2CCHA 3HUBA 4C4JA 5EI2A 3UOLA 3R21A 4EORA 2QURA 3GFEA 4BTMA 4ZP5A 2PZPA 3CTQA 4EH4A 3PXYA 4WBBB 4O91A 3O8PA 2OJJA 2WKMA 4U3YA 4L43A 1LPUA 5CQUA 2X4ZA 3LFQA 4RWKA 4R5YA 4O1OA 1Q4LA 1A48A 4TN6A 4UMQA 4YNEA 2WEVA 2XIZA 4IEBA 5AIRA 1PMNA 1W83A 2WMAA 4FV0A 4O22A 4RC4A 3TNWA 4IACA 4EOMA 3D5XA 2YFXA 2VWVA 4IIRA 4IZYA 2HZ4A 4EJNA 3IOPA 4FTLA 4FV4A 2W9ZB 3Q5ZA 5CENA 4X6RA 3ZC6A 4BIDA 1YRPA 5IQEA 3CPBA 3R1NA 4GEOA 4NCTA 3QUDA 4UWCA 4XG4A 5IISA 4QOXA 2XVDA 3LCTA 4F9WA 5HU9A 1T45A 3DTWA 4C35A 3B8RA 1Q99A 4M97A 2P2IA 5JRQA 4DFYA 3UDBA 3AG9A 4NEUA 2OZOA 3CC6A 3D7TB 1ZYLA 3ENMA 3R7GA 3Q2MA 5TR6A 5KBQA 5JQ5A 3VBTA 4AT3A 2PUIA 4DH3A 4GUEA 3AC5A 3E5AA 4HYIA 3EQHA 2IVVA 2QKRA 3KK8A 5GIPE 2VNWA 2RGPA 3I5NA 5CSWA 3W8LA 5J1VA 2I1MA 1XBAA 4MNEB 3U6JA 5CWZA 4ENXA 2IW9A 3O23A 4J8MA 4JDJA 4B99A 2OXXA 2YA9A 3F3VA 4EK5A 4AS0A 2XH5A 5TOZA 5IQBA 4I0SA 4DH8A 3UZTA 3Q52A 3EQIA 4AQCA 5K0KA 4AACA 2JITA 4IJPA 1OPKA 4IC7A 4B4LA 5JGAA 4UX9A 3KRWA 3PPKA 4DH7A 4XV9A 4CCUA 2C6DA 4ZSJA 5KHXA 2XRUA 3S95A 4QP7A 4WNKA 3FMKA 4JLCA 4GK3A 2WMWA 3U51A 4AWIA 4G3FA 5M56A 3WF6A 2EXCX 3GI3A 4JBOA 2YAAA 4HGTA 4RWIA 4AXAA 4EONA 3R9DA 4Q5HA 1M2PA 4FF8A 3HEGA 4FC0A 3C4CA 2UV2A 5F9EA 3OXTA 1SMHA 4Q2AA 3P5KA 4YUQA 2OFVA 3NR9A 2ZM4A 3HA8A 4BDCA 4RIOA 1VJYA 3QX2A 5E9EA 2UZLA 1OIQA 5A3XA 3PA3A 5EHLA 4AFJA 5IA3A 4I94A 2RKUA 4Z3VA 3GC9A 3FMLA 1NY3A 1G8AA 2PZYA 5DT4A 4GS6A 5C8MA 3QD4A 4RFMA 5DRBA 4V05A 2XJ1A 1OKYA 4C4HA 2Y9QA 5AUWA 3VS3A 3LJ2A 2X7GA 3D83A 4EBWA 5EI8A 4MWHA 1H27A 4R3PA 1JWHA 4ZS0A 3I0OA 4K33A 3OCSA 3RM7A 3N4TA 3RGFA 2JIUA 2DQ7X 2ITQA 2DS1A 3OVVA 4ACDA 3OW3A 4BDJA 4I41A 2F7XE 5E4HA 4EKKA 3BCEA 2VTQA 1Y6BA 1XH9A 4NT4A 3CBLA 3GB2A 4X0MA 3FSKA 5EHOA 5DRDA 3EN7A 5J9YA 3C4XA 4HCUA 3ORZA 2B7AA 5JRSA 4HCTA 4UMRA 4ONAA 2YDKA 2W1DA 4RX9A 4GKHA 4II5A 2I40A 5I9YA 2Q83A 4FZ7A 4EJ7A 1P4OA 3FJQE 3O2MA 2YITA 5AP5A 3F3WA 3TWJA 1WCCA 4IWQA 4Z55A 5BPYA 5FUTA 4RQKA 2BPMA 1WVYA 2GU8A 4BKZA 3LXKA 4O0TA 1IG1A 1WBSA 3MSSA 3GXLA 3PJ3A 4MD7E 5LVMA 3COIA 4EK4A 2XNEA 5D1JA 3LQ8A 3Q96A 3A7JA 5A54A 5E8TA 3KF4A 5DFPA 3ZSHA 3NSZA 4MF1A 3H0ZA 3QQHA 2B9FA 3PG1A 3PWDA 4GYGA 4N0SA 4FKTA 2BZKB 4QMLA 3EN9A 1BLXA 2QLQA 5KMLA 5T6KA 4GFOA 2BFYA 2BUJA 2LGCA 2BHHA 5EYCA 3T9IA 5HG8A 3FKOA 3KRXA 1KE6A 1NVSA 4PDPA 3LCDA 3QGWA 2YWVA 4AZEA 2XA4A 3WZDA 3KY2A 4M67A 3V5JA 4ERKA 5L2WA 2WIHA 2UZBA 2YJRA 1FPUA 3RTPA 2BKKA 5EKNA 4G3CA 4S32A 3G5DA 3KCKA 3UYTA 3QF9A 5DI1A 2ITYA 3NS9A 3FE3A 4OUCA 5A6OA 4O84A 4FEXA 2VWYA 3KEXA 4GVAA 2J7TA 3E7OA 2CKQA 3KXHA 2YAKA 3MS9A 3D2KA 2QOIA 4IWPA 5CF5A 4TYHB 2O0UA 2OIBA 5BYLA 1Y57A 4C4EA 1IRKA 3IQ7A 3P7BA 4RVMA 4DEBA 3BV2A 3R2BA 3AMBA 3U9NA 3WIGA 5KKRC 5DOSA 2Z7LA 3WF7A 3ZXZA 4IFGA 2WQBA 1KOBA 1WMKA 2UW8A 3ROYA 4X2GA 4KWPA 5BVFA 2C5VA 2PUPA 3FLNC 2PE1A 4O6LA 4CMUA 2R3QA 2J90A 3OZ6A 3MDYA 3QTUA 4E4MA 3Q9WA 2AC5A 4FT7A 3R01A 3N51A 5ITAA 4DCAA 2ACXA 3QLGA 1LR4A 2J0IA 3SXSA 4AAAA 4GJ2A 3C7QA 4YC3A 3R7IA 3R8MA 2FUMA 2R3LA 2R3MA 1WVWA 2V55A 1UV5A 4XRLA 2VD5A 3A7GA 3W10A 2W9FB 3EFKA 2BRNA 5HVYA 4FTAA 4AF3A 3BELA 2J50A 5CU3A 3U4WA 5IA2A 4Y5HA 3PE2A 4E5WA 4QTCA 5M44A 2OGVA 3RWPA 3UNKA 3BHYA 4ANNA 5J8IA 3TKUA 4MTAA 1Q8TA 1WBOA 4AG8A 1NVRA 4RX5A 4MBIA 4AU8A 4D2WA 3OUKA 2XJ2A 5EFQA 3OTUA 1ZMWA 2BMCA 3NUNA 2X9FA 4IANA 3UJGA 3UIBA 5IQAA 4GJ3A 3O0GA 3ZSIA 1OB3A 4J95A 3WIKA 5JQ8A 5IQFA 4F99A 3WE8A 1JPAA 4ZY4A 2QU5A 2ZB0A 4MEDA 5J95A 4ZJVA 5HTBA 3GU4A 4EL9A 3HRBA 4FUYA 4K9YA 1UVRA 3L9PA 5CU2A 4ENYA 3KQ7A 1Q3DA 3COKA 2QD9A 1TVOA 4LRMA 3BEGA 3WZEA 5M06A 2F7ZE 3SLSA 4KSPA 3G15A 2VWBA 4QMTA 2RFDA 2WMVA 2PWLA 2PVJA 4W9WA 3EFLA 2R64A 4IHPA 1ZOGA 4FIIA 5DR6A 4E6DA 2C1BA 2VWUA 3BE9A 4YHTA 4J96A 4LQMA 4S30A 3OY3A 2YZAA 3EKNA 3DLSA 3F5UA 3AMYA 5CU0A 2VWZA 1H08A 1F0QA 2R3OA 3C5IA 2ITNA 3EFWA 5FXRA 3EN4A 5HKMA 4GL9A 5DGZA 2HW7A 2OJ9A 2R3JA 2Y7JA 3MFTA 3NCZA 3P78A 4FICA 4XEYA 3V5LA 3Q5IA 4XCUA 3FQSA 3HMPA 2EB2A 3RAHA 4I21A 4KAOA 4X2JA 4BDIA 4RA4A 1J3HA 4FTNA 3VS4A 5EDRA 3I7CA 4HPTE 5H2UA 4E7WA 5JZNA 3PDTA 2WNTA 4R6VA 2BTRA 2G2IA 4WIHA 5EI6A 5HNIX 4FEWA 4BDFA 4KUJA 2XK9A 5L3AA 1REJA 3PYYA 3NCGA 3NUUA 3MWUA 2JFMA 1CKJA 4QP6A 4S2ZA 3TDWA 4LYNA 3SQQA 3QRKA 3VWAA 1SYKA 1URCA 3TZMA 4CKRA 3FEGA 4ORKA 4EOJA 2IPXA 3NMUF 1SVEA 1WBPA 3BHVA 3V8SA 3HDNA 4BBFA 3W2CA 3SKCA 4ZSLA 2C6LA 5HE3A 2OSCA 4ALUA 4ALVA 4BWKA 5K9IA 4ZMFA 2BTSA 4IX5A 3QZIA 3ZDIA 3L8SA 3T9TA 3TJDA 1IASA 2WTIA 3LW0A 3VF8A 1QPJA 4RIXA 3P23A 4K11A 1JQHA 3PA4A 1IR3A 2C30A 4IDVA 3TJCA 3UYSA 5LARA 1P4FA 4AFEA 1SNUA 4IADA 4YJSA 2B53A 5D10A 2P3GX 2GQGA 3CCNA 3OY1A 4I6QA 4ZSGA 3D9VA 4C3PA 4FNYA 1DM2A 3A2CA 4FV8A 1JLUE 5HLNA 1U4DA 4U79A 3A7HA 1DAYA 1RDQE 4GFMA 4PDSA 2C3KA 3D2IA 4E93A 3HRFA 5DEYA 5HGIA 1SM2A 4QNYA 2PPQA 4C2VA 2WMRA 3ZO2A 3LFCA 3BE2A 2C6MA 3QXPA 5BUIA 2C0IA 2I0HA 4BKJA 2DUVA 2JD5A 2PVNA 2XK3A 4LGHA 5KUPA 3LXLA 4WNOA 5CZIA 3FMNA 3EL7A 5CI7A 3A4PA 4TL0A 2UW0A 2JAMA 2WMBA 2WMQA 3ZU7A 5HIEA 2BIKB 3F3UA 3R7YA 4GSBA 5F94A 4YJRA 3UNZA 4QQTA 1TKIA 2G9XA 3KVWA 1JKLA 1JVPP 4JDKA 3PWYA 3V3VA 4F0GA 2YEXA 2C5XA 1U54A 4H1JA 2JKQA 4FKOA 2VO6A 5IDNA 1BKXA 4FVRA 3WBLA 4YZNA 2FGIA 5HIDA 4BC6A 5LJJA 4U8ZA 4DG0E 4RGJA 1VR2A 4GCJA 4MCVA 5HCYA 2UW3A 3F5GA 2ITWA 4G6LA 4Z9LA 4AZVA 2PMOX 4F63A 5BX0A 5B2LA 1CMKE 5JMSA 3UGCA 3MFUA 3OOGA 4QRCA 2BDFA 3LFAA 5LCKA 3QTSA 3ZRKA 3F69A 4TXCA 5DBXA 4FZAB 3HDMA 4NM5A 2BRBA 1WBTA 1Q41A 2RFSA 1Q24A 3RK5A 2P0CA 2QO7A 1KE5A 1U5RA 2EB3A 3NWWA 3PSDA 5HO8A 3W2SA 5L4QA 3K5UA 4U41A 5FBOA 3R7VA 1XQZA 5AWMA 3DTCA 4CMOA 5A4TA 1QPEA 3O7LD 5EKOA 3ACKA 3DU8A 3F5PA 4U42A 1LUFA 3ORLA 3QD0A 5A4QA 1JKTA 2W4JA 3JYAA 3LMIA 4KIQA 4NL0A 3ZO1A 4GG7A 3R7OA 3TKIA 4UY9A 3VBVA 3MJ2A 2EUFB 2AYPA 3ELJA 4YO6A 5JGDA 4Y73A 3QUPA 3FZTA 5IQDA 3BQCA 2R3NA 4K6ZA 2XBAA 3IONA 3MGYA 3VAPA 5BVOA 5JFXA 1YXTA 4EH6A 3PJ8A 5AM6A 2GMXA 4BYJA 2W7XA 2QR7A 3EQRA 3QQGA 1F5QA 5HVJA 5K4JA 3DDPA 3IO7A 4FKGA 3DGKA 4LRJA 4JAJA 3VBXA 3P7CA 4TYIA 5F1ZA 1Q8UA 4C61A 4DGLC 5AV0A 5HNGA 4A4XA 5HQ0A 4FTMA 5FWKK 3NNWA 4GW8A 3EL8A 2CCIA 2I0VA 4QP9A 4ZY5A 4NKSA 4XLVA 4IXPA 4O2PA 1YHWA 3IW6A 2PVFA 2RG5A 3FC2A 2WB8A 4W4WA 3UVRA 4ASXA 3H3CA 2R3RA 2V22A 3PXKA 1YHSA 3DCVA 3NRMA 3I79A 2X8DA 3LPBA 3ROCA 2XKFA 5E8WA 1G5SA 1U46A 4ASZA 2VAGA 2OFUA 4FIJA 3DAJA 2ITPA 3A8XA 3VUHA 4XS2A 4X7QA 5HBEA 2JIVA 2QVSE 4CTBA 4DYMA 5KO1A 4J99A 4BCJA 1G3NA 1MQBA 4LUEA 4YGAA 4IB3A 4CG9A 2VGPA 4O0YA 3ZYAA 4I6HA 2X8EA 3WYXA 4Y85A 2HYYA 4CV9A 3VUIA 2IVUA 3R1SA 4I92A 4XOZA 5GJDA 4YPSA 4MKCA 4FEUA 5A4CA 2W05A 3KMWA 5HO6A 4B9DA 1H1PA 5CU6A 2CKOA 2UVZA 3FMDA 4L53A 3ZDUA 4R1YA 4X3FC 1PXMA 4WNPA 4FE2A 3CTHA 2QONA 3WILA 4IAIA 3FYKX 3EYGA 1NW1A 5FRIA 4D4YA 4BICA 3UBDA 3Q6UA 3MVJA 5I3OA 1U59A 3F6XA 5HCXA 3S3IA 4EOQA 3R8ZA 5I9WA 5AUZA 5KMNA 5HBHA 3BBWA 3OS3A 2XYUA 4MBJA 4U5JA 2J2IB 1PJKA 2JGZA 3GNIB 4P2KA 5IH5A 2WOUA 3ZFYA 4O7ZA 3E3PA 3JPVA 2IG7A 4LRKA 3QCYA 1OBGA 4PUZA 2XEYA 4MXAA 4UYAA 4BGGA 4FV7A 3R1QA 1FOTA 4IX3A 2G1TA 3TT0A 2JAVA 3O8TA 3F7ZA 4KIKB 2I0YA 3KGAA 2XNMA 2WTWA 4WSYA 5AX3A 3MVMA 2OLCA 2WTJA 4E20A 4FL1A 4EOOA 3QCXA 4J98A 4EH2A 3ZS5A 1PKDA 1ZZLA 3GCQA 4GT5A 4AZTA 3MYGA 2A19B 3KCFA 5E90A 3CQWA 5CTPA 3HV4A 4JR3A 4PMPA 4E6QA 4O7RA 3CEKA 1YW2A 4GRBA 4EUUA 3BEAA 3WF8A 4F7NA 3OT3A 3QA8A 3TDVA 3ZLWA 1BX6A 3V51A 3WOWA 4EZ7A 1PXPA 1ZYCA 3LJ1A 3QGYA 4F08A 4M12A 2X1NA 3GP0A 5DPVA 3RPYA 3PUPA 5D7VA 1YOMA 4FKVA 5CAVA 3OEFX 3TL8A 4E6AA 5IEYA 3B8QA 4H39A 4ACHA 1Q8ZA 1B6CB 3ZRMA 2CPKE 4I6BA 2G2FA 3BYOA 3V5WA 3ZFXA 3SV0A 2HENA 5CEIA 2VTLA 3TZ8A 3L8XA 3EOCA 5EG3A 4D0XA 2GQSA 3KA0A 1W82A 3MFRA 5L6OA 2Z60A 5KZIA 1JSVA 4EZ3A 3WYYA 5IF1A 3G6GA 3OUNB 1GZ8A 2PVYA 4I23A 4NFNA 3AXWA 4C38A 3FI4A 3PY1A 4G5PA 4RVTA 1W84A 5HG5A 3RM6A 4DEGA 4EHGA 4BDHA 2V5QA 4CZUA 2A2AA 3OEZA 2C3IB 4DGGA 5HTCA 4KBAA 2OF2A 3FMMA 3QKMA 4ZTLA 4AN3A 1DS5A 2CN8A 4G9RA 5EQYA 4UBAA 4F9BA 4A06A 2HOGA 2C0OA 3E63A 3Q6WA 4IW0A 2VUWA 4IC8A 1ZOHA 3I4BA 2GQRA 2BROA 3NAXA 2YM4A 4PF4A 3THBA 3LCOA 2O63A 3B2WA 4YZMA 1PW2A 4AOJA 5GIOE 3LLTA 3E88A 3MH0A 4TYHA 4BI2A 5JEBA 5EOLA 4UZDA 3KMUA 2Z7RA 2VX1A 3OCBA 4PTCA 5TO8A 3ZO3A 2QNJA 5FM2A 3F9NA 4UB7A 5C26A 2GHMA 2E2BA 4AT4A 4RIXB 5DE2A 3ZTXA 4ACGA 5C8NA 2JBOA 4FZFB 4CEGA 4XV1A 3Q4ZA 4LL5A 4EQMA 2YWPA 3PIZA 3LAUA 3OXIA 4OTQA 3LFBA 4J8NA 4E26A 3FV8A 4ITIA 4FKLA 3UVQA 2C5OA 4HNFA 3F3ZA 1R0EA 4Z7GA 1CM8A 2BALA 1MP8A 3BGQA 3KVXA 3FZRA 4DHFA 4F6UA 3MI9A 4WKQA 3U55A 2XM9A 5A9UA 5JGBA 4CXAA 3EQDA 2I0EA 3FDNA 3NUPA 3ORTA 2DWBA 4M7IA 3R9NA 3TACA 5JH6A 3BV3A
chains in the Genus database with same CATH superfamily
3RAIA 4I24A 1UNHA 2VRXA 5I3RA 4DHZA 1APME 3KF7A 3II5A 3G90X 2GS6A 4CVAA 3ZH8A 4TWPA 5CZHA 4IMYA 3CKXA 3PZEA 3ORMA 4C8BA 4CZTA 1W2DA 2BHEA 5BUJA 1TQIA 1XBBA 4XP3A 1U54B 3LMHA 3ZEPA 3ORNA 5HG9A 3MPMA 5E8SA 4AA0A 4BGQA 4P5QA 3ZZEA 3R04A 3O50A 4W8EA 4KINA 1H26A 3KXZA 2PL0A 4QNAA 5HCZA 4EZ5A 4R77A 4DN5A 5FM3A 1BI8A 4Z7HA 2UZNA 2XK6A 4TTHB 4UALA 2BRHA 4DLJA 2FSMX 5JSMA 3BZ3A 3FKLA 5AP7A 2GHGA 4N6YA 4IJ9A 4FKQA 4P4CA 5FTQA 3FZOA 3N9XA 3QD3A 4K2RA 5HE0A 2AUHA 4LM5A 1X8BA 3MH1A 1UKHA 1VYWA 4O38A 4EOIA 4L7FA 2XUUA 3F61A 4GG5A 5DLSA 4V01A 4OT5A 4RC3A 2OJFE 5H8GA 3DK6A 1UWHA 4Y46A 3KU2A 4EUTA 2Z2WA 2C5NA 2PHKA 3BX5A 5C4KA 5HEZA 2F2UA 1GIHA 2X8IA 3VBWA 4PL3A 2ETKA 4F1MA 3NNUA 2Z02A 4KA3A 1UU3A 4OTRA 4R1VA 4C7TA 4PQNA 3QTWA 3Q4UA 4UWBA 3T3UA 3BU3A 1XH6A 1OKVA 3Q4CA 5IPJA 2IN6A 2PVHA 2WU7A 3R28A 2CLXA 5E8UA 5HZNA 3JXWA 3G2FA 4EK6A 4LMUA 2XIKA 2PMLX 2VX3A 3AGLA 4IAKA 5IZFA 3DJ6A 4H1MA 3TUDA 2BAJA 2ZV9A 4FV9A 4QT1A 5LMAA 4C4FA 3BPRA 5A4EA 1OL6A 5FXSA 1OMWA 4O7WA 4K1BA 3SD0A 3FYJX 4X3JA 4F0FA 3BWFA 3TCPA 4BI1A 5B7VA 4L3LA 5LMKC 3W0QA 4IAFA 3DK7A 3UOHA 4CG8A 1FINA 4KRCA 4F9CA 3D7ZA 2W5BA 4DG2E 3LKMA 3FXZA 2ZDUA 4MHAA 4QYYA 5T68A 3UQCA 3LVPA 2UW5A 4R7IA 3W32A 4UN0C 3VUKA 5CVGA 3HMIA 3RP9A 3DBFA 3LM5A 4QQ5A 4QMXA 2XZSA 1E9HA 2HXQA 4W8DA 3UMXA 5KX8A 5AADA 4O0VA 3U87A 4AZFA 4YZDA 2JBPA 4BRXA 3UODA 1J7UA 4E8AA 4A9TA 5CALA 4G17A 3ANQA 4CKJA 3F2RA 2WEIA 4QTDA 3QKLA 4WBOA 5M4IA 4IVDA 4C59A 3EWHA 4GMYA 3P08A 3UE4A 2PYWA 5IEVA 1J1CA 2F7EE 2OKRA 3RHKA 3EFJA 4C3FA 2A1AB 3C4ZA 3GU8A 4MXCA 3AOXA 1PMEA 2J51A 3HMOA 3L1SA 5CT0A 3LJ0A 4WSQA 3TUCA 2WTVA 2RFNA 1YVJA 4WD5A 5DT3A 3ZONA 3EQPA 5KZ0A 4LOOA 4M69A 4BCNA 5AIKA 1YOJA 2OH4A 3AT3A 3E93A 4LV5A 4V04A 1Y8YA 3KREA 2Y4IB 2W1ZA 2QOKA 5EM8A 2X7OA 3EZVA 4OTFA 4F0IA 2X0PA 3SXRA 3VBQA 1YDRE 2XK4A 3VS2A 4BGHA 4GFGA 3N4UA 3R9HA 3ULIA 4MXYA 4P7EA 2WQNA 3DB6A 1B38A 2ITOA 1R78A 2QODA 3ERKA 2BZHB 1W0XC 2Y6OA 3C1XA 4F9YA 5K0XA 3QXOA 3O51A 4JJRA 1H01A 4CFWA 5CU4A 5L8JA 3C4WA 1ZXEA 3OBJA 4B8MA 2HWOA 4FVPA 4U80A 4KNBA 4LMNA 5E8YA 5C27A 3VONA 2XCHA 4AW1A 5EW3A 3CTJA 5BVEA 4CRLA 3LHJA 5BMMA 5E8VA 4A07A 2R3IA 4D28A 3PIXA 3K3IA 4OTWA 3G6HA 4WT6A 3R71A 4YJVA 5CY3A 1JKSA 5CANA 5L2QA 2VV9A 2GNLA 4XG2A 3PRFA 2BAQA 4RJ3A 2XNOA 2C47A 2ZMCA 3PLAE 3MBLA 5JT2A 1ZARA 4FSYA 4DAWA 3FXXA 3JY0A 3QYWA 1YWVA 1FVRA 3IOKA 1ATPE 3RVGA 4HVGA 1UA2A 1OECA 4ZMEA 1GIJA 2C4GA 4AXCA 4DC2A 4IWOA 4BIEA 4FSNA 3GQIA 4E6CA 2YZLA 4CV8A 3CPCA 2RL5A 4EQUA 4DEDA 3MA3A 2XNBA 5AP2A 3MPAA 4PRJA 3ZLYA 4ZLZA 4DGMA 2XIXA 3CP9A 4DH1A 2UW9A 3DXPA 2QKWB 4ZTQA 3QALE 4JVGA 5A4LA 4L46A 1V0OA 2SRCA 4U43A 4I93A 1OUKA 3N4VA 5AAEA 2ONLA 3C9WA 3QBNA 4KBCA 4M0ZA 3MV5A 3E8DA 4PNIA 4JIKA 2V0DA 5HE1A 4DF3A 4O1PA 1YI6A 4QP8A 3VQHA 4FV3A 3UDTA 1RJBA 4C36A 3MY1A 3KRJA 3FLZA 3HUCA 3VS1A 3K54A 4UWYA 3NYXA 5AV4A 4FEVA 5BVKA 5BYYA 2WTKB 4IZ7A 3RAWA 1OBDA 3KXMA 4CFXA 2HCKA 5LOHA 2H9VA 4FR4A 3U4UA 4AW5A 2PZIA 4FI1A 4DBXA 4B7TA 5ACBC 3NZ0A 3UQGA 1CTPE 2YM3A 1H25A 4HVDA 3VQUA 4DFZE 5A14A 5IU2A 2XARA 4HOKA 4TNDA 1GAGA 4QP3A 4ACCA 2IVTA 3MY5A 2UZOA 3LQ5A 4DFLA 3QRUA 2OICA 1E1VA 5IUGA 4C57A 3QTXA 2CLQA 3R7EA 3NVMB 4O86A 5FQDC 4HZSA 3JY9A 4NCTC 4YBJA 3WE4A 3F5XA 3VUTA 4XP0A 5FTGA 4FKRA 4QPSA 1ZYJA 3VC4A 5HIBA 2E9UA 3FWQA 4YTIA 3WF5A 2VTMA 4AT5A 4D5KA 3FMJA 4JOAA 4AUAA 4BF2A 5AP6A 5BV3A 5AA8A 4O82A 4C62A 1OPLA 3NDMA 3DNEA 1W8CA 5E1EA 5FEQA 2VO3A 5GHVA 5IA1A 4IM2A 1Q8WA 3U54A 5CSVA 2V62A 2H6DA 5I9VA 5E1SA 5FP6A 1H1WA 3AT2A 3G51A 5M53A 2XKEA 4TYGA 5HESA 4X2FA 1P5EA 4AN2A 4WHZA 1G8JA 3QWKA 2X6EA 3P1AA 4NTTA 2GTNA 4O7NA 2GNGA 4RQVA 2FB8A 4NW5A 2X6DA 4AZWA 3NGAA 5HO7A 4FTJA 3C0IA 3DOGA 1L8TA 3OCGA 3V8WA 4KS8A 4L42A 5KNJA 4EK3A 4HNIA 4DG3E 4KIKA 1Q97A 2GPHA 4J71A 3DQXA 1GNGA 2ITTA 3KXNA 4FTOA 3GC0A 5EM7A 5IA5A 1H1RA 4R8QA 3PXFA 3R6XA 3PY0A 4YURA 5CNNA 4FT5A 4QMVA 3G9NA 2LAVA 3W55A 3QC9A 3CGOA 4FSUA 1YXSA 5AM7A 3TV4A 1ZMUA 5KMKA 3NW6A 2FSOX 4QP1A 1PXIA 2YHVA 1RQQA 5FLFA 1KSWA 4X21A 3UPZA 4P5ZA 5KCVA 4I22A 4XRJA 4H05A 3I81A 4L8MA 2WHBA 2JDOA 4AGUA 5HLWA 3EB0A 3UQFA 3OROA 5CVHA 1M14A 3ZFMA 5AP3A 1K9AA 3IPHA 4JQ8A 2XIRA 1OVEA 4F4PA 1ZYSA 3HYHA 2AQXA 2WELA 5L6WL 3UG1A 5AEPA 3CGFA 2HY81 4XOYA 3ZC5A 3FC1X 4CSVA 3MTLA 4FIHA 4HGSA 3QL8A 3ORPA 2X2LA 4IX4A 5HICA 4HPUE 4GKIA 2QOLA 4FG9A 3GENA 5D12A 1ZOEA 3GC8A 3VUGA 3KIOC 3SRVA 4JQEA 4YJPA 4JXFA 4AW0A 2JKOA 4FKPA 3UPXA 4CKIA 2XF0A 5IQIA 3UNJA 5EQEA 3R22A 3FSFA 5AR5A 1JSTA 3OF0A 3GOKA 4TT7A 3RPRA 2R7IA 4OTGA 4PV0A 4AA5A 1JAMA 4O96A 4GV1A 3TTJA 1Y8GA 2B0QA 1MRUA 4M3QA 4TYJA 4FA2A 3OHTA 4YJQA 5C4LA 3QCSA 2F4JA 4XLIA 3R83A 3ZHPC 1FGKA 5G1XA 3D5WA 3PXQA 5BNJA 3D14A 2PVMA 3QA0A 4ZLYA 5LQFA 4KIPA 2BAKA 2VTRA 5CEPA 5LWNA 5I0BA 3RAKA 1MQ4A 3VJOA 3WZJA 1H24A 3C4FA 3V5QA 1DI9A 4U97A 3MY0A 4YHJA 1M52A 4CGAA 5IQHA 1XH4A 2BDJA 3L8PA 3UIXA 4YSJA 5AV1A 3ETAA 3R8VA 2QLUA 2JIIA 4QMSA 3E8CA 4DFBA 2YIXA 3E64A 2YM6A 3MN3A 3QRTA 4ZEGA 1FMKA 4EHEA 4JMQA 1ZRZA 5K5NA 4WG3A 2YM7A 4G3GA 4LGDA 5D9HA 1OGUA 5B2KA 1PHKA 2OZAA 1YXVA 3FI8A 2W5AA 2BCJA 3UTOA 3O5AA 3VS5A 2ITZA 3LFSA 4W9XA 2Z7SA 5E8ZA 4APCA 3PE1A 4ZZNA 3ML1A 3BHHA 5GJFA 1G8SA 2PVKA 4DFXE 4EYMA 1PY5A 4DHJA 1BL7A 2FA2A 2R3KA 3AQVA 1A9UA 2NPQA 2O5KA 4I6FA 4NSTA 1UU9A 5ANOA 5EHYA 1IAHA 2VWIA 3NYOA 3IW8A 5EM5A 2PVLA 4XP2A 1U5QA 5GZAA 1YDSE 3ZEWA 5M4CA 2PZRA 3FZ1A 4M69B 5HHWA 3VIDA 2C3JA 3VRZA 4IWDA 3HVCA 4IE9A 4C3RA 3ENHA 3ZUUA 4BI0A 3ZM4A 3DAEA 4E4LA 4NM0A 4I5MA 4BDBA 3UC3A 1J91A 3RNYA 5LWMA 3W0OA 4O0RA 2R5TA 4ZAUA 5H8EA 4O7TA 5AV2A 4V0GA 3CQUA 4YTFA 5AUVA 4F78A 3MPTA 1J7IA 5ANJA 5HORA 4MD8E 1JSUA 4C02A 5C1QB 2VU3A 4WA9A 1BYGA 1ZMVA 4NKAA 3F7WA 2BZJA 3BYVA 2B9JA 2WAJA 3W0NA 4P90A 4TY1A 4YNOA 1WAKA 3QTZA 3R7UA 4QYHA 4CT1A 4DBNA 3U6HA 3AKKA 2CHLA 3TIZA 4TNBA 2XYNA 4Q9ZA 2CGVA 4HYHA 2ZFYA 4BR3A 4M14A 5DT0A 4I5HA 3VUDA 3V6RA 5L8KA 4A9RA 4MYGA 3UO6A 4BCGA 4TWOA 4F64A 2CKPA 4QYEA 5IQCA 4FG8A 4MXZA 4CFVA 3TV6A 2YLFA 3NAYA 3R2YA 2BVAA 2WO6A 1LP4A 5EW9A 3Q60A 4L6QA 2C6EA 3IGOA 4O21A 4AOTA 4EH8A 5CQWA 2WTCA 2C5YA 2ETRA 3DZOA 2JDVA 4YZCA 5C8KA 3OW4A 4O0UA 3C0GA 3DFCB 3I0QA 2ZV8A 4WUAA 2QI8A 4W4XA 4EBVA 4YJNA 2WXVA 3QAME 4OBQA 1UWJA 3C51A 3AD5A 3IW5A 3QCQA 2J9MA 4PP7A 4XJ0A 1AGWA 3UVPA 4QMOA 4GIHA 4ZXTA 3AC1A 2HAKA 1KV2A 2ERKA 3JS2A 2GNJA 3PIYA 4O81A 4M68A 4DA5A 4PMTA 4UMTA 1W2FA 5DMZA 4NUSA 5A46A 1HCKA 2CGXA 4IVBA 4QYGA 3DKCA 2NRYA 2PE2A 3FKNA 2B52A 1E1XA 2GDOA 3H9OA 2Z8CA 3U9CA 4U81A 4OTHA 2QQ7A 4OR5A 4DH5A 4O4EA 5GNKA 3TV7A 4AE6A 5CF6A 5LVLA 4MX9A 3VN9A 4TWNA 4CNHA 3AMAA 2ZJWA 4G34A 3FAAA 5L2SA 4JT3A 1QL6A 3KXXA 4UYNA 3DAKA 3AD6A 4FTQA 4YJUA 3IW7A 4RX7A 3OOMA 1JKKA 2XCKA 1LEZA 3SG9A 4K0YA 2VO7A 3SC1A 3DY7A 4YHFA 4YBKA 3RCJA 2C1AA 1M7QA 2XKCA 4YR8A 4F7JA 5IG1A 4HVSA 5M57A 3K3JA 3LQ3A 4DE4A 2IZTA 1Q5KA 4IH8A 3GU7A 4FSQA 4AXDA 4C34A 4AAYA 4FIEA 1Q3WA 4X6QC 4KKGA 3ORKA 3DKOA 1UNGA 4FV5A 4GK2A 4DT9A 3H9RA 4ZY6A 2E9VA 2PU8A 4PNKA 4ZSEA 2BRMA 3VJNA 2JEDA 3DB8A 2R3GA 3I6WA 3HA6A 2R0UA 3EN5A 4PWNA 3CD3A 2Y4PA 5AR8A 5IMXA 3QX4A 2GNIA 1BL6A 1KV1A 3BGZA 3HP5A 5EDPA 1CSNA 3SXFA 1WZYA 4ARKA 4DEEA 4ZS4A 3QZFA 1YQJA 4RSSA 2JC6A 2EU9A 3S0OA 5CXZA 3CY2A 2OI4X 3V8TA 2EVAA 3PJCA 4E3CA 4DTBA 2WMUA 3PG3A 3DXNA 4NTSA 4OT6A 2XP2A 2XANA 3GQLA 2F2CB 1JNKA 4RLKA 3EMGA 3AC2A 3OT8A 4MF0A 3IGGA 4O2ZA 3UP7A 5LVNA 5IH4A 1XKKA 3BHTA 5H3QA 4MVFA 4TRLA 4D4VA 4D2RA 5KMIA 1G8KA 2PULA 2CN5A 5CSHA 4ERWA 2IW8A 2FO0A 2W4OA 5DVRA 1WBNA 3ODZX 2VTOA 4EOSA 3IK3A 5AAGA 4UEUA 1ZY4A 4RRVA 4GU6A 4QQJA 3HECA 4YPDA 4AGCA 2GSFA 3BL9A 4L3PA 2WQOA 4NIFA 2GFSA 2UZEA 4D2TA 3VW8A 1GZNA 3GOPA 3Q9XA 4XYFA 5BYZA 4CFNA 3CD8A 4KKHA 4YLJA 4EQCA 4N70A 1EH4A 2ZB1A 4D2PA 3P9JA 4FYNA 1XMMA 4O4DA 5F95A 4D1ZA 4Y72A 5AR4A 1BMKA 2Q0NA 3CR0A 4UXQA 5IDPA 1OIUA 2W1EA 4LOPA 4C0TA 4A9YA 2PK9A 3ODYX 4E1ZA 1YXXA 4A9UA 1VZOA 4OBPA 3OMVA 4DCEA 2YCRA 5GZ8A 3POZA 3TI1A 4ZLOA 5CEOA 2OK1A 2WMSA 2PZ5A 1OPJA 4FK3A 3V04A 2HK5A 4CFUA 4FNXA 5IUHA 1ND4A 3SRVB 5AJQA 3QTIA 4IB1A 3VHKA 3VHEA 1PXLA 2BIYA 3D0EA 4I5CA 1R3CA 5CX9A 2O65A 4A4LA 1PYXA 2CJMA 4YC8A 1WBWA 2Y0AA 1URWA 3HLLA 5D11A 4O0XA 4RJ8A 4WOVA 3ZMMA 4AGDA 3D5VA 1H8FA 4PDOA 2WZJA 1CKPA 3NYVA 3NYNA 3W0MA 3PTGA 2QOCA 3VO3A 3R9OA 4GVJA 4L00A 3QKKA 4M84A 5TE0A 2XKDA 4RLLA 3A8WA 3R00A 3A7IA 3NIEA 3L8VA 3PFQA 2ZOQA 3NUXA 3RKBA 4FKWA 4XNEA 5HE2A 5M4FA 4FSRA 4ZZMA 2XB7A 1XO2B 5ETAA 4MNFA 4XV3A 2C6IA 4W4YA 4O0SA 4PY1A 2ZDTA 4M8TA 3BI6A 2UW6A 2UW4A 4BZDA 4CQGA 4M0YA 4EK8A 2WOTA 1VYZA 3EQBA 3E3BX 2B54A 2FVDA 4GH2A 3CJFA 3RMFA 3UP2A 4XH6A 4DITA 5EK7A 4LL0A 4X3FB 2OZAB 3LFEA 3MFSA 5JK3A 2A98A 5BQ0A 4QMQA 5DH3A 1UKIA 2WQEA 4PPCA 2ITVA 4E73A 4FZDB 2W1CA 4FOCA 4BFMA 5DA3A 3FPQA 3DNDA 4L52A 4RT7A 2VWWA 3DBCA 2W5HA 4CFFA 4F09A 1I44A 4RMZA 3DLZA 1OITA 1YWNA 2YIWA 4FUXA 2O2UA 2YABA 4X2KA 2OH0E 3DBEA 3LXPA 3RZFA 3TNPC 4OGRA 5CAPA 3P4KA 3HKOA 2W17A 4JDIA 3V6SA 4L44A 3HV6A 3QQLA 3M2WA 5FGKA 3ANRA 3VS7A 3DKGA 2A27A 3KRLA 4ANLA 5IH6A 4B8LA 4XBRA 5CASA 3FI2A 5LXMA 4DTAA 4EHVA 2KTYA 5D41A 5CI6A 3ZCLA 2VO0A 1LEWA 3A4OX 2F49A 3A62A 4V0GB 4F7LA 5J7HA 5CEKA 2FYSA 2GS2A 2HZNA 3BYUA 4RX8A 4RZWA 3UO4A 4ANSA 3FL4A 5FBNC 3DJ5A 3DJ7A 3KULA 2IZUA 1BUHA 3Q9ZA 5I9ZA 4EWQA 1J7LA 1K3AA 1NVQA 2Y4IC 2YN8A 3I5ZA 3PXZA 3EQCA 3GU6A 4Q9SA 2J0MB 5DR9A 2J5EA 5AA9A 5ANIA 3TXOA 3NFFB 1XJDA 3RJCA 5B0XA 2EXMA 3QLFA 3JUHA 5AUTA 3P79A 5CSXA 2X0GA 3KMMA 5FDPA 4HYUA 3A60A 4XUFA 3TNHA 2H34A 4FYOA 5JKGA 3W0SA 1OI9A 1CKIA 5JN2A 4RG0A 5M08A 5AP1A 3IDCA 3AKLA 4B6LA 4O7YA 5AUYA 3PVUA 1MRYA 3QTQA 3H9FA 3HV7A 5AP4A 4XMOA 2WPAA 2HWPA 3HAVA 4IAZA 4GIIA 3EIDA 4UMUA 3FMEA 2OW3A 4MH7A 3SAYA 4EH9A 1F3MC 4C37A 2NRUA 4EH7A 5L6PA 3ID6C 3TYKA 3SG8A 5AR2A 4WO5A 2GFCA 2YIYA 2C0TA 4FX3A 3RI1A 1OUYA 2WQMA 3RPOA 2CNQA 2JLDA 3RWQA 4EOPA 3FMHA 2FH9A 5E91A 3R8UA 2GTMA 5CLPA 4C4IA 3UZRA 5DHJA 1TFFA 1WBVA 3KKVA 3MH3A 5T3QA 1H1QA 3PVGA 5G6VA 4BWXA 4DEHA 4FV1A 3PUFC 5D7AA 3PXRA 4HYSA 2PMNX 1J1BA 1OL2A 1R1WA 3VNTA 2ZAZA 4LV8A 4FIGA 1S9JA 4FNZA 4YO4A 3O7LB 3R30A 1SVHA 2ZMDA 1Z57A 3IW4A 4D1SA 3HX4A 1ZWSA 3IG7A 4AZSA 4U40A 2ZV7A 3D4QA 4NH1A 4ACMA 3WARA 5LVOA 3I7BA 2C6TA 4FKUA 2BDWA 4QPAA 3FUPA 5ANEA 2A4LA 4G6NA 4BWPA 2E9NA 3QUEA 4OTIA 4WRGA 2V7AA 2PMIA 2GNHA 3W8QA 3QRIA 3F3TA 3DT1A 3PJ1A 5HLPA 3UIUA 2OU7A 2CNVA 3RPVA 4ZJJA 3NVKI 3W2QA 4U9AA 3AD4A 1XH7A 3ZBXA 3NW7A 4FV6A 5F20A 2XNGA 4O4CA 5CT7A 1PXKA 2GCDA 4ZSAA 2GHLA 4XG3A 3BU6A 2WTKC 4DT8A 5J5TA 3G0FA 2XK8A 4RFZA 5AMNA 3C4EA 4FSWA 1YDTE 3HZTA 3Q53A 4RBLA 4BCKA 4XX9A 3R8LA 4Y8DA 3VS6A 1XMLA 3QHWA 1IA8A 2CMWA 2QOFA 4BDGA 2J4ZA 1JOWB 1UU7A 1CDKA 3FL5A 4CRSA 3ITZA 3IS5A 1S9IA 5M4UA 1H0WA 3O96A 4O83A 2O3PA 4I5PA 2X4FA 2XEZA 3KRRA 5TF9A 4QMUA 4ZTMA 1P14A 2QOBA 4IBMA 4JX7A 4R3RA 5CVFA 5H8BA 3SOAA 3TNQB 4DINA 3I1AA 5CAQA 3HAMA 3QC4A 2X2MA 3AGMA 4H3PA 3OFMA 3V01A 3MTFA 4L67A 4BZNA 3A61A 5ETCA 2R3FA 5J7BA 2XBJA 2NNWB 4PTGA 3E87A 4MXXA 4YSMA 1RE8A 5M09A 3C0HA 4XG7A 2HY0A 3OD6X 2Y6MA 2JKKA 3AC8A 3GVUA 4LGGA 2BFXA 2GNFA 3BGPA 1OL7A 4M13A 4RIYB 3QFVA 3T8OA 1UU8A 3ATSA 1TQPA 2YIRA 4H3QA 3RHXA 4EWHA 4HW7A 4GT3A 4YLLA 3UDSA 3NNXA 4GUBA 1VEBA 2B9IA 4M15A 1IAJA 3EQFA 1V0PA 1ZY5A 3GC7A 2OIQA 3E62A 4ZTRA 3E92A 5JFWA 4H3BA 4HGLA 4RZVA 4BCHA 4ID7A 4BCPA 4D2VA 4LDTA 4FK6A 3MJ1A 3ZXTA 4NIFB 3LLAA 3QHRA 3GUBA 5AAFA 4YMJA 3VULA 4HVIA 4CZYB 1XH5A 4A4OA 5M07A 3DZQA 3VW6A 2IF8A 4TWCA 5JFSA 4MD9E 4J7BA 2X0QA 3BIZA 4PDYA 4NWMA 5M55A 3I60A 1PMUA 4D55A 2CGUA 5BVNA 3K2LA 3GFWA 1R0PA 2CDZA 4DLIA 5C03A 5K5XA 2XALA 3REPA 4FGBA 3W2OA 4IX6A 2VTNA 4CYIA 3TM0A 3U6IA 2PY3A 3TEIA 4JRVA 4Q5EA 5L8LA 2YDIA 4FKSA 4BCMA 3NUYA 1YHVA 4IAYA 3ZBFA 4BYIA 4FSZA 4JR7A 4DGNA 4U0IA 3TTIA 3BLAA 4J97A 2J5FA 4G31A 3EYHA 4BB4A 4UMPA 5DN3A 1H00A 4Y95A 1GOLA 1AQ1A 2EWAA 4LUDA 3S4QA 3BHUA 4BDDA 4BCFA 5HBJA 5L2TA 4QPMA 3DBQA 3NUAA 3Q2JA 1M7NA 1IA9A 3OWJA 4FT3A 2P33A 2O64A 5CEQA 2YLEA 4QMMA 4EOKA 5LVPA 4YZ9A 3LMGA 3VRYA 5E8XA 1QCFA 4JAIA 4FMQA 2E9OA 4PL4A 3HL7A 3QTRA 4RJ4A 5EYKA 2XIYA 4BDEA 4D9TA 2UZWE 4KBKA 1M2QA 3F2NA 3Q32A 2R3HA 4NU1A 1NXKA 4BN1A 4FKIA 5EH0A 4AXEA 3TZ9A 2UUEA 3DV3A 4LI5A 5ACKA 3VUMA 3E8NA 3R0TA 4NZWB 3KN5A 3AT4A 4D0WA 3W2RA 4BDAA 4NYEA 2IJMA 4UV0A 1FQ1B 5FP5A 3FLWA 3KN6A 4S34A 4BHZA 5B2MA 5IEXA 4ZZOA 3LFDA 2QG7A 4K8AA 2YERA 3JVSA 1BI7A 1QPCA 3Q4TA 5HD4A 1NT2A 2IZRA 1H0VA 3O71A 4RVKA 4YC6A 4QD6A 5CS6A 3V5PA 4FT0A 4G1WA 4EC8A 4R7HA 3EHAA 4I1ZA 4NM7A 4R78A 1XBCA 4PPBA 3KXGA 2B55A 3QQFA 3V5TA 3PRIA 2H96A 2HZIA 5EOBA 1Q8YA 4Y83A 3DK3A 2ZV2A 3W1FA 1B39A 5JFVA 3DFAA 5KMOA 2YJSA 4FTUA 2R3PA 2X81A 4LOQA 2W1HA 1H1SA 3P7AA 4FJVA 4NJDA 3PVWA 4EYJA 2J0JA 5F4NA 5DG5A 4C2WA 2YCFA 3M42A 2YDJA 5TT7A 2XS0A 3IDPA 4IB5A 3UOKA 3FLSA 5LCJA 4KKEA 5EQPA 5DYJA 3R02A 3T3VA 2QOQA 3BWJA 3WZKA 3KULB 4C33A 1SNXA 2W1FA 4FTCA 1OKZA 4YLKA 4FOBA 4FZ6A 3RNIA 4XBUA 3CY3A 3HV5A 4NW6A 2HIWA 4ZTHA 2W99B 5GJGA 4GK4A 4BTFA 1VLRA 4O0WA 4I4EA 4XG8A 3RBWA 1XHAA 3MW1A 2HELA 5DR2A 4CD0A 3BQRA 4F1TA 4BJJB 4QP2A 4J1RA 4KSQA 3NNVA 4BY9E 5IKWA 3DA6A 4J52A 2DYLA 3ALNA 3FQEA 5EW8A 3O17A 2C3LA 2F9GA 2IVSA 3E8EA 4FVQA 4JI9A 4QTEA 1JBPE 3GCPA 3EN6A 2W1IA 2O8YA 4CT2A 2Z7QA 4FTKA 5FXQA 5HVKA 2XNNA 4FTIA 3R8PA 4GU9A 3HMMA 2ZYBA 2R2PA 4IVAA 3BYSA 3PSBA 3H4JA 1OL1A 4WNMA 2X0OA 3HP2A 4E5AX 1O9UA 1GIIA 4PL5A 5IUIA 5HG7A 3ZZWA 2QO9A 3PA5A 2HXLA 4HZRA 2IO6A 5IMEA 3Q3BA 5K3YA 5J5SA 4D9UA 1OIRA 1ST4A 4Y5QA 4QMPA 3RPSA 4RJ5A 2B4SB 3F82A 3EZRA 1T46A 4RWJA 5GZ9A 3S2PA 2QO2A 3FZSA 4FL3A 2OWBA 4FTTA 3PPJA 3MESA 2CNUA 5K4IA 4M66A 1GZKA 1MUOA 2WGJA 1KE7A 2OO8X 3CKWA 2FSLX 2XK7A 3UMWA 4APPA 3O8UA 4QTBA 2BR1A 2PSQA 4N6ZA 3CSVA 4KB8A 2PTKA 3KC3A 4D4SA 3OBGA 3TMOA 3FBVA 5BMSA 3CXWA 3QQJA 3FPMA 3R63A 2GS7A 2CSNA 4IQ6A 5KKRB 4QO9A 5TKDA 4K18A 4F9AA 1V1KA 4L3JA 2ONLC 3BU5A 4LFIA 4AX8A 5J9LA 4QYFA 4X3FA 4JG8A 3SOCA 3S00A 4D58A