3PPKA

Human b-raf kinase in complex with a non-oxime furopyridine inhibitor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
276
structure length
262
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
publication title Non-oxime inhibitors of B-Raf(V600E) kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 262
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ppkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ppkA01
3EWHA 4XG8A 5EHOA 4D2TA 2ZB0A 1L3RE 1RDQE 4U42A 5IA3A 4FVRA 4MAOA 5AMNA 4QTEA 2R0UA 4NFMA 4BWKA 5T68A 3PDTA 2WO6A 3NUUA 2OF2A 2BILB 3GT8A 1E9HA 4WNKA 4AS0A 5A6OA 4JDHA 3MVLA 5L2TA 5J1VA 3IW4A 4D1ZA 4YJTA 2X7OA 4WG4A 1Q8ZA 2A19B 2C1BA 3P23A 4M67A 4S33A 1LUFA 4XG6A 3SD0A 1Q8WA 2XKFA 3VHEA 3TCPA 1J7LA 3A7IA 4X6QC 4HGEA 4S31A 4BB4A 1YHVA 4XV3A 4DH5A 3PLAE 4I4FA 3OT3A 2YJSA 2UZBA 3ODZX 5DOSA 3PWDA 4I21A 1IA8A 3HV5A 3V8SA 4XRJA 3SW7A 3PG3A 3KMWA 3LFNA 3AC5A 1URWA 4TWCA 1DS5A 3PG1A 2P33A 4C02A 4G5JA 1ZXEA 3V5WA 3SQQA 1XWSA 2HAKA 4KS7A 4ANMA 2QKRA 3LPBA 2UW7A 3DDQA 1XJDA 1BMKA 5HVKA 3D94A 3F88A 3EOCA 3Q5IA 4AOIA 2X2MA 5CEPA 2EU9A 5IUHA 5EW3A 5CF5A 4OBPA 3WZEA 3LMGA 3MPAA 2BROA 3A60A 3R9DA 4AW0A 2BTSA 4A06A 4DGNA 4CMUA 2YJRA 4IMYA 3GC7A 1JKSA 3DZQA 3A4PA 3NPCA 4BDCA 2G1TA 4ANLA 1QMZA 4QTBA 4GT4A 2YCFA 2IW8A 4TZRA 4K33A 3UIUA 3SXSA 3D7ZA 3W8LA 4JLCA 3O8TA 4EZ7A 1NVRA 3L9PA 3AD4A 4UY9A 2W7XA 3ELJA 4DFZE 4WKQA 2Q0BA 5A46A 2JDTA 3QQUA 2VWZA 4FTRA 1MRVA 5A4CA 4J1RA 2B55A 2WEVA 3GENA 3VS2A 1ZWSA 4BDHA 5EHLA 2R3HA 4O0SA 4I5MA 2ZM4A 2HW6A 4ZEGA 4DTBA 3NCGA 4UB7A 2F7EE 4FT9A 4IX6A 5CXZA 3EN5A 3EQFA 2JDOA 1WBPA 4H58A 5ICPA 2VX3A 4EOKA 3EFWA 4JQ8A 1OL6A 3KRXA 3M42A 5KO1A 1CKPA 4GT3A 4W4YA 4EYJA 2JKQA 2F7ZE 3OD6X 4O86A 1KSWA 2HZNA 3Q53A 4O7YA 2E2BA 2XF0A 3HNGA 2C3IB 2WMXA 5L2IA 2H96A 4AZFA 4TN6A 2J51A 4ZTQA 5JKGA 1WMKA 3ROYA 1PXPA 3KXXA 5LWMA 3TUDA 4FVQA 1S9JA 3CTQA 4U5JA 2XUUA 3WE8A 3E8CA 3UIBA 3M1SA 4R7IA 3RGFA 4M69B 4Y85A 2W9FB 3T8OA 4QMTA 5IEVA 2GCDA 2YLEA 5CQWA 3U4UA 2YDIA 1O6KA 2PMNX 3E93A 3O17A 3VW6A 5EOBA 5IPJA 4FKJA 4WRGA 4YC8A 4FSQA 4ZTSA 4BL1A 2QOFA 1STCE 5DIAA 1PJKA 5IF1A 4MVFA 3WZDA 2I40A 2J2IB 3C4ZA 1OBDA 5FEEA 3MB7A 3PVWA 2ZV9A 4O1PA 2IW6A 2DQ7X 4JBQA 4ZTHA 3BHVA 2XK3A 4YHFA 4NT4A 4X21A 2XNBA 3MFUA 4YJVA 5D7VA 4AQCA 1ZLTA 5KMJA 3VUKA 3ZO4A 2JDRA 3E3BX 3FYJX 4AT3A 4F63A 2J9MA 1QCFA 3LOKA 4CLJA 5I4NA 2BRNA 1NA7A 3VUGA 2JAVA 4YTFA 4QMXA 1GAGA 4EOOA 4FYOA 2F9GA 5TR6A 3PTGA 3ITZA 2ITQA 3PJ8A 2BRMA 1ZOHA 2Z8CA 3QA8A 4L6QA 3QQJA 3OTVA 2YA9A 1DAYA 4BCNA 2DUVA 3BHUA 3HDMA 4LFIA 2AC3A 4LG4A 2XKEA 3QTUA 2E9OA 2W96B 3RI1A 2ZB1A 2RF9A 3NS9A 4LUEA 3R1YA 3FLNC 4IX5A 3DB6A 4FKWA 2R0IA 2PMLX 4FEQA 4OT5A 4CV9A 4U0IA 3O23A 2O2UA 2F2UA 5J5SA 5CY3A 1Q97A 4G3GA 1GIJA 2GDOA 4YNOA 4XV1A 4DGGA 2EXCX 5HORA 5KHXA 2LAVA 3HMNA 3G9NA 1QPJA 3RAKA 1M52A 4ZAUA 2GS7A 2Z60A 4RIWA 3UTOA 1FBNA 1TQPA 2BIYA 4HYHA 2Z02A 4O22A 3VUIA 4YZ9A 4JJRA 5J7HA 4CQEA 4IAIA 4IWDA 3KXGA 4FK3A 5TO8A 1CM8A 4C7TA 4H3PA 5F94A 1F0QA 2CKEA 2W06A 3U51A 5K5NA 3SG8A 4FT0A 4L01A 1FMOE 3OP5A 4YZNA 5JGBA 3TZMA 1XHAA 4IQ6A 3LFEA 1P4FA 2OIBA 5CI6A 4O7SA 3U8WA 4BIEA 2OXDA 3R8UA 1P2AA 3ROCA 4BDFA 5EW8A 5BQ0A 3PJ3A 4O0TA 2PVLA 2OH0E 4QP4A 2V62A 5D10A 3S4QA 4A4OA 3PE2A 4J71A 3L8VA 1BX6A 1UNGA 1ZZ2A 4G9CA 4R6VA 2ZMDA 1GIIA 2J5EA 3EN9A 2GQSA 1Q4LA 5EQPA 3KU2A 5I9YA 3COIA 1Q3DA 4R3PA 4UEUA 4BI0A 3UC4A 4JI9A 3QD3A 4OTRA 3TT0A 3FDNA 3Q9XA 3R0TA 2QG7A 2PZPA 3QBNA 4YHTA 1H1SA 3OXZA 5KHWA 4A4XA 4USEA 4HVGA 3PSDA 5HZNA 3MJ2A 4I6HA 4IVDA 3HAVA 2QURA 4G2FA 5DPVA 3HV7A 4IIRA 5IKWA 5C8NA 2NPQA 3I79A 4IBMA 3LFSA 3EN7A 1ZOEA 5FG8A 3E8EA 5JZNA 2YHVA 3WI6A 4FL2A 3DFAA 3SG9A 3HMIA 4AN3A 2Z7RA 4D2VA 3HEGA 5HU3A 4D2SA 5CT7A 2FSOX 4XP3A 5FBNC 1Q5KA 3DKFA 4GK2A 3FMNA 4BTJA 3LVPA 5LXMA 3HUBA 4NCTC 4E6QA 4TNBA 3MWUA 3O96A 1M14A 2YIYA 2GTMA 3MPTA 4W8EA 2O65A 2OH4A 1Q62A 4XOYA 5DVRA 1FPUA 3RP9A 2QVSE 2W5AA 3OWJA 5M08A 1OKZA 1Y91A 2GS6A 4O27B 2VAGA 2UW3A 5IG1A 3Q4TA 4FUYA 2C6MA 2X8DA 3FMLA 2JD5A 4IAFA 4DITA 4FSUA 4RIXA 5M53A 3LM0A 2V5QA 3OT8A 4FBXA 2VV9A 4M15A 5AP5A 4BTMA 3UG1A 2CKOA 4F7JA 4RG0A 4X3FB 1R78A 5CF4A 5HTIA 2Z2WA 2GNJA 3OCSA 4TYGA 1ZYCA 4YSMA 4ZJJA 2F7XE 3MVMA 4QP1A 5H3QA 2CGXA 3OXIA 3C4WA 3QTWA 4PY1A 3KC3A 4ITHA 2QOOA 4K18A 4FMQA 2OLCA 4BCIA 3NYOA 3WF7A 2R3JA 4PL5A 4E8AA 4P4CA 5E7RA 3RM6A 5GJDA 5CVHA 4GJ2A 3ZDUA 4CQGA 5F20A 4YURA 4FV6A 3EFJA 2A2AA 4PV0A 4M68A 4WG3A 3W2OA 4DEHA 2XBAA 2UW9A 3ORKA 3QRKA 4HJOA 4U8ZA 5HCXA 2RG6A 3PYYA 4RC4A 4LMNA 4HNIA 4QQJA 3G0EA 3FJQE 5AEPA 4NM3A 3BX5A 5EM6A 1UWJA 5LJJA 5A4LA 3T9TA 2RFSA 4FTCA 3G5DA 2G15A 4EOLA 1VEBA 3OUKA 2VO3A 2XYNA 3M2WA 4J95A 4E1ZA 4XBRA 4RC3A 5CQUA 5H8BA 2OJGA 2PZYA 1XO2B 3LCSA 3TNPC 3U9CA 4BIDA 3UZPA 5ANKA 2HY0A 5D41A 4FKRA 3BEAA 5H9BA 1BKXA 5AIKA 4DGMA 3E92A 3QLGA 3V5PA 3ZLXA 1M2PA 3PPZA 5AV2A 4YO6A 5E90A 4ALUA 2DWBA 3EQPA 3ULIA 5L4QA 1PYEA 1WCCA 2OWBA 2Y8OA 3F2NA 4XP0A 5AP7A 1KE7A 2A4LA 2VTAA 4AGDA 3ZYAA 1RQQA 4CLIA 1S9IA 2PZRA 1OPKA 3PLSA 4J7BA 3AQVA 3GFWA 3VBVA 3WYYA 4EJNA 4F6UA 3TUCA 5D9HA 1L8TA 3N4TA 3FLQA 3R1NA 3QWKA 3ZS5A 4L44A 3BPRA 4FSTA 4RSSA 4NH1A 4BCQA 3RK9A 2CJMA 3QCYA 1PYXA 3CP9A 3ODYX 4ANNA 5JN2A 4GFGA 5KNJA 4FODA 4UN0C 3NCZA 4IH8A 4XUFA 5HIBA 3VBXA 4F99A 1MRYA 4HZRA 4UBAA 2G9XA 3CCNA 3EQIA 4J99A 4C8BA 4M69A 3FC2A 5BNJA 5C4LA 1OIUA 2GNGA 2Y0AA 5HCZA 4AA5A 4IAAA 3R7OA 4B99A 5JFSA 3QUEA 3R01A 3R22A 4U45A 3TG1A 3W33A 5GINE 4LMUA 1IASA 3R63A 3LMIA 4DE4A 2RL5A 3DU8A 3NNXA 5CLPA 1REJA 3RALA 4YHJA 4W4VA 1U5QA 2WPAA 1J7UA 3UOLA 4O82A 3D2KA 3NYNA 2OZAB 5DBXA 2VWUA 5HBEA 4MXXA 3UYTA 3G2FA 3VJNA 5H8GA 4EH6A 3QRUA 5AP0A 5KCVA 2GQRA 5DN3A 4RX9A 5FDXA 2HWOA 1H08A 2O8YA 4TWNA 1YOMA 1MQ4A 4LM5A 5AM7A 4AN9A 3FZTA 4BGGA 5BYLA 2G2FA 2O63A 4XS2A 4XYFA 4O81A 2ZV2A 3F2AA 3UZRA 4RWJA 2VGPA 1YOLA 4I1ZA 2XYUA 3HA6A 4YJNA 3ZDIA 4R5YA 5DMZA 4O0UA 5L2QA 3GI3A 2J90A 2W1HA 4YZDA 3MJ1A 2V7OA 4C3FA 2XIKA 2JEDA 2WTKC 4GRBA 4CTBA 4I5HA 2HY81 3F66A 3ZSGA 2JGZA 3KA0A 4APPA 1WVWA 2O0UA 4C38A 5AFVA 5I9XA 2E9NA 4Q5HA 2UV2A 5CAVA 2VTJA 4LV5A 4IZ7A 1ZMUA 4PTCA 2RIOA 3W2CA 3NUYA 3E87A 3DA6A 3PZEA 5C1QB 3NAXA 3AMYA 2JC6A 3BHHA 2PUIA 2JDVA 4MCVA 5I3OA 1FINA 3HLLA 3A8WA 2YISA 5LVLA 4KUJA 3Q6UA 4LOPA 3DZOA 4EH7A 1ZAOA 3MS9A 3ETAA 4CFVA 4V05A 2XEZA 3MGYA 2IZTA 3W18A 4PWNA 4H1JA 2PTKA 4TYEA 4E5BA 1JWHA 5M4IA 5E9EA 5I9WA 2B9FA 3HMPA 2OKRA 2GHMA 4G6LA 2PE0A 2WTDA 4RJ8A 4W4WA 4JVGA 4FEVA 4X3JA 3R83A 1KOAA 4G3CA 4C59A 3C0IA 4O38A 4BCFA 4Z16A 3AD6A 5GIPE 3ATSA 2P2HA 3HMOA 4FA2A 4FKOA 3C9WA 5D11A 4ZTNA 4BIBA 4D2PA 5HLPA 1SVGA 1ZYJA 3NUNA 4TKSA 3ZBFA 4UV0A 4YU2A 2W5HA 4HGSA 5F4NA 3FMKA 4FSMA 3IW8A 3RWQA 3TDWA 4CYIA 2C47A 3QRTA 2BALA 1Q8TA 2WTWA 2JIVA 2OK1A 2JBPA 3COKA 5JSMA 3FI8A 4IWPA 5ETCA 2ZM3A 1OUKA 2X2KA 3QXOA 3E8DA 5I9VA 3NNUA 4BCKA 2V22A 5DR2A 2R3OA 3CIKA 3F5PA 5CZIA 3C4CA 5DGZA 3QD4A 4Z55A 2YWVA 3KRJA 2YCSA 4YTIA 3AC2A 3V5LA 2VRXA 2B1PA 3QAME 4FV2A 5EKNA 1H01A 3IOPA 5IA0A 2WMVA 3PP0A 3AMAA 4PMPA 5AAFA 4RFYA 4A9TA 4BVUA 3EFKA 5IEYA 4F1TA 5HBJA 4QMZA 5EDRA 2OIQA 2B52A 3C4FA 4O0VA 4YO4A 3R7VA 3REPA 2YAKA 3U54A 4MXOA 3KF4A 3IOKA 3QX2A 4E4XA 4WIHA 3R2BA 3OBGA 3I5NA 5A4EA 3FE3A 3TV6A 2YACA 2OO8X 4QT1A 4KBKA 3FBVA 3FKLA 3P7AA 4IB3A 3KVWA 3ORTA 3UNJA 4BFMA 4EHVA 5A4QA 1OPLA 2X7GA 4NFNA 4RJ7A 4IHPA 3KXHA 1OIRA 5HI2A 4NTTA 1P4OA 2CCHA 5LVNA 3GBZA 4ZY5A 4FIJA 2GMXA 2P3GX 5E8ZA 1I09A 4EORA 3UVQA 3CGFA 3E88A 3EH9A 3DXNA 2C0OA 3EQDA 3Q4UA 4USFA 1H27A 4ITIA 3R1QA 3BWFA 3KKVA 1YXUA 4I41A 2WQMA 4B8LA 5BVEA 2EUFB 1XQZA 1YHWA 2ITNA 4P5ZA 4P2KA 2YM7A 1G3NA 3CD3A 3PA5A 2HOGA 5AV4A 3BE9A 1WVXA 2C6IA 4QQCA 1JSVA 4QD6A 5EKOA 4PPCA 5C01A 3PXFA 3DAKA 1ZMWA 1YWRA 4DFBA 3LIJA 5B2MA 2BPMA 3PJ1A 4MF0A 3PIYA 3TV7A 4ZY6A 4E6AA 5ANDA 2BDJA 4A4LA 4HGLA 3AGMA 1XH4A 3QYWA 3MIAA 1ZYSA 2QONA 3DAJA 2YABA 3QZFA 4K77A 4L45A 5IMEA 2C69A 4ASDA 2QLQA 2F49A 3B2WA 5E8YA 2CGVA 4DEIA 1UV5A 4G31A 4JOAA 2R7BA 4PF4A 5LQFA 2BDWA 4CG8A 4PDYA 4IDTA 1ZYDA 5CTPA 1A06A 5CWZA 5FLFA 3D7TB 4DLJA 2PWLA 2WGJA 4TYIA 5BVDA 1JBPE 2CLXA 4A9RA 5JFWA 4BDBA 3RTPA 1CKIA 2F2CB 4IM2A 2X4FA 3BIZA 4FL1A 5DEWA 4FGRA 1NVSA 1UA2A 4XH6A 3DKGA 4BCOA 2I7QA 4GMYA 4WOVA 3UJGA 4PPAA 4EQUA 4EONA 5EDQA 3Q6WA 2C6OA 4AN2A 3BCEA 3KB7A 5DLSA 3MTFA 4XG7A 3UNZA 3ZH8A 2PVHA 2HCKA 1Y57A 2Z7QA 2WU7A 3VBQA 2LGCA 5EI2A 3NW5A 3FL5A 5GZAA 3U87A 1H8FA 4R7BA 4K0YA 3IECA 1TVOA 1YXTA 4A9SA 4E4LA 3FZSA 3I7CA 4JDIA 4ZTRA 5CAUA 5IU2A 4RIOA 2FUMA 4X2JA 3QZIA 2J0KA 2CMWA 4JIKA 3ZUVA 2CNVA 4FR4A 3BE2A 4IWOA 2BFYA 4L00A 4YPSA 3A7HA 3U4WA 3NNVA 3V5QA 4E3CA 3GQIA 3C4XA 2W17A 4PDSA 3C50A 3CLYA 3GB2A 3A8XA 3TNHA 4PP9A 3LKMA 5IH6A 1ZY5A 1LPUA 2REIA 2XM8A 5EH0A 3LCDA 3ZBXA 2YM4A 3M11A 2FSTX 2YM6A 3MDYA 1J1CA 4RVKA 1IAJA 1GY3A 4GV1A 3HV4A 4GH2A 3EKNA 5BVKA 3RK5A 1FVRA 3BKBA 4GT5A 4ZSGA 2IN6A 3FMEA 4J8MA 4IJPA 3LE6A 3PXZA 4XP2A 2BR1A 3FMJA 3FLSA 4ASZA 3N4VA 4HPTE 3BV3A 4FIIA 3OFMA 3C13A 3OTUA 4GSBA 1Z57A 3GU7A 1H4LA 3IG7A 2XIZA 5BUIA 4JXFA 2QHMA 4QP2A 4JBOA 4RFZA 3VS7A 2V7AA 4N57A 3D83A 3UYSA 4FIFA 3FEGA 4IVBA 3R7IA 5HO7A 2UZVA 3W2PA 3LJ2A 1W84A 3DJ5A 2OZAA 3SHEA 2VX1A 3VC4A 5LMKC 4FSNA 2YEXA 4LOQA 5KKRC 3TJCA 5M4UA 3LJ1A 4KAOA 4RWLA 4FNXA 4E4NA 5B2KA 1EH4A 2UZDA 2PVJA 4L52A 4OTPA 3FV8A 2X4ZA 3TACA 1NW1A 1E1VA 4D0XA 4U81A 4QNYA 4J98A 4AA0A 2VO7A 2XJ1A 4MBJA 3QQLA 3QXPA 4TPTA 4XHKB 2GS2A 4WNOA 1W98A 4M0ZA 3D0EA 2PVMA 3V51A 3CJGA 3WZUA 4QMWA 5HVYA 3QHWA 3PY3A 4GG7A 4RRVA 5IISA 3NR9A 3PVUA 2R3KA 4BKYA 1SZMA 5BPYA 2R3GA 1ZZLA 3PSBA 4QP9A 4RIXB 4B8MA 5A6NA 5J9LA 3MY1A 2UZUE 3R2YA 3ZEPA 4BWPA 2IZRA 5CF8A 3S3IA 3U9NA 3CGOA 4S2ZA 5AP3A 4UZDA 4CG9A 2J0IA 2PVNA 3COMA 4TYJA 3EZRA 1CTPE 3Q96A 3HV6A 5DR6A 2FGIA 1OECA 2NRYA 5TKDA 4YPDA 3H9RA 1OKVA 5AIRA 2HXQA 3AOXA 3DK3A 4Z9LA 4EKLA 3ULZA 4O7RA 2PZ5A 2I0VA 4P7EA 4D5HA 4WG5A 3C7QA 4GUEA 5BVWA 5DR9A 3DKCA 5C4KA 5AUVA 4JNWA 5JFVA 4H36A 3QCSA 4FKSA 2IZUA 4M8TA 3ZHPC 4KKGA 1JKTA 5BVOA 3HV3A 3W32A 5B7VA 4RZVA 1R0EA 2QCSA 4U97A 4KRCA 5HE3A 4C62A 3MVJA 4EOQA 4YR8A 4PNIA 4BDEA 1Q61A 3Q60A 4FG9A 3TL8A 3WF5A 1FVTA 4O84A 4BR3A 4DF3A 4EK5A 2WTIA 2JIUA 4TT7A 4MQ2A 1O6YA 4ACMA 1G8AA 3S2PA 2GNHA 3COHA 2BTRA 4R8QA 4XX9A 3R8ZA 4FE2A 3GXLA 4AF3A 3SRVB 1F5QA 4LRKA 3HX4A 2UVZA 2C5VA 4FSWA 3THBA 2KTYA 3GC8A 4GW8A 5CSWA 5LCKA 3D2IA 3UO5A 2BMCA 1GZKA 3BGZA 4UWYA 1XBCA 1PXIA 4Y5HA 4EHGA 4HCUA 2AC5A 5CSHA 2XEYA 2VO6A 3D5VA 4IZYA 4NIFB 3VBYA 3VW8A 2PVRA 4C4JA 3HRCA 1BI7A 5EDPA 3EKKA 3OWKA 1O9UA 4M0YA 2RFNA 4ZZOA 3QA0A 4EUUA 4KINA 3POOA 2ZDUA 3VBTA 3R6XA 2CNUA 4AZEA 4EH5A 4FOCA 4ZLOA 4O7NA 4CZTA 4JL9A 2V0DA 3ZC5A 2Z7LA 4XRLA 3ZZEA 1OL2A 2VTRA 1DM2A 3LXNA 3ERKA 3P0MA 5LARA 3ZO2A 1NVQA 3O50A 2JKOA 2ZJWA 4YJRA 3VUDA 1KE8A 5DHJA 4I24A 3FZ1A 4YJSA 4JR3A 4L9IA 2O3PA 4S30A 3VULA 4QMSA 4GIHA 4EC8A 4D58A 2QR7A 3PA3A 3ENHA 4QNAA 2YM3A 2I1MA 4NM0A 3ATTA 2H6DA 3FHRA 3IPHA 3VUTA 4E5WA 4FV8A 1TKIA 3TTJA 2QOLA 4TTHB 5TE0A 1OL1A 4PMTA 4RVTA 1NT2A 3OOMA 3R8VA 5FUTA 4AGCA 1R3CA 4BGHA 5K0XA 2C68A 4PP7A 2OXXA 2IPXA 4I5PA 4AFEA 5IA2A 1JKLA 1LR4A 2VD5A 2Y4IC 5HNBA 4F0GA 4RLLA 3ORNA 4I6FA 2C6TA 2IO6A 3DOGA 2PULA 3QGYA 2QNJA 2CN5A 5AR5A 2GHGA 3G51A 4U80A 3RVGA 1CMKE 1FOTA 2W1DA 4FTOA 5CVFA 5IQCA 4RA5A 5CAQA 4DBXA 3WIGA 4V01A 4U41A 2UZLA 5GJGA 2CGWA 2GHLA 4NK9A 5E8VA 3R28A 4GFOA 4ANOA 1PXKA 5EM7A 3D9VA 3IS5A 4UWBA 4QMVA 3HRFA 4JG6A 5LVPA 5E4HA 3D7TA 3GU4A 1O6LA 3R71A 4BWXA 3F61A 5B0XA 4NEUA 4HVSA 4OBQA 2FSMX 3NDMA 2UW4A 5CEIA 4USDA 3VS1A 4BY9E 2W1IA 4AZVA 2YIXA 3GP0A 3VS3A 4PRJA 4AX8A 4RQVA 4FTIA 3ZRKA 4DEGA 4AW2A 1YI3A 3MH1A 5E91A 4FEXA 3FZPA 2AUHA 2GPHA 3ANRA 4JX7A 4PDPA 4C61A 2VTIA 4WRSA 3CKXA 3QRJA 2WIHA 4ZTLA 1YW2A 1UWHA 2OGVA 2UW8A 4O6LA 4WNMA 4AAAA 2OFVA 4I0SA 3TZ9A 4A9YA 2WMBA 4XG2A 1YXVA 3ZFYA 1H1RA 1ERKA 4GKIA 3DY7A 5H8EA 3RPRA 1JOWB 4II5A 2ZV8A 4RIYB 2JIIA 2WHBA 3ZLSA 1P14A 3PY0A 5EYDA 2QOIA 2XNPA 3EQRA 4O0XA 2W5BA 1U54B 4HYSA 3V3VA 4XLVA 3DTCA 1BI8A 4J52A 2VTSA 4XNEA 1YXXA 5KE0A 3N51A 4L53A 5AUWA 4MTAA 4ENXA 3EJ1A 3GOPA 4AW5A 4G3DA 2X8EA 3BYSA 2YLFA 4Y8DA 3ORZA 5AR2A 3T9IA 5IUGA 3BLQA 5BUEA 1JSUA 3NWWA 5JZJA 4KIPA 4R77A 3QC4A 3I6WA 4HGTA 4ZLZA 3UBDA 4R5SA 3ZONA 3NIZA 2XNGA 4J97A 2ERZE 5KZ0A 2HZIA 3QL8A 4EHEA 5JGDA 5KMKA 5ETAA 2WEIA 4NTSA 4QMPA 3OMVA 3RCJA 3UDBA 1OMWA 3ZSHA 2ZAZA 3QYZA 4OBOA 2B54A 4FX3A 4QP8A 2CKPA 4OTQA 2ZV7A 4CVAA 3HVCA 4I22A 3KEXA 3LFDA 4RVLA 5ACKA 2QI8A 2VUWA 4PL4A 4UXQA 1REKA 4MNFA 3Q52A 3H10A 3LAUA 1YXSA 5HG9A 3TUBA 3ZO1A 1YI4A 2YITA 3WZJA 2PUPA 3OEFX 4ZXTA 4EWHA 3CJFA 3ORXA 4FGBA 4S34A 4GJ3A 2ZVAA 5HLNA 3P7BA 5DH3A 3K5UA 5CNNA 5C26A 1MP8A 2X6EA 4GU6A 3QALE 3FI3A 1Y6AA 2EXMA 5DRDA 3L9NA 4I5CA 4LGDA 3EQBA 4NZWB 3F7WA 4P90A 1M2QA 5DT3A 3KRLA 3UGCA 5CU2A 3VUMA 1FGIA 3TKUA 4FK6A 5FDPA 4FSYA 5HIDA 4JAIA 2JDSA 5LVOA 1KOBA 3BZ3A 1YI6A 2XM9A 4OGRA 3F7ZA 3HMMA 4RBLA 5HHWA 5IA1A 5D7AA 3TZ8A 4LQMA 3DK6A 3KMMA 4I94A 4AW1A 2UZNA 1Y6BA 3Q2MA 3RNIA 4XOZA 3BU3A 1Q41A 3N9XA 3QUPA 4FTQA 5IMXA 4YBKA 3V01A 5FP5A 4QMQA 4Y46A 3D5WA 1OBGA 1K9AA 2GSFA 5FD2A 3H30A 5A54A 4E7WA 4CCUA 2NO3A 3PY1A 4H3QA 4FVPA 4QQ5A 4WNPA 4O7TA 5L3AA 1WBWA 5FRIA 1ZYLA 3IDBA 4R3CA 5E1EA 5IUIA 1AQ1A 1GJOA 4C4EA 3CS9A 2WU6A 4FV0A 5CXHA 1WVYA 3I1AA 3BRBA 4U79A 5K0KA 4ANBA 1QPEA 3W2RA 5AV0A 4ORKA 4DFLA 3KRWA 3RZBA 3CY3A 4M84A 3ACJA 1UU9A 3GU5A 4CFWA 4MYGA 3DCVA 4DEDA 3NUXA 3MFRA 3O2MA 4ZK5A 4CFXA 3VN9A 3DXPA 1KV2A 3PZHA 4CFNA 2XA4A 2P2IA 4ACCA 4ZMFA 1YWNA 3TNIA 1HCLA 4MH7A 3SRVA 3ZUUA 4Y73A 4NJ3A 3CC6A 3LCOA 3DK7A 4RZWA 1XBAA 4D4VA 3FXXA 5IQHA 2QO2A 4DEBA 3JUHA 5BVFA 4DAWA 3MYGA 4FUXA 4GL9A 2VTLA 2FH9A 2YM5A 3NX8A 4O7WA 4NIFA 2X7FA 2WD1A 3MTLA 4ALWA 5CASA 1JQHA 5JQ5A 1OUYA 3LXLA 3POZA 3MY5A 3UQFA 2ETRA 4EZ3A 4YC6A 3TKHA 5M51A 4BDAA 5C27A 3OS3A 5CU4A 4DH3A 2W99B 3L9MA 4K6ZA 4MWHA 4XBUA 4L3JA 3ANQA 2ITXA 4ZSEA 4OTIA 2CNQA 3LLTA 2YCRA 3BEGA 2DS1A 3PPKA 2FYSA 1RW8A 3KQ7A 2X39A 2RFDA 1HOWA 3F5XA 2ITOA 3PA4A 2IG7A 5AV1A 4UMUA 5GIOE 3LW0A 4FEUA 4EQCA 3EYHA 4O83A 3IW7A 5HX6A 3S1HA 2J6MA 1G5SA 4DFYA 2Y7JA 1KE6A 3GCPA 3ORIA 2P4IA 4FKLA 2WIPA 1PXMA 4YTCA 1DAWA 2B9IA 4DCEA 4O0WA 4ACHA 4YZBA 3QLFA 2XVDA 4PDOA 1W8CA 2Y4PA 3AXWA 4Y95A 4BBMA 1H07A 3L8SA 1XH9A 2XK8A 3UODA 3C1XA 2R3NA 1JPAA 5EG3A 4ZSLA 5EYKA 4CKRA 5HLWA 2P55A 2W1EA 1XBBA 2R4BA 4RJ3A 4ACGA 4A9UA 2UW6A 2IJMA 3FQSA 3KXMA 4UMTA 3P4KA 3UVRA 1ZARA 1MQBA 4MXAA 2BRHA 4CRLA 1YDRE 4FV1A 3F82A 3RBWA 4AGWA 4AZSA 4C2VA 4F0IA 4CT1A 1LP4A 4FKVA 4YLKA 1OB3A 4DH1A 4F65A 4UYAA 1FGKA 1F3MC 2WOTA 4ITJA 5K9IA 2CHLA 2YWPA 2BAQA 4OAVB 3DBCA 3MA3A 3FQEA 4CFMA 1U4DA 4DYMA 4CFFA 4QMLA 3G15A 3I81A 5EI6A 2EB3A 5C9CA 4TY1A 2CSNA 3A7FA 3GCVA 5HG8A 3BWJA 4WBOA 1GZ8A 3Q4CA 1WFCA 3R04A 5EM8A 3DBQA 2WMTA 1PMUA 2WQNA 1WAKA 4CXAA 2R5TA 4JQEA 5M4FA 1J3HA 4E4MA 3AC8A 4CTCA 3DBDA 2YIQA 4F7NA 2PHKA 4EK8A 1SVEA 4QPSA 2OXYA 4BKZA 4CMOA 2PL0A 1X8BA 1M17A 3Q9ZA 4OUCA 1KWPA 4BYIA 3G6GA 3SDJA 3H0YA 4ZS0A 3V8TA 3QU0A 3HP5A 2C3KA 4FTTA 3CEKA 3IKAA 2PZIA 3FZOA 3JYAA 3CKWA 5FXQA 4ZS4A 3RPYA 3OXTA 2GNLA 4JIAA 5DYJA 3KL8A 4B0GA 2UVXA 2BRGA 4MXZA 4DA5A 3LFFA 5HQ0A 1NXKA 1DI8A 3E7OA 3FI4A 5HO8A 4BI2A 5I0BA 4FTAA 3TIZA 1OL7A 4NW5A 3ZRMA 3OEZA 4NM5A 4BZDA 1DI9A 1PMEA 2C0TA 3VWAA 3ZSIA 4RIYA 4BKJA 4DGOA 2UZWE 4QMNA 4YMJA 4ANQA 3L1SA 1OKYA 3CY2A 4O7LA 3MIYA 3DJ6A 3F3UA 3EHAA 1H25A 4FV9A 4M3QA 2OFUA 4NKAA 1U54A 5IDPA 3UQCA 3UG2A 3F3TA 4NSTA 4MD7E 3QTIA 1W83A 2BVAA 1UVRA 4X3FC 2HXLA 5LCJA 1Q8UA 3P5KA 4OTGA 4XEYA 5JQ8A 5BMSA 3HL7A 3LXPA 4Y72A 1IG1A 3MFTA 3LCTA 3QD0A 4MEDA 3ORLA 3BYVA 4OR5A 4UWCA 3NRMA 5HD7A 4EUTA 4K11A 3V5TA 4DINA 1WBVA 4ALVA 5AP2A 4FSRA 2QOCA 4BRXA 2ITUA 4RX5A 5I3RA 4FT7A 4NKSA 2W05A 4BICA 4IE9A 2ONLA 3DGKA 4D1XA 4DBNA 2X9FA 4EOJA 5JMSA 3BQRA 3QQGA 5B2LA 3GC0A 5HG5A 5J79A 5J9ZA 5ETFA 3VS6A 4EOIA 1U59A 2QU6A 2WMAA 2W1GA 3NLBA 3ZLYA 3FAAA 1H00A 5CX9A 4C34A 3UPXA 1B6CB 4QYFA 4DLIA 4HZSA 4ZY4A 2C4GA 2J7TA 4JDKA 4LL0A 4C3RA 3PSCA 4F6WA 5BVNA 2WMUA 4YBJA 2XCKA 4D9TA 4LGGA 4FV5A 2J5FA 4GIIA 4J8NA 2C6DA 4RGJA 4D4SA 3DTWA 2XK6A 2KULA 3FLYA 3TNQB 1KE5A 4X2GA 4W4XA 4L7SA 2IWIA 2PY3A 3K5VA 3QUDA 4RLKA 4MNEA 4A7CA 4CRSA 4R3RA 3HUCA 2BDFA 3D5XA 3PFQA 4D4RA 5J87A 3OC1A 3TN8A 1PF8A 2ACXA 1B39A 1MUOA 3LM5A 2OJFE 1PKDA 1J91A 2BIKB 2HW7A 4AGUA 4F7SA 2BKKA 5ITAA 4O96A 5AM6A 4KIQA 3LZBA 5BYYA 2ITYA 4K2RA 4AT4A 5KBQA 3WYXA 2WZJA 3FC1X 2BHHA 3TTIA 5IH5A 2YERA 2R9SA 1A48A 2R3FA 4QQTA 2NP8A 3NMUF 5L2SA 5CYIA 1CSNA 1AGWA 2OBJA 2QOKA 5FEDA 3LCKA 4GS6A 1FVVA 2HK5A 4QPAA 4ID7A 3EFLA 2HWPA 4JRVA 4HPUE 3RCDA 4EC9A 2W1ZA 2VZ6A 4RC2A 4G34A 3V6RA 2HZ4A 3HZTA 4CZYB 3R9RA 3QX4A 3ZZWA 2QLUA 4EH4A 3E3PA 3PWYA 4IDVA 5L8LA 2F4JA 1APME 4G3FA 4JRNA 3C51A 1JKKA 5DNRA 2VWIA 2BZKB 5AADA 3ZU7A 3D4QA 5A9UA 3DAEA 2B7AA 4RWIA 4E6DA 5HU9A 5HVJA 5JT2A 4GVAA 4D2WA 5FXRA 1IAHA 4TWPA 5EFQA 3OBJA 4L68A 3OG7A 3TNWA 4V04A 2JFMA 4E93A 3W16A 3RHXA 1YDSE 4LYNA 3CSVA 4EYMA 3KF7A 4UMPA 4UXLA 1H1QA 4GU9A 4WA9A 3P1AA 4CT2A 1V0PA 1GIHA 4JG8A 2VO0A 3UIXA 4E5AX 2PU8A 4U43A 3FPMA 3G33A 1PRYA 3FUPA 3C5UA 1JNKA 3FY2A 3MFSA 3WF8A 4CGAA 3LFQA 2A27A 3MI9A 3N4UA 3O0GA 4QMMA 2XIYA 4JR7A 3VF9A 5I9UA 1QPDA 2XP2A 5HE2A 4IAYA 4AOTA 5BX0A 5M44A 2OU7A 4TXCA 3FPQA 4GYIA 4W8DA 5EW9A 4FL3A 3A7JA 4QYHA 3B8RA 2BAKA 4JAJA 4MQ1A 2Z7SA 5FWKK 5K3YA 2OJJA 4M7IA 4ZLYA 5KMOA 3ENMA 2HZ0A 4HVDA 4BGQA 2W9ZB 2SRCA 3Q04A 3NNWA 4IB5A 3RINA 2VTHA 3UOJA 4GKHA 1XKKA 5AP4A 4QYYA 2BKZA 1ZMVA 5HIEA 3DNEA 1PXNA 1J1BA 5ANGA 5C8KA 5AR7A 5IQBA 2VN9A 3E62A 2WMWA 2WMRA 4EH3A 4IADA 3VJOA 3DBFA 4ZMEA 5ANIA 4ACDA 4E20A 3SGCA 2OG8A 3P79A 3DB8A 4YUQA 5E8WA 2CPKE 3Q32A 4PQNA 2OIDA 3R7EA 4F7LA 1OKWA 3QCXA 3GCSA 3ZXTA 2RGPA 3KXNA 4H39A 2YDKA 2YZLA 5CENA 4GYGA 4J53A 4QMYA 5CU6A 5BMMA 5CEOA 3NVMB 4IFGA 1WBTA 4O91A 4QRCA 4NYEA 2R3QA 3VNTA 3FHIA 3JXWA 4K8AA 2Q0NA 5F9EA 2C3LA 2OI4X 4ERWA 4FEWA 3DV3A 4BDDA 4EOMA 2XJ0A 3RM7A 3ZEWA 2X6DA 5DI1A 4KKHA 4HVIA 1PXOA 3GC9A 4KKEA 4I6QA 1T46A 4ONAA 1IEPA 2VNYA 2YAAA 1I44A 2WELA 3LJ0A 5FGKA 3OZ6A 3SV0A 4I20A 4YTHA 4BC6A 3FLZA 4PMMA 4WO5A 3VQHA 3WZKA 5J7BA 2XK4A 3NSZA 4O2PA 2XNMA 3T3UA 3PRFA 3LLAA 3E64A 2CCIA 3KMUA 1KV1A 4JBPA 3P86A 4BHZA 3ZOSA 3DKOA 2XCHA 3OW4A 5F95A 4CKIA 5IZFA 5CF6A 3NUAA 3QQKA 4ANSA 1H1WA 3AG9A 3KREA 3MH2A 4G9RA 1GNGA 4I23A 4CYJA 3NUPA 3FI2A 3GVUA 2ITWA 2RFEA 1YHSA 2VTNA 4M66A 2VWXA 3B2TA 4ZP5A 4ZJIA 3VBWA 2PPQA 2RKUA 3A62A 5DT0A 3VS5A 5CEMA 4QP7A 1GOLA 4I4EA 4QP3A 4CSVA 3O71A 2VU3A 3PIXA 5KZIA 5KMMA 2PE1A 3RZFA 5KX8A 3HAMA 3BYUA 3IDCA 1V0OA 4FC0A 4IACA 2QKWB 4PTEA 2ERKA 4U3ZA 5HX8A 4F6SA 5CT0A 3SOAA 4CD0A 3PJCA 1UNHA 1Q99A 2WXVA 2HELA 3GCQA 4G3EA 4NL0A 5FEQA 3VVHA 4RJ6A 4PMSA 3E63A 2R7IA 4M14A 2QU5A 4YJQA 2JFLA 4EK3A 1ZRZA 2QODA 2CN8A 4GCJA 4O6EA 3H3CA 4ZZMA 3DNDA 3W55A 4B7TA 5CVGA 5AUTA 3KCFA 5K4JA 4DN5A 2WFYA 4IZAA 5HBHA 5ANJA 5J9YA 4UYNA 3OCGA 4HYIA 3V04A 4ERKA 4YLLA 3A61A 3GCUA 2GTNA 3EQHA 4XJ0A 4EEVA 3GFEA 2C5OA 3LFBA 4APCA 4EH2A 1K2PA 3CXWA 3EL8A 3LHJA 4FKPA 4F1OA 1BL6A 4BCPA 2PK9A 3ZTXA 4IM3A 2XH5A 3F3WA 3MVHA 4FIHA 3FWQA 3BI6A 1H1PA 4YC3A 5DRBA 2VTOA 2PVKA 4G16A 5AR8A 5CEKA 5IQIA 4I0RA 1GZNA 2WQOA 3BV2A 3NIEA 4RFMA 3DPKA 3R7YA 4ASEA 4EK6A 3CTHA 3JVRA 3U6IA 3V6SA 3RPVA 3SOCA 4DTKA 3HGKA 4O21A 1TQMA 1OZ1A 3VAPA 2O5KA 3SKCA 5JK3A 5LMKA 5AA9A 1YKRA 1UNLA 1GZOA 2CGUA 3CR0A 4MXYA 4D2RA 4QOXA 1ZOGA 1XH6A 2GNFA 2VTTA 3TJDA 3B8QA 3UOKA 4KIKB 4R7HA 5TF9A 1TQIA 3D5UA 5M06A 1CDKA 1SM2A 3FMMA 4E73A 4G6OA 4V0GA 3E7VA 5E1SA 4UX9A 1K3AA 4S32A 3WE4A 4C2WA 4IFCA 2ITVA 3NVKI 2BRBA 2UW0A 1UU3A 3KXZA 3KCKA 1Q3WA 5IA5A 3CD8A 1QL6A 5CS6A 2WMSA 4RX8A 2BZHB 4F9AA 5KMLA 4MKCA 5DG5A 4G6NA 5HE0A 4FSZA 3ACKA 4XG4A 4U40A 3TIYA 4BI1A 2V55A 4CEGA 3S0OA 2R3PA 2R3MA 3JS2A 4RVMA 2NNWB 3A7GA 3BYOA 3FSFA 3OY3A 5IA4A 5IQEA 4IXPA 2VWBA 5E8TA 3R30A 4MX9A 4OTDA 5EYMA 3MY0A 3F3ZA 4QTCA 3CE3A 5IQDA 4DGLC 3PJ2A 4YNEA 3TKIA 3PVGA 2IW9A 4MBLA 4AU8A 5EI8A 3UP2A 2BAJA 1Y8GA 3WIKA 2A1AB 2BZIB 5IQAA 1V1KA 2OW3A 4MHAA 5CU0A 1AD5A 3RNYA 4Z7HA 3KN5A 4FT3A 4OLIA 4D55A 3FYKX 4DFUA 3RK7A 3BGPA 3FKOA 2OZOA 4AACA 2QO9A 4FNZA 4ZSJA 3VF8A 3R8LA 5TOZA 1H24A 2H34A 2VTPA 2XKCA 2YIRA 3IO7A 3FMHA 3CQEA 5CEQA 4J96A 4YJOA 3R9HA 4BN1A 3P7CA 4IAKA 3KVXA 4F9CA 5ANEA 3WF6A 3DJ7A 3VUHA 2JITA 3OW3A 5AJQA 4AT5A 3RAWA 1VZOA 4TW9A 3V8WA 3ZUTA 3FQHA 2J50A 4FKGA 3R21A 3OHTA 4F9BA 4EWQA 3RHKA 1OM1A 2C5NA 4CNHA 4FKUA 5LWNA 5FBOA 4I3ZA 3OY1A 3W8QA 4R1YA 4KRDA 5JH6A 1RE8A 3D15A 4NUSA 4Z7GA 2HYYA 2C5XA 5A14A 3TM0A 3CQWA 1Z5MA 2QR8A 2E9PA 2W4JA 4QP6A 4F9YA 5KMNA 3UC3A 3U6JA 3O7LD 2CLQA 2QD9A 3DT1A 2W0JA 4BZNA 5CSPA 5HNIX 4M12A 4BCGA 4NW6A 4LRMA 2HENA 4KIOA 4NM7A 1U5RA 1V0BA 4IW0A 3OCTA 3ZFXA 3OCBA 3EB0A 1H0WA 4L3LA 4Z3VA 2DYLA 4N4SA 2BFXA 1IRKA 5FTQA 4E26A 3QWJA 4UMRA 4XV2A 3AMBA 3QC9A 4G17A 4EOPA 4C3PA 5LOHA 4QTAA 5T6KA 4AA4A 5E8UA 3PP1A 4HCTA 3VQUA 4YP8A 4FF8A 5T3QA 4F0FA 3IDPA 3L9LA 2QO7A 4KWPA 2QG5A 2XK9A 4FV3A 4Q9ZA 3G9LX 2ESMA 3TV4A 3G6HA 5AUUA 3NW6A 5DE2A 3DQWA 4CKJA 2G2HA 4D5KA 3MA6A 2P0CA 1SVHA 5M07A 4TYHB 5HOAA 2WTCA 5CNOA 2FA2A 2H9VA 4PNKA 5HCYA 2WQBA 1XH8A 4PX6A 4BTKA 4BCJA 3KK8A 1FQ1B 4BYJA 4DEEA 3JR1A 2J0JA 4L8MA 5D12A 3IK3A 3NW7A 4GEOA 5J95A 2E9UA 3RAIA 2RSVA 3DLZA 4XG3A 5LVMA 4AE9A 5GNKA 1BLXA 4MF1A 4XG9A 2PYWA 4FTUA 1YVJA 3KULB 3DQXA 4I93A 2OICA 4DT8A 3TZ7A 3R9NA 4TL0A 2PUNA 5M09A 4FT5A 3RKBA 3SVVA 1P5EA 2WAJA 2X1NA 2ZOQA 2PSQA 3MSSA 4MWIA 3MB6A 3ET7A 3MV5A 2X81A 4QMUA 2WTKB 2BCJA 4FKQA 3F5GA 3F9NA 4N6ZA 5LMAA 4ZZNA 4MNEB 3ORMA 4FZAB 2JKMA 4DG3E 4DH8A 5GHVA 2QQ7A 2PVFA 2R3RA 2Y6MA 3FZRA 4DG2E 5KMIA 5TT7A 4WT6A 4BZOA 4DEAA 3SXFA 3CTJA 3SC1A 4LUDA 4F08A 4PUZA 4U9AA 4WBBB 4EHZA 4KABA 4W9XA 2AYPA 2X8IA 4HOKA 3K54A 3UIMA 4X2FA 4A07A 5K5XA 3Q2JA 4XMOA 3BYMA 3F6XA 5JEBA 4R1VA 2ITPA 3JY9A 5CSVA 3W1FA 5KUPA 4BBFA 5CAPA 2WTVA 4F09A 5E8SA 4MD9E 3OWLA 4FZ6A 4JDJA 4BF2A 1JSTA 4F1MA 5J5TA 3WARA 4JQ7A 3ZRLA 4YZMA 3R8MA 2IVSA 4MXCA 5AX3A 4ARKA 4Y83A 2C6EA 2WMQA 2J4ZA 3FSKA 3G0FA 4EBVA 4H3BA 4M97A 4LGHA 3C4EA 2B9JA 5EK7A 5I5ZA 4KB8A 3I5ZA 4IM0A 3ZC6A 2GQGA 5M4CA 3IW5A 4PL3A 4O0RA 3VHKA 4DHFA 3QTZA 2E9VA 1OIQA 3QQHA 4FZFB 3BHYA 3I0QA 4UALA 4D1SA 1G8SA 3PE1A 3V5JA 3ALOA 3MPMA 3SXRA 3BLHA 3ZLWA 3F5UA 3QTRA 3O51A 3UQGA 1OGUA 4YJPA 2WTJA 5LMBA 4HVHA 3MBLA 4ENYA 3QD2B 2NRUA 2GNIA 1VR2A 1YQJA 3DBEA 4OW8A 2BUJA 3H9FA 4WD5A 1VYWA 4ASXA 3EZVA 2C30A 2ZMCA 2I0HA 3IQ7A 2JKKA 2QHNA 3C5IA 4IC8A 5CI7A 4D0WA 3BBWA 4HW7A 1M7QA 2I0YA 1H26A 4C35A 4X2NA 3O8UA 3BELA 4OT6A 3R8PA 4C33A 5ANOA 3JY0A 4IC7A 2XRWA 3NEWA 1URCA 5AP1A 1PXLA 3FL4A 5FXSA 2OSCA 2UZTA 2VWWA 4D28A 3FLWA 4WSYA 4LOOA 2OJIA 4BCMA 4WSQA 1SNXA 4E6CA 5FP6A 3DXQA 2UVYA 2W1CA 3ALNA 2PUUA 4FNYA 5AWMA 3RPSA 5HGIA 2JLDA 3OVVA 3E5AA 4RA4A 2OF4A 2EWAA 2Q83A 1JLUE 1ATPE 1UU8A 2R2PA 4KIKA 3HECA 4KBCA 3IGGA 4Q5EA 3CPBA 5GZ9A 2GU8A 4C57A 1OI9A 2JBOA 4IX4A 3LQ8A 2PE2A 4NCTA 4B9DA 3R02A 5HD4A 3U6HA 4O7VA 4FICA 2XS0A 1M2RA 2J0MB 4FG8A 4IJ9A 1J7IA 3A2CA 5EM5A 4U6RA 4BDJA 2UZOA 3DLSA 4EOSA 3MESA 4BHNA 3BHTA 2WKMA 5CALA 3ID6C 5AAEA 3R7UA 2B0QA 1OPJA 3A4OX 2QOHA 3I6UA 2ZM1A 4FG7A 2YIWA 4O2ZA 2GFCA 5JRQA 5AUYA 2EXEA 3R1SA 3I4BA 5K4IA 4L3PA 4W9WA 4WHZA 5HEZA 5HTCA 4D4YA 4UZHA 4NU1A 3FY0A 3ZXZA 2BZJA 5HESA 2HIWA 3LFAA 3EL7A 2Y9QA 4F70A 5ACBC 3R7GA 3I0OA 4YLJA 3T3VA 3PUPA 4DTAA 3R00A 2QC6A 1FMKA 4FZDB 1Q24A 3RWPA 4K9YA 3P78A 4OTFA 4BDKA 1H28A 4QYGA 4PPBA 3OROA 4KBAA 4H05A 5HG7A 3FKNA 3Q3BA 1H0VA 2ONLC 3VRZA 4CMTA 2UW5A 3D14A 4N70A 4BBEA 5E8XA 4OTWA 4ZJVA 3PXKA 3FXZA 4IAZA 4RQKA 3TEIA 4P5QA 4NWMA 4IB0A 5DEYA 1YWVA 1OL5A 4GUBA 3HDNA 4YGAA 2WB8A 4YSJA 1BYGA 3II5A 5EYCA 4DT9A 1XR1A 4DH7A 1YRPA 3BU5A 4IZ5A 5AA8A 3G90X 3GEQA 4FZ7A 4I0TA 3TXOA 3ZM4A 1JVPP 4AOJA 4DCAA 5G1XA 4DFNA 5CANA 2W4KA 5L6OA 3JVSA 4HNFA 3F69A 4X0MA 4H1MA 3RAHA 1SMHA 4ZTMA 4EI4A 4F9WA 1Z9XA 3PXQA 5HICA 5HO6A 4JX3A 4ZSAA 5AAGA 5AUXA 4IVAA 2I0EA 4GK3A 2C1AA 5G6VA 4C4IA 1PHKA 5AX9A 3PIZA 3ZM9A 1BL7A 3UE4A 5JRSA 4ZIMA 3LQ5A 4UMQA 1CKJA 3QCQA 3ZFMA 4BTFA 3GGFA 2F57A 4KNBA 2IVVA 3KK9A 5ETIA 3VS0A 4C36A 2IVUA 3L8XA 1VYZA 3OOGA 3DS6A 3EIDA 3Q4ZA 4X2KA 4FTLA 5M55A 3WOWA 5IQGA 2GFSA 4OAUC 4RT7A 3H0ZA 3R9OA 1BUHA 3EMGA 4L42A 3VO3A 5M56A 3EQCA 4EH8A 2UUEA 3AC4A 4RJ4A 4ZOGA 5GZ8A 1RJBA 5AR4A 3NYVA 4FNWA 3QKMA 4MK0A 3AD5A 3K3IA 1W82A 4L7FA 3OWPA 4C58A 4YZCA 1IA9A 4D9UA 4AFJA 5L8KA 3SW4A 4PTGA 4AP7A 4EL9A 5IDNA 2FO0A 4FIEA 5CAOA 1IR3A 5C03A 2XZSA 5AP6A 2B53A 5DFPA 2PMIA 4Y5QA 5GJFA 3UP7A 5DT4A 1LEZA 3VRYA 2YCQA 3NUSA 4FI1A 2X2LA 3F3VA 3L8PA 4TYHA 1UKIA 4NJDA 4LV8A 2XNNA 2VTMA 3IW6A 4DC2A 2J0LA 3ZCLA 3RJCA 3KRRA 3PXRA 5IEXA 3GOKA 5KKRB 2VWYA 5BUJA 4AXAA 1ZY4A 5HNGA 4B4LA 4EK4A 3I7BA 3S00A 4RMZA 2PVYA 4V0GB 4WUNA 3DDPA 2WNTA 3KULA 3LFCA 3EYGA 1WBNA 3Q9WA 1NY3A 4TRLA 4JG7A 3UO4A 2XB7A 1JAMA 1KE9A 4AG8A 3QKKA 3AT4A 4IANA 4JT3A 1R39A 3Q5ZA 3LXKA 4L67A 5DA3A 4F64A 1A9UA 3OF0A 4FOBA 3UVPA 2C5YA 3QGWA 3QZHA 5IH4A 3BQCA 4GK4A 2B4SB 1UKHA 4LI5A 3LQ3A 2O64A 3SX9A 4OTHA 4CCBA 3MH0A 5FTOA 3GU6A 4BCHA 3KGAA 3MN3A 4TNDA 2I6LA 3E8NA 5A3XA 4QMOA 3NYXA 4G1WA 3GNIB 4X7QA 2XNOA 3FMDA 1Y8YA 1PMNA 2XKDA 5JGAA 1SYKA 4QPMA 2W4OA 4EBWA 2ZYBA 3FXWA 3QF9A 3MW1A 4O0YA 3KFAA 4XV9A 2PMOX 4C4HA 1QPCA 3H9OA 1R1WA 4RWKA 5CSXA 3VIDA 2YDJA 1LEWA 3HA8A 4L46A 5FM2A 3AT3A 3AC3A 5L2WA 3QTXA 1WZYA 1ND4A 4C0TA 4DFXE 4JS8A 3W10A 4QTDA 3F2RA 2IZSA 5AV3A 3HRBA 4IEBA 1SNUA 1Q8YA 2WOUA 2XMYA 3H4JA 2YM8A 2ITZA 4O1OA 3EQGA 4RJ5A 2VWVA 2VX0A 5AR3A 4CZUA 2CKQA 2XJ2A 3EN4A 4B6LA 2X0GA 5FQDC 3WF9A 4RX7A 3A99A 1R0PA 4XCUA 3QRIA 3DFCB 5AUZA 2ETKA 2G2IA 4EH9A 3UPZA 3W2QA 3S95A 2EB2A 3BBTB 3UMWA 4X3FA 4GVJA 3QTQA 3GUBA 3TDVA 1WBOA 5J8IA 3SAYA 4AWIA 4EQMA 1U46A 5L8JA 4F4PA 3QHRA 1PY5A 3Q9YA 2XIXA 4C37A 5DWRA 1T45A 2B9HA 3PPJA 3GU8A 2R64A 4FTJA 3C0GA 5HKMA 1UU7A 1PW2A 1KUTA 1PMVA 4IVCA 4U3YA 5E92A 3EN6A 5CZHA 1YOJA 2C6KA 4IWQA 3U55A 3I60A 4G5PA 4IX3A 4BDGA 3NGAA 5A4TA 5HTBA 3GQLA 3SA0A 3K2LA 5EQYA 4LL5A 4FKIA 4FTKA 4FTMA 1W7HA 1XH7A 4I6BA 4LRJA 1YDTE 1XH5A 3UO6A 2RG5A 3HYHA 5HE1A 5I9ZA 4U44A 3K3JA 4FIGA 4N0SA 3BLRA 4KS8A 4FTNA 3AT2A 4EZ5A 3P9JA 3WILA 4C4GA 2ETMA 4K1BA 4Q9SA 4RIWB 4WUAA 3UMXA 4AZWA 4CV8A 3LMHA 3QKLA 4N6YA 2YZAA 5EHYA 5L6PA 2YN8A 2Y6OA 4KD1A 4AUAA 4C4FA 3HKOA 2VTQA 3P08A 2EVAA 4CFUA 2VNWA 2ZDTA 3SLSA 3UZTA 3JPVA 3NAYA 4MBIA 3QZGA 4QO9A 3W2SA 2C0IA 5L6WL 2C3JA 3VS4A 1W0XC 2FSLX 4M13A 3NZ0A 4YJUA 3AC1A 5C8MA 3BGQA 2YFXA 3BU6A 4AZTA 3AGLA 3UOHA 4R78A 4FV7A 4HCVA 4EKKA 2UZEA 2C6LA 3CPCA 3MH3A 3ZO3A 4BDIA 5J1WA 3KY2A 2XNEA 4GFMA 2QOQA 3QTSA 2BHEA 3PRIA 1B38A 3PVBA 2Y4IB 1WBSA 3HP2A 2JAMA 4FV4A 2OJ9A 5F1ZA 4KA3A 1MRUA 4X6RA 4O7ZA 3CQUA 4GG5A 4DG0E 2XK7A 2FVDA 1PXJA 4TWOA 4MD8E 4FYNA 5KBRA 3TWJA 3TI1A 3IONA 2X9EA 1M7NA 2XRUA 5EOLA 2R3IA 5H2UA 3RPOA 3WBLA 4L43A 5M57A 3ZMMA 1VJYA 2XBJA 4KSPA 3QFVA 4FKTA 3RMFA 4HYUA 3O7LB 2CDZA 2H8HA 4I92A 5D1JA 2W1FA 5EQEA 2A0CX 5FM3A 5FTGA 1E1XA 3R73A 2WQEA 4U7ZA 2ITTA 4RPVA 1PKGA 2FB8A 4XLIA 1OITA 2VGOA 3PXYA 3UNKA 4AE6A 1OVEA 2QOBA 3CBLA 5IQFA 2XIRA 5JFXA 2G01A 4QYEA 1OIYA 3OUNB 4IB1A 2R3LA 5CU3A 1HCKA 5BYZA 2IVTA 3QQFA 4EJ7A 4KSQA 3IGOA 3KN6A 4Q2AA 4JBVA 3O8PA 3ORPA 3C0HA
chains in the Genus database with same CATH superfamily
3EWHA 4XG8A 5EHOA 4D2TA 2ZB0A 1L3RE 1RDQE 4U42A 5IA3A 4FVRA 4MAOA 5AMNA 4QTEA 2R0UA 4NFMA 4BWKA 5T68A 3PDTA 2WO6A 3NUUA 2OF2A 2BILB 3GT8A 1E9HA 4WNKA 4AS0A 5A6OA 4JDHA 3MVLA 5L2TA 5J1VA 3IW4A 4D1ZA 4YJTA 3O5AA 2X7OA 4WG4A 1Q8ZA 2A19B 2C1BA 3P23A 4M67A 4S33A 1LUFA 4XG6A 3SD0A 1Q8WA 2XKFA 3VHEA 3TCPA 1J7LA 3A7IA 4X6QC 4HGEA 4S31A 4BB4A 1YHVA 4XV3A 4DH5A 3PLAE 4I4FA 3OT3A 2YJSA 2UZBA 3W0PA 3ODZX 5DOSA 3PWDA 4I21A 1IA8A 3HV5A 3V8SA 4XRJA 3SW7A 3PG3A 3KMWA 3LFNA 3AC5A 1URWA 4TWCA 1DS5A 3PG1A 2P33A 4C02A 4G5JA 1ZXEA 3V5WA 3SQQA 1XWSA 2HAKA 4KS7A 4ANMA 2QKRA 3LPBA 2UW7A 3DDQA 1XJDA 1BMKA 5HVKA 3D94A 3F88A 3EOCA 3Q5IA 4AOIA 2X2MA 5CEPA 2EU9A 5IUHA 5EW3A 5CF5A 4OBPA 3BL9A 3WZEA 3LMGA 3MPAA 4O4DA 2BROA 3A60A 3R9DA 4AW0A 2BTSA 4A06A 4DGNA 4CMUA 2YJRA 4IMYA 3GC7A 1JKSA 3DZQA 3A4PA 3NPCA 4BDCA 2G1TA 4ANLA 1QMZA 4QTBA 4GT4A 2YCFA 2IW8A 4TZRA 4K33A 3UIUA 3SXSA 3D7ZA 3W8LA 4JLCA 3O8TA 4EZ7A 1NVRA 3L9PA 3AD4A 4UY9A 2W7XA 3ELJA 4DFZE 4WKQA 2Q0BA 5A46A 2JDTA 3QQUA 2VWZA 4FTRA 1MRVA 5A4CA 4J1RA 2B55A 2WEVA 3GENA 3VS2A 1ZWSA 4BDHA 5EHLA 2R3HA 4O0SA 4I5MA 2ZM4A 2HW6A 4ZEGA 4DTBA 3NCGA 4UB7A 2F7EE 4FT9A 4IX6A 5CXZA 3EN5A 3EQFA 2JDOA 1WBPA 4H58A 5ICPA 2VX3A 4EOKA 3EFWA 4JQ8A 1OL6A 3KRXA 3M42A 5KO1A 1CKPA 4GT3A 4W4YA 4EYJA 2JKQA 2F7ZE 3OD6X 4O86A 1KSWA 2HZNA 3Q53A 4O7YA 2AEGA 2E2BA 2XF0A 3HNGA 2C3IB 2WMXA 5L2IA 2H96A 4AZFA 4TN6A 2J51A 4ZTQA 5JKGA 1WMKA 3ROYA 1PXPA 3KXXA 5LWMA 3TUDA 4FVQA 1S9JA 3CTQA 4U5JA 2XUUA 3WE8A 1W2DA 3E8CA 3UIBA 3M1SA 4R7IA 3RGFA 4M69B 4Y85A 2W9FB 3T8OA 4QMTA 5IEVA 2GCDA 2YLEA 5CQWA 3U4UA 3BL7A 2YDIA 1O6KA 4DHIB 2PMNX 3E93A 3O17A 3VW6A 5EOBA 5IPJA 4FKJA 4WRGA 4YC8A 4FSQA 4ZTSA 4BL1A 2QOFA 1STCE 5DIAA 1PJKA 5IF1A 4MVFA 3WZDA 2I40A 2J2IB 3C4ZA 1OBDA 5FEEA 3MB7A 3PVWA 2ZV9A 4O1PA 2IW6A 2DQ7X 4JBQA 4ZTHA 3BHVA 2XK3A 4YHFA 4NT4A 4X21A 2XNBA 3MFUA 4YJVA 5D7VA 4AQCA 1ZLTA 5KMJA 3VUKA 3ZO4A 2JDRA 3E3BX 3FYJX 4AT3A 4F63A 2J9MA 1QCFA 3LOKA 4CLJA 5I4NA 2BRNA 1NA7A 3VUGA 2JAVA 4YTFA 3ML1A 4QMXA 1GAGA 4EOOA 4FYOA 2F9GA 5TR6A 3PTGA 3ITZA 2ITQA 3PJ8A 2BRMA 1ZOHA 2Z8CA 3QA8A 4L6QA 3QQJA 3OTVA 2YA9A 1DAYA 4BCNA 2DUVA 3BHUA 3HDMA 4LFIA 2AC3A 4LG4A 2XKEA 3QTUA 2E9OA 2W96B 3RI1A 2ZB1A 2RF9A 3NS9A 4LUEA 3R1YA 3FLNC 4IX5A 3DB6A 4FKWA 2R0IA 2PMLX 4FEQA 4OT5A 4CV9A 4U0IA 3O23A 2O2UA 2F2UA 5J5SA 5CY3A 1Q97A 4G3GA 1GIJA 2GDOA 4YNOA 4XV1A 4DGGA 2EXCX 5HORA 5KHXA 2LAVA 3HMNA 3G9NA 1QPJA 3RAKA 1M52A 4ZAUA 2GS7A 2Z60A 4RIWA 3UTOA 1FBNA 1TQPA 2BIYA 4HYHA 2Z02A 4O22A 3VUIA 4YZ9A 4JJRA 5J7HA 4CQEA 4IAIA 4IWDA 3KXGA 4FK3A 5TO8A 1CM8A 4C7TA 4H3PA 5F94A 1F0QA 2CKEA 2W06A 3U51A 5K5NA 3SG8A 4FT0A 4L01A 1FMOE 3OP5A 4YZNA 5JGBA 3TZMA 1XHAA 4IQ6A 3LFEA 1P4FA 2OIBA 5CI6A 4O7SA 3U8WA 4BIEA 2OXDA 3R8UA 1P2AA 3ROCA 4BDFA 5EW8A 5BQ0A 3PJ3A 4O0TA 2PVLA 2OH0E 4QP4A 2V62A 5D10A 3S4QA 4A4OA 3PE2A 4J71A 3L8VA 1BX6A 1UNGA 1ZZ2A 4G9CA 4R6VA 2ZMDA 1GIIA 2J5EA 3EN9A 2GQSA 1Q4LA 5EQPA 3KU2A 5I9YA 3COIA 1Q3DA 4R3PA 4UEUA 4BI0A 3UC4A 4JI9A 3QD3A 4OTRA 3TT0A 3FDNA 3Q9XA 3R0TA 2QG7A 4MUQA 2PZPA 3QBNA 4YHTA 1H1SA 3OXZA 5KHWA 4A4XA 4USEA 4HVGA 3PSDA 5HZNA 3MJ2A 4I6HA 4IVDA 3HAVA 2QURA 4G2FA 5DPVA 3HV7A 4IIRA 5IKWA 5C8NA 2NPQA 3I79A 4IBMA 3LFSA 3EN7A 1ZOEA 5FG8A 3E8EA 5JZNA 2YHVA 3WI6A 4FL2A 3DFAA 3SG9A 3HMIA 4AN3A 2Z7RA 4D2VA 3HEGA 5HU3A 4D2SA 5CT7A 2FSOX 4XP3A 5FBNC 1Q5KA 3DKFA 4GK2A 3FMNA 4BTJA 3LVPA 5LXMA 3HUBA 4NCTC 4E6QA 4TNBA 3MWUA 3O96A 1M14A 2YIYA 2GTMA 3MPTA 4W8EA 2O65A 2OH4A 1Q62A 4XOYA 5DVRA 1FPUA 3RP9A 2QVSE 2W5AA 3OWJA 4AAYA 5M08A 1OKZA 1Y91A 2GS6A 4O27B 2VAGA 2UW3A 5IG1A 3Q4TA 4FUYA 2C6MA 2X8DA 3FMLA 2JD5A 4IAFA 4DITA 4FSUA 4RIXA 5M53A 1ST4A 3LM0A 2V5QA 2NYAA 3OT8A 4FBXA 2VV9A 4M15A 5AP5A 4BTMA 3KIOC 3UG1A 2CKOA 4F7JA 4RG0A 4X3FB 1R78A 5CF4A 5HTIA 2Z2WA 2GNJA 3OCSA 4TYGA 1ZYCA 4YSMA 4ZJJA 2F7XE 3MVMA 4QP1A 5H3QA 2CGXA 3OXIA 3C4WA 3QTWA 4PY1A 3KC3A 4ITHA 2QOOA 4K18A 4FMQA 2OLCA 4BCIA 3NYOA 3WF7A 2R3JA 4PL5A 4E8AA 4P4CA 5E7RA 3RM6A 5GJDA 5CVHA 4GJ2A 3ZDUA 4CQGA 5F20A 4YURA 4FV6A 3EFJA 2A2AA 4PV0A 4M68A 4WG3A 3W2OA 4DEHA 2XBAA 2UW9A 3ORKA 3QRKA 4HJOA 4U8ZA 5HCXA 2RG6A 2A98A 3PYYA 4RC4A 4LMNA 4HNIA 4QQJA 3G0EA 3FJQE 5AEPA 4NM3A 3BX5A 5EM6A 1UWJA 5LJJA 5A4LA 3T9TA 2RFSA 4FTCA 3G5DA 2G15A 4EOLA 1VEBA 3OUKA 2VO3A 2XYNA 3M2WA 4J95A 4E1ZA 4XBRA 4RC3A 5CQUA 5H8BA 2OJGA 2PZYA 1XO2B 3LCSA 3TNPC 3U9CA 4BIDA 3UZPA 5ANKA 2HY0A 5D41A 4FKRA 3BEAA 5H9BA 1BKXA 5AIKA 4DGMA 3E92A 3QLGA 3V5PA 3ZLXA 1M2PA 3PPZA 5AV2A 4YO6A 5E90A 4ALUA 2DWBA 3EQPA 3ULIA 5L4QA 1PYEA 1WCCA 2OWBA 2Y8OA 3F2NA 4XP0A 5AP7A 1KE7A 2A4LA 2VTAA 4LDTA 4AGDA 3ZYAA 1RQQA 4CLIA 1S9IA 2PZRA 1OPKA 3PLSA 4J7BA 3AQVA 3GFWA 3VBVA 3WYYA 4EJNA 4F6UA 3TUCA 5D9HA 1L8TA 3N4TA 3FLQA 3R1NA 4QDVA 3QWKA 3ZS5A 4L44A 3BPRA 4FSTA 4RSSA 4NH1A 4BCQA 3RK9A 2CJMA 3QCYA 1PYXA 3CP9A 3ODYX 4ANNA 5JN2A 2XAOA 4GFGA 5KNJA 4FODA 4UN0C 3NCZA 4IH8A 4XUFA 1W2FA 5HIBA 3VBXA 4F99A 3PUFC 1MRYA 4HZRA 4UBAA 2G9XA 3CCNA 3EQIA 4J99A 4C8BA 4M69A 3FC2A 5BNJA 5C4LA 1OIUA 2GNGA 2Y0AA 5HCZA 4AA5A 4IAAA 3R7OA 4B99A 5JFSA 3QUEA 3R01A 3R22A 4U45A 3TG1A 3W33A 5GINE 4LMUA 1IASA 3R63A 3LMIA 4DE4A 2RL5A 3DU8A 3NFFB 3NNXA 5CLPA 1REJA 3RALA 4YHJA 4W4VA 1U5QA 2WPAA 1J7UA 3UOLA 4O82A 3D2KA 3NYNA 2OZAB 5DBXA 2VWUA 5HBEA 4MXXA 3UYTA 3G2FA 3VJNA 5H8GA 4EH6A 3QRUA 5AP0A 5KCVA 2GQRA 5DN3A 4RX9A 5FDXA 2HWOA 1H08A 2O8YA 4TWNA 1YOMA 1MQ4A 4LM5A 5AM7A 4AN9A 3FZTA 4BGGA 5BYLA 2G2FA 2O63A 4XS2A 4XYFA 4O81A 2ZV2A 3F2AA 3UZRA 4RWJA 2VGPA 1YOLA 4I1ZA 2XYUA 3HA6A 4YJNA 3ZDIA 4R5YA 5DMZA 4O0UA 5L2QA 3GI3A 2J90A 2W1HA 4YZDA 3AKKA 3MJ1A 2V7OA 4C3FA 2XIKA 2JEDA 2WTKC 4GRBA 4CTBA 4I5HA 2HY81 3F66A 3ZSGA 2JGZA 3KA0A 4APPA 1WVWA 2O0UA 4C38A 5AFVA 5I9XA 2E9NA 4Q5HA 2UV2A 5CAVA 2VTJA 4LV5A 4IZ7A 1ZMUA 4PTCA 2RIOA 3W2CA 3VONA 3NUYA 3E87A 3DA6A 3PZEA 5C1QB 3NAXA 3AMYA 2JC6A 3BHHA 2PUIA 2JDVA 4MCVA 5I3OA 1FINA 3HLLA 3A8WA 2YISA 5LVLA 4KUJA 3Q6UA 4LOPA 3DZOA 4EH7A 1ZAOA 3MS9A 3ETAA 4CFVA 4V05A 3AKJA 2XEZA 3MGYA 2IZTA 3W18A 4PWNA 4H1JA 2PTKA 4TYEA 4E5BA 1JWHA 5M4IA 5E9EA 5I9WA 2B9FA 3HMPA 2OKRA 2GHMA 4G6LA 4AXDA 2PE0A 2WTDA 4RJ8A 4W4WA 4JVGA 4FEVA 4X3JA 2IF8A 3R83A 1KOAA 4G3CA 4C59A 3C0IA 4O38A 4BCFA 4Z16A 3AD6A 5GIPE 3ATSA 2P2HA 3HMOA 4FA2A 4FKOA 3C9WA 5D11A 4ZTNA 4BIBA 4D2PA 5HLPA 1SVGA 1ZYJA 3NUNA 4TKSA 3ZBFA 4UV0A 4YU2A 2W5HA 4HGSA 5F4NA 3FMKA 4FSMA 3IW8A 3RWQA 3TDWA 4CYIA 2C47A 3QRTA 2BALA 1Q8TA 2WTWA 2JIVA 2OK1A 2JBPA 3COKA 5JSMA 3FI8A 4IWPA 5ETCA 2XALA 2ZM3A 1OUKA 2X2KA 3QXOA 3E8DA 5I9VA 3NNUA 4BCKA 2V22A 5DR2A 2R3OA 3CIKA 3F5PA 5CZIA 3C4CA 5DGZA 3QD4A 4Z55A 2YWVA 3KRJA 2YCSA 4YTIA 3AC2A 3V5LA 2VRXA 2B1PA 3QAME 4FV2A 5EKNA 1H01A 3IOPA 5IA0A 2WMVA 3PP0A 3AMAA 4PMPA 5AAFA 4RFYA 4A9TA 4BVUA 3EFKA 5IEYA 4F1TA 5HBJA 4QMZA 5EDRA 2OIQA 2B52A 3C4FA 4O0VA 4YO4A 3R7VA 3REPA 2YAKA 3U54A 4MXOA 2IEWA 3KF4A 3IOKA 3QX2A 4E4XA 4WIHA 3R2BA 3OBGA 3I5NA 5A4EA 3FE3A 3TV6A 2YACA 2OO8X 4QT1A 4KBKA 3FBVA 3FKLA 3P7AA 4IB3A 3KVWA 3ORTA 3UNJA 4BFMA 4EHVA 5A4QA 1OPLA 2X7GA 4NFNA 4RJ7A 4IHPA 3KXHA 1OIRA 5HI2A 4NTTA 1P4OA 2CCHA 5LVNA 3GBZA 4ZY5A 4FIJA 2GMXA 2P3GX 5E8ZA 1I09A 4EORA 3UVQA 3CGFA 3E88A 3EH9A 3DXNA 2C0OA 3EQDA 3Q4UA 4USFA 1H27A 4ITIA 3R1QA 3BWFA 3KKVA 1YXUA 4I41A 2WQMA 4B8LA 5BVEA 2EUFB 1XQZA 1YHWA 2ITNA 4P5ZA 4P2KA 2YM7A 1G3NA 3CD3A 3PA5A 2HOGA 5AV4A 3BE9A 1WVXA 2C6IA 4QQCA 1JSVA 4QD6A 5EKOA 4PPCA 5C01A 3PXFA 3DAKA 1ZMWA 1YWRA 4DFBA 3LIJA 5B2MA 2BPMA 3PJ1A 4MF0A 3PIYA 3TV7A 4ZY6A 4E6AA 5ANDA 2BDJA 4A4LA 4HGLA 3AGMA 1XH4A 3QYWA 3MIAA 1ZYSA 2QONA 3DAJA 2YABA 3QZFA 4K77A 4L45A 5IMEA 2C69A 4ASDA 2QLQA 2F49A 3B2WA 5E8YA 2CGVA 4DEIA 1UV5A 4G31A 4JOAA 2R7BA 4PF4A 5LQFA 2BDWA 4CG8A 4PDYA 4IDTA 1ZYDA 5CTPA 1A06A 5CWZA 5FLFA 3D7TB 4DLJA 2PWLA 2WGJA 4TYIA 5BVDA 1JBPE 2CLXA 4A9RA 5JFWA 4BDBA 3RTPA 1CKIA 2F2CB 4IM2A 2X4FA 3BIZA 4FL1A 5DEWA 4FGRA 1NVSA 1UA2A 4XH6A 3DKGA 4BCOA 2I7QA 4GMYA 4WOVA 3UJGA 4PPAA 4EQUA 4EONA 5EDQA 3Q6WA 2C6OA 4AN2A 3BCEA 3KB7A 5DLSA 3MTFA 4XG7A 3UNZA 3ZH8A 2PVHA 2HCKA 1Y57A 2Z7QA 2WU7A 3VBQA 2LGCA 5EI2A 3NW5A 3FL5A 5GZAA 3U87A 1H8FA 4R7BA 4K0YA 3IECA 1TVOA 1YXTA 4A9SA 4E4LA 3FZSA 3I7CA 4JDIA 4ZTRA 5CAUA 5IU2A 2XANA 4RIOA 2FUMA 4X2JA 3QZIA 2J0KA 2CMWA 4JIKA 3ZUVA 2CNVA 4FR4A 4QDEA 3BE2A 4IWOA 2BFYA 4L00A 4YPSA 3A7HA 3U4WA 3NNVA 3V5QA 4E3CA 3GQIA 3C4XA 2W17A 4PDSA 3C50A 3CLYA 3GB2A 3A8XA 3TNHA 4PP9A 3LKMA 5IH6A 1ZY5A 1LPUA 2REIA 2XM8A 5EH0A 3LCDA 3ZBXA 2YM4A 3M11A 2FSTX 2YM6A 3MDYA 1J1CA 4RVKA 1IAJA 1GY3A 4GV1A 3HV4A 4GH2A 3EKNA 5BVKA 3RK5A 1FVRA 3BKBA 4GT5A 4ZSGA 2IN6A 3FMEA 4J8MA 4IJPA 3LE6A 3PXZA 4XP2A 2BR1A 3FMJA 3FLSA 4ASZA 3N4VA 4HPTE 3BV3A 4FIIA 3OFMA 3C13A 3OTUA 4GSBA 1Z57A 3GU7A 1H4LA 3IG7A 2XIZA 5BUIA 4JXFA 2QHMA 4QP2A 4JBOA 4RFZA 3VS7A 2V7AA 4N57A 3D83A 3UYSA 4FIFA 3FEGA 4IVBA 3R7IA 5HO7A 2UZVA 3W2PA 3LJ2A 1W84A 3DJ5A 2OZAA 3SHEA 2VX1A 3VC4A 5LMKC 4FSNA 2YEXA 4LOQA 5KKRC 3TJCA 5M4UA 3LJ1A 4KAOA 4RWLA 4FNXA 4E4NA 5B2KA 1EH4A 2UZDA 2PVJA 4L52A 4OTPA 3FV8A 2X4ZA 3TACA 1NW1A 1E1VA 4D0XA 4U81A 4QNYA 4J98A 4AA0A 2VO7A 2XJ1A 4MBJA 3QQLA 3QXPA 4TPTA 4XHKB 2GS2A 4WNOA 1W98A 4M0ZA 3D0EA 2PVMA 4F78A 3V51A 3CJGA 3WZUA 4QMWA 5HVYA 3QHWA 3PY3A 4GG7A 4RRVA 5IISA 3NR9A 3PVUA 2R3KA 4BKYA 1SZMA 5BPYA 2R3GA 1ZZLA 3PSBA 4QP9A 4RIXB 4B8MA 5A6NA 5J9LA 3MY1A 2UZUE 3R2YA 3ZEPA 4BWPA 2IZRA 5CF8A 3S3IA 3U9NA 3CGOA 4S2ZA 5AP3A 4UZDA 4CG9A 2J0IA 2PVNA 3COMA 4TYJA 3EZRA 1CTPE 3Q96A 3HV6A 5DR6A 2FGIA 1OECA 2NRYA 5TKDA 4YPDA 3H9RA 1OKVA 5AIRA 2HXQA 3AOXA 3DK3A 4Z9LA 4EKLA 3ULZA 4O7RA 2PZ5A 2I0VA 4P7EA 4D5HA 4WG5A 3C7QA 4GUEA 5BVWA 5DR9A 3DKCA 5C4KA 5AUVA 4JNWA 5JFVA 4H36A 3QCSA 4FKSA 2IZUA 4M8TA 3ZHPC 4KKGA 1JKTA 5BVOA 3HV3A 3W32A 5B7VA 4RZVA 1R0EA 2QCSA 4U97A 4KRCA 5HE3A 4C62A 3MVJA 4EOQA 4YR8A 3UDSA 4PNIA 4BDEA 1Q61A 3Q60A 4FG9A 3TL8A 3WF5A 1FVTA 4O84A 4BR3A 4DF3A 4EK5A 2WTIA 2JIUA 4TT7A 4MQ2A 1O6YA 4ACMA 1G8AA 3S2PA 2GNHA 3PFYA 3COHA 2BTRA 4R8QA 4XX9A 3R8ZA 4FE2A 3GXLA 4AF3A 3SRVB 1F5QA 4LRKA 3HX4A 2UVZA 2C5VA 4FSWA 3THBA 2KTYA 3GC8A 4GW8A 4O4BB 5CSWA 3D2IA 5LCKA 3UO5A 2BMCA 1GZKA 3BGZA 4UWYA 1XBCA 1PXIA 4Y5HA 4EHGA 4HCUA 2AC5A 5CSHA 2XEYA 2VO6A 3D5VA 4IZYA 4NIFB 3VBYA 3VW8A 2PVRA 4C4JA 3HRCA 1BI7A 5EDPA 3EKKA 3OWKA 1O9UA 4M0YA 2RFNA 4ZZOA 3QA0A 4EUUA 4KINA 3POOA 2ZDUA 3VBTA 3R6XA 2CNUA 4AZEA 4EH5A 4FOCA 4ZLOA 4O7NA 4CZTA 4JL9A 2V0DA 3ZC5A 2Z7LA 4XRLA 3ZZEA 1OL2A 2VTRA 1DM2A 3LXNA 3ERKA 3P0MA 5LARA 3ZO2A 1NVQA 3O50A 2JKOA 2ZJWA 4YJRA 3VUDA 1KE8A 5DHJA 4I24A 3FZ1A 4YJSA 4JR3A 4L9IA 2O3PA 4S30A 3VULA 4QMSA 4GIHA 4EC8A 4D58A 2QR7A 3PA3A 3ENHA 2XAMA 4QNAA 2YM3A 2I1MA 4NM0A 3ATTA 2H6DA 3FHRA 3IPHA 3VUTA 4E5WA 4FV8A 1TKIA 3TTJA 2QOLA 4TTHB 5TE0A 1OL1A 4PMTA 4RVTA 1NT2A 3OOMA 3R8VA 5FUTA 4AGCA 1R3CA 4BGHA 5K0XA 2C68A 4PP7A 2OXXA 2IPXA 4I5PA 4AFEA 5IA2A 1JKLA 1LR4A 2VD5A 2Y4IC 5HNBA 4F0GA 4RLLA 3ORNA 4I6FA 2C6TA 2IO6A 3DOGA 2PULA 3QGYA 2QNJA 2CN5A 5AR5A 2GHGA 3G51A 4U80A 3RVGA 1CMKE 1FOTA 2W1DA 4FTOA 5CVFA 5IQCA 4RA5A 5CAQA 4DBXA 3WIGA 4V01A 4U41A 2UZLA 5GJGA 2CGWA 2GHLA 4NK9A 5E8VA 3R28A 4GFOA 4ANOA 1PXKA 5EM7A 3D9VA 3IS5A 4UWBA 4QMVA 3HRFA 4JG6A 5LVPA 5E4HA 3D7TA 3GU4A 1O6LA 3R71A 4BWXA 3F61A 5B0XA 4NEUA 4HVSA 4OBQA 2FSMX 3NDMA 2UW4A 5CEIA 4USDA 3VS1A 4BY9E 2W1IA 4AZVA 2YIXA 3GP0A 3VS3A 4PRJA 4AX8A 4RQVA 4FTIA 3ZRKA 4DEGA 4AW2A 1YI3A 3MH1A 5E91A 4FEXA 3FZPA 2AUHA 2GPHA 3ANRA 4JX7A 4PDPA 4C61A 2VTIA 4WRSA 3CKXA 3QRJA 2WIHA 4ZTLA 2OGVA 1UWHA 1YW2A 2UW8A 4O6LA 4WNMA 4AAAA 2OFVA 4I0SA 3TZ9A 4A9YA 2WMBA 4XG2A 1YXVA 3ZFYA 1H1RA 1ERKA 4GKIA 3DY7A 5H8EA 3RPRA 1JOWB 4II5A 2ZV8A 4RIYB 2JIIA 2WHBA 3ZLSA 1P14A 3PY0A 5EYDA 2QOIA 2XNPA 3EQRA 4O0XA 2W5BA 1U54B 4HYSA 3V3VA 4XLVA 3DTCA 1BI8A 4J52A 2VTSA 4XNEA 1YXXA 5KE0A 3N51A 4L53A 5AUWA 4MTAA 4ENXA 3EJ1A 3GOPA 4AW5A 4G3DA 2X8EA 3BYSA 2YLFA 4Y8DA 3ORZA 4LV7A 5AR2A 3T9IA 5IUGA 3BLQA 5BUEA 1JSUA 3NWWA 5JZJA 4KIPA 4R77A 3QC4A 3I6WA 4HGTA 4ZLZA 3UBDA 4R5SA 3ZONA 3NIZA 2XNGA 4J97A 2ERZE 5KZ0A 2HZIA 3QL8A 4EHEA 5JGDA 5KMKA 5ETAA 2WEIA 4NTSA 4QMPA 3OMVA 3RCJA 3UDBA 1OMWA 3ZSHA 2ZAZA 3QYZA 4OBOA 2B54A 4FX3A 4QP8A 2CKPA 4OTQA 2ZV7A 4CVAA 3HVCA 4I22A 3KEXA 3LFDA 4RVLA 5ACKA 2QI8A 2VUWA 4PL4A 4UXQA 1REKA 4MNFA 3Q52A 3H10A 3LAUA 1YXSA 5HG9A 3TUBA 3ZO1A 1YI4A 2YITA 3WZJA 2PUPA 3OEFX 4ZXTA 4EWHA 3CJFA 3ORXA 4FGBA 4S34A 4GJ3A 2ZVAA 5HLNA 3P7BA 5DH3A 3K5UA 5CNNA 5C26A 1MP8A 2X6EA 4GU6A 3QALE 3FI3A 1Y6AA 2EXMA 5DRDA 3L9NA 4I5CA 4LGDA 3EQBA 4NZWB 3F7WA 4P90A 1M2QA 5DT3A 3KRLA 3UGCA 5CU2A 3VUMA 1FGIA 3TKUA 1ST0A 4FK6A 5FDPA 4FSYA 5HIDA 4JAIA 2JDSA 5LVOA 1KOBA 3BZ3A 1YI6A 2XM9A 4OGRA 3F7ZA 3HMMA 4RBLA 5HHWA 5IA1A 5D7AA 3TZ8A 4LQMA 3DK6A 3KMMA 4I94A 4AW1A 2UZNA 1Y6BA 3Q2MA 3RNIA 4XOZA 3BU3A 1Q41A 3N9XA 3QUPA 4FTQA 5IMXA 4YBKA 3V01A 5FP5A 4QMQA 4Y46A 3D5WA 1OBGA 1K9AA 2GSFA 5FD2A 4JMQA 3H30A 5A54A 4E7WA 4CCUA 2NO3A 3PY1A 4H3QA 4FVPA 4QQ5A 4WNPA 4O7TA 5L3AA 1WBWA 5FRIA 1ZYLA 3IDBA 4AXEA 4R3CA 5E1EA 5IUIA 1AQ1A 1GJOA 4C4EA 3CS9A 2WU6A 4FV0A 5CXHA 1WVYA 3I1AA 3BRBA 4U79A 5K0KA 4ANBA 1QPEA 3W2RA 5AV0A 4ORKA 4DFLA 3KRWA 3RZBA 3CY3A 4M84A 3ACJA 1UU9A 3GU5A 4CFWA 4MYGA 3DCVA 4DEDA 3NUXA 3MFRA 3O2MA 4ZK5A 4CFXA 3VN9A 3DXPA 1KV2A 3PZHA 4CFNA 2XA4A 2P2IA 4ACCA 4ZMFA 1YWNA 3TNIA 1HCLA 4MH7A 3SRVA 3ZUUA 4Y73A 4NJ3A 3CC6A 3LCOA 3DK7A 4RZWA 1XBAA 4D4VA 3FXXA 5IQHA 2QO2A 4DEBA 3JUHA 5BVFA 4DAWA 3MYGA 4FUXA 4GL9A 2VTLA 2FH9A 2YM5A 3NX8A 4O7WA 4NIFA 2X7FA 2WD1A 3MTLA 4ALWA 5CASA 1JQHA 5JQ5A 1OUYA 3LXLA 3POZA 3MY5A 3UQFA 2ETRA 4EZ3A 4YC6A 3TKHA 5M51A 4BDAA 5C27A 3OS3A 5CU4A 4DH3A 2W99B 3L9MA 4K6ZA 4MWHA 4XBUA 4L3JA 3ANQA 2ITXA 4ZSEA 4OTIA 2CNQA 3LLTA 2YCRA 3BEGA 2DS1A 3PPKA 2FYSA 1RW8A 3KQ7A 2X39A 2RFDA 1HOWA 3F5XA 2ITOA 3PA4A 2IG7A 5AV1A 4UMUA 5GIOE 3LW0A 4FEUA 4EQCA 3EYHA 4O83A 3IW7A 5HX6A 3S1HA 2J6MA 1G5SA 4DFYA 2Y7JA 1KE6A 3GCPA 3ORIA 2P4IA 4FKLA 2WIPA 1PXMA 4YTCA 1DAWA 2B9IA