5BVFA

Tetrahydropyrrolo-diazepenones as inhibitors of erk2 kinase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
350
structure length
327
Chain Sequence
AGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVRWYRAPEIMTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Tetrahydropyrrolo-diazepenones as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 107
structure length 327
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bvfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bvfA01
1NA7A 3KRLA 1FVVA 3ZHPC 2VWUA 3JY0A 1YWNA 3VBQA 4DTAA 2C5OA 3G6GA 1WVYA 4C8BA 4CG8A 3KF4A 5CEIA 4IDTA 4UYNA 4EORA 4IC8A 4NW6A 4O96A 3V8SA 5HHWA 3QTSA 3GBZA 2QKWB 5EYMA 3RMFA 3OVVA 4CGAA 3ACJA 3D5UA 3DXNA 1WBNA 3E8EA 4UXLA 4CD0A 3MFRA 2KTYA 4IW0A 5DRBA 3VC4A 1GJOA 3GEQA 3KXZA 3FSKA 3CGFA 3PTGA 1PXIA 5I0BA 4FKRA 1PXOA 4DFZE 3FLYA 3MVJA 4DEAA 2ZMCA 3F5PA 2VX0A 3R21A 5HG5A 3PVWA 3KEXA 3DAKA 2FSTX 4R3RA 3W16A 4NCTA 2UZDA 2BUJA 3ODYX 4BVUA 3R7VA 4Q9ZA 3R2BA 5CT0A 5KMLA 4MXAA 3QLFA 4AOTA 5AAGA 1Q99A 4BZOA 3GU4A 4D2WA 5E1SA 4PDOA 3B8QA 3VHKA 4BKYA 5GIPE 4EYJA 5AUUA 1CKIA 2VN9A 5A6NA 4E4NA 4O27B 3C1XA 3H0YA 5LARA 3SKCA 3VUKA 3HZTA 2WMBA 3OCTA 4G3DA 3ITZA 1ERKA 5EK7A 3QHRA 4EZ7A 4O6LA 4D4SA 3DGKA 2V0DA 1H27A 4XG2A 5E8WA 2PL0A 4J99A 5I9WA 3UC3A 3GENA 3S0OA 5ICPA 1NXKA 1YXSA 2PVJA 2J51A 4K33A 4C3PA 4CV9A 2VTAA 2VWWA 3H9OA 4R3CA 3PPJA 3D83A 4FKSA 3O50A 4K18A 2PMLX 2OFUA 3I7BA 3RPRA 2R3MA 2R3LA 5AR8A 5FLFA 3ANQA 4A4XA 3IG7A 3KXHA 3LE6A 5K5NA 5M4IA 3VRZA 4RG0A 1KSWA 2ZJWA 3PJ3A 4GFGA 4TN6A 4I5PA 4IX3A 4AW2A 4FF8A 4F63A 5LWNA 4U5JA 3QHWA 1ZXEA 3SHEA 2X7GA 3GU7A 4TRLA 3NAYA 3PP1A 4U97A 5CEOA 4IZ7A 3DB8A 4JL9A 4TZRA 2GQGA 3DTWA 3Q6UA 3KN5A 2O63A 4FYOA 4ACMA 5HBJA 4E7WA 4CFXA 4QMWA 5L3AA 1PKDA 1Q8WA 1XBAA 4LMUA 3A8XA 4AN9A 2YITA 3U54A 5JT2A 4WHZA 2FH9A 4OTRA 4QTEA 4LGGA 4F9AA 3CD8A 4P90A 4EUUA 2YM5A 3VF8A 4CMOA 1ZZLA 3BCEA 3QQKA 4ZIMA 4ZTMA 3QAME 4K77A 2QNJA 3DQXA 3RKBA 4Z7GA 3RNYA 2YIXA 3HV6A 4P5ZA 1WBOA 4A7CA 3K3IA 4DAWA 2RGPA 2HXQA 4EJ7A 3OXZA 4USFA 1JSTA 2IVTA 5AR3A 5TE0A 3RNIA 3UODA 4HW7A 5J7BA 2W1EA 3FMHA 4FTOA 5IG1A 3R9HA 4DFXE 4D2VA 2EXEA 4C35A 1O6YA 3PG1A 4FT9A 2V62A 3V3VA 3ZRLA 1J7UA 5DYJA 4IBMA 2O3PA 3FZOA 3SW7A 3FLZA 3VBTA 1YOJA 2QOHA 3ZLXA 3IW8A 3LM5A 1H0WA 2AC5A 3LXKA 3NPCA 1PXKA 4IX5A 2IZTA 4CTBA 4QYHA 2WMVA 2WTDA 2YCFA 2J0LA 2YISA 3Q2MA 3Q9ZA 4TWNA 5F1ZA 4DEGA 3GOKA 1G3NA 3VQHA 3I6WA 3ZEPA 4U3YA 3BEAA 3CEKA 3F7WA 2OF2A 3DKOA 2RG5A 4FTQA 5H2UA 4NUSA 4ZTNA 4BCHA 3FI3A 5TO8A 3NAXA 5HTIA 3SW4A 2V7AA 3I7CA 5LQFA 4C2WA 4YJQA 5L2IA 1J7IA 3DB6A 4DH7A 3F82A 4W4XA 3C51A 4FEXA 4UYAA 3PJCA 4M3QA 3MI9A 3ORMA 5ANDA 1NVRA 3DAEA 3DBDA 3JXWA 5CANA 3U6JA 4I94A 4L43A 3P7BA 4HVHA 4BCGA 3F3ZA 3BGZA 3PFQA 3OY3A 2ETMA 3UIUA 1YW2A 4W4VA 4PMMA 2YM3A 3LFSA 3CD3A 5CALA 5IDPA 3OHTA 3ZUUA 4ANLA 2VTMA 5GZ9A 4BCPA 4E4LA 4E73A 3PVUA 2JAMA 3EQDA 4G5JA 4BDHA 5BX0A 5BVOA 5LCJA 1Y91A 3R7IA 3R22A 3PIYA 1OKYA 1E1VA 3MA3A 4OTHA 4Z3VA 2XIZA 5L8KA 2I0YA 3KK8A 1JQHA 4GK4A 4I6HA 4G6NA 4TXCA 3MA6A 4NFMA 1Q97A 4U0IA 4AQCA 5HNIX 5KBRA 4H05A 3NZ0A 3R01A 3R1YA 4X2KA 1XH5A 3FLQA 2UW5A 3EHAA 3RCDA 1UWJA 2KULA 4IX4A 2IPXA 4FNXA 4FL3A 2HXLA 4NJ3A 2VAGA 3MH3A 3BHVA 5HLPA 3HRFA 4RWIA 4ANQA 4EZ3A 4EZ5A 3COKA 5CVGA 5HVYA 2XRWA 3JS2A 3ORTA 5GNKA 1H1WA 3F3WA 4U81A 4QTDA 4BCNA 3P78A 4U79A 2UZOA 3MIAA 4BN1A 3LFBA 4DE4A 4FSZA 3NUYA 3NIZA 3KVXA 5KMNA 1O6LA 3EJ1A 5M4FA 5D41A 1IR3A 3LM0A 4GT4A 3MDYA 3R30A 4PDYA 4JG6A 4JBVA 2GQSA 3R8VA 1OL6A 2JLDA 2QLUA 3Q60A 1EH4A 4BKZA 5DEWA 4BHNA 4M66A 2VD5A 2W4JA 4JDKA 3QX2A 2LAVA 4S32A 3OTVA 4BICA 3ZO2A 3UG2A 2F2CB 3UTOA 3GXLA 3P9JA 2YA9A 2UZWE 3ZU7A 2REIA 1OL7A 4GYGA 4CMTA 1PXJA 4HVDA 3H3CA 4B7TA 4HVSA 4TWOA 3GQLA 5IEXA 3MPAA 1PY5A 5AR2A 3W2RA 4B99A 3OF0A 4BDDA 5KUPA 4BZDA 4WKQA 3WI6A 4DT8A 4RJ4A 3UDBA 1ZOHA 3KRXA 4NL0A 1HCKA 3VW6A 2G1TA 4BTMA 4TTHB 4R5SA 5KE0A 4YTFA 2GFCA 1RE8A 5HG8A 5IA1A 4CG9A 1JKLA 3R73A 3LAUA 4FL1A 3ANRA 1R39A 3TWJA 4GIIA 3TUBA 2XB7A 4YLJA 4ZTQA 4RMZA 2BZKB 4QYEA 2W0JA 2F2UA 4UY9A 3POOA 3QA8A 2P2HA 5IQHA 3LMHA 1IRKA 2OFVA 4Z55A 5A6OA 1PKGA 3KRWA 4G16A 4E4MA 2ERKA 2CSNA 3Q4UA 3SA0A 4DBXA 4Y73A 4KBKA 5IA2A 4C36A 4CTCA 1L8TA 1REKA 3KRJA 3NYXA 4QTBA 3PJ2A 3WE4A 5CS6A 3QGWA 3V01A 3U6IA 4O7YA 3M1SA 3MSSA 4FYNA 4Q5HA 3GB2A 3ORXA 4TYHA 1R1WA 2NNWB 2UVYA 5DH3A 2WMRA 2XCHA 3QZGA 3KU2A 4NKAA 4XG6A 4Y85A 4TWPA 5FBNC 5HI2A 4DFBA 3S1HA 3JVRA 2B0QA 3V6RA 1PYXA 3OOMA 4PY1A 4HPUE 3W18A 2FO0A 4JIKA 4O0XA 3K54A 5AP4A 5HD4A 4PDSA 4QMNA 2HZ0A 4ZMEA 2C6IA 2ERZE 5D9HA 2GNFA 5DG5A 4IAKA 3JPVA 3WF7A 2BRBA 4E6QA 4FODA 4QPSA 3FLSA 3FMJA 2OXDA 2JKKA 4CKIA 3FL4A 3CQUA 2PE1A 4I0RA 3PP0A 3WIGA 2WGJA 3D15A 2Q83A 3G6HA 3MPTA 4IIRA 4LGHA 4RC4A 3ZO3A 2Z02A 3FV8A 3D94A 1DAYA 3S95A 2BAKA 2IVSA 5EW3A 5J1VA 3R63A 4FIEA 3ZDUA 5KHXA 5L8JA 3E93A 5KMJA 2QHNA 3CQEA 3P0MA 3FMLA 2R3PA 3VUMA 2UVXA 3EN7A 1YHVA 2ITNA 4D4VA 4OBQA 5JMSA 3NDMA 4AT4A 3GCPA 4QMLA 1BL7A 3WE8A 4AWIA 3AMAA 4DBNA 5C01A 4O6EA 4JG8A 2XKDA 3DJ6A 3R8ZA 2F9GA 4RZWA 1Y6BA 2B54A 2WQEA 3G9LX 2XA4A 4U3ZA 2IO6A 4BCQA 5GIOE 5AUZA 5DR9A 3FY0A 4XG7A 4FKIA 5J5SA 3BWJA 4XJ0A 3QX4A 4XUFA 4A4OA 2BRNA 3KGAA 3A7IA 4D28A 3E87A 2VO3A 4EK4A 2YEXA 4EQUA 3UO4A 3ZRKA 3LCDA 1E9HA 4DEIA 4HGSA 1YDTE 3COIA 3RK7A 3DBFA 3R1NA 4FV2A 4AT5A 4JDJA 4FG7A 4NH1A 4U8ZA 3I79A 4FVRA 5CVFA 5AAFA 3BIZA 4EH7A 1WBPA 5T3QA 1V0PA 5CAQA 5JFVA 3HRCA 3LFEA 4H3QA 2UW0A 4O0YA 4EOIA 2V7OA 3OWKA 4B0GA 4P2KA 3TIZA 5I9VA 5HE3A 4CMUA 4FZ7A 4XG9A 5CAPA 3CIKA 4RT7A 4H3PA 5KMOA 3P4KA 5CSVA 5CAOA 4RIXA 4DEBA 4QMQA 5CT7A 2RIOA 3RP9A 4YLLA 3F3UA 4Z16A 4J52A 2NO3A 4C34A 3ZM9A 2HYYA 4WBBB 2WKMA 4D2SA 3KC3A 4AA4A 3RAHA 1QPEA 2WTIA 4XP2A 3QFVA 4MK0A 3RPOA 3VW8A 5CXZA 5FTGA 4RA4A 3A61A 2GMXA 2JITA 3LFDA 4HYUA 4IZYA 3CS9A 4TYHB 4XV3A 4YJRA 4BFMA 2UW6A 4EH2A 2PZPA 3H30A 5E91A 4ZTLA 4D0XA 1OITA 4AE6A 4BGGA 4RX5A 4CT1A 1OBDA 4IAYA 5CU4A 3PRIA 4S33A 3TZ9A 2IJMA 4GS6A 3TTIA 5AUVA 4L3LA 5FEEA 3DFAA 3IK3A 4FX3A 2WAJA 3LCOA 2H34A 4OTWA 5ANOA 4QP1A 3V5TA 4ASZA 3MPMA 4FKQA 2VO7A 3FQEA 2P2IA 3EN4A 4F9WA 3LOKA 4YC6A 2NRUA 5CAVA 2PE2A 3HMMA 4KIPA 1A9UA 2G2HA 5BVKA 5IH5A 2GNJA 5FUTA 2XNMA 3C13A 2ETRA 4K2RA 2BZJA 3CJFA 5FXQA 3V8TA 3GU8A 1XR1A 2UZTA 4KB8A 2PVFA 5AP5A 4FKLA 4IWOA 3TXOA 5IEYA 4X3FB 5H8BA 3TKHA 2WMUA 1SZMA 3HDNA 4GYIA 2JC6A 4RRVA 3LLAA 2WMSA 2W4KA 4YSMA 5TKDA 3TUCA 4H1MA 2J9MA 3CCNA 3WBLA 4FKTA 4ITHA 3VWAA 4A9UA 2B9IA 4D9UA 4PL5A 2JKQA 3FQSA 3LLTA 2YCQA 5CSPA 3TCPA 1H07A 2WMQA 3W33A 5IQGA 4WUAA 5HX8A 5DIAA 2PZRA 4AX8A 3L8SA 5BQ0A 3EFWA 3KA0A 2BDFA 4AOIA 3ULZA 2R3JA 3ZH8A 4JOAA 3QBNA 3BLRA 3EL7A 3MESA 3QU0A 4OTDA 2BDWA 4IQ6A 2G9XA 1OUYA 2E9NA 4U42A 4P4CA 4G9RA 5DN3A 4FA2A 4OTPA 5BMMA 1UKHA 3IW6A 2VZ6A 4Y46A 5EFQA 4G3FA 4ZAUA 5AP7A 2CJMA 4A9TA 1YDRE 1OVEA 5ANKA 5K0XA 3RWQA 1H08A 3SOCA 3HGKA 3LCSA 3HKOA 1PXNA 4GJ2A 2Z8CA 3ZXTA 4TYGA 3ACKA 2QOQA 4PL3A 5H8EA 5JGDA 1H1PA 3AGMA 4L42A 4AOJA 3UPZA 1M14A 1OIRA 3QXPA 5E8ZA 1WBVA 3Q9YA 4V0GB 4YZNA 3ZBXA 4BKJA 2XJ1A 4DLIA 1MP8A 1J3HA 3ZS5A 1JPAA 4YZBA 3NNUA 3F2NA 3FE3A 3LHJA 3ZUTA 5L2WA 4AZSA 4RIXB 4RLKA 2ZDTA 4RVLA 1I09A 4JRVA 4FOBA 4M0ZA 5A46A 2QR8A 3HNGA 2X9EA 3OWLA 1XH6A 4RWLA 1YOMA 3ZLWA 4PTEA 4O0RA 3SRVA 3F5GA 4KKGA 2Y9QA 3BHTA 3PDTA 4FT3A 3RPVA 3GGFA 1M2PA 4IFCA 3NEWA 4UZHA 3SOAA 3LXPA 2XJ0A 4GK2A 3ZXZA 1H28A 3QQFA 4KIOA 4ZOGA 4EK6A 3VF9A 2VO6A 4YNOA 3TV7A 3NUPA 3ZLSA 1UNLA 3V5QA 4L7FA 2BRGA 2I0EA 3QTXA 4O7WA 3MB7A 4FL2A 4NTSA 4CKRA 2O5KA 3FZ1A 4S2ZA 4YBJA 2FSMX 3KCKA 4EH9A 1FBNA 2B55A 2X39A 4BCMA 3F5UA 5HIBA 4DLJA 2QD9A 4FZDB 4RIOA 1JKTA 1IEPA 2HENA 3N4TA 1JAMA 3NWWA 5HE0A 5HVJA 2Q0BA 4MBLA 4QTCA 3UVRA 3RHKA 1NVSA 1PF8A 3EFJA 4WNOA 3MGYA 4N70A 5HU3A 4XBRA 4ERKA 2ITYA 4I0SA 5DLSA 3P7CA 5HESA 3RK5A 5IU2A 4ZLZA 3DBQA 1PXMA 5BPYA 4FOCA 4ANMA 2RFEA 3NSZA 2VTLA 2ZV9A 4WBOA 4ZY6A 3VHEA 4EOOA 4HPTE 3BKBA 2OH0E 2QO9A 2C5YA 1DS5A 3GT8A 3LZBA 4GSBA 4KRDA 5CSWA 1JSVA 2XBJA 4ZZMA 4ALVA 5LVNA 4PRJA 2C6LA 2RKUA 3OP5A 1H01A 3AD4A 3W10A 3PWDA 4L8MA 5JGAA 5EOLA 2QVSE 4BTFA 2GNHA 2R7IA 2Y6MA 2C3KA 3UG1A 2BTRA 1V0BA 2C1AA 2X4FA 4CZUA 2HY81 1YI6A 3IONA 4HGTA 2GDOA 3EZRA 3WYXA 4UMTA 1TQIA 3QA0A 3RVGA 2R3FA 5TT7A 4ERWA 2XZSA 4RVKA 5ETFA 2C3LA 3QUDA 3UO6A 2R64A 4AP7A 4NYEA 3Q6WA 4O2ZA 4MNFA 4FIJA 4XCUA 2C3IB 3VJOA 4FEVA 1F3MC 5DR6A 1W0XC 3NCZA 2VTOA 4TYEA 1WCCA 4HZRA 1PW2A 3PG3A 3G5DA 1U4DA 4MYGA 2V22A 3GUBA 2G2FA 1UNHA 3DTCA 4MX9A 3PSCA 4OTGA 3UOLA 2ZM1A 5AUTA 4YTIA 5B7VA 2XJ2A 3LXLA 2H6DA 2OH4A 4QMUA 5AP3A 2ZOQA 4DA5A 3QRJA 5AA8A 4EC8A 4AA5A 3ROYA 1ZYLA 3NW6A 4UMQA 2QURA 3CPCA 2HWOA 2BHEA 3Q9WA 3RBWA 2OJIA 4GKHA 4KNBA 1BI7A 1REJA 2B7AA 1H4LA 4FG9A 2YCRA 3JVSA 3LCKA 4QNAA 3RPYA 4DT9A 3L9LA 1ZRZA 5ACBC 3HMOA 4J1RA 4RC3A 4C4EA 4C4IA 1XQZA 2J6MA 4AG8A 3AT4A 5ANIA 5AV2A 4FNYA 3FSFA 3GC0A 4HJOA 4C33A 4E5WA 4MTAA 1CSNA 2R3GA 4OW8A 5A54A 1CKPA 3BE9A 3UOJA 1R0EA 4USEA 4DTKA 4EHZA 3TNHA 4KKHA 4DFYA 4BYJA 5HORA 2QOOA 5LMKC 1DI8A 5I4NA 3ERKA 4KS8A 2I6LA 4EC9A 3P79A 4YURA 3VBXA 2C69A 3MWUA 5AADA 5CU0A 4FVPA 3OBGA 4RWKA 4J97A 3O51A 4J71A 5E8XA 4NFNA 5M09A 2GNGA 2PVYA 3OWPA 3QQGA 4HOKA 4TW9A 4TPTA 4XV1A 2CKOA 3SDJA 2VWBA 4FV1A 4QP7A 4AGDA 4L6QA 5CNOA 2WIPA 1YHSA 2W9ZB 2UZBA 4FC0A 3BU5A 2PVNA 3FPMA 2XNNA 3HEGA 3CXWA 2BPMA 4R7IA 4RC2A 4UV0A 4ZSEA 4X2FA 4P5QA 3KN6A 2W1ZA 5GZAA 4DGOA 4EEVA 4N0SA 4FEQA 4D4YA 2VGOA 4L01A 1VJYA 2G01A 5BUEA 1Q3DA 3ATTA 3HP5A 3FLNC 4G3GA 2QI8A 2HWPA 5B0XA 4V04A 4YBKA 4TKSA 5JK3A 1MQBA 4L53A 5AV3A 4L46A 3WF5A 4EQMA 5J9LA 4FZAB 3V6SA 4AAAA 1RW8A 3QCYA 5EW9A 5FM2A 5K4JA 4FEWA 5DBXA 4UMPA 1MUOA 3R02A 3S3IA 3DLSA 5IH6A 3OUKA 4LI5A 2XK8A 3U87A 3E64A 3WF8A 2QONA 5IQCA 3I60A 1O6KA 5HG7A 1U5RA 3MV5A 2UZVA 4JIAA 4JAIA 4IM3A 2VX3A 5IMEA 4DFNA 4O81A 5FEDA 2JDOA 2J5EA 4MXOA 4K8AA 3VIDA 3LMIA 4MD8E 4D1SA 3T3VA 1OL2A 4KBAA 4EOMA 1ZMVA 2H8HA 3CSVA 5IQEA 3NVKI 3KULA 3LMGA 2XK3A 2ZV2A 3TJDA 1IA8A 4X3JA 4WRGA 3A60A 2WTKB 4OT5A 3LQ3A 5HX6A 3HMPA 4I6QA 5AV0A 4I5CA 2QOIA 3FBVA 2WHBA 4JBPA 4X2NA 4W9WA 4JX3A 1GIIA 5CVHA 3UQFA 1STCE 1SVHA 4TNDA 1W98A 3AOXA 4ZZNA 3V5PA 4R6VA 5I9XA 3W2OA 3AC5A 4KSQA 2XEYA 5D10A 3EH9A 3RWPA 5AV1A 4XRLA 3QQLA 2UV2A 5HLWA 2QOKA 4J7BA 3KB7A 4D0WA 4BTKA 3M11A 1PXPA 2VRXA 3I6UA 2RG6A 4FV5A 5DR2A 4EUTA 3WZKA 4QOXA 5AX3A 4TT7A 2Z7QA 3CPBA 2XNBA 4L67A 2BAJA 3DOGA 3SXSA 2XK4A 5AR7A 3U6HA 2DUVA 2W1DA 2OF4A 2BRMA 1ZAOA 5AMNA 3GCUA 2W1IA 3IO7A 4NK9A 1BL6A 2JKOA 5B2KA 2P33A 4EOLA 4D4RA 3EQRA 4EBVA 1UV5A 2F7ZE 4R5YA 3SVVA 2R9SA 4DCAA 3PXFA 3A7HA 2P3GX 3KREA 3N4VA 1M17A 4HCVA 5E8TA 4BY9E 2AYPA 4BGHA 4UMUA 3EYHA 4JVGA 3PJ8A 2W1HA 3VS3A 3UOKA 5M57A 2R5TA 3ZRMA 2PZYA 3G33A 5EI2A 5DEYA 5EDQA 2Z7RA 3E63A 3GOPA 4E20A 4ZTSA 2CNQA 2BIYA 4F1OA 3H10A 4QO9A 1KOAA 2PWLA 2XUUA 3IKAA 4ORKA 2ITTA 2XIXA 3QXOA 4PPCA 3TNPC 2Y4IB 4MNEA 3PVBA 3VO3A 4D9TA 1MRUA 1OI9A 4DEEA 3HRBA 1YKRA 1KE6A 4WA9A 3QC4A 4LRKA 4RGJA 4YZ9A 5IA4A 5JZJA 5EKOA 5IA5A 5AX9A 1XJDA 4BC6A 4U80A 3OEFX 4O7SA 4FSQA 5HE2A 4FKOA 2C0IA 1GAGA 5E90A 4CFNA 1BUHA 2B1PA 4ZJJA 5ANJA 4USDA 2PZ5A 3LJ2A 4FV0A 1XHAA 4MD7E 3V8WA 4DF3A 4DFUA 1JVPP 3M42A 5AP0A 2X9FA 5BVWA 2I1MA 3LFCA 5FTOA 3UJGA 3UMXA 4QP4A 3MB6A 1Y8GA 3PUPA 4J53A 4L9IA 2BR1A 5DRDA 4DEDA 1XBCA 2F7EE 1KV2A 3LKMA 3SG8A 3HUBA 5G1XA 2CLQA 3ATSA 3NR9A 3QTUA 2C4GA 3KULB 4LL0A 3C4XA 5LVLA 1P2AA 2FYSA 3Q4CA 3BLHA 5JFXA 1RDQE 2PY3A 1MQ4A 3U51A 1OPKA 3GNIB 2CCIA 4GVJA 4AACA 5AAEA 2ZV8A 3QD0A 3EN9A 4MH7A 2PVKA 4XP3A 5EDPA 1OKVA 2R0IA 3BE2A 3PXKA 4IX6A 4XS2A 5BVEA 1UVRA 3QZHA 2IW8A 4HGLA 5EG3A 5KZIA 5L2SA 1G5SA 3AD6A 3EZVA 2YM4A 3FPQA 5C8MA 1UA2A 5AP1A 4AT3A 4YUQA 4RJ8A 4MXZA 3EFKA 1TQPA 2XNGA 2BCJA 2GS6A 3DV3A 2XF0A 5HBEA 1ZZ2A 3IDPA 3L1SA 3IW5A 2VGPA 3PPZA 3POZA 2VTIA 5HVKA 5IKWA 4FUYA 5EKNA 4M0YA 2BMCA 2E9PA 1OZ1A 5CZHA 5JZNA 3UZTA 4DC2A 1KWPA 5G6VA 4EONA 5M4CA 1J7LA 2F7XE 4CFUA 2XK9A 5FQDC 4MAOA 5ITAA 5B2LA 4NSTA 2G15A 2X7OA 2ZDUA 1Q4LA 3D4QA 3RM7A 4OT6A 1WFCA 5EHLA 3I0QA 4JR3A 4RIYB 2YDIA 3T9IA 5L6PA 1QCFA 3PE1A 2WTJA 3OXIA 3BQRA 3FMKA 2XCKA 3QTZA 3KXGA 3R6XA 4E6DA 4G6LA 2YHVA 2HW7A 2VTNA 4BZNA 4EHEA 4CVAA 4C0TA 4FG8A 4NIFB 4LRMA 4UWCA 4A9RA 2Y4PA 3QD3A 4F0FA 3IW4A 2XNEA 2JDVA 3O7LD 2OXYA 3UIMA 4CFMA 4D2RA 2VTTA 4I93A 3DXQA 2ITXA 4MNEB 3A8WA 4CXAA 3QKKA 4C4JA 1NVQA 4NM0A 5M44A 5C03A 2R7BA 2JAVA 4HZSA 3GFWA 2YLFA 1T46A 2P4IA 3KXMA 2W17A 2XIRA 3HYHA 1Q24A 2OU7A 3IDCA 2AC3A 3FKNA 2A19B 5ETCA 1VR2A 4MQ2A 4EKKA 2HK5A 5DOSA 2QOCA 5I9YA 4I20A 3VAPA 4FKJA 4OTQA 2A2AA 5JKGA 4BGQA 4RFMA 1M7NA 2WEIA 4IB5A 4RX9A 3CTQA 4WNMA 2NRYA 5K5XA 3UP7A 5I3RA 2C3JA 3CR0A 3AMYA 4MBIA 4FTAA 2W5HA 1YXXA 2OBJA 3E8CA 1SM2A 1ZOGA 3QWJA 3TV4A 2ZVAA 1WMKA 3QKMA 2WMXA 4GH2A 5LXMA 2W7XA 5AP2A 1U5QA 4U9AA 5BVFA 4I4EA 3DS6A 3Q52A 1URWA 5DNRA 2J4ZA 4G1WA 2X2KA 2ZB1A 4IZAA 5GINE 4IB0A 4FV7A 4ACHA 3GVUA 4D1ZA 4O7RA 4I1ZA 1FGKA 2CKEA 5H8GA 3LJ1A 4BTJA 4CZYB 3OCGA 2ONLA 5HTBA 1GIJA 4U7ZA 3R71A 3MH1A 3OC1A 4L7SA 4O1PA 4GFOA 2YIYA 1T45A 1OUKA 1PMVA 5FBOA 1OPLA 4XG8A 5TR6A 3ALOA 3GCQA 5IQFA 4LG4A 4EWQA 4H3BA 3P7AA 4QT1A 2IZRA 3TKUA 4GJ3A 4NTTA 3ZZEA 3WZDA 5A4CA 2UVZA 3PJ1A 4MQ1A 4O0UA 1Q8YA 3QTRA 3ZSHA 3D9VA 4ASEA 3ZDIA 2XEZA 2E9UA 2UZUE 3LQ5A 5KO1A 3EB0A 3IECA 2VWXA 4L00A 2IW9A 3PIXA 4AW5A 1IA9A 3D7ZA 3R9NA 3G2FA 4ZJVA 5KNJA 4L44A 2W5AA 3DKCA 4ZZOA 5LVPA 3QKLA 4AU8A 4TYIA 5EQYA 1VYZA 4YP8A 1FOTA 5EI6A 4BHZA 4FTRA 4DCEA 3ZO4A 5BNJA 3NUAA 2YACA 5JRSA 3KMMA 2A4LA 4UX9A 3L9PA 1S9JA 4AN2A 4ANBA 1OMWA 4GG7A 4YC3A 4X3FA 4ZXTA 3REPA 3TG1A 4JBQA 3ULIA 1FGIA 3LFNA 4X6RA 4M13A 3BYMA 5FM3A 1FPUA 4FSTA 4ZEGA 3E92A 2PVLA 3FZRA 3PXQA 5EM6A 3QQUA 2X2MA 2UW9A 2XRUA 2VTQA 2C0TA 5FGKA 4JNWA 4M67A 2DWBA 3MY5A 4I3ZA 2X2LA 2GFSA 3R8UA 1UNGA 3KCFA 3MFTA 3QRTA 5E8VA 1GZ8A 4AE9A 4O38A 3DDPA 4LV5A 4OAUC 5CXHA 4CRSA 4F7JA 2QO2A 3EKKA 4CT2A 4FGBA 4F64A 2J7TA 2WTVA 3GFEA 4JDHA 3NNXA 3E3PA 4PMSA 4QMXA 3W55A 4IM2A 4FK3A 5M51A 2CNUA 5A9UA 2YZLA 3OCBA 4GK3A 4XOZA 3NW7A 2LGCA 4Y8DA 1H1QA 1OKWA 3FXWA 2PVMA 1K2PA 2UW7A 3IW7A 1ZARA 3HV4A 4V0GA 3VVHA 2HZNA 3BLQA 5E9EA 3EL8A 5GJGA 4IJ9A 2ZAZA 3E3BX 4FGRA 4FV4A 3FZPA 4IEBA 3RHXA 5KKRC 5K3YA 3MW1A 2R3QA 5AM6A 5JQ8A 3JUHA 2BROA 1JKSA 2H9VA 3SD0A 5AUYA 1A48A 4I92A 3D14A 4JQ7A 5IISA 4O86A 3E88A 2ZM3A 3NLBA 3CKXA 3NW5A 4BDBA 5C4LA 4YPDA 3R0TA 4FTTA 4HCUA 2V55A 4QYGA 4BCJA 2OKRA 1Y6AA 1YI3A 1JNKA 3A99A 1GZKA 3F69A 1XH9A 3MTLA 4DH1A 4XV9A 4F9BA 5CASA 5M08A 3RZBA 4XBUA 4H36A 3BU3A 4J98A 3TACA 3K5VA 1Q61A 4LUEA 4OTFA 4AZVA 4YR8A 5IA0A 4F70A 3UO5A 1PMEA 1Q8TA 2XKFA 3QRUA 3COMA 4WO5A 5CF4A 4BB4A 3ZONA 4F08A 5CLPA 2EB3A 5DGZA 1DM2A 3GCSA 3OTUA 3EWHA 3BU6A 2Y0AA 2YIQA 3EIDA 3DPKA 4GW8A 4PF4A 1M52A 4O82A 2B9FA 5LJJA 4NM5A 5DWRA 5CEMA 3I1AA 4QYYA 5F9EA 1BKXA 5DT3A 4O7TA 3U9NA 1OM1A 2OZAB 2HIWA 1F0QA 4TNBA 2VWYA 4YHFA 1BMKA 3PY3A 3AC2A 3KY2A 5EQEA 4XLIA 1FMOE 5A4TA 1I44A 4F0GA 3QCXA 4FTKA 2BKZA 4J8NA 5C27A 5DMZA 2HZ4A 3PVGA 3QZFA 1V1KA 3EQHA 4Y95A 5J95A 2E9OA 3MN3A 3U4UA 3UNZA 4ANSA 3OWJA 4BDJA 3HV3A 2JIIA 2WQBA 1RQQA 4HNIA 2O0UA 3O8TA 2ITPA 5M07A 3L8VA 4QP6A 4X7QA 4XG3A 4YTHA 2QU6A 4LRJA 4C37A 4F99A 4QRCA 5HQ0A 3W8LA 1YXUA 4C61A 2IZSA 2X4ZA 2BFXA 3V51A 3TUDA 4KS7A 5I5ZA 4KABA 2ITOA 2UZEA 3P1AA 2Z7LA 2Z60A 4I41A 4KIQA 5EYDA 3VJNA 4CYIA 4PP7A 5IQBA 1M2RA 4O1OA 5F20A 1KOBA 1WBWA 5IUIA 3TZ8A 2X6DA 2XM8A 1Z5MA 4KKEA 3THBA 3A62A 2QC6A 3DLZA 2EWAA 1ZMUA 1QMZA 3FXXA 3MIYA 3LQ8A 5HCXA 4YJSA 4GIHA 5FTQA 5HG9A 1YDSE 2FVDA 4E4XA 3E8DA 4CV8A 5J5TA 2R3NA 2C5XA 2HW6A 5JH6A 3LIJA 4DH5A 1FMKA 3B2WA 2VUWA 2R0UA 4BWPA 2B52A 2JGZA 5A4QA 3ZM4A 1W82A 2HAKA 2ZMDA 4PTCA 4E5AX 3L8PA 4YGAA 1H0VA 3AMBA 3ALNA 4HVIA 5GHVA 3ROCA 3KFAA 2GS7A 5M53A 4QMYA 3I5NA 4ZSLA 4BYIA 5FRIA 2DS1A 3L9NA 4NZWB 3QTWA 4FKGA 4FNZA 5HICA 5CF8A 3OW4A 3FDNA 4ZY4A 3DK3A 1Q3WA 4DN5A 3NNVA 2PE0A 3COHA 2NPQA 3GU5A 3VS2A 1XWSA 3UP2A 3G0FA 5BYYA 4EOJA 5EM5A 4M69B 4PMTA 4M97A 1BI8A 1PMUA 1ZY4A 3FXZA 4RLLA 4EKLA 4J8MA 3BV3A 4FTUA 5IUHA 3ZO1A 5TF9A 4BI0A 3P23A 5H9BA 1KE9A 3R1SA 1OKZA 3E8NA 2YLEA 3C4CA 4FTNA 2JDRA 3RAKA 2EXMA 1Q8UA 2ITZA 2XIKA 3EMGA 3VUDA 4V05A 2EUFB 2OSCA 3FLWA 4F09A 3AC8A 4FVQA 4ZP5A 2BALA 3TNQB 2QG7A 4OR5A 2ETKA 4EH5A 3BRBA 2R3HA 4XG4A 5J87A 3HL7A 3DNEA 4F7LA 1G8SA 4EYMA 5EH0A 2YWVA 4A4LA 3BGQA 4C4FA 2PTKA 2CGUA 3B2TA 4AGCA 5IH4A 2UZNA 5HNBA 4EJNA 4J95A 4YTCA 3SX9A 3KXNA 3DY7A 4QYFA 1X8BA 3MJ1A 4N4SA 4Y72A 5CWZA 4IH8A 3ZBFA 2BFYA 2WTWA 4EOQA 4C62A 2RSVA 3TIYA 3R1QA 1XKKA 5C4KA 4Y5QA 3PA5A 4WRSA 4XRJA 2BRHA 5M55A 2JFMA 2HZIA 3C0IA 5JGBA 4FE2A 3HLLA 4JT3A 4IFGA 4F7NA 1YRPA 3FUPA 1GOLA 3SC1A 3DKGA 4Y83A 2IW6A 2QKRA 4RVTA 3ZSGA 2PSQA 2C0OA 2C6KA 2GCDA 2QQ7A 3DK7A 3H4JA 5M4UA 3O96A 3F88A 4IB1A 2QO7A 1UU9A 4QMTA 3NVMB 4FBXA 5KZ0A 3TL8A 4FV6A 3DBEA 2OJGA 5L4QA 1CTPE 2R4BA 5CSXA 4IE9A 1ZYSA 2OIDA 1AGWA 1XH7A 2PZIA 3DNDA 3O8PA 4GUBA 3R8PA 4CFFA 3D7TB 5AR4A 4GVAA 4O0SA 4A07A 3FZTA 3EQCA 1OPJA 3RI1A 3RM6A 5LMBA 4GT3A 3DT1A 3DAJA 4GRBA 4AGUA 3OZ6A 4AW1A 3VBVA 3TJCA 4EHVA 2CGXA 3F3VA 4LM5A 4UWYA 3AT3A 2BTSA 4MKCA 1VEBA 4EK5A 4JBOA 4R1VA 3VN9A 3SGCA 4NCTC 3CY2A 4IACA 5EYCA 4FT5A 4AFEA 4PWNA 4ALUA 3UOHA 2ZB0A 3SV0A 3ZFXA 3EQIA 4JR7A 4MVFA 5HKMA 3RCJA 4QQTA 3GC8A 3GC9A 3KQ7A 4JRNA 4WG5A 3EKNA 2NP8A 3BEGA 3WYYA 4CFWA 2YN8A 3UMWA 4I0TA 4WD5A 3TZMA 3PYYA 5HLNA 4CFVA 5HNGA 4ZTHA 1O9UA 2JIVA 4CRLA 5I9ZA 4C3FA 1CM8A 1DAWA 4K6ZA 3QCQA 2PMOX 3O2MA 4HCTA 4YZCA 3R8LA 4AN3A 2YIRA 2C6TA 5EDRA 5DA3A 5J9YA 1K9AA 3S4QA 2XK6A 4FSMA 2IN6A 2XM9A 4XMOA 5A14A 3ZEWA 3IOPA 5DPVA 4LOQA 4GT5A 1H1RA 3N9XA 4LFIA 3PSBA 4MXYA 4UB7A 4OAVB 4ZJIA 3GCVA 4BI2A 4C2VA 3CTHA 5L6WL 4BBMA 1OBGA 3QCSA 1SVEA 3NX8A 4FKPA 1JWHA 4XNEA 3SLSA 3KMWA 4G9CA 5AP6A 4M14A 5ETAA 4W4WA 4B8MA 2CPKE 3EN6A 3QQHA 4IZ5A 1K3AA 5D12A 3V5JA 2FUMA 4FTMA 4UWBA 2R3KA 5E7RA 4IAZA 3CTJA 5GJDA 4EOSA 4KRCA 5EHYA 4V01A 3UYTA 4O0VA 5ANGA 4BBFA 3OD6X 4BIDA 3A7FA 1UU8A 3UNJA 5BYZA 2B4SB 3C0HA 4KSPA 4J96A 5DFPA 3MS9A 4MCVA 1FQ1B 2A27A 4RSSA 1CDKA 1IG1A 1PJKA 2JKMA 2P55A 1KE5A 1IAJA 4ASXA 5IZFA 2CKQA 4H1JA 4F6UA 3ORNA 4FIGA 1ZWSA 4LQMA 3TI1A 4ZK5A 2XP2A 3PZHA 3AT2A 4X2GA 5FG8A 4D5KA 4CEGA 4R7BA 3OXTA 5CENA 5C8KA 3VNTA 4L3PA 2BDJA 3OROA 3F66A 4ENYA 4F65A 4KUJA 1GZOA 1ZOEA 3MH2A 4FV8A 3BHHA 4IC7A 4RX7A 3Q2JA 1QPDA 2Z7SA 4WG4A 4FK6A 4PUZA 4FIIA 3NYNA 4K9YA 2FGIA 5E8UA 4FR4A 4IB3A 4XHKB 5B2MA 3PXZA 5CF6A 3AGLA 3HAMA 5CQWA 3V04A 3OW3A 4CLJA 1XH4A 5BYLA 4KD1A 1GIHA 2BKKA 4CKJA 4QMSA 2HELA 3P5KA 4IVAA 1Q8ZA 5DI1A 3F2RA 3OT8A 4LMNA 3BHUA 3WARA 4EI4A 3HV7A 3KMUA 4C02A 4D2TA 4XX9A 4BCFA 5AWMA 1M2QA 5FXRA 2VTPA 4U6RA 3FI8A 3NUNA 3HA6A 4AF3A 3FHRA 5IF1A 5L2QA 4A9SA 2Z2WA 3W8QA 2R2PA 2WQNA 4QMMA 1JKKA 2E9VA 2JBPA 3CLYA 3PLSA 4IVDA 5EYKA 3OG7A 5HO6A 3TN8A 3FY2A 4APCA 4BWKA 1QL6A 4B4LA 1JBPE 5EHOA 1VZOA 4N6ZA 2QU5A 3NRMA 1SNUA 4GEOA 3ET7A 5BUIA 2ITVA 4MWHA 1IAHA 2YABA 4B9DA 3F3TA 3FHIA 3P08A 4IMYA 2Y6OA 3SXFA 3A7GA 3UYSA 3UC4A 5C1QB 4X0MA 4DG0E 4XOYA 2PUIA 5L6OA 4C4HA 3IGGA 1NT2A 2WZJA 1B6CB 3H9FA 4AZTA 2J50A 4CSVA 1J1BA 5H3QA 2JBOA 2YAAA 3HA8A 4QTAA 4KIKB 4E6AA 5CY3A 4RA5A 2PVRA 3IQ7A 1R0PA 4FIFA 5T6KA 3C4WA 3QUEA 3ENMA 3U9CA 2IVVA 4F6SA 3RAWA 1Y57A 3PLAE 4RFYA 5CTPA 3F5XA 2X8IA 4NJDA 4CNHA 5D1JA 4FMQA 3R7YA 2C6OA 2XNPA 4KINA 3RJCA 4PL4A 4RIYA 1KE7A 2X8DA 2X8EA 4O91A 4EH3A 3DFCB 1BLXA 4CYJA 2RL5A 3QYWA 4YZDA 3GC7A 2AUHA 2ESMA 4QNYA 5EM7A 2OJJA 4BDAA 3FMMA 3DA6A 3L9MA 2HY0A 3V5LA 3QRIA 4C3RA 2C5VA 4D1XA 2QLQA 5CZIA 4RJ5A 2W4OA 3VUGA 4JG7A 4D2PA 2QG5A 3O8UA 2IVUA 4DG3E 2CKPA 2CNVA 3U55A 3LVPA 3MVMA 3PIZA 3QC9A 4HNFA 4NIFA 4UALA 3D2KA 3RZFA 5HZNA 3AC1A 2X0GA 5LMKA 5I3OA 2WEVA 5JRQA 1V0OA 2O64A 4GU6A 4N6YA 4D55A 4U45A 2OW3A 4K0YA 4ZLOA 2OK1A 3C5IA 2XK7A 4NU1A 3FI2A 3FMDA 3SQQA 3QALE 4PDPA 4FZFB 3Q9XA 3R9RA 3OEZA 4CQGA 1XH8A 4X21A 4BDKA 2I40A 4BDIA 4DGLC 4ZSJA 5FDXA 1LP4A 2W9FB 3ZC5A 1ZYJA 3AQVA 5IA3A 4GMYA 5EM8A 3QGYA 1ZLTA 1JOWB 2RF9A 3R7GA 4JI9A 4YJTA 4PP9A 4RVMA 5FWKK 2YDJA 5D7VA 4EBWA 5C26A 4FUXA 4DGNA 2EXCX 3QZIA 2FSOX 3FI4A 3ETAA 3UNKA 2PMIA 2J5FA 4FTJA 1H8FA 2P0CA 4BDGA 3G0EA 4XYFA 4LYNA 2OIBA 4B6LA 3MBLA 2X81A 3C4FA 4F1MA 4M68A 3NUXA 3DKFA 1W83A 1NY3A 3AG9A 5FEQA 2VU3A 4FT7A 5F94A 2XNOA 3WF6A 4AGWA 4BIBA 4C59A 2PUUA 1P4OA 5ANEA 4N57A 5EQPA 2WELA 2ONLC 4YC8A 2JD5A 4M84A 3F7ZA 3S2PA 3DK6A 3O71A 4EH6A 4HYHA 4GV1A 5K9IA 1W7HA 3PXRA 4M15A 4QMOA 3PRFA 3UGCA 4FSYA 3BYUA 2QODA 4Z7HA 3EYGA 4IAIA 1FVTA 3GP0A 3W2CA 1Y8YA 5KCVA 3O17A 4GU9A 3ZTXA 3TV6A 4YJNA 5KBQA 2GHLA 4M7IA 4PMPA 3VQUA 3PY1A 5L2TA 2WXVA 4OUCA 3SAYA 2PK9A 5IEVA 3LFFA 3TTJA 4E8AA 2OO8X 3ORIA 2C1BA 5HIDA 1Q41A 4AXAA 2GQRA 3EN5A 4LL5A 4AS0A 4YJVA 4UXQA 3N51A 2OZOA 3QWKA 4FNWA 5IQAA 1ND4A 4XEYA 3QTIA 2JDTA 1LEZA 3TZ7A 3R7UA 4ALWA 3OT3A 4EK3A 3DZQA 2CHLA 4L52A 2Q0NA 2YFXA 5I9UA 3ELJA 1LPUA 3QLGA 4PPAA 4AW0A 5BUJA 4QQCA 5A4EA 3NYOA 1URCA 2YIWA 3FYKX 4H58A 2C68A 3LW0A 3FMNA 3PSDA 5DVRA 4X3FC 4IVCA 4FTIA 3D5VA 4EH4A 3JYAA 5E1EA 3GU6A 3UQGA 5BVNA 2RFNA 2OLCA 3ZFYA 4W8DA 4L45A 1QPJA 5CI7A 5DT0A 3A4PA 4ACGA 3BPRA 4O83A 4PX6A 3A4OX 3CC6A 2J0MB 4TYJA 3D2IA 1ATPE 5JEBA 4RPVA 2WD1A 2W05A 2GHMA 5CQUA 1U59A 4F1TA 4FSRA 4R1YA 3G90X 3FC2A 3RTPA 5LVOA 1ZY5A 4KWPA 1WVXA 2UW8A 3K5UA 4BCOA 4IAFA 4NEUA 4BCKA 3ORPA 2QOFA 4ZLYA 4YHTA 3ID6C 2OI4X 4JDIA 3OUNB 4QPMA 5F4NA 5JFWA 3DBCA 5AR5A 3DJ7A 3QL8A 4I5HA 2F57A 3E5AA 4C57A 2WMWA 2O2UA 4FV3A 4U41A 2OICA 1P14A 4R7HA 2DQ7X 3WZUA 3MY0A 5AFVA 1U54A 4CZTA 4BF2A 4BBEA 3NIEA 3T3UA 4HYSA 4C4GA 5JFSA 5KMMA 3C9WA 5HIEA 2PUNA 4H39A 3W1FA 4QP9A 3BYOA 3QTQA 5A4LA 3UIBA 3UZRA 3Q5ZA 1HCLA 3D5XA 4F4PA 2C6EA 3WF9A 5AJQA 5CYIA 3EQGA 5HCZA 5HOAA 1WZYA 3P86A 4QP2A 5J8IA 2XYNA 3FKOA 1KE8A 5HGIA 1E1XA 1SMHA 1YHWA 5A3XA 4EL9A 3AC3A 4TY1A 2H96A 3ZSIA 4IXPA 3ZLYA 3LFAA 4A9YA 3BBTB 4DH8A 2VNWA 3C4EA 2B9JA 5HBHA 5CAUA 3N4UA 2OJ9A 5HU9A 2B53A 1TQMA 3HVCA 4QMPA 2WMTA 4W9XA 5E8SA 4IAAA 4O0WA 3VULA 4F0IA 2BVAA 2Y8OA 4YZMA 4ZS4A 2WO6A 2BIKB 2GTNA 4G5PA 4CCBA 3NMUF 3PY0A 4I24A 2XYUA 3G9NA 3HMNA 3BELA 3AC4A 4JX7A 2QR7A 4Q2AA 5CU6A 3Q3BA 4YU2A 2RFSA 3QD2B 5C8NA 3IPHA 3FZSA 1R78A 4ENXA 5LOHA 4P7EA 5J1WA 4G3EA 4OLIA 1PHKA 3HMIA 4JJRA 3HX4A 4O7ZA 1XO2B 1TKIA 2GHGA 4NW5A 3HAVA 2OGVA 5CSHA 4WSQA 4EQCA 1MRYA 3QRKA 5AIKA 4IJPA 4ZTRA 4BIEA 4C38A 3BYVA 2CGWA 3IDBA 2YJSA 3E62A 3IS5A 3PPKA 2YM7A 3FMEA 4E5BA 2OZAA 2BAQA 3C5UA 3IOKA 3O0GA 2W1CA 3LJ0A 4FIHA 1WAKA 3RAIA 4RJ7A 3VS5A 5BVDA 4QMZA 3AD5A 4BDEA 5LVMA 4F6WA 1R3CA 3MY1A 3RPSA 2O65A 4IDVA 4BR3A 4QQ5A 4U40A 5CU3A 4UN0C 4DINA 5FDPA 4PTGA 2ITUA 5KHWA 1B39A 2J0JA 2QCSA 2CMWA 5JSMA 3NGAA 2CGVA 3EFLA 4Z9LA 4MWIA 1VYWA 3DDQA 4K11A 5HO8A 4S34A 1F5QA 4A06A 3FEGA 3Q5IA 3IGOA 3K2LA 4YJPA 2WOTA 2OWBA 4MXXA 4YJUA 4KA3A 1M7QA 3CGOA 3KKVA 5IMXA 3KRRA 5CNNA 3W2SA 3C4ZA 3UIXA 1BYGA 3UPXA 3BZ3A 2YZAA 2BZIB 1UU3A 3HECA 4DH3A 2WQMA 2CLXA 3MFUA 5TOZA 3TEIA 4G3CA 2DYLA 2VTRA 5FP5A 3QYZA 2XKCA 3RALA 3TKIA 4DGMA 1OIQA 4FSNA 4I22A 5K4IA 2WOUA 1P4FA 5CU2A 4R8QA 1PXLA 4ITJA 5EW8A 2R3OA 4DEHA 1U54B 2BZHB 3OBJA 3PA4A 3OMVA 1MRVA 4Q5EA 4OBOA 5LCKA 5DHJA 4YNEA 2X1NA 3C7QA 4II5A 4YO6A 4UEUA 4IHPA 4PV0A 4WNKA 3MTFA 4DHFA 4RZVA 3VS4A 4XH6A 4E1ZA 3RGFA 3NNWA 4FEUA 5FXSA 4D5HA 1YVJA 4ARKA 5IUGA 1H25A 3HP2A 4AZEA 4PNKA 3R83A 3T8OA 3Q96A 4BI1A 5KX8A 2J2IB 4QP8A 3QQJA 2VO0A 3TM0A 1YXTA 4NT4A 3ZFMA 4R3PA 2X6EA 3Q4ZA 3TNWA 3LXNA 3DQWA 1SVGA 5DE2A 3V5WA 3PXYA 3Q53A 3VS1A 4I4FA 3OCSA 2W1FA 2WMAA 4WNPA 2CCHA 1H00A 3MFSA 2YM8A 3ODZX 4I6FA 4I6BA 4M69A 5M06A 4WIHA 2WB8A 1YQJA 2R3IA 4RIWA 3TT0A 3FAAA 4EWHA 1YI4A 3PWYA 2BHHA 2YWPA 1H26A 4M8TA 3II5A 4ZY5A 4B8LA 5J9ZA 1H1SA 3H0ZA 3JY9A 3CBLA 2OJFE 3RK9A 3ZCLA 4AFJA 5IDNA 4EOKA 1PYEA 1ZYDA 3F61A 3KXXA 3EQFA 3M2WA 2VWVA 3AXWA 2GNIA 2OG8A 5J79A 3BWFA 3BYSA 4GFMA 2PUPA 2WNTA 4RWJA 4JS8A 5AIRA 3PZEA 5ACKA 1Z9XA 4YHJA 3CY3A 5HTCA 4O7VA 4BRXA 2VNYA 4LOPA 3LPBA 4QD6A 2C30A 2W5BA 4MXCA 3VS6A 4WOVA 5K0KA 2SRCA 3PA3A 3WILA 1H24A 4DTBA 3R9DA 4FSUA 5CF5A 5CEKA 3FC1X 3OY1A 3WIKA 3OOGA 4OBPA 3UBDA 4G2FA 3D0EA 1LR4A 5CI6A 4CCUA 1LEWA 1ZYCA 4FTLA 4O2PA 2QOBA 4NWMA 3VS7A 2YJRA 4EHGA 3DXPA 5C9CA 1ZMWA 2UZLA 3FL5A 3R7OA 4GL9A 3BQCA 2A1AB 1U46A 2Y7JA 3D7TA 3UZPA 2PPQA 2XMYA 4G31A 4S31A 1OL1A 3I81A 2WQOA 2C47A 2O8YA 1Q62A 2ZV7A 3MYGA 4TWCA 2J0IA 2F49A 3KK9A 1S9IA 3MH0A 3FJQE 4LV8A 4G17A 5GZ8A 4NKSA 5KMKA 1GY3A 4R77A 5J7HA 1AD5A 3CQWA 5BMSA 5EOBA 1TVOA 3EOCA 3ORZA 4F9YA 4FI1A 4OTIA 2GSFA 1UWHA 2ZYBA 4LGDA 1UKIA 3G51A 4XLVA 4YPSA 4JQEA 4RQKA 1YWRA 4O22A 3TNIA 2UW4A 3ZMMA 4FKWA 4AUAA 1FINA 1UU7A 4Y5HA 2XIYA 3KL8A 1LUFA 1B38A 2JDSA 3HUCA 4PPBA 4E3CA 2WTKC 2W1GA 4WSYA 3F6XA 4MEDA 3LFQA 4C58A 4IM0A 3I4BA 2B9HA 4GCJA 3ORKA 2UUEA 1PRYA 1Z57A 2HOGA 4L3JA 4LOOA 2OIQA 3LCTA 4L68A 3FYJX 1OB3A 4IWPA 4FV9A 4IWQA 4ACCA 4EH8A 2X7FA 2XBAA 5AV4A 2PMNX 4CQEA 1APME 4I23A 3GI3A 1G8AA 3WOWA 1OIYA 4O7NA 2OXXA 4RIWB 3BX5A 4O84A 3I5ZA 4BCIA 1W8CA 4WT6A 5HO7A 3UVQA 3U4WA 4WG3A 4RX8A 5GJFA 5CX9A 3W2QA 3EQPA 3K3JA 2F4JA 1P5EA 1HOWA 3NS9A 1WBSA 3CP9A 3VUIA 4I21A 3ZZWA 3QD4A 3NYVA 1KUTA 1CMKE 2I7QA 4FZ6A 2PVHA 4FSWA 4LUDA 2HCKA 4QPAA 2PHKA 2VTSA 4IADA 5F95A 4F7SA 4MHAA 1YOLA 4DITA 5T68A 2XS0A 2PU8A 1CKJA 4GUEA 5CEPA 4QQJA 4JQ8A 3A2CA 3WZJA 5CEQA 4O21A 4X6QC 4YSJA 3C0GA 2EB2A 3SG9A 3DZOA 3Q04A 5AUXA 3SXRA 2R3RA 2GTMA 3R2YA 2EVAA 1W84A 3L8XA 5JN2A 1DI9A 4RFZA 4U44A 5HE1A 4BDCA 4BL1A 4W4YA 3D5WA 3VRYA 3MVLA 4HVGA 3DCVA 2WTCA 4FICA 3BGPA 4D58A 4ZSAA 5L8LA 1FVRA 2Y4IC 2YM6A 5HD7A 4QMVA 3BV2A 2J0KA 2QOLA 4IANA 1AQ1A 1GNGA 2CDZA 4RQVA 3JR1A 3ZUVA 3ORLA 4AZFA 4ZMFA 3BI6A 4APPA 2XVDA 4RJ3A 3Q4TA 1J91A 4IWDA 3B8RA 4UMRA 1WVWA 1SNXA 5FP6A 2UW3A 3VBWA 4KBCA 1Q5KA 3W2PA 3OS3A 3F2AA 4MF1A 3I0OA 1IASA 1A06A 2YDKA 4RBLA 4BWXA 2CN5A 3RINA 2CN8A 3FWQA 3H9RA 4ACDA 2GS2A 4E6CA 4BDFA 1JSUA 3KVWA 2VTJA 4R78A 5FD2A 1GZNA 4KAOA 5JQ5A 2I0HA 2C5NA 5E4HA 3NUUA 2V5QA 2RFDA 4HGEA 4ANNA 2VWZA 4JXFA 4X2JA 1OGUA 3FKLA 3UE4A 4DFLA 5KMIA 2A0CX 2JFLA 4PQNA 4K1BA 2C6MA 2E2BA 3MJ2A 4YJOA 2IG7A 4WUNA 4GG5A 5HCYA 3CJGA 2IZUA 1NW1A 5IQDA 3ZC6A 2VWIA 2C6DA 5E92A 2ITWA 2J90A 4OGRA 3T9TA 5AA9A 4O7LA 3QUPA 2BILB 2JEDA 2ZM4A 4I5MA 4IVBA 4DGGA 3E7OA 2W99B 2GNLA 3S00A 3O7LB 5AM7A 3TDVA 4NM3A 3ENHA 2PYWA 4YLKA 4TL0A 3R7EA 1L3RE 5E8YA 4ITIA 3CKWA 2WIHA 2GPHA 4MF0A 3C50A 5LMAA 2XKEA 3MVHA 2YERA 4PNIA 2VTHA 4O0TA 2EU9A 2W06A 5AUWA 3ZOSA 5LWMA 3ZYAA 3A7JA 4JLCA 4ONAA 2WPAA 3E7VA 5M56A 3R04A 3R8MA 5IQIA 4Q9SA 1KV1A 1RJBA 3VBYA 3W32A 1XBBA 2JIUA 2FB8A 2WU6A 3DU8A 4G6OA 4KIKA 4QP3A 5KKRB 3EQBA 2QHMA 5D11A 1SYKA 2XH5A 3R00A 4ID7A 3KF7A 4C7TA 4CLIA 3WZEA 4YO4A 3SRVB 1YWVA 2WFYA 4XV2A 3FQHA 4FTCA 3NCGA 4AA0A 4ZSGA 3UVPA 4FKUA 3VUHA 3U8WA 3R28A 4S30A 4RJ6A 4UBAA 4AZWA 2IWIA 1BX6A 4U43A 2W96B 4DG2E 2FA2A 2G2IA 4GKIA 2VV9A 2I0VA 1OL5A 3Q32A 3PE2A 5D7AA 4E93A 2PULA 3TDWA 4FT0A 5ETIA 4FKVA 3VUTA 5IPJA 5HEZA 3O23A 3F9NA 4W8EA 4JAJA 3R9OA 4UZDA 1WBTA 4EOPA 1YXVA 3DJ5A 4XP0A 1OIUA 3CE3A 1JLUE 4ASDA 2ITQA 3BBWA 4HYIA 3VS0A 4MBJA 5EI8A 2WU7A 2ACXA 4ANOA 1J1CA 2YCSA 4YMJA 3G15A 3HDMA 4G34A 3UQCA 3QF9A 1OECA 4M12A 4F9CA 4EK8A 2YAKA 1QPCA 4MD9E 4E26A 4ZS0A 2GU8A 3NUSA 3HV5A 4DYMA 3BHYA 1PMNA 2VX1A 4NM7A 3GQIA 5AEPA 5DT4A 3OFMA 2FSLX
chains in the Genus database with same CATH superfamily
1NA7A 3KRLA 1FVVA 3ZHPC 2VWUA 3JY0A 1YWNA 3VBQA 4DTAA 2C5OA 3G6GA 1WVYA 4C8BA 4CG8A 3KF4A 5CEIA 4IDTA 4UYNA 4EORA 4IC8A 4NW6A 4O96A 3V8SA 5HHWA 3QTSA 3GBZA 2QKWB 5EYMA 3RMFA 3OVVA 4CGAA 3ACJA 3D5UA 3DXNA 1WBNA 3E8EA 4UXLA 4CD0A 3MFRA 2KTYA 4IW0A 5DRBA 3VC4A 1GJOA 3GEQA 3KXZA 3FSKA 3CGFA 3PTGA 1PXIA 5I0BA 4FKRA 1PXOA 4DFZE 3FLYA 3MVJA 4DEAA 2ZMCA 3F5PA 2VX0A 3R21A 5HG5A 3PVWA 3KEXA 3DAKA 2FSTX 4R3RA 3W16A 4NCTA 2UZDA 2BUJA 3ODYX 4BVUA 3R7VA 4Q9ZA 3R2BA 5CT0A 5KMLA 4MXAA 3QLFA 4AOTA 5AAGA 1Q99A 4BZOA 3GU4A 4D2WA 5E1SA 4PDOA 3B8QA 3VHKA 4BKYA 2XALA 5GIPE 4EYJA 5AUUA 1CKIA 2VN9A 5A6NA 4E4NA 4O27B 3C1XA 3H0YA 5LARA 3SKCA 3VUKA 3UDZA 3HZTA 2WMBA 3OCTA 4G3DA 3ITZA 1ERKA 5EK7A 3QHRA 4EZ7A 4O6LA 4D4SA 3DGKA 2V0DA 1H27A 4XG2A 5E8WA 2PL0A 4J99A 5I9WA 3UC3A 3GENA 3S0OA 5ICPA 1NXKA 1YXSA 2PVJA 2J51A 4K33A 4C3PA 4CV9A 2VTAA 2VWWA 3H9OA 4R3CA 3PPJA 3D83A 4FKSA 3O50A 4K18A 2PMLX 2OFUA 3I7BA 3RPRA 2R3MA 2R3LA 5AR8A 5FLFA 3ANQA 4A4XA 3IG7A 3KXHA 3LE6A 5K5NA 5M4IA 3VRZA 4RG0A 1KSWA 2ZJWA 3PJ3A 4GFGA 4TN6A 4I5PA 4IX3A 4AW2A 4FF8A 4F63A 5LWNA 4U5JA 3QHWA 1ZXEA 3SHEA 2X7GA 3GU7A 4TRLA 3NAYA 3PP1A 4U97A 5CEOA 4IZ7A 3DB8A 4JL9A 4TZRA 2GQGA 3DTWA 3Q6UA 3KN5A 2O63A 4FYOA 4O4EA 4ACMA 5HBJA 4E7WA 4CFXA 4QMWA 5L3AA 1PKDA 1Q8WA 1XBAA 4LMUA 3A8XA 4AN9A 2YITA 3U54A 5JT2A 4WHZA 2FH9A 4OTRA 4QTEA 4LGGA 4F9AA 3CD8A 4P90A 4EUUA 2YM5A 3VF8A 4CMOA 1ZZLA 3BCEA 3QQKA 4ZIMA 4ZTMA 3QAME 4K77A 2QNJA 3DQXA 3RKBA 4Z7GA 3RNYA 2YIXA 3HV6A 4P5ZA 1WBOA 4A7CA 3K3IA 4DAWA 2RGPA 2HXQA 4EJ7A 3OXZA 4USFA 1JSTA 2IVTA 5AR3A 5TE0A 3RNIA 3UODA 4HW7A 5J7BA 2W1EA 3FMHA 4FTOA 5IG1A 3R9HA 4DFXE 4D2VA 2EXEA 4C35A 1O6YA 3PG1A 4FT9A 2V62A 3V3VA 3ZRLA 1J7UA 5DYJA 4IBMA 2O3PA 3FZOA 3SW7A 3FLZA 3VBTA 1YOJA 2QOHA 3ZLXA 3IW8A 3LM5A 1H0WA 2AC5A 3LXKA 3NPCA 1PXKA 4IX5A 2IZTA 4CTBA 4QYHA 2WMVA 2WTDA 2YCFA 2J0LA 2YISA 3Q2MA 3Q9ZA 4TWNA 5F1ZA 4DEGA 3GOKA 1G3NA 3VQHA 3I6WA 3ZEPA 4U3YA 3BEAA 3CEKA 3F7WA 2OF2A 3DKOA 2RG5A 4FTQA 5H2UA 4NUSA 4ZTNA 4BCHA 3FI3A 5TO8A 3NAXA 5HTIA 3SW4A 2V7AA 3I7CA 5LQFA 4C2WA 4YJQA 5L2IA 1J7IA 3DB6A 4DH7A 3F82A 4W4XA 3C51A 4FEXA 4UYAA 3PJCA 4M3QA 3MI9A 3ORMA 5ANDA 1NVRA 3DAEA 3DBDA 3JXWA 5CANA 3U6JA 4I94A 4L43A 3P7BA 4HVHA 4AXDA 4BCGA 3F3ZA 3BGZA 3PFQA 3OY3A 2ETMA 3UIUA 1YW2A 4W4VA 4PMMA 2YM3A 3LFSA 3CD3A 5CALA 3W0QA 5IDPA 3OHTA 3ZUUA 4ANLA 2VTMA 5GZ9A 4BCPA 4E4LA 4E73A 3PVUA 2JAMA 3EQDA 4G5JA 4BDHA 5BX0A 5BVOA 5LCJA 1Y91A 3R7IA 3R22A 3PIYA 1OKYA 1E1VA 3MA3A 4OTHA 4Z3VA 2XIZA 5L8KA 2I0YA 3KK8A 1JQHA 2IEWA 4GK4A 4I6HA 4G6NA 4TXCA 3MA6A 4NFMA 1Q97A 4U0IA 4AQCA 5HNIX 5KBRA 4H05A 3NZ0A 3R01A 3R1YA 4X2KA 1XH5A 3FLQA 2UW5A 3EHAA 3RCDA 3P5JC 1UWJA 2KULA 4IX4A 2IPXA 4FNXA 4FL3A 2HXLA 4NJ3A 2VAGA 3MH3A 3BHVA 5HLPA 3HRFA 4RWIA 4ANQA 4EZ3A 4EZ5A 3COKA 5CVGA 5HVYA 2XRWA 3JS2A 3ORTA 5GNKA 1H1WA 3F3WA 4U81A 4QTDA 4BCNA 3P78A 4U79A 2UZOA 3MIAA 4BN1A 3LFBA 4DE4A 4FSZA 3NUYA 3NIZA 3KVXA 5KMNA 1O6LA 3EJ1A 5M4FA 5D41A 1IR3A 3LM0A 4GT4A 3MDYA 3R30A 4PDYA 4JG6A 4JBVA 2GQSA 3R8VA 1OL6A 2JLDA 2QLUA 3Q60A 1EH4A 4BKZA 5DEWA 4BHNA 4M66A 2VD5A 2W4JA 4JDKA 3QX2A 2LAVA 4S32A 3OTVA 4BICA 3ZO2A 3UG2A 2F2CB 3UTOA 3GXLA 3P9JA 2YA9A 2UZWE 3ZU7A 2REIA 1OL7A 4GYGA 4CMTA 1PXJA 4HVDA 3H3CA 4B7TA 4HVSA 4TWOA 3GQLA 5IEXA 3MPAA 1PY5A 5AR2A 3W2RA 4B99A 3OF0A 4BDDA 5KUPA 4BZDA 4WKQA 3WI6A 4DT8A 4RJ4A 3UDBA 1ZOHA 3KRXA 4NL0A 1HCKA 3VW6A 2G1TA 4BTMA 4TTHB 3AKJA 4R5SA 5KE0A 4YTFA 2GFCA 1RE8A 5HG8A 4FRFA 5IA1A 1G8KA 1JKLA 3R73A 4CG9A 3LAUA 4FL1A 3ANRA 1R39A 3TWJA 4GIIA 3TUBA 2XB7A 4YLJA 4ZTQA 4RMZA 2BZKB 4QYEA 2W0JA 2F2UA 4UY9A 3POOA 3QA8A 2P2HA 5IQHA 3LMHA 1IRKA 2OFVA 4Z55A 5A6OA 1PKGA 3KRWA 4G16A 4E4MA 2ERKA 2CSNA 3Q4UA 3SA0A 4DBXA 4Y73A 4KBKA 5IA2A 4C36A 4CTCA 1L8TA 1REKA 3KRJA 3NYXA 4QTBA 3PJ2A 3WE4A 5CS6A 3QGWA 3V01A 3U6IA 4O7YA 3M1SA 3MSSA 4FYNA 4Q5HA 3GB2A 3ORXA 4TYHA 1R1WA 2NNWB 2UVYA 5DH3A 2WMRA 2XCHA 3QZGA 3KU2A 4NKAA 4XG6A 4Y85A 4TWPA 5FBNC 5HI2A 4DFBA 3S1HA 3JVRA 2B0QA 3V6RA 1PYXA 3OOMA 4PY1A 4HPUE 3W18A 2FO0A 4JIKA 4O0XA 3K54A 5AP4A 5HD4A 4PDSA 4QMNA 2HZ0A 4ZMEA 2C6IA 2ERZE 5D9HA 2GNFA 5DG5A 4IAKA 3JPVA 3WF7A 2BRBA 4E6QA 4FODA 4QPSA 3FLSA 3FMJA 2OXDA 2JKKA 4CKIA 3FL4A 3CQUA 2PE1A 4I0RA 3PP0A 3WIGA 2WGJA 3D15A 2Q83A 3G6HA 3MPTA 4IIRA 4LGHA 4RC4A 3ZO3A 2Z02A 4DDIA 3FV8A 3D94A 1DAYA 3S95A 2BAKA 2IVSA 5EW3A 5J1VA 3R63A 4FIEA 3ZDUA 5KHXA 5L8JA 2A98A 3E93A 5KMJA 2QHNA 3CQEA 3P0MA 3FMLA 2R3PA 3VUMA 2UVXA 3EN7A 1YHVA 2ITNA 4D4VA 4OBQA 5JMSA 3NDMA 4AT4A 3GCPA 4QMLA 1BL7A 3WE8A 4AWIA 3AMAA 4DBNA 5C01A 4O6EA 4JG8A 2XKDA 3DJ6A 3R8ZA 2F9GA 4RZWA 1Y6BA 2B54A 2WQEA 3G9LX 2XA4A 4U3ZA 2IO6A 4BCQA 5GIOE 5AUZA 5DR9A 3FY0A 4XG7A 4FKIA 5J5SA 3BWJA 4XJ0A 3QX4A 4XUFA 4A4OA 2BRNA 3KGAA 3A7IA 4D28A 3E87A 2VO3A 4EK4A 2YEXA 4EQUA 3UO4A 3ZRKA 3LCDA 1E9HA 4DEIA 4HGSA 1YDTE 3COIA 4QDEA 3RK7A 3DBFA 3R1NA 4FV2A 4AT5A 4JDJA 4FG7A 4NH1A 4U8ZA 3I79A 4FVRA 5CVFA 5AAFA 3BL7A 3BIZA 4EH7A 1WBPA 5T3QA 1V0PA 5CAQA 5JFVA 3HRCA 3LFEA 4H3QA 2UW0A 4O0YA 4EOIA 2V7OA 3OWKA 4B0GA 4P2KA 3TIZA 5I9VA 5HE3A 4CMUA 4FZ7A 4XG9A 5CAPA 3CIKA 4RT7A 4H3PA 5KMOA 3P4KA 5CSVA 5CAOA 4RIXA 4DEBA 4QMQA 5CT7A 2RIOA 3VONA 3RP9A 4YLLA 3F3UA 4Z16A 4J52A 2NO3A 4C34A 3ZM9A 2HYYA 4WBBB 2WKMA 4D2SA 3KC3A 4AA4A 3RAHA 1QPEA 2WTIA 4XP2A 3QFVA 4MK0A 3RPOA 3W0PA 3VW8A 5CXZA 5FTGA 4RA4A 3A61A 2GMXA 2JITA 3LFDA 4HYUA 4IZYA 3CS9A 4TYHB 4XV3A 4YJRA 4BFMA 2UW6A 4EH2A 2PZPA 3H30A 5E91A 4ZTLA 4D0XA 1OITA 4AE6A 4BGGA 4RX5A 4CT1A 1OBDA 4IAYA 5CU4A 3PRIA 4S33A 3TZ9A 2IJMA 4GS6A 3TTIA 5AUVA 4L3LA 5FEEA 3DFAA 3IK3A 4FX3A 2WAJA 3LCOA 2H34A 4OTWA 5ANOA 4QP1A 3V5TA 4ASZA 3MPMA 4FKQA 2VO7A 3FQEA 2P2IA 3EN4A 4F9WA 3LOKA 4YC6A 2NRUA 2ZFYA 5CAVA 2PE2A 3HMMA 4KIPA 1A9UA 2G2HA 5BVKA 5IH5A 2GNJA 5FUTA 2XNMA 3C13A 2ETRA 4K2RA 2BZJA 3CJFA 5FXQA 3V8TA 3GU8A 1XR1A 2UZTA 4KB8A 2PVFA 5AP5A 4FKLA 4IWOA 3TXOA 5IEYA 4X3FB 5H8BA 3TKHA 2WMUA 1SZMA 3HDNA 4GYIA 2JC6A 4RRVA 3LLAA 2WMSA 2W4KA 4YSMA 5TKDA 3TUCA 4H1MA 2J9MA 3CCNA 3WBLA 4FKTA 4ITHA 3VWAA 4A9UA 2B9IA 4D9UA 4PL5A 2JKQA 3FQSA 3LLTA 4DHJA 2YCQA 5CSPA 3TCPA 1H07A 2WMQA 3W33A 5IQGA 4WUAA 1ST4A 5HX8A 5DIAA 2PZRA 4AX8A 3L8SA 5BQ0A 3EFWA 3KA0A 2BDFA 4AOIA 3ULZA 2R3JA 3ZH8A 4JOAA 3QBNA 3BLRA 3KIOC 3EL7A 3MESA 3QU0A 4OTDA 2BDWA 4IQ6A 2G9XA 1OUYA 2E9NA 4U42A 4P4CA 4G9RA 5DN3A 4FA2A 4OTPA 5BMMA 1UKHA 3IW6A 2VZ6A 4Y46A 5EFQA 4G3FA 4ZAUA 5AP7A 2CJMA 4A9TA 1YDRE 1OVEA 5ANKA 5K0XA 3RWQA 1H08A 3SOCA 3HGKA 3LCSA 3HKOA 1PXNA 4GJ2A 2Z8CA 3ZXTA 4TYGA 3ACKA 2QOQA 4PL3A 5H8EA 5JGDA 1H1PA 3AGMA 4L42A 4AOJA 3UPZA 1M14A 1OIRA 3QXPA 5E8ZA 1WBVA 3Q9YA 4O4BB 4V0GB 4YZNA 3ZBXA 4BKJA 2XJ1A 4DLIA 1MP8A 1J3HA 3ZS5A 1JPAA 4YZBA 3NNUA 3O5AA 3F2NA 3FE3A 3LHJA 3ZUTA 5L2WA 4AZSA 4RIXB 4RLKA 2ZDTA 4RVLA 1I09A 4JRVA 4FOBA 4M0ZA 5A46A 2QR8A 3HNGA 2X9EA 3OWLA 1XH6A 4RWLA 1YOMA 3ZLWA 4PTEA 4O0RA 3SRVA 3F5GA 4KKGA 2Y9QA 3BHTA 3PDTA 1XMMA 4FT3A 3RPVA 3GGFA 1G8JA 1M2PA 4IFCA 3NEWA 4UZHA 3SOAA 3LXPA 2XJ0A 4GK2A 3ZXZA 1H28A 3QQFA 4KIOA 4ZOGA 4EK6A 3VF9A 2VO6A 4YNOA 3TV7A 3NUPA 3ZLSA 1UNLA 3V5QA 4L7FA 2BRGA 2I0EA 3QTXA 4O7WA 3MB7A 4FL2A 4NTSA 4CKRA 2O5KA 3FZ1A 4S2ZA 4YBJA 2FSMX 3KCKA 4EH9A 1FBNA 2B55A 2X39A 4BCMA 3F5UA 5HIBA 4DLJA 2QD9A 4FZDB 4RIOA 1JKTA 1IEPA 2HENA 3N4TA 1JAMA 3NWWA 5HE0A 5HVJA 2Q0BA 4MBLA 4QTCA 3UVRA 3RHKA 1NVSA 1PF8A 3EFJA 4WNOA 3MGYA 4N70A 5HU3A 4XBRA 4ERKA 2ITYA 4I0SA 5DLSA 3P7CA 5HESA 3RK5A 5IU2A 4ZLZA 3DBQA 1PXMA 5BPYA 4FOCA 4ANMA 2RFEA 3NSZA 2VTLA 2ZV9A 4WBOA 4ZY6A 3VHEA 4EOOA 4HPTE 3BKBA 2OH0E 2QO9A 2C5YA 1DS5A 3GT8A 3LZBA 4GSBA 4KRDA 5CSWA 1JSVA 2XBJA 4ZZMA 4ALVA 5LVNA 4PRJA 2C6LA 2RKUA 3OP5A 1H01A 3AD4A 3W10A 3PWDA 4L8MA 5JGAA 5EOLA 2QVSE 4BTFA 4DHIB 2GNHA 2R7IA 2Y6MA 2C3KA 3UG1A 2BTRA 1V0BA 2C1AA 2X4FA 4CZUA 2HY81 4LDTA 1YI6A 3IONA 4HGTA 2GDOA 3EZRA 3WYXA 4UMTA 1TQIA 3QA0A 3RVGA 2R3FA 5TT7A 4ERWA 2XZSA 4RVKA 5ETFA 2C3LA 3QUDA 3UO6A 2R64A 4AP7A 4NYEA 3Q6WA 4O2ZA 4MNFA 4FIJA 4XCUA 2C3IB 3VJOA 4FEVA 1F3MC 5DR6A 1W0XC 3NCZA 2VTOA 4TYEA 1WCCA 4HZRA 1PW2A 3PG3A 3G5DA 1U4DA 4MYGA 2V22A 3GUBA 2G2FA 1UNHA 3DTCA 4MX9A 3PSCA 4OTGA 3UOLA 2ZM1A 5AUTA 4YTIA 5B7VA 2XJ2A 3LXLA 2H6DA 2OH4A 4QMUA 5AP3A 2ZOQA 4DA5A 3QRJA 5AA8A 4EC8A 4AA5A 3ROYA 1ZYLA 3NW6A 4UMQA 2QURA 3CPCA 2HWOA 2BHEA 3Q9WA 3RBWA 2OJIA 4GKHA 4KNBA 1BI7A 1REJA 2B7AA 1H4LA 4FG9A 2YCRA 3JVSA 3LCKA 4QNAA 3RPYA 4DT9A 3L9LA 1ZRZA 5ACBC 3HMOA 4J1RA 4RC3A 4C4EA 4C4IA 1XQZA 2J6MA 4AG8A 3AT4A 5ANIA 5AV2A 4FNYA 3FSFA 3GC0A 4HJOA 4C33A 4E5WA 4MTAA 1CSNA 2R3GA 4OW8A 5A54A 1CKPA 3BE9A 3UOJA 1R0EA 4USEA 4DTKA 4EHZA 3TNHA 4KKHA 4DFYA 4BYJA 5HORA 2QOOA 5LMKC 1DI8A 5I4NA 3ERKA 4KS8A 2I6LA 4EC9A 3P79A 4YURA 3VBXA 2C69A 3MWUA 5AADA 5CU0A 4FVPA 3OBGA 4RWKA 4J97A 3O51A 4J71A 5E8XA 4NFNA 5M09A 2GNGA 2PVYA 3OWPA 3QQGA 4HOKA 4TW9A 4TPTA 4XV1A 2CKOA 3SDJA 2VWBA 4FV1A 4QP7A 4AGDA 4L6QA 5CNOA 2WIPA 1YHSA 2W9ZB 2UZBA 4FC0A 3BU5A 2PVNA 3FPMA 2XNNA 3HEGA 3CXWA 2BPMA 4R7IA 4RC2A 4UV0A 4ZSEA 4X2FA 4P5QA 3KN6A 2W1ZA 5GZAA 4DGOA 4EEVA 4N0SA 4FEQA 4D4YA 2VGOA 4L01A 1VJYA 2G01A 5BUEA 1Q3DA 3ATTA 3HP5A 3FLNC 4G3GA 2QI8A 2HWPA 5B0XA 4V04A 4YBKA 4TKSA 5JK3A 1MQBA 4L53A 5AV3A 4L46A 3WF5A 4EQMA 5J9LA 4FZAB 3V6SA 4AAAA 1RW8A 3QCYA 5EW9A 5FM2A 5K4JA 4FEWA 5DBXA 4UMPA 1MUOA 3R02A 3S3IA 3DLSA 5IH6A 3OUKA 4LI5A 2XK8A 3U87A 3E64A 3WF8A 2QONA 5IQCA 3I60A 1O6KA 5HG7A 1U5RA 3MV5A 2UZVA 4JIAA 4JAIA 4IM3A 2VX3A 5IMEA 4DFNA 4O81A 5FEDA 2JDOA 2J5EA 4MXOA 4K8AA 3VIDA 3LMIA 4MD8E 4D1SA 3T3VA 1OL2A 4KBAA 4EOMA 1ZMVA 2H8HA 3CSVA 5IQEA 3NVKI 3KULA 3LMGA 2XK3A 2ZV2A 3TJDA 1IA8A 4X3JA 4WRGA 3A60A 2WTKB 4OT5A 3LQ3A 5HX6A 3HMPA 4I6QA 5AV0A 4I5CA 2QOIA 3FBVA 2WHBA 4JBPA 4X2NA 4W9WA 4JX3A 1GIIA 5CVHA 3UQFA 1STCE 1SVHA 4TNDA 1W98A 3NFFB 3AOXA 4ZZNA 3V5PA 4R6VA 5I9XA 3W2OA 3AC5A 4KSQA 2XEYA 5D10A 3EH9A 3RWPA 5AV1A 4XRLA 3QQLA 2UV2A 5HLWA 2QOKA 4J7BA 3KB7A 4D0WA 4BTKA 3M11A 3TYKA 1PXPA 2VRXA 3I6UA 2RG6A 4FV5A 5DR2A 4EUTA 3WZKA 4QOXA 5AX3A 4TT7A 2Z7QA 3CPBA 2XNBA 4L67A 2BAJA 3DOGA 3SXSA 2XK4A 5AR7A 3U6HA 2DUVA 2W1DA 2OF4A 2BRMA 1ZAOA 5AMNA 3GCUA 2W1IA 3IO7A 4NK9A 1BL6A 2JKOA 5B2KA 2P33A 4EOLA 4D4RA 3EQRA 4EBVA 1UV5A 2F7ZE 4R5YA 3SVVA 2R9SA 4DCAA 3PXFA 3A7HA 2P3GX 3KREA 3N4VA 1M17A 4HCVA 5E8TA 4BY9E 2AYPA 4BGHA 4UMUA 3EYHA 4JVGA 3PJ8A 2W1HA 3VS3A 3UOKA 5M57A 2R5TA 3ZRMA 2PZYA 3G33A 5EI2A 5DEYA 5EDQA 2Z7RA 3E63A 3GOPA 4E20A 4ZTSA 2CNQA 2BIYA 4F1OA 3H10A 4QO9A 1KOAA 2PWLA 2XUUA 3IKAA 4ORKA 2ITTA 2XIXA 3QXOA 4PPCA 3TNPC 2Y4IB 4MNEA 3PVBA 3VO3A 4D9TA 1MRUA 1OI9A 4DEEA 3HRBA 1YKRA 1KE6A 4O4FA 4WA9A 3QC4A 4LRKA 4RGJA 4YZ9A 5IA4A 5JZJA 5EKOA 5IA5A 5AX9A 1XJDA 4BC6A 4U80A 3OEFX 4O7SA 4FSQA 1W2DA 5HE2A 4FKOA 2C0IA 1GAGA 5E90A 4CFNA 1BUHA 2B1PA 4ZJJA 5ANJA 4USDA 2PZ5A 3LJ2A 4FV0A 1XHAA 4MD7E 3V8WA 4DF3A 4DFUA 1JVPP 3M42A 5AP0A 2X9FA 5BVWA 2I1MA 3LFCA 5FTOA 3UJGA 3UMXA 4QP4A 3MB6A 1Y8GA 3PUPA 4J53A 4L9IA 2BR1A 5DRDA 4DEDA 1XBCA 2F7EE 1KV2A 3LKMA 3SG8A 3HUBA 5G1XA 2CLQA 3ATSA 3NR9A 3QTUA 2C4GA 3KULB 4LL0A 3C4XA 5LVLA 1P2AA 2FYSA 3Q4CA 3BLHA 5JFXA 1RDQE 2PY3A 1MQ4A 3U51A 1OPKA 3GNIB 2CCIA 4GVJA 4AACA 5AAEA 2ZV8A 3QD0A 3EN9A 4MH7A 2PVKA 4XP3A 5EDPA 1OKVA 2R0IA 3BE2A 3PXKA 4IX6A 4XS2A 5BVEA 1UVRA 3QZHA 2IW8A 4HGLA 5EG3A 5KZIA 5L2SA 1G5SA 3AD6A 3EZVA 2YM4A 3FPQA 5C8MA 1UA2A 5AP1A 4AT3A 4YUQA 4RJ8A 4MXZA 3EFKA 1TQPA 2XNGA 3UDSA 2BCJA 2GS6A 3DV3A 2XF0A 5HBEA 1ZZ2A 3IDPA 3L1SA 3IW5A 2VGPA 3PPZA 3POZA 2VTIA 5HVKA 5IKWA 4FUYA 5EKNA 4M0YA 2BMCA 2E9PA 1OZ1A 5CZHA 5JZNA 3UZTA 4DC2A 1KWPA 5G6VA 4EONA 5M4CA 1J7LA 2F7XE 4CFUA 2XK9A 5FQDC 4MAOA 4A9SA 5ITAA 5B2LA 4NSTA 2G15A 2X7OA 2ZDUA 1Q4LA 3D4QA 3RM7A 4OT6A 1WFCA 5EHLA 3I0QA 4JR3A 4RIYB 2YDIA 3T9IA 5L6PA 1QCFA 3PE1A 2WTJA 3OXIA 1TZDA 3BQRA 3FMKA 2XCKA 3QTZA 3KXGA 3R6XA 4E6DA 4G6LA 2YHVA 2HW7A 2VTNA 4BZNA 4EHEA 4CVAA 4C0TA 4FG8A 4NIFB 4LRMA 4UWCA 4A9RA 2Y4PA 3QD3A 4F0FA 3IW4A 2XNEA 2JDVA 3O7LD 2OXYA 3UIMA 4CFMA 4D2RA 2VTTA 4I93A 3DXQA 2ITXA 4MNEB 3A8WA 4CXAA 3QKKA 4C4JA 1NVQA 4NM0A 5M44A 5C03A 2R7BA 2JAVA 4HZSA 3GFWA 2YLFA 1T46A 2P4IA 3KXMA 2W17A 2XIRA 3HYHA 1Q24A 2OU7A 3IDCA 2AC3A 3FKNA 2A19B 5ETCA 1VR2A 4MQ2A 4EKKA 2HK5A 5DOSA 2QOCA 5I9YA 4I20A 3VAPA 4FKJA 4OTQA 2A2AA 4BJJB 5JKGA 4BGQA 4RFMA 1M7NA 2WEIA 4IB5A 4RX9A 3CTQA 4WNMA 2NRYA 5K5XA 3UP7A 4QEBA 5I3RA 2C3JA 3CR0A 3AMYA 4MBIA 4FTAA 2W5HA 1YXXA 2OBJA 3E8CA 1SM2A 1ZOGA 3QWJA 3TV4A 2ZVAA 1WMKA 3QKMA 2WMXA 4GH2A 5LXMA 2W7XA 5AP2A 1U5QA 4U9AA 5BVFA 4AXFA 4I4EA 3DS6A 3Q52A 1URWA 5DNRA 2J4ZA 4G1WA 2X2KA 2ZB1A 4IZAA 5GINE 4IB0A 4FV7A 4ACHA 3GVUA 4D1ZA 4O7RA 4I1ZA 1FGKA 2CKEA 5H8GA 3LJ1A 4BTJA 4CZYB 3OCGA 2ONLA 5HTBA 1GIJA 4U7ZA 3R71A 3MH1A 3OC1A 4L7SA 4O1PA 4GFOA 2YIYA 1T45A 1OUKA 1PMVA 5FBOA 1OPLA 4XG8A 5TR6A 3ALOA 3GCQA 5IQFA 4LG4A 4EWQA 4H3BA 3P7AA 4QT1A 2IZRA 3TKUA 4GJ3A 4NTTA 3ZZEA 3WZDA 5A4CA 2UVZA 3PJ1A 4MQ1A 4O0UA 1Q8YA 3QTRA 3ZSHA 3D9VA 4ASEA 3UDTA 3ZDIA 2XEZA 2E9UA 2UZUE 3LQ5A 5KO1A 3EB0A 3IECA 2VWXA 4L00A 2IW9A 3PIXA 4AW5A 1IA9A 3D7ZA 3R9NA 3G2FA 4ZJVA 5KNJA 4L44A 2W5AA 3DKCA 4ZZOA 5LVPA 3QKLA 4AU8A 4TYIA 5EQYA 1VYZA 4YP8A 1FOTA 5EI6A 4BHZA 3PFYA 4FTRA 4DCEA 3ZO4A 5BNJA 3NUAA 2YACA 5JRSA 3KMMA 2A4LA 4UX9A 3ML1A 3L9PA 1S9JA 4AN2A 4ANBA 1OMWA 4GG7A 4YC3A 4X3FA 4ZXTA 3REPA 3TG1A 4JBQA 3ULIA 4MUQA 1FGIA 3LFNA 4X6RA 4M13A 3BYMA 5FM3A 1FPUA 4FSTA 4ZEGA 3E92A 2PVLA 3FZRA 3PXQA 5EM6A 3QQUA 2X2MA 2UW9A 2XRUA 2VTQA 2C0TA 5FGKA 4JNWA 4M67A 2DWBA 3MY5A 4I3ZA 2X2LA 2GFSA 3R8UA 1UNGA 3KCFA 3MFTA 3QRTA 5E8VA 1GZ8A 4AE9A 4O38A 4O4CA 3DDPA 4LV5A 4OAUC 5CXHA 4CRSA 4F7JA 4AQKA 2QO2A 3EKKA 4CT2A 4FGBA 4F64A 2J7TA 2WTVA 3GFEA 4JDHA 3NNXA 3E3PA 4PMSA 4QMXA 3W55A 4IM2A 4FK3A 5M51A 2CNUA 5A9UA 2YZLA 3OCBA 4GK3A 4XOZA 3NW7A 2LGCA 4Y8DA 1H1QA 1OKWA 3FXWA 2PVMA 1K2PA 2UW7A 3IW7A 1ZARA 3HV4A 4V0GA 3VVHA 2HZNA 3BLQA 5E9EA 3EL8