3PPKA

Human b-raf kinase in complex with a non-oxime furopyridine inhibitor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
276
structure length
262
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Non-oxime inhibitors of B-Raf(V600E) kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 75
structure length 262
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ppkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ppkA01
4BCOA 2OWBA 5IA3A 4AZEA 4YTIA 2Z7RA 3HL7A 2GS6A 5EH0A 3ORLA 2B55A 3FE3A 5T3QA 3SKCA 4CFWA 5FDPA 4PDPA 3W55A 2ONLC 3DU8A 4FIFA 5BVFA 3UIBA 3OXZA 5HNIX 5CXHA 3GU7A 4HJOA 4OAUC 2PULA 3LQ8A 3BE9A 1OBDA 3OEFX 1WAKA 4Z9LA 5HLWA 4J71A 3UIXA 1K2PA 4BBFA 4G9CA 4R7HA 4A06A 4EK8A 4XG7A 3EFJA 3HUCA 3WF9A 4QPSA 4ZTMA 3WOWA 4FV6A 4GVJA 2RGPA 1OI9A 3OUKA 3V8WA 4YJTA 1K9AA 2PMNX 4G31A 4M13A 3A7JA 3SG8A 1WBVA 3UNZA 4ZSGA 1F5QA 5K5NA 2HY81 4DEAA 1UNGA 4RC4A 1QL6A 2X0GA 2XBJA 4K33A 1YOMA 4ZK5A 2WHBA 3ZRLA 4YNEA 3PP0A 4UEUA 5H8GA 3C0IA 3ZUTA 3RMFA 4JNWA 1Q3DA 2VRXA 1XH5A 3DKFA 3RGFA 4WRGA 3QKLA 2W1FA 3FSFA 3GQLA 4IHPA 2H8HA 3FLSA 4M14A 3EZRA 4DTBA 5BUJA 1OL7A 2PVMA 4NIFB 3DDQA 2NO3A 3PY3A 3WIGA 3BYOA 4FV5A 4EQUA 1K3AA 3MFSA 3OCBA 3DBCA 3ORZA 4L44A 5HNGA 1U4DA 4RJ6A 3FLQA 1UA2A 5M57A 3MTLA 3UZTA 2XIKA 1ZMVA 3NR9A 2J5EA 4WO5A 4FOBA 4JBPA 3F82A 3GU8A 5M44A 2XK7A 2OXXA 3BYSA 5KKRC 4EOLA 4D0WA 3GENA 4FKLA 3SXSA 3GT8A 2BDJA 3AD5A 4BDEA 4C57A 4F0FA 3LCDA 4M69A 3ZH8A 4G2FA 5CAUA 4W4VA 3KXGA 4PWNA 4DEIA 2UZDA 5AADA 4GS6A 4MYGA 3FLWA 2YABA 4C0TA 4L46A 3NMUF 3W8QA 3R7EA 1R39A 3LFEA 3QHRA 2YCRA 3LCOA 5M55A 4FUXA 4XV9A 5F1ZA 2XK3A 4MQ2A 4O1PA 2UZUE 4QOXA 4V01A 4F7LA 2QONA 3MGYA 4FKSA 3QTXA 4RLKA 4I93A 4AT3A 4Q9SA 4EH6A 1H0WA 3RCJA 4BZDA 3HDMA 4D5KA 4RIOA 4U79A 5LMAA 1F0QA 1H28A 5CSVA 3HP5A 1KSWA 2XBAA 4O27B 3AMYA 3FC2A 3LPBA 2WMXA 3L8XA 4YMJA 5IG1A 4YGAA 4BZNA 1YVJA 5BVWA 2C6DA 3DTCA 3GC7A 3KXNA 1OKWA 4QPMA 3E8CA 1OPJA 1XHAA 3CXWA 1P4FA 1UU8A 3OXIA 4QMZA 5FEQA 5KBRA 3TEIA 4MBLA 5T6KA 2W1HA 3CP9A 4ID7A 3QC9A 3ORNA 4FX3A 3II5A 2VO3A 4Z16A 2CJMA 3AXWA 4E4LA 2WMWA 5CEPA 1P5EA 5KMLA 2CKOA 2CLXA 3QQJA 4PTCA 3I7CA 5GIOE 2DYLA 2JDRA 3VF9A 4ZY4A 5I9VA 5L6OA 3OW4A 3D94A 3PJ3A 3CLYA 3KEXA 2ZYBA 3QALE 5JT2A 3EN6A 2Y9QA 4E4NA 3MIYA 3A8XA 1E1XA 3MFTA 4NM0A 5JQ5A 5I9ZA 4DAWA 2XJ2A 4FYOA 2FSMX 4HYHA 2B1PA 2BFXA 5CWZA 4BDCA 4G16A 4G3GA 4YLLA 2OO8X 2E2BA 2NPQA 4YJQA 3RHKA 3CS9A 5B2MA 2J90A 3RPRA 1G8SA 2PE2A 2I1MA 3NNWA 5TE0A 3DJ6A 2ACXA 1MQBA 4TYJA 4KSPA 3NEWA 3V5WA 4IDTA 3VS4A 4RJ3A 3CCNA 5CSXA 5HBHA 2WMQA 5CT0A 1OPLA 2X4ZA 5ANDA 1LUFA 1O9UA 3TWJA 3FMKA 2IZRA 4KKGA 5IPJA 3BX5A 4FIEA 4JLCA 4KIPA 3HNGA 4J8NA 4AA5A 4QP9A 1OKVA 3A99A 4DH8A 2C5NA 3U51A 4DH7A 5JRQA 1M52A 3B2WA 5CSWA 1MQ4A 2Z7SA 4GG7A 3T9TA 4JS8A 5K5XA 3AC1A 3MBLA 2HAKA 3E92A 4DYMA 2O2UA 4FNZA 5IKWA 3WF5A 4CV8A 4RQKA 4LL0A 3W10A 3E64A 3T9IA 5AV3A 5BUEA 4EORA 3QC4A 2HXLA 3TIZA 4EL9A 3RZFA 2C0TA 3LE6A 2W1CA 2QU6A 3TZMA 1QMZA 3I81A 3IKAA 1PMUA 4TT7A 2C1AA 3BYMA 4FSUA 3S3IA 3S95A 4CFMA 3IK3A 2ZOQA 1PXJA 1P14A 5CEIA 4FKIA 4FKUA 2OK1A 4QP6A 4RX5A 2B53A 3HGKA 5DI1A 1NXKA 5LCKA 1OGUA 2XIXA 4JDHA 4KB8A 3ATTA 2ITTA 1ZRZA 1XH7A 4BBMA 4C3RA 1GZ8A 5CQUA 4X2JA 4QNAA 1H1RA 4Y73A 3K2LA 5J95A 3U6IA 3MESA 5AUZA 3QLGA 2GS2A 4QMUA 2HELA 3E3PA 4X3FB 3VJOA 2W4JA 3FC1X 4XLVA 2CKEA 4ANLA 4EHGA 4I4EA 1XWSA 4PP7A 2A1AB 3KB7A 1OIUA 3R7YA 3C4WA 3GB2A 4IXPA 4XBRA 2YHVA 3C5UA 3V5JA 3F3UA 4Y72A 4KIOA 1GAGA 3F9NA 5DMZA 4XHKB 1Y6BA 3CQEA 3DOGA 3AOXA 4D0XA 4EWQA 3KK8A 2RG6A 4E6DA 1Q4LA 3PZHA 4RFMA 4YJOA 3W2OA 4M97A 3OXTA 4EOJA 2VTNA 5EYKA 4ZJJA 3IW7A 3OBJA 4BB4A 3FI3A 4FSWA 3G5DA 3GC8A 4R3CA 3PUPA 2E9VA 2YITA 4FKQA 2RFSA 3DKGA 2QO7A 3KN5A 4IAKA 4FF8A 1B6CB 2ITUA 4J97A 3MH3A 4LL5A 4F09A 5AA8A 1H1PA 4FUYA 4O7NA 5CNNA 2BALA 2QR7A 3AT3A 5C26A 4BCIA 1JBPE 3QZFA 4AX8A 5LVMA 1ZOEA 4NTSA 2UVYA 3NUXA 3NCGA 4R78A 2XK9A 4USEA 2CMWA 4MAOA 4IZAA 4FNXA 4OTGA 5FTOA 5HESA 3R1YA 4EZ3A 4BCHA 1AGWA 4I5HA 5JRSA 3NW6A 1ZZLA 4IX3A 3UNJA 2WIHA 2YERA 4HCUA 4FSMA 4N6YA 4JL9A 2P3GX 3HMMA 4YHTA 5DR6A 5HE0A 5IMEA 5J5SA 4AA4A 5JFSA 1OIYA 3ZU7A 2VWUA 4X2NA 1YKRA 3MA3A 2PU8A 1Q5KA 4D1SA 3DY7A 1YXXA 2JGZA 2PZYA 3LCSA 3A7IA 2Z8CA 3I0OA 5HO6A 4ZAUA 3OZ6A 2PE0A 3FHIA 3KF7A 2WTKC 3MA6A 4DLIA 5AUUA 3RP9A 2BZKB 3G15A 4C59A 3O17A 3UMXA 3UTOA 3PA3A 2C30A 3A4PA 4XCUA 5GNKA 2XS0A 3PLSA 2QKRA 3DJ7A 2EB2A 4LGGA 4TWNA 5EM7A 2V7OA 4FBXA 5CI7A 4BF2A 5LMKC 2VTLA 4GIIA 4WA9A 4ZS4A 2OG8A 4FZ6A 4KA3A 3R71A 1Q8UA 3PXZA 2J0LA 3E8NA 4JBVA 2QOHA 5C9CA 2E9OA 3MB6A 3LMHA 3PSDA 3AQVA 1F3MC 3KK9A 4KNBA 3C4ZA 2FVDA 3K5VA 4YPDA 4FOCA 3FMNA 4EC8A 2CGXA 2CNUA 1YW2A 2GTNA 1NT2A 1TQMA 2J6MA 3GUBA 4E20A 2VNWA 3CD3A 3Q6WA 4W8EA 1RE8A 2UVZA 2ZM1A 3BHYA 3QQKA 2OXDA 3HUBA 5KZ0A 2HW6A 4IFGA 2JKOA 2E9UA 2PYWA 1PRYA 1YOJA 5FGKA 3FQSA 1WCCA 2UW0A 1FGIA 3O7LD 4CKJA 5M4CA 3RWPA 4P2KA 2VWXA 2BRNA 4HCVA 3MY0A 5D11A 4UMQA 2C4GA 3IECA 3LM5A 3I60A 3ZDIA 4PQNA 5IEVA 3TNHA 4QT1A 4NJDA 5AX9A 5IA1A 3RAHA 3KFAA 5HO7A 3G9NA 2REIA 1PXPA 2WQNA 3EN7A 4A4XA 1IA9A 1HCLA 4CG9A 1PKDA 3R22A 5C8KA 4A9UA 4ZTNA 3ANRA 3ZMMA 1M2PA 1UVRA 4BN1A 2Y4PA 4QNYA 5L2WA 3F7ZA 1Q41A 1ZMWA 4FSNA 3ZUUA 2PVNA 4KINA 4WIHA 5IA5A 4U3YA 5DFPA 2AC5A 4M12A 2DS1A 2VAGA 5CTPA 5C03A 3VRYA 3DKOA 3Q53A 4FI1A 4AWIA 5ETAA 5AUWA 4GH2A 4USFA 2CCHA 4JG8A 3KXXA 4QMYA 3EMGA 4EOIA 1L3RE 4HPUE 5A14A 3R0TA 4IDVA 4DG2E 2WTVA 4L68A 4FKWA 1STCE 4MD8E 5CU2A 3TTJA 4RC2A 4M68A 5GJDA 3VO3A 3QAME 5DWRA 3UPXA 4FL2A 4P5QA 4UMRA 4O0YA 1ATPE 5CAQA 3KMWA 4IFCA 4X2FA 1JKTA 5LVOA 1H0VA 2WMSA 5AAGA 2VGPA 4FTRA 2PMLX 2NRYA 1I09A 3MWUA 4TYEA 4G6OA 5L6WL 4EONA 4RIYB 3LCKA 4DITA 5BQ0A 3SQQA 5HU3A 4MHAA 3D83A 2ZAZA 3NGAA 4YPSA 5HD4A 2BZHB 4FTKA 2I40A 4IM0A 4BHNA 5IQHA 5FG8A 1Q61A 2WMUA 2ERZE 4BBEA 3QA8A 2ITQA 5IEXA 3Q5IA 4QTDA 3COMA 3UYTA 1M14A 4QMOA 5IQBA 2FSOX 5LWNA 3F5UA 4JX3A 3ATSA 2Y4IB 3KGAA 1LP4A 3NVMB 3F61A 3H0YA 3HMOA 4USDA 3BPRA 4D9UA 3TNPC 2ZV7A 3KMUA 5AR2A 4F9YA 3TNWA 3RPOA 1XQZA 4DEDA 4TY1A 1Z57A 4IB3A 3TM0A 1SM2A 3KXZA 1J1BA 4GCJA 3QQUA 3RCDA 2HZ0A 2PE1A 4PL5A 5A4QA 3IW5A 2BUJA 2BRHA 3ZRKA 1E9HA 3W32A 2OKRA 3WZUA 4JIKA 3KRRA 4AS0A 2VTAA 5BVDA 2XA4A 4FT7A 4GFMA 4WG4A 5EW8A 3F88A 2C6IA 4RX7A 3UVQA 3ZBXA 5IQCA 4UMPA 5HBJA 3BV2A 5AR8A 4M84A 3ZO4A 3SVVA 4OT6A 5LXMA 4OGRA 1PXIA 4G17A 3HAMA 3IDPA 4AACA 5KX8A 4RZVA 5JMSA 4IMYA 3EL8A 5HHWA 3PIYA 3VW6A 5K4JA 2RFEA 3JY0A 5EM5A 2WGJA 3GXLA 4FKRA 4I94A 4BTJA 1XBBA 3MYGA 3PA5A 4DTAA 5DEYA 3TZ7A 4MXZA 2W1DA 2CGVA 4BDAA 3UZPA 4BY9E 3SOAA 4AOJA 5BVOA 2P2HA 3L8VA 1MRUA 4RJ5A 1RJBA 5BVEA 1H8FA 2JIVA 2VWWA 3PVBA 4IX6A 2X2LA 2H96A 4RA4A 4EH5A 4QTBA 4U42A 4EOSA 1H24A 5CENA 4EKLA 3W18A 4FEVA 5AFVA 3NIZA 3HV4A 2YACA 3RAWA 4BGGA 1T46A 2QNJA 3NRMA 2J0KA 4PMSA 3P08A 1H26A 2JAMA 4ASZA 2C3LA 4L3JA 3TXOA 5CF4A 3LVPA 3PVWA 4F0IA 5JSMA 1UKHA 2ZDUA 5KNJA 2WOTA 1V0PA 2QODA 4GK2A 1LEZA 2XP2A 4I22A 5TKDA 2QKWB 3BI6A 4AOIA 5KKRB 5BYLA 2KULA 3SW7A 5GHVA 2GPHA 2XJ1A 1OKYA 3IDBA 4G9RA 2XKFA 3VHKA 2R4BA 1PYXA 2G2FA 2IVSA 5E8TA 3HECA 2QCSA 4EH9A 2R7BA 3OW3A 4F7NA 4ZP5A 3V8SA 4FTLA 4PP9A 4U3ZA 3MFUA 2C3IB 3QYWA 5F94A 2JBPA 4O6EA 5KE0A 2PVHA 3UYSA 4YZBA 2IVVA 3WF7A 4EH4A 2OFUA 4EZ7A 1J91A 2BRMA 4PX6A 5I0BA 4O2ZA 2FSTX 4FT5A 2PUNA 3FZPA 3V01A 2C0IA 3TUBA 3JXWA 4K6ZA 1SVGA 5HOAA 3QUEA 4UMUA 4ZTLA 4AN9A 5FRIA 3LMGA 4O0TA 4LOQA 1BUHA 4R7IA 2R7IA 1SVHA 2QG5A 3GOKA 4IEBA 4X3FA 2FO0A 5HNBA 1OPKA 4F7SA 1ZY5A 4C4HA 4K77A 5DOSA 1UU7A 4AOTA 4HVHA 5A4EA 5ANOA 5LJJA 5C27A 4BL1A 2QLUA 5EQEA 3MB7A 1OUKA 3SRVB 4AP7A 3DK3A 5ANJA 2Y0AA 4XJ0A 3C4FA 2J51A 4WUNA 4NSTA 3QZIA 2WMVA 3BBTB 3BLRA 4IC8A 2IWIA 2BAKA 5AP1A 5I9UA 5J7HA 3NUAA 3W8LA 2R3PA 4TWPA 2OIBA 3BU3A 3QKKA 5BVKA 4B9DA 2CKPA 3FZTA 3ZLSA 4FVPA 3QRIA 1KOBA 4F65A 4UN0C 2Z02A 1PXMA 4BDJA 3F2RA 4HGLA 5IQDA 3RPYA 4YSJA 2JKKA 4JDJA 3R7GA 1NA7A 3VS6A 1WBNA 4R3PA 2I6LA 1W7HA 1AQ1A 1YDSE 2R3LA 3TTIA 1M7NA 3F3ZA 4E6QA 4I6QA 4C61A 4MK0A 5BUIA 3OMVA 5DPVA 2JDTA 3FEGA 4WBOA 3F3TA 4NKAA 4EC9A 4X21A 2F49A 2IG7A 3CSVA 4LRJA 4CMTA 3IS5A 4EOMA 4U5JA 3C4CA 3ZC6A 5EI2A 4ZZMA 5FWKK 1CTPE 1GZNA 4YNOA 3E88A 4ALVA 4F1TA 4YR8A 3B2TA 5CVFA 3WF6A 2WAJA 4ACGA 3VIDA 5IH6A 4II5A 5L8JA 2J0MB 1FBNA 4RX8A 2YLFA 4XRJA 1FQ1B 3MY1A 4IB1A 4MXXA 4F0GA 4M8TA 3A7GA 4GJ2A 2IW9A 2IN6A 3NDMA 3OWLA 3Q2JA 2XJ0A 2XNNA 4PDYA 3VVHA 3P23A 4Q5HA 3THBA 4BCKA 4D2SA 4HOKA 1VYWA 4KKHA 5C4LA 1DS5A 1PHKA 2F9GA 4EHEA 3CTJA 4ITIA 1QPJA 4S34A 4RX9A 3FPQA 3HVCA 3FHRA 1KOAA 3D4QA 4FE2A 4XX9A 3EYHA 3VAPA 3U8WA 4C4GA 4QP3A 2CPKE 2AC3A 5DYJA 4U44A 4BCMA 5DVRA 2WMAA 3MJ1A 5AP7A 4BKJA 4FL3A 2X6DA 3KVWA 1M2RA 4J98A 2PZ5A 4PL4A 4O7YA 4Q5EA 3A4OX 4CZTA 2R3GA 4AZVA 4HYIA 4CQGA 4IAIA 5A6OA 2UZNA 4EK4A 3NCZA 2R9SA 3OEZA 1YDRE 2RSVA 4JIAA 3R9RA 1RDQE 3IO7A 5ETIA 2PL0A 3FMDA 4FL1A 5ACBC 3ENHA 4D2WA 1BL6A 1DAYA 3S2PA 3TZ9A 2ITXA 5L2SA 3FMMA 3BCEA 1WBOA 1UWJA 4XG3A 2ZM4A 3FQHA 4EEVA 4WBBB 5AP0A 4ZTSA 4EOQA 4QD6A 4OBOA 4MD7E 3D7ZA 3OCGA 4YZNA 2IPXA 1ZYLA 3R2YA 5HG8A 4FR4A 3Q32A 2WPAA 4ENYA 2B54A 2G9XA 3QD4A 4JBOA 3RM6A 3T3VA 2UZWE 3Q96A 5DNRA 3UODA 5CF8A 3QD0A 3H3CA 3PXKA 5AM7A 1R78A 4CFFA 3LXNA 2HWPA 5A46A 3KXMA 4O82A 2CN5A 5E91A 2W1ZA 3NAYA 2WMTA 1OL2A 3EQHA 2ZMDA 3HMIA 2R3QA 3UQGA 3PJ1A 4YBJA 3A61A 3F2AA 3ZCLA 5AEPA 4QYEA 3GFWA 4U43A 4F6SA 4RBLA 4G6NA 3AC8A 4XG9A 5FTGA 2R0IA 2VD5A 1XJDA 1YI6A 3VUIA 5IF1A 3PJCA 3QX4A 4L7FA 3HAVA 3EOCA 3EQCA 4FTQA 4XYFA 3SLSA 5IQGA 4JR7A 1QPEA 4DT8A 4KD1A 1EH4A 2W05A 1NW1A 2VTQA 3EN9A 4BKYA 3R00A 4F6UA 4C2VA 3HRCA 4DFBA 5CVGA 3AGMA 4QMXA 3FLZA 2JFMA 1PF8A 3KKVA 5FM3A 4RIYA 4FKJA 3NUPA 5E92A 4MCVA 4ARKA 5FBOA 5EYDA 2VV9A 4D55A 1VEBA 2V22A 5A4TA 4ZSEA 4DTKA 4F99A 5HIEA 3ZFXA 2B9IA 2GDOA 3I79A 2GNLA 3ZM9A 3NPCA 3D14A 3PTGA 4MF0A 2WOUA 3RZBA 2X1NA 3DXNA 4FSRA 4PMTA 4YZDA 5G1XA 5FUTA 2YIQA 3R04A 5CVHA 5DHJA 4A9TA 2B0QA 3LOKA 2GFCA 3FKLA 4AZWA 4UX9A 1GJOA 2XIZA 4YO4A 4AGDA 5JQ8A 3KRJA 5F9EA 1BI7A 3ID6C 2ZMCA 1YI4A 4ANQA 3SXRA 4FTIA 3ZDUA 2XNEA 4RWJA 2EWAA 4K9YA 5EYCA 3QA0A 4RVLA 4EJNA 3BHTA 4DEHA 3VWAA 1TQIA 4PPAA 4NEUA 4GSBA 4F4PA 1G3NA 1W8CA 2R3MA 3Q9WA 4OW8A 3JVRA 5EW3A 4AW0A 1JSVA 4NWMA 3MH2A 3AC2A 3REPA 4FIJA 4XV1A 2CDZA 4WUAA 4L8MA 5GZ9A 3UG1A 4ASXA 1FVTA 4QPAA 4L45A 2C0OA 4BI0A 4F70A 3PSBA 3VN9A 3LMIA 3A2CA 1YI3A 2QQ7A 4DEBA 4EOPA 1JVPP 2R3OA 3DPKA 4PRJA 3DBDA 4QQ5A 2OGVA 4IVCA 4LUDA 1GIIA 3ODYX 5CZIA 1SZMA 5L2TA 5DA3A 5I3OA 3W33A 4FODA 3RKBA 3KVXA 5EFQA 3UE4A 4FICA 2X7FA 4IWQA 3JR1A 2QHMA 4D1ZA 3CEKA 3LJ2A 5CEQA 2OU7A 4G1WA 1JLUE 3LXPA 4EK3A 4E26A 2HY0A 2OICA 4IZYA 4V04A 2Z7QA 4AU8A 3FXZA 5AV2A 2G15A 4DEGA 4JXFA 5I9XA 2O64A 3GU6A 4IZ5A 3OWPA 4BWKA 4HCTA 1UV5A 2Q0NA 5HGIA 4ITHA 4YJSA 4XH6A 3NUUA 3PSCA 5EHYA 4Q2AA 4H3BA 4L00A 4O6LA 3JPVA 2YZAA 3NUNA 4W4XA 4H3QA 2J4ZA 2GS7A 2CNQA 2X4FA 1VZOA 3JVSA 2ZV8A 1GIJA 5L6PA 5AR3A 4BCJA 1YXUA 4F9AA 1Y8GA 2R0UA 5TF9A 5CALA 3LFAA 2UW7A 3HZTA 4TNBA 3R1QA 2JLDA 3N9XA 3OOMA 4EK6A 5TO8A 5IZFA 1FINA 4FTJA 2VO6A 1JWHA 4D2VA 4GK3A 2HZNA 5M4UA 3QTIA 4QMSA 3V6RA 4R5YA 3WARA 4BGQA 4BCQA 4I21A 2UZEA 1LR4A 4O0VA 2FSLX 4O38A 3CJGA 1YHVA 1YWVA 4F1OA 4C62A 1CKJA 1BYGA 2QC6A 2VTSA 4PNIA 4B6LA 3I6WA 3N4TA 3BIZA 2C6LA 3SRVA 1NVSA 2YJRA 3EJ1A 3ZTXA 1JKSA 3Q9XA 3WE8A 2BROA 1MRVA 4U8ZA 2YCQA 4ZZOA 3RNYA 1QPDA 2DWBA 4PL3A 3EFWA 1SVEA 3SD0A 2W5AA 3V5PA 2CSNA 3VS2A 4LMUA 5CYIA 5D9HA 3QCSA 4XEYA 1W82A 4BYIA 5I5ZA 4O2PA 4I5MA 5E1EA 4IWPA 4UXQA 3OWKA 1I44A 4C02A 5A6NA 4HVIA 4FT0A 4NFNA 3PWDA 3VUTA 4BGHA 3VULA 3FL4A 5KZIA 4FG8A 5J87A 2YDJA 3E5AA 1OM1A 3UO5A 4CMOA 3U9NA 4R1YA 3F5GA 4G3CA 2XNBA 4EZ5A 2VO7A 3EB0A 1M17A 2HZIA 3R1NA 4WHZA 3QU0A 3V3VA 4F9CA 4BZOA 2PMIA 5BMSA 5EI8A 4JX7A 4KIKB 2IZTA 1A06A 4GUEA 2PTKA 4R7BA 2ITVA 3N4UA 1BL7A 3RI1A 4S31A 1WBTA 3BQRA 4XNEA 1P2AA 3BRBA 4APCA 5E8SA 1KWPA 3CBLA 3FI2A 3OBGA 2OF4A 5E4HA 3FY2A 5JGBA 4BDHA 5DRDA 3R6XA 3KCFA 2YCSA 5FEEA 4L3PA 4EOOA 4MH7A 2UZOA 3WF8A 4J53A 2I0HA 5CX9A 3BGQA 2J0IA 4CFXA 4P4CA 3W2SA 1W83A 2VU3A 5HQ0A 2GNJA 4U40A 2E9NA 4R5SA 2X8IA 2GHLA 1R3CA 3BE2A 3ANQA 3QCXA 4BYJA 1JQHA 2ZB1A 4YJVA 3ZEWA 4PNKA 4PPBA 3DT1A 3TZ8A 3MVHA 3I4BA 4F6WA 2CCIA 3DFCB 4WSQA 4ZLOA 2G01A 3P7CA 5AUYA 3RAKA 4GT5A 4B8LA 5HVJA 4QMWA 4FTMA 5DLSA 1MRYA 2W5BA 3NIEA 3U87A 1Q8ZA 4K18A 3U6JA 3MH0A 5H2UA 5K9IA 2VX0A 4FEWA 3UQFA 5CASA 2UW8A 4F9WA 4ANSA 3GFEA 3BWJA 4AW2A 3D5VA 2UZLA 3S4QA 4DG3E 1OL1A 4O7VA 3MVLA 4J95A 5AP2A 4PF4A 2P0CA 1REKA 3P9JA 5HE1A 3UOKA 3PE1A 2IO6A 4K1BA 2ZV2A 2J9MA 4P5ZA 4MD9E 1XO2B 4YHFA 4ZIMA 3HYHA 3MS9A 3ZLWA 4FKPA 3QWKA 4QMVA 3COIA 2O65A 4NM3A 4UB7A 2WD1A 3E62A 2BFYA 5E8XA 4O7RA 3R9DA 4Z3VA 2OBJA 2YA9A 3V5LA 2VWZA 4OBQA 4N57A 5DR9A 2R64A 4YBKA 2B9JA 4FEQA 4E93A 3E7OA 1O6YA 5EW9A 3R73A 3MV5A 3ZZWA 3NVKI 3TUDA 3KU2A 5AWMA 2JFLA 3W2QA 4RJ7A 3WE4A 4ACDA 2OXYA 4C4EA 5IA4A 3UZRA 2F2UA 3TIYA 5JN2A 4IAYA 4AG8A 3QXOA 5HCZA 2GHMA 3RBWA 3N4VA 3OCSA 3LQ5A 5FD2A 1SNUA 1BKXA 4N6ZA 3WYYA 5EKNA 3R2BA 3V51A 1Y91A 3CIKA 3KREA 3NX8A 1OKZA 4QTAA 4P90A 2HZ4A 3H30A 3C0GA 4A7CA 4FV8A 5HCYA 4DGMA 3DAKA 3DAJA 1OIRA 4CLJA 1YRPA 4WKQA 2W1GA 4U6RA 2HK5A 1DAWA 3VNTA 4K0YA 3RK5A 2W06A 4FT9A 5B2LA 3U4WA 4NM5A 4PMMA 1S9IA 3ENMA 5KMNA 4FNYA 5EQYA 3H9RA 4IM3A 3D5XA 4ZSJA 2F2CB 5G6VA 2ITWA 3ALOA 4MXYA 1UNLA 2ZJWA 4IVAA 3VS1A 1XKKA 3AGLA 3LHJA 4FK3A 4S2ZA 1XH4A 2RKUA 3KCKA 4FIGA 4CG8A 4OTDA 4NCTC 3ZSHA 2ETRA 5C4KA 5HVYA 4ZJIA 3DZOA 5AA9A 2BDWA 4XG2A 3TV6A 4ALUA 2GTMA 5CF5A 2W9FB 3TG1A 2JD5A 2WEVA 4QMPA 5DEWA 3LXLA 2QOLA 3ORPA 2YISA 4BWPA 5CU0A 3SX9A 1WVXA 4H1MA 5H8BA 2BHEA 3DBFA 1JSUA 5ICPA 2VTHA 4LG4A 2YIWA 3OCTA 5ETFA 3NYOA 4E5BA 3QD2B 4MXOA 3PIXA 3C0HA 4FSTA 4UZHA 2RG5A 4U80A 2JKQA 5E1SA 4BFMA 3QBNA 3AC3A 4RIWB 3VW8A 4XLIA 5IQAA 3K5UA 5AUTA 2YM6A 3QTWA 3LJ0A 5EQPA 3IONA 3QTUA 4CQEA 2KTYA 4H39A 4S30A 3P7AA 3GCUA 4ZOGA 2UW5A 5KMMA 4LYNA 5C1QB 3WZKA 4AUAA 3R83A 3NNVA 5LVPA 4WNMA 3DLSA 2GSFA 4L7SA 2C5YA 3UOJA 2JDOA 1V1KA 2YJSA 4TXCA 3UOHA 3EWHA 2R3FA 2B9FA 3PY0A 3MIAA 3KY2A 2C5XA 3I6UA 2ITZA 3F69A 4GJ3A 2QLQA 4IZ7A 4Z55A 2GQSA 2PUPA 2GNHA 2BVAA 4XRLA 4EH3A 2BAJA 1BX6A 5M06A 5BPYA 1U59A 2OJGA 2WO6A 4O91A 4RG0A 4TZRA 4D28A 1NVQA 4E73A 2YM5A 4F7JA 2PVRA 1Y6AA 3ZBFA 5EKOA 5AR4A 2VWBA 4YO6A 4F9BA 4V05A 5J1VA 2RIOA 3SV0A 2PZRA 1BI8A 4CD0A 4EQMA 3FY0A 3EQDA 3PLAE 1GOLA 4TYHB 5B2KA 2NNWB 4EBWA 4MNFA 3PA4A 2VX1A 4JT3A 1CKIA 1OBGA 2EUFB 3EYGA 4FKOA 4FZ7A 3ALNA 5J9YA 4GG5A 3OC1A 2EB3A 3BKBA 3RPVA 4PPCA 4ZLZA 4LFIA 2H34A 4D4VA 4O0RA 3Q2MA 4CZYB 5HX8A 2JDSA 4CGAA 5JZNA 3CE3A 3CTHA 1R0EA 1CM8A 3CPCA 4K8AA 1CDKA 2JEDA 4S33A 4WNKA 3CGFA 5HCXA 3SG9A 5ANGA 2BRGA 3Q04A 3UP7A 2XM8A 3VBYA 4DFYA 3CKWA 5CT7A 2ITOA 4YJNA 3VUDA 1J3HA 3WZDA 2CGUA 2H9VA 4NU1A 5L8LA 3O8TA 4G3FA 4IAAA 5HEZA 4EJ7A 4IWDA 4DN5A 2PVLA 2JKMA 3I0QA 3I5NA 4FNWA 4IE9A 4S32A 4XP0A 4YJUA 2V55A 3FMEA 4L52A 2A4LA 4QO9A 3E7VA 1RW8A 3UIUA 2WTJA 3RM7A 4YSMA 4L9IA 5FXSA 2OJFE 2WTIA 5H8EA 4E5WA 4AFJA 4EOKA 3SC1A 5M08A 5CAOA 3LLTA 2QO2A 4C4IA 3L9PA 5F4NA 3VBWA 3QRTA 3NW5A 1CKPA 4L6QA 4AFEA 2YWVA 2PWLA 2C68A 2FB8A 2O5KA 2V7AA 3E93A 2PVYA 4G34A 4LM5A 5CEOA 3DBQA 5TOZA 4HZSA 3HEGA 4GK4A 4D2TA 4TPTA 2VGOA 3IGOA 3NUSA 4FZAB 5AR7A 4U0IA 3UP2A 3ZO2A 4D4YA 3UPZA 4M7IA 4WSYA 2QI8A 2ETMA 3FAAA 5C8MA 2HXQA 3PZEA 3PXYA 3R01A 5EM6A 1SYKA 5K0XA 4O7LA 2NP8A 3M42A 2ETKA 4GT4A 3R8MA 3UO6A 3QCYA 5LQFA 2G1TA 1R0PA 4HGEA 3V5QA 3RALA 3SDJA 4E8AA 3MH1A 5LMKA 3Q5ZA 3U54A 1MUOA 4BVUA 4AZSA 2XVDA 4NKSA 4UWYA 4KIKA 3VS5A 1KV1A 5EHLA 2BR1A 4YP8A 5HE3A 5EK7A 3RNIA 3AD6A 4LV5A 4G3EA 4CEGA 5M53A 3O8PA 3POOA 5LOHA 3MPAA 4CFVA 3H4JA 4M0ZA 4Q9ZA 2GHGA 1WZYA 3ZM4A 3O0GA 1OVEA 2PSQA 2Y6MA 3ORMA 4G3DA 5L2QA 3ET7A 3Q6UA 3ITZA 2X8EA 2XK8A 1JNKA 4O0WA 3UJGA 3Q4TA 4PDOA 3D7TB 3WIKA 3AG9A 5ETCA 4ANBA 2XK6A 1MP8A 3EKNA 3OF0A 3LFQA 2ZDTA 2QVSE 4I6HA 1V0OA 4CYIA 3UIMA 3FL5A 3DNEA 4OTWA 3LFCA 3POZA 4UXLA 3UC3A 1KE8A 3KC3A 2RFDA 4BDIA 4AT5A 2HIWA 5IQIA 2YCFA 1WBWA 3F5PA 3VF8A 2YM4A 3UQCA 2E9PA 5IA2A 2EVAA 3UVPA 1XBCA 2QR8A 3AT4A 4FV7A 4GRBA 5C01A 1KUTA 3IOPA 4JAIA 4FGRA 4ITJA 4X2GA 4CTCA 3QTZA 4ZSLA 1JAMA 1OZ1A 3M1SA 4BDFA 4BICA 1GZOA 3HP2A 3U9CA 3PG3A 4IJPA 4BCNA 2X7OA 4EWHA 2C5OA 3LFBA 5HIBA 5IUHA 4D4SA 5CAVA 2QHNA 4A9RA 1PJKA 3G6GA 3CJFA 3EKKA 4XBUA 3R8VA 4CSVA 1O6KA 5GZ8A 4QMTA 3ZLYA 5HTIA 5J1WA 5J9LA 1JSTA 2BTRA 2OZAB 3AD4A 4M66A 4OUCA 4B4LA 3KRXA 4WOVA 2BILB 3KRLA 1J1CA 3GC9A 1KV2A 4MNEB 1ZWSA 3SOCA 4LQMA 4UYNA 5JGAA 3U55A 3AC4A 4TYGA 1GIHA 4ZXTA 3R8UA 3L9LA 3PVUA 3FV8A 4DFUA 5EHOA 3GOPA 4TW9A 5IEYA 3SGCA 4ANOA 4B99A 2CKQA 5E8WA 4UBAA 2QOIA 4LRKA 3AMBA 5L8KA 3FZRA 3C5IA 2Y4IC 3VC4A 1UNHA 5GJFA 5M56A 5AAEA 4UALA 3FDNA 4BDGA 4DCAA 4NL0A 3A62A 3UOLA 3R30A 3KA0A 1UWHA 2ESMA 3BYVA 3EZVA 3KQ7A 2QOFA 4PTEA 3R7OA 4DH5A 3RAIA 2PZPA 2X39A 2ZV9A 1OL5A 4UYAA 4WNPA 5JEBA 2QU5A 4EHZA 3NYNA 4H3PA 3HLLA 3DK6A 3O8UA 4GIHA 4Y83A 3IQ7A 2PVFA 3HRBA 2JITA 4GYIA 3OT8A 2XIYA 4DT9A 5TT7A 4YJRA 3LXKA 3F66A 4CXAA 3ZRMA 3WZEA 2P2IA 4C36A 5AV4A 1NY3A 3NYVA 2UZBA 2X9FA 4ZSAA 2R3HA 4GU9A 2HCKA 4J7BA 2C1BA 3TV7A 3FYKX 4CFNA 3DGKA 4QQCA 4YZ9A 4CV9A 3BLHA 2IZSA 3DBEA 4WRSA 2I0EA 2RL5A 4MXCA 3DXQA 4W4YA 3P78A 2PVJA 2XM9A 4I24A 4RWIA 2DUVA 4X6RA 4DGOA 1YXTA 4DGNA 3LLAA 4HGSA 3VBXA 2VTRA 4NK9A 4CTBA 2C6EA 4BR3A 2EXMA 4FTAA 5C8NA 4I1ZA 3ULZA 2QG7A 3IW8A 2W0JA 4L53A 3G90X 4AT4A 3IOKA 1ZYJA 2EU9A 3KRWA 3FWQA 4FZFB 4A9YA 2JIIA 4ZTRA 1TKIA 4FV3A 4JAJA 3BHVA 4PV0A 4GYGA 5IDPA 4C33A 3Q4CA 3Q60A 4GU6A 3NZ0A 2A2AA 4OTFA 4F64A 1B39A 4X3JA 3OG7A 4KS8A 4KS7A 2Y7JA 3GGFA 5FP5A 3TJDA 2VUWA 4RIWA 3LAUA 4KWPA 1Y57A 4J96A 5IDNA 5HZNA 3G2FA 4P7EA 4RVKA 4IQ6A 3ZXTA 5EDPA 3DDPA 4IAZA 2W96B 3ZS5A 1J7LA 5HE2A 4GL9A 3D2IA 4N70A 2JC6A 3SXFA 3VUHA 4IACA 3WYXA 4FV9A 3QYZA 3PY1A 4XMOA 1QPCA 2C5VA 4ZEGA 4GW8A 4NH1A 3ETAA 3Q3BA 3W16A 2IZUA 1DI8A 5CSHA 2F7EE 5DBXA 4E3CA 4U9AA 5F95A 1WVYA 2YLEA 3FXWA 4FK6A 1U5RA 3HKOA 4RWKA 1LPUA 3R9OA 4BRXA 4CYJA 1ZAOA 3HA8A 3VHEA 4DBXA 4ZMFA 2CNVA 2PK9A 2W4OA 5HO8A 4CMUA 1ZY4A 4PMPA 3L9NA 4N0SA 1GZKA 3D5UA 1G5SA 4TRLA 3HV6A 4AZTA 3MDYA 5CY3A 4CZUA 3QTSA 4W4WA 3ZUVA 5H9BA 3QL8A 4KBCA 2XB7A 3OVVA 4Y5QA 3PYYA 3BYUA 2BPMA 5HG9A 2IVTA 3COHA 2G2HA 2P4IA 4HYSA 3FSKA 3QQLA 4TYHA 4BI1A 3DFAA 2UW4A 1H1QA 3R7IA 3PG1A 3FKOA 3HRFA 2XNPA 3LJ1A 4MX9A 4DCEA 4TWCA 4L01A 5AX3A 5ITAA 2OJ9A 4C35A 4QMNA 1TQPA 4CFUA 2PVKA 5A3XA 2YWPA 4Z7HA 4TTHB 3GCQA 3ACKA 3TNQB 4NT4A 1OUYA 1GNGA 3FXXA 4A07A 1XH9A 5DT3A 5J79A 3D5WA 3QZGA 5KO1A 2PUIA 4LV8A 3LIJA 3BHUA 3EIDA 4RA5A 1YWRA 1Z9XA 4MEDA 3G33A 2VWYA 2F4JA 3MPMA 2PY3A 3DKCA 1YHSA 3F6XA 2GMXA 4IAFA 3DXPA 5J5TA 1YXSA 2YDKA 3JS2A 5E90A 4TL0A 5BX0A 3RK7A 3E8EA 2UVXA 2YN8A 3L8PA 5EG3A 5TR6A 3T8OA 2O63A 2UZVA 4AE9A 2EXEA 2C6TA 5HVKA 4XG8A 2FA2A 2R5TA 2W99B 5LCJA 2OLCA 4DC2A 2QOCA 2C6OA 4FA2A 4UMTA 4C2WA 5D10A 4CCBA 2WTDA 4YURA 4NM7A 3QTRA 5K3YA 4C37A 4IVBA 4RIXB 5CLPA 1WBSA 2ITPA 2WQOA 3GU5A 3DV3A 5CAPA 2V5QA 3M2WA 3QRUA 4RFYA 5D7VA 4FZDB 4BIDA 3Q4UA 5HTBA 5HICA 3UC4A 3EHAA 2GNIA 2OJIA 3EFLA 5D12A 4FSZA 1W84A 5D41A 3EQPA 4LGHA 2QOKA 1VYZA 2UV2A 3CQUA 4NUSA 3RHXA 4YUQA 5ACKA 2VWVA 3PWYA 5HTCA 2YDIA 2YM3A 1APME 5ANKA 3VQHA 5E7RA 3QZHA 2BKZA 3KF4A 3ORKA 1H4LA 2XRWA 4RSSA 4TKSA 1U54B 5LWMA 2J50A 4YLJA 3TKIA 3VUMA 5GINE 4IWOA 2XNGA 4D9TA 3DTWA 4J8MA 2CN8A 5HLPA 4O7WA 4O81A 5HD7A 3M11A 3OWJA 4EQCA 3NWWA 1REJA 4W9WA 2XEYA 3B8QA 3ZFMA 4CKIA 5JK3A 3NSZA 4NW5A 4DHFA 1PXNA 2WELA 5I9YA 3HX4A 4K11A 5KMIA 4EI4A 4Y85A 3VS0A 4FYNA 3AC5A 4QQJA 5HU9A 1PXOA 1RQQA 2VO0A 2DQ7X 3E8DA 4DG0E 4FIIA 2VTIA 1GY3A 1H25A 5AUVA 1ZOGA 4G5JA 3E87A 4TN6A 4O83A 5AIRA 1Q62A 2A19B 3GVUA 2X2KA 3EQFA 3FLYA 4M15A 4HVDA 2OH4A 5CEMA 3D7TA 5IUGA 4A4LA 5CQWA 1T45A 1FMKA 3HMNA 1H1SA 4GFOA 4JJRA 3BEGA 4RGJA 4W8DA 2OH0E 3R8LA 1YOLA 3NNXA 5KHWA 2OSCA 2UW9A 3QRKA 4CT2A 2J0JA 2BZIB 3LM0A 4MWIA 4RLLA 4B0GA 4Z7GA 3PPKA 4AW5A 3NNUA 4BCFA 1HOWA 3PXFA 1YQJA 4GKHA 4IH8A 4QP4A 2Z7LA 4TYIA 4H05A 1UU9A 5A54A 3PRFA 1Q3WA 3BLQA 2YM8A 1ZLTA 1KE5A 3QX2A 3GCVA 3GI3A 3IDCA 5A4CA 1OMWA 1OB3A 3BZ3A 4IX4A 3BEAA 1IEPA 3BELA 3FZSA 4EBVA 4KUJA 1WFCA 4GV1A 3CC6A 4MBIA 4O7SA 3GP0A 1X8BA 5EDQA 1WBPA 3VJNA 3ZFYA 1OIQA 4YHJA 4G6LA 4L43A 3TKHA 3PPJA 5DT0A 5FBNC 5FXQA 4BTMA 5KBQA 3FI8A 1UU3A 4RVMA 2OZAA 4ERWA 3ODZX 4I92A 3ORXA 3R9HA 4FGBA 3WZJA 5JH6A 3Q9YA 4MNEA 4XP3A 3DS6A 2V0DA 1H00A 3G51A 3AMAA 3BGZA 4IBMA 4R6VA 5AP4A 4TNDA 4O84A 3HV7A 3TDWA 4YTCA 4R3RA 2PHKA 3G0FA 4WT6A 2HENA 4U97A 5B7VA 4AQCA 2WTKB 4LOOA 2ONLA 2WIPA 5CXZA 5IUIA 4R1VA 1CSNA 2O8YA 5A4LA 1ZXEA 4C3FA 4E5AX 1Y8YA 1FVRA 3FMLA 3GBZA 4PY1A 5CU3A 2UW6A 2WTCA 4MVFA 1KE6A 4BWXA 4UWBA 4BDKA 3BU6A 3UO4A 3FPMA 4IC7A 3CQWA 4YZCA 4O22A 4YZMA 2OJJA 2WQEA 4YJPA 3ROYA 4WD5A 1IAHA 4YTFA 4BTFA 5LVNA 1PY5A 2R2PA 5D1JA 1M2QA 2SRCA 4CKRA 1TVOA 4AAAA 2XCKA 4I4FA 5E8ZA 4I3ZA 1AD5A 2WZJA 3OY3A 5JFVA 2VTPA 4KBKA 2O3PA 5HIDA 1DM2A 3DA6A 2HYYA 4V0GA 2A27A 3UGCA 5HI2A 2BTSA 2YEXA 4IADA 5AR5A 3JY9A 4RQVA 4JQ7A 4XG4A 3Q4ZA 2F57A 5IQFA 2WEIA 3OROA 4C4FA 3FQEA 5DIAA 2GQRA 3ZOSA 1Q8WA 1U46A 4IB5A 3AT2A 2YIYA 3EFKA 3L8SA 4ZLYA 1E1VA 3ZEPA 3TJCA 4PDSA 5AJQA 4NW6A 3VRZA 3EN5A 4DBNA 4HW7A 4U41A 4ACMA 3R7UA 4FIHA 4I0RA 2Z60A 3G0EA 4O96A 2XKDA 1ZMUA 2AYPA 2Y8OA 4M3QA 5M51A 1IG1A 4ZJVA 2FGIA 1PYEA 4I6BA 1FMOE 4X2KA 3RJCA 2LGCA 5T68A 3E63A 4CRLA 4EUTA 2IVUA 4UY9A 2W1EA 2WU6A 2C47A 2P55A 2X9EA 3BGPA 3RINA 5HBEA 1ZARA 2YIXA 3OP5A 2X6EA 4QMMA 3ORTA 1Q99A 3P5KA 3UNKA 4GFGA 1JKLA 2ITYA 4OBPA 4AA0A 4JG7A 4ANMA 3CY3A 4E4XA 2ITNA 1SMHA 4BKZA 4JI9A 5IU2A 4C3PA 4YU2A 3EN4A 2VTMA 5J8IA 5HORA 3S1HA 2EXCX 2VZ6A 2WMBA 5CZHA 3OS3A 4BIBA 3F5XA 2WNTA 3L1SA 3WI6A 5K0KA 4QQTA 2B9HA 2J2IB 4XOYA 3QD3A 2J7TA 3QCQA 4ERKA 5DE2A 5M07A 3DQWA 2CHLA 3QQFA 4IJ9A 4EHVA 5JZJA 2FUMA 3I5ZA 2VNYA 3F3VA 3LFFA 5IA0A 2W9ZB 3SW4A 5JGDA 2YFXA 5D7AA 4RVTA 3HDNA 3P1AA 4RT7A 4QP1A 4R8QA 2JAVA 1LEWA 4AE6A 1CMKE 4E1ZA 1HCKA 4J52A 2OW3A 2YM7A 4O1OA 4XG6A 3RTPA 3R02A 4GEOA 3FMJA 4MQ1A 3ZZEA 1FVVA 5KMKA 4MTAA 2GNFA 4MXAA 4Y5HA 4MBJA 4QMQA 3KXHA 1PXKA 1U5QA 4FV0A 5CU4A 4FG9A 3VBQA 4JOAA 3KN6A 4C4JA 4EUUA 1ZYCA 4KSQA 3ROCA 2C3KA 4DF3A 2BZJA 3S0OA 2BKKA 2GU8A 5FDXA 2YIRA 3W2PA 2GQGA 3K3JA 4NJ3A 2XYUA 2UUEA 4DA5A 3TACA 3ZO3A 2ZM3A 3DQXA 5I4NA 5I3RA 4FV2A 5E8VA 2W1IA 4QP7A 1QCFA 3NYXA 3H0ZA 4NYEA 3BU5A 4ANNA 3H10A 2XNOA 2VWIA 5HG7A 2A0CX 4AGUA 4OTHA 5E9EA 2GFSA 2R3IA 3I7BA 1H01A 3FKNA 3O50A 5F20A 4HVSA 4JRNA 5KMJA 4XS2A 3ZSIA 3D0EA 4LUEA 1OECA 2QURA 2JIUA 4E6CA 5IMXA 3PIZA 1ZOHA 3QRJA 4FV1A 4FC0A 3TI1A 3G9LX 4I0TA 4GUBA 3EQRA 4JRVA 4ZTQA 5IH5A 1UKIA 5K4IA 4QTCA 4AN2A 2NRUA 4BDBA 3CKXA 5DT4A 3A60A 3L9MA 5A9UA 3QXPA 3R9NA 5EDRA 2VTJA 3K3IA 3FBVA 1JOWB 4JQEA 4IVDA 5AM6A 5AV1A 3C1XA 3TCPA 4NZWB 1ZZ2A 5FQDC 4QYHA 1YXVA 4WG3A 3TT0A 3ZHPC 2PPQA 5IQEA 3CTQA 3P4KA 3PP1A 4WNOA 3TNIA 3CD8A 4H58A 3OTUA 4ASEA 3EQBA 3A8WA 2W4KA 3LFNA 4RIXA 4BTKA 4QMLA 5AV0A 4O0SA 1V0BA 4GMYA 3ZYAA 3RPSA 2HW7A 4UV0A 4FSYA 3PXQA 5GJGA 2Z2WA 4DFNA 4JBQA 4YLKA 2OI4X 4CCUA 4X6QC 1XBAA 2X8DA 3MN3A 4AN3A 3GU4A 3QFVA 3U4UA 4EK5A 1A9UA 5L2IA 2OFVA 3IW4A 3JUHA 5KUPA 2XNMA 4FKGA 4N4SA 1IRKA 2F7ZE 2OZOA 4Y95A 4X3FC 3WBLA 4DH3A 3HV5A 1W98A 4NIFA 5E8UA 1VJYA 2IJMA 4KRDA 5AAFA 2WU7A 3NUYA 1U54A 3KULB 3PFQA 1L8TA 3CPBA 1PMNA 3O96A 4O86A 1PW2A 4UWCA 2C6MA 2XMYA 3H9FA 3O2MA 3C50A 4IX5A 4RC3A 3HMPA 2YAAA 2BIKB 4HVGA 5CF6A 3S00A 4BIEA 4K2RA 4O0XA 4ACCA 3QKMA 2BIYA 4DFZE 3ZC5A 5J7BA 4DINA 4KRCA 2V62A 4DGLC 4I20A 3OD6X 3SHEA 3D2KA 3MFRA 5EI6A 3FLNC 5CS6A 3CR0A 4FSQA 4FTOA 2WQMA 3ZO1A 2WB8A 3QF9A 2B7AA 4FTNA 3IG7A 4ALWA 4CVAA 2R3RA 5L3AA 3VUGA 3PXRA 1OL6A 3PRIA 4FMQA 5FTQA 3PDTA 4QYYA 3TKUA 3W2RA 3H9OA 2XEZA 4U7ZA 2O0UA 3P79A 4GVAA 4IW0A 5EOLA 4D2RA 3MVMA 5CEKA 3TL8A 2WMRA 4E6AA 3IPHA 4XP2A 5M4IA 2IW8A 3UBDA 3QUDA 4WG5A 4FTCA 5J9ZA 4HGTA 4FT3A 4GT3A 4KKEA 3EQGA 4L67A 5M09A 5CI6A 3SA0A 2RF9A 3D9VA 3VBVA 2XUUA 5KMOA 4MWHA 4E4MA 3PPZA 4BCGA 1FOTA 3UG2A 3ORIA 2IW6A 3O7LB 3ELJA 2QO9A 5E8YA 1YWNA 3W2CA 4Y8DA 4H36A 3VS3A 4ACHA 2R3JA 2OIDA 2XZSA 4JDKA 4OTPA 3OFMA 3DK7A 4JG6A 4OTRA 4DFXE 4JVGA 2PMOX 3OUNB 4F08A 4OTQA 3Q9ZA 4C7TA 3EL7A 3VBTA 5AP6A 4A9SA 4FEXA 4LMNA 4DEEA 2UW3A 4IB0A 1W0XC 1Q8YA 3BV3A 3BHHA 3UVRA 1B38A 5HG5A 1PMEA 1ZYDA 2BMCA 4HNIA 4C34A 4LRMA 1WVWA 5EOBA 2WQBA 5B0XA 4D4RA 5JKGA 1P4OA 4DGGA 4ZTHA 4JDIA 4YTHA 1H27A 1IASA 4IIRA 4PUZA 4BI2A 4HPTE 5DH3A 1O6LA 3C7QA 4BC6A 4D1XA 3R1SA 5DN3A 2LAVA 3PJ8A 4RJ4A 4RMZA 3TUCA 3HA6A 2UZTA 4I6FA 2P33A 2QD9A 4EH8A 1XR1A 2PZIA 3VQUA 1Q97A 1Z5MA 1NVRA 4DLJA 5LMBA 3QGYA 4O7ZA 3BQCA 5EYMA 4X0MA 3TN8A 5FXRA 5BMMA 3B8RA 2Q83A 2C3JA 3WILA 1XH8A 4O7TA 4OTIA 4EH7A 3T3UA 4QYFA 3ULIA 2XK4A 3I1AA 4TWOA 3O23A 3GQIA 2I0VA 4ASDA 2ERKA 3EH9A 1R1WA 3EQIA 3GNIB 4M69B 4MKCA 4NCTA 5EM8A 4APPA 5BVNA 3NS9A 4FG7A 3QQGA 3NLBA 4G5PA 2QOBA 3DNDA 1WMKA 4RFZA 4RJ8A 5ANIA 3ZONA 3F7WA 4O0UA 4M0YA 4MF1A 5L4QA 5GZAA 4HYUA 1JKKA 3QGWA 2BCJA 4XV3A 5DG5A 4EH2A 4DE4A 3MJ2A 4QTEA 2X2MA 2WTWA 1M7QA 1URCA 3RK9A 4C8BA 4ZMEA 4KIQA 3ACJA 4QP2A 4XV2A 4F63A 3GEQA 3KL8A 1A48A 3FZOA 4QP8A 1KE9A 2Q0BA 2XF0A 5AUXA 4YC3A 3VUKA 1KE7A 4CNHA 5JFXA 4AW1A 2RFNA 4YC8A 4I23A 4YC6A 4J1RA 1PMVA 3Q52A 2B4SB 4CT1A 4U45A 2G2IA 2QOOA 3IGGA 4Y46A 3R7VA 3TV4A 3C51A 3ZXZA 3LFDA 3N51A 2XKCA 4JR3A 5HX6A 4OAVB 3MSSA 4AZFA 5BYZA 4FTUA 1SNXA 3E3BX 5BYYA 2I0YA 1ERKA 5DR2A 3MVJA 4QRCA 3DB8A 2VTOA 3FUPA 4HNFA 5I9WA 3F3WA 4NTTA 4OLIA 5FP6A 4ZY5A 3P7BA 4ORKA 3R63A 5CNOA 3LQ3A 4L3LA 4OR5A 2ZB0A 1BMKA 3R21A 2YZLA 4BDDA 1DI9A 1Q24A 3CGOA 3FYJX 3OT3A 4H1JA 2C6KA 2FYSA 4ONAA 1XH6A 3V6SA 3PJ2A 2W7XA 4DFLA 4I5PA 4KABA 3GCPA 2Y6OA 2YAKA 3C4XA 1G8AA 4AXAA 4GKIA 4EYJA 3A7HA 4C38A 4D2PA 2W5HA 1PKGA 5DRBA 4IANA 3DB6A 2XH5A 4FVQA 3V04A 4NFMA 3COKA 3R28A 5CANA 5HKMA 3SAYA 4J99A 2VX3A 3QHWA 4EKKA 4CLIA 1YHWA 2BDFA 2H6DA 3P86A 3QWJA 4ENXA 1Q8TA 4V0GB 4E7WA 3C13A 2GNGA 3FJQE 3LCTA 4AGWA 2ZVAA 2X81A 3O51A 4EYMA 1URWA 3GC0A 4D58A 5M4FA 2BRBA 3VS7A 3ZSGA 3KMMA 2WXVA 2BHHA 3A7FA 5JFWA 3DJ5A 4LI5A 3PE2A 3MPTA 3QTQA 4OT5A 1S9JA 4D5HA 4A4OA 4FKTA 4FTTA 5DGZA 3NAXA 3OHTA 3P0MA 3DCVA 3ERKA 3FMHA 1H08A 3FZ1A 1PXLA 2F7XE 3LW0A 3UDBA 5BNJA 3F2NA 4U81A 4L42A 3O71A 1ND4A 3RWQA 3V5TA 1JPAA 1IAJA 4KAOA 3BBWA 1ZYSA 3QQHA 3QUPA 1J7UA 4R77A 4IM2A 3K54A 4XUFA 5IH4A 4B7TA 4B8MA 1J7IA 2I7QA 4O21A 5LVLA 2FH9A 3R8ZA 3CY2A 3DZQA 2W17A 4I5CA 4CRSA 1H07A 2BAQA 4XOZA 2VTTA 3IW6A 5HLNA 3V8TA 4ZY6A 4PTGA 2HWOA 4M67A 3DAEA 2XRUA 5CU6A 1BLXA 3BWFA 3W1FA 4BHZA 1IA8A 2OF2A 5H3QA 4I0SA 5LARA 3MI9A 4RWLA 2VN9A 4UZDA 5FM2A 2X7GA 4AGCA 2JBOA 2WFYA 3HV3A 5IISA 3LKMA 2B52A 3GCSA 2XCHA 2QOQA 2CGWA 2HOGA 3MY5A 5KCVA 1VR2A 5KHXA 5GIPE 1IR3A 1OITA 1FGKA 3D15A 4ZS0A 2C69A 2XIRA 4HZRA 4ZZNA 3DLZA 3PVGA 4FKVA 5AIKA 3OY1A 4RRVA 4C58A 3OTVA 5FLFA 3UMWA 4BCPA 4RZWA 2OIQA 4F1MA 3MW1A 2JDVA 5ANEA 4RPVA 3U6HA 2GCDA 3MTFA 3RVGA 3C9WA 2XKEA 3NW7A 4LGDA 5AP3A 3ZLXA 3LFSA 2R3KA 4I41A 1H1WA 2J5FA 5AMNA 4FVRA 3KULA 4KBAA 2R3NA 1YDTE 3C4EA 5CSPA 4LOPA 4QYGA 3TDVA 2CLQA 4JQ8A 5AP5A 4FEUA 3G6HA 3QLFA 3JYAA 3OOGA 4X7QA 5FEDA 4AF3A 2AUHA 3FI4A 3R8PA 3LZBA 2PUUA 4W9XA 4DH1A 2WKMA 4FV4A 1FPUA 2XYNA
chains in the Genus database with same CATH superfamily
4BCOA 2OWBA 5IA3A 4AZEA 4YTIA 2Z7RA 3HL7A 2GS6A 5EH0A 3ORLA 2B55A 3FE3A 5T3QA 3SKCA 4CFWA 5FDPA 3BL7A 4PDPA 3W55A 2ONLC 3DU8A 4FIFA 5BVFA 3UIBA 3OXZA 5HNIX 5CXHA 3GU7A 4HJOA 4OAUC 2PULA 3LQ8A 3BE9A 1OBDA 3OEFX 1WAKA 4Z9LA 5HLWA 4J71A 3UIXA 1K2PA 4BBFA 4G9CA 4R7HA 4A06A 4EK8A 4XG7A 3EFJA 3HUCA 3WF9A 4QPSA 4ZTMA 1XMLA 3WOWA 4FV6A 4GVJA 2RGPA 1OI9A 3OUKA 3V8WA 4YJTA 1K9AA 2PMNX 4G31A 4M13A 1OGYA 3A7JA 3SG8A 1WBVA 3UNZA 4ZSGA 1F5QA 5K5NA 2HY81 4DEAA 1UNGA 4RC4A 1QL6A 2X0GA 2XBJA 4K33A 1YOMA 4ZK5A 2WHBA 3ZRLA 4YNEA 3PP0A 4UEUA 5H8GA 3C0IA 3ZUTA 3RMFA 4JNWA 1Q3DA 2VRXA 1XH5A 3DKFA 3RGFA 4WRGA 3QKLA 2W1FA 3FSFA 3GQLA 4IHPA 2H8HA 3FLSA 4M14A 3EZRA 4DTBA 5BUJA 1OL7A 2PVMA 4NIFB 3DDQA 2NO3A 3PY3A 3WIGA 3BYOA 4FV5A 4EQUA 1K3AA 3MFSA 3OCBA 3DBCA 3ORZA 4L44A 5HNGA 1U4DA 4RJ6A 3FLQA 1UA2A 5M57A 3MTLA 3UZTA 2XIKA 1ZMVA 3NR9A 2J5EA 4WO5A 4FOBA 3AKKA 4JBPA 3F82A 3GU8A 5M44A 2XK7A 2OXXA 4QEBA 3BYSA 5KKRC 4EOLA 4D0WA 3GENA 4FKLA 3SXSA 3UDZA 3GT8A 2BDJA 3AD5A 4BDEA 4C57A 4BJJA 4F0FA 3LCDA 4M69A 3ZH8A 4G2FA 5CAUA 4W4VA 3KXGA 4PWNA 4DEIA 2UZDA 5AADA 4GS6A 4MYGA 3FLWA 2YABA 4C0TA 4L46A 3NMUF 3W8QA 3R7EA 1R39A 3LFEA 3QHRA 2YCRA 3LCOA 5M55A 4FUXA 4XV9A 5F1ZA 2XK3A 4MQ2A 4O1PA 2UZUE 4QOXA 4V01A 4F7LA 2QONA 3MGYA 4FKSA 3QTXA 4RLKA 4I93A 4AT3A 4Q9SA 4EH6A 1H0WA 3RCJA 4BZDA 3HDMA 4D5KA 4RIOA 4U79A 5LMAA 1F0QA 1H28A 5CSVA 3HP5A 1KSWA 2XBAA 4O27B 3AMYA 3FC2A 3LPBA 2WMXA 3L8XA 4YMJA 5IG1A 4YGAA 4BZNA 1YVJA 5BVWA 2C6DA 3DTCA 3GC7A 3KXNA 1OKWA 4QPMA 3E8CA 1OPJA 1XHAA 3CXWA 1P4FA 1UU8A 3OXIA 4QMZA 5FEQA 5KBRA 2IF8A 3TEIA 4MBLA 5T6KA 2W1HA 3CP9A 4ID7A 3QC9A 3ORNA 4FX3A 3II5A 2VO3A 4Z16A 2CJMA 3AXWA 4E4LA 2WMWA 5CEPA 1P5EA 5KMLA 2CKOA 2CLXA 3QQJA 4PTCA 3I7CA 5GIOE 2DYLA 2JDRA 3VF9A 4ZY4A 5I9VA 5L6OA 2ZFYA 3OW4A 3D94A 3PJ3A 3CLYA 3KEXA 2ZYBA 3QALE 5JT2A 3EN6A 2Y9QA 4E4NA 3MIYA 3A8XA 1E1XA 3MFTA 4NM0A 5JQ5A 2XALA 5I9ZA 4DAWA 2XJ2A 4FYOA 2FSMX 4HYHA 2B1PA 2BFXA 5CWZA 4BDCA 4G16A 4G3GA 4YLLA 2OO8X 2E2BA 2NPQA 4YJQA 3RHKA 3CS9A 5B2MA 2J90A 3RPRA 1G8SA 2PE2A 2I1MA 3NNWA 5TE0A 3DJ6A 2ACXA 1MQBA 4TYJA 4KSPA 3NEWA 3V5WA 4IDTA 3VS4A 4RJ3A 3CCNA 5CSXA 5HBHA 2WMQA 5CT0A 1OPLA 2X4ZA 5ANDA 1LUFA 1O9UA 3TWJA 3FMKA 2IZRA 4KKGA 5IPJA 3BX5A 4FIEA 4JLCA 4KIPA 3HNGA 4J8NA 4AA5A 4QP9A 1OKVA 3A99A 4DH8A 2C5NA 3U51A 4DH7A 5JRQA 1M52A 3B2WA 5CSWA 1MQ4A 2Z7SA 4GG7A 3T9TA 3W0QA 4JS8A 5K5XA 3AC1A 3MBLA 2HAKA 3E92A 4DYMA 2O2UA 4O4BB 4FNZA 5IKWA 3WF5A 4CV8A 4RQKA 4LL0A 3W10A 3E64A 3T9IA 5AV3A 5BUEA 4DDGA 4EORA 3QC4A 2HXLA 3TIZA 4EL9A 3RZFA 2C0TA 3LE6A 2W1CA 2QU6A 3TZMA 1QMZA 3I81A 3IKAA 1PMUA 4TT7A 2C1AA 3BYMA 4FSUA 3S3IA 3S95A 4CFMA 3IK3A 2ZOQA 1PXJA 1P14A 5CEIA 4FKIA 4FKUA 2OK1A 4QP6A 4RX5A 2B53A 3HGKA 5DI1A 1NXKA 5LCKA 1OGUA 2XIXA 4JDHA 4KB8A 3ATTA 2ITTA 1ZRZA 1XH7A 4BBMA 4C3RA 1GZ8A 5CQUA 4X2JA 4QNAA 1H1RA 4Y73A 3K2LA 5J95A 3U6IA 3MESA 5AUZA 3QLGA 2GS2A 4QMUA 2HELA 3E3PA 4X3FB 3VJOA 2W4JA 3FC1X 4XLVA 2CKEA 4ANLA 4EHGA 4I4EA 1XWSA 4PP7A 2A1AB 3KB7A 1OIUA 3R7YA 3C4WA 3GB2A 4IXPA 4XBRA 2YHVA 3C5UA 3V5JA 3F3UA 4Y72A 4KIOA 1GAGA 3F9NA 5DMZA 4XHKB 1Y6BA 3CQEA 3DOGA 3AOXA 4D0XA 1ST4A 4EWQA 3KK8A 2RG6A 4E6DA 1Q4LA 3PZHA 4RFMA 4YJOA 3W2OA 4M97A 3OXTA 4EOJA 2VTNA 5EYKA 4ZJJA 3IW7A 3OBJA 4BB4A 3FI3A 4FSWA 3G5DA 3GC8A 4R3CA 3PUPA 2E9VA 2YITA 4FKQA 2RFSA 3DKGA 2QO7A 3KN5A 4IAKA 4FF8A 1B6CB 2ITUA 4J97A 2XARA 3MH3A 4LL5A 4F09A 5AA8A 1H1PA 4FUYA 4O7NA 5CNNA 2BALA 2QR7A 3AT3A 5C26A 4BCIA 1JBPE 3QZFA 4AX8A 5LVMA 1ZOEA 4NTSA 2UVYA 3NUXA 3NCGA 4R78A 2XK9A 4USEA 2CMWA 4MAOA 4IZAA 4FNXA 4OTGA 5FTOA 5HESA 3R1YA 4EZ3A 4BCHA 1AGWA 4I5HA 5JRSA 3NW6A 1ZZLA 4IX3A 3UNJA 2WIHA 2YERA 4HCUA 4FSMA 4N6YA 4JL9A 2P3GX 3HMMA 4YHTA 5DR6A 5HE0A 5IMEA 5J5SA 4AA4A 5JFSA 1OIYA 3ZU7A 2VWUA 4X2NA 1YKRA 3MA3A 2PU8A 1Q5KA 4D1SA 3DY7A 1YXXA 2JGZA 2PZYA 3LCSA 3A7IA 2Z8CA 3I0OA 5HO6A 4ZAUA 3OZ6A 2PE0A 3FHIA 3KF7A 2WTKC 3MA6A 4DLIA 5AUUA 3RP9A 2BZKB 3G15A 4C59A 3O17A 3UMXA 3UTOA 3PA3A 2C30A 3A4PA 4XCUA 5GNKA 2XS0A 3PLSA 2QKRA 3DJ7A 2EB2A 3P5JC 4LGGA 4TWNA 5EM7A 2V7OA 4FBXA 5CI7A 4BF2A 5LMKC 2VTLA 4GIIA 4WA9A 4ZS4A 2OG8A 4FZ6A 4KA3A 3R71A 1Q8UA 3PXZA 2J0LA 3E8NA 4JBVA 2QOHA 5C9CA 2E9OA 3MB6A 3LMHA 3PSDA 3AQVA 1F3MC 3KK9A 4KNBA 3C4ZA 2FVDA 3K5VA 4YPDA 4FOCA 3FMNA 4EC8A 2CGXA 2CNUA 1YW2A 2GTNA 1NT2A 1TQMA 2J6MA 3GUBA 4E20A 2VNWA 3CD3A 3Q6WA 4W8EA 1RE8A 4QDVA 2UVZA 2ZM1A 3BHYA 3QQKA 2OXDA 3HUBA 5KZ0A 2HW6A 4IFGA 2JKOA 2E9UA 2PYWA 1PRYA 1YOJA 5FGKA 3FQSA 1WCCA 2UW0A 1FGIA 3O7LD 4CKJA 5M4CA 3RWPA 4P2KA 2VWXA 2BRNA 4HCVA 3MY0A 5D11A 4UMQA 4AXCA 2C4GA 3IECA 3LM5A 3I60A 3ZDIA 4PQNA 5IEVA 3TNHA 4QT1A 4NJDA 5AX9A 5IA1A 3RAHA 3KFAA 5HO7A 3G9NA 2REIA 1PXPA 2WQNA 3EN7A 4A4XA 1IA9A 1HCLA 4CG9A 1PKDA 3R22A 5C8KA 4A9UA 4ZTNA 3ANRA 3ZMMA 1M2PA 1UVRA 4BN1A 2Y4PA 4QNYA 5L2WA 3F7ZA 1Q41A 1ZMWA 4FSNA 3ZUUA 2PVNA 4KINA 4WIHA 5IA5A 2AQXA 4U3YA 5DFPA 2AC5A 4M12A 2DS1A 2VAGA 5CTPA 5C03A 3VRYA 3DKOA 3Q53A 4FI1A 4AWIA 5ETAA 5AUWA 4GH2A 4USFA 2CCHA 4JG8A 3KXXA 4QMYA 3EMGA 4EOIA 1L3RE 4HPUE 5A14A 3R0TA 4IDVA 4DG2E 2WTVA 4L68A 4FKWA 1STCE 4MD8E 5CU2A 3TTJA 4RC2A 4M68A 5GJDA 3VO3A 3QAME 5DWRA 3UPXA 4FL2A 4P5QA 4UMRA 4O0YA 1ATPE 5CAQA 3KMWA 4IFCA 4X2FA 1JKTA 5LVOA 1H0VA 2WMSA 5AAGA 2VGPA 4FTRA 2PMLX 2NRYA 1I09A 3MWUA 4TYEA 4G6OA 5L6WL 4EONA 4RIYB 3LCKA 4DITA 5BQ0A 3SQQA 5HU3A 4MHAA 3D83A 2ZAZA 3NGAA 4YPSA 5HD4A 2BZHB 4FTKA 2I40A 4IM0A 4BHNA 5IQHA 5FG8A 1Q61A 2WMUA 2ERZE 4BBEA 3QA8A 2ITQA 1W2DA 3Q5IA 4QTDA 3COMA 3UYTA 1M14A 5IEXA 4QMOA 5IQBA 2FSOX 5LWNA 3F5UA 4JX3A 3ATSA 3UDTA 2Y4IB 3KGAA 1LP4A 3NVMB 3F61A 3H0YA 3HMOA 4USDA 3BPRA 4D9UA 3TNPC 2ZV7A 3KMUA 5AR2A 4F9YA 3TNWA 4AQKA 3RPOA 1XQZA 4DEDA 4TY1A 1Z57A 4IB3A 3TM0A 1SM2A 3KXZA 1J1BA 4GCJA 3QQUA 3RCDA 2HZ0A 2PE1A 4PL5A 5A4QA 3IW5A 2BUJA 2BRHA 3ZRKA 1E9HA 3W32A 2OKRA 3WZUA 4JIKA 3KRRA 4AS0A 2VTAA 5BVDA 2XA4A 4FT7A 4GFMA 4WG4A 5EW8A 3F88A 2C6IA 4RX7A 3UVQA 3ZBXA 5IQCA 4UMPA 5HBJA 3BV2A 5AR8A 4M84A 3ZO4A 3SVVA 4OT6A 5LXMA 4OGRA 1PXIA 4G17A 3HAMA 3IDPA 4AACA 5KX8A 4RZVA 5JMSA 4IMYA 3EL8A 5HHWA 3PIYA 3VW6A 5K4JA 2RFEA 3JY0A 5EM5A 2WGJA 3GXLA 4FKRA 4I94A 4BTJA 1XBBA 3MYGA 3PA5A 4DTAA 5DEYA 3TZ7A 4MXZA 2W1DA 2CGVA 4BDAA 3UZPA 4BY9E 3SOAA 4AOJA 5BVOA 2P2HA 3L8VA 1MRUA 4RJ5A 1RJBA 5BVEA 1H8FA 2JIVA 2VWWA 3PVBA 4IX6A 2X2LA 2H96A 4RA4A 4EH5A 4QTBA 4U42A 4EOSA 1H24A 5CENA 4EKLA 3W18A 3BL9A 4FEVA 5AFVA 3NIZA 3HV4A 2YACA 3RAWA 4BGGA 1T46A 2QNJA 3NRMA 2J0KA 4PMSA 3P08A 1H26A 2JAMA 4ASZA 2C3LA 4L3JA 3TXOA 5CF4A 3LVPA 3PVWA 4F0IA 5JSMA 1UKHA 2ZDUA 5KNJA 2WOTA 1V0PA 2QODA 4GK2A 1LEZA 2XP2A 4I22A 5TKDA 2QKWB 3BI6A 4AOIA 5KKRB 5BYLA 2KULA 3SW7A 5GHVA 2GPHA 2XJ1A 1OKYA 3IDBA 4G9RA 2XKFA 3VHKA 2R4BA 1PYXA 2G2FA 2IVSA 5E8TA 3HECA 2QCSA 4EH9A 2R7BA 3OW3A 4F7NA 4ZP5A 3V8SA 4FTLA 4PP9A 4U3ZA 3MFUA 2C3IB 3QYWA 5F94A 2JBPA 4O6EA 5KE0A 2PVHA 3UYSA 4YZBA 2IVVA 3WF7A 4EH4A 2OFUA 4EZ7A 1J91A 2BRMA 4PX6A 5I0BA 4O2ZA 2FSTX 4FT5A 2PUNA 3FZPA 3V01A 2C0IA 3TUBA 3JXWA 4K6ZA 1SVGA 5HOAA 3QUEA 4UMUA 4ZTLA 4AN9A 5FRIA 3LMGA 4O0TA 4LOQA 1BUHA 4R7IA 2R7IA 1SVHA 2QG5A 3GOKA 4IEBA 4X3FA 2FO0A 5HNBA 1OPKA 4F7SA 1ZY5A 4C4HA 4K77A 5DOSA 1UU7A 4AOTA 4HVHA 5A4EA 5ANOA 5LJJA 5C27A 4BL1A 2QLUA 5EQEA 3MB7A 1OUKA 3TMOA 3SRVB 4AP7A 3DK3A 5ANJA 2Y0AA 4XJ0A 3C4FA 2J51A 4WUNA 4NSTA 3QZIA 2WMVA 3BBTB 3BLRA 4IC8A 2IWIA 2BAKA 5AP1A 5I9UA 5J7HA 3NUAA 3W8LA 2R3PA 4TWPA 2OIBA 3BU3A 3QKKA 5BVKA 4B9DA 2CKPA 3FZTA 4I6LA 3ZLSA 4FVPA 3QRIA 1KOBA 4F65A 4UN0C 2Z02A 1PXMA 4BDJA 3F2RA 4HGLA 5IQDA 3RPYA 4YSJA 2JKKA 4JDJA 3R7GA 1NA7A 3VS6A 1WBNA 4R3PA 2I6LA 1W7HA 1AQ1A 1YDSE 2R3LA 3TTIA 1M7NA 3F3ZA 4E6QA 4I6QA 4C61A 4MK0A 5BUIA 3OMVA 5DPVA 2JDTA 3FEGA 4WBOA 3F3TA 4NKAA 4EC9A 4X21A 2F49A 2IG7A 3CSVA 4LRJA 4CMTA 3IS5A 4EOMA 4U5JA 3C4CA 3ZC6A 5EI2A 4ZZMA 5FWKK 1CTPE 1GZNA 4YNOA 3E88A 4ALVA 4F1TA 4YR8A 3B2TA 5CVFA 3WF6A 2WAJA 4ACGA 3VIDA 5IH6A 4II5A 5L8JA 2J0MB 1FBNA 4RX8A 2YLFA 4XRJA 1FQ1B 3MY1A 4IB1A 4MXXA 4F0GA 4M8TA 3A7GA 4GJ2A 2IW9A 2IN6A 3NDMA 3OWLA 3Q2JA 2XJ0A 2XNNA 4PDYA 3VVHA 3P23A 4Q5HA 3THBA 4BCKA 4D2SA 4HOKA 1VYWA 4KKHA 5C4LA 1DS5A 1PHKA 2F9GA 4EHEA 4O4EA 3CTJA 4ITIA 1QPJA 4S34A 4RX9A 3FPQA 3HVCA 3FHRA 3AKJA 1KOAA 3D4QA 4FE2A 4XX9A 3EYHA 3VAPA 3U8WA 4C4GA 4QP3A 2CPKE 2AC3A 5DYJA 3W0PA 4U44A 4BCMA 5DVRA 2WMAA 3MJ1A 5AP7A 4BKJA 4FL3A 2X6DA 3KVWA 1M2RA 4J98A 2PZ5A 4PL4A 4O7YA 4Q5EA 3A4OX 4CZTA 2R3GA 4AZVA 4HYIA 4CQGA 4IAIA 5A6OA 2UZNA 4EK4A 3NCZA 2R9SA 3OEZA 1YDRE 2RSVA 4JIAA 3R9RA 1RDQE 3IO7A 5ETIA 2PL0A 3FMDA 4FL1A 5ACBC 3ENHA 4D2WA 1BL6A 1DAYA 3S2PA 3TZ9A 2ITXA 5L2SA 3FMMA 3BCEA 1WBOA 1UWJA 4XG3A 2ZM4A 3FQHA 4EEVA 4WBBB 5AP0A 4ZTSA 4EOQA 4QD6A 4OBOA 4MD7E 3D7ZA 3OCGA 4YZNA 2IPXA 1ZYLA 3R2YA 5HG8A 4FR4A 3Q32A 2WPAA 4ENYA 2B54A 2G9XA 3QD4A 4JBOA 3RM6A 3T3VA 2UZWE 3Q96A 5DNRA 3UODA 5CF8A 3QD0A 3H3CA 3PXKA 5AM7A 1R78A 4CFFA 3LXNA 2HWPA 5A46A 3KXMA 4O82A 2CN5A 5E91A 2W1ZA 3NAYA 2WMTA 1OL2A 3EQHA 2ZMDA 3HMIA 2R3QA 3UQGA 3PJ1A 4YBJA 3A61A 3F2AA 3ZCLA 5AEPA 4QYEA 3GFWA 4U43A 4F6SA 4RBLA 4G6NA 3AC8A 4XG9A 5FTGA 2R0IA 2VD5A 1XJDA 1YI6A 3VUIA 5IF1A 3PJCA 3QX4A 4L7FA 3HAVA 3EOCA 3EQCA 4FTQA 4XYFA 3SLSA 5IQGA 4JR7A 1QPEA 4DT8A 4KD1A 1EH4A 2W05A 1NW1A 2VTQA 3EN9A 4AAYA 4BKYA 3R00A 4F6UA 4C2VA 3HRCA 4DFBA 5CVGA 3AGMA 4QMXA 3FLZA 2JFMA 1PF8A 3KKVA 5FM3A 1VLRA 4RIYA 4FKJA 3NUPA 5E92A 4MCVA 4ARKA 5FBOA 5EYDA 2VV9A 4D55A 1VEBA 2V22A 5A4TA 2IEWA 4ZSEA 4DTKA 4F99A 5HIEA 3ZFXA 2B9IA 2GDOA 3I79A 2GNLA 3ZM9A 3NPCA 3D14A 3PTGA 4MF0A 2WOUA 3RZBA 2X1NA 3DXNA 4FSRA 4PMTA 4YZDA 5G1XA 5FUTA 2YIQA 3R04A 5CVHA 5DHJA 4A9TA 2B0QA 3LOKA 2GFCA 3FKLA 4AZWA 4UX9A 4AXFA 1GJOA 2XIZA 4YO4A 4AGDA 5JQ8A 3KRJA 5F9EA 1BI7A 3ID6C 2ZMCA 1YI4A 4ANQA 3SXRA 4FTIA 3ZDUA 2XNEA 4RWJA 2EWAA 4K9YA 5EYCA 3QA0A 4RVLA 4EJNA 3BHTA 4DEHA 3VWAA 1TQIA 4PPAA 4NEUA 4GSBA 4F4PA 1G3NA 1W8CA 2R3MA 3Q9WA 4OW8A 3JVRA 5EW3A 4AW0A 1JSVA 4NWMA 3MH2A 3AC2A 3REPA 4FIJA 4XV1A 2CDZA 4WUAA 4L8MA 5GZ9A 3UG1A 4ASXA 1FVTA 4QPAA 4L45A 2C0OA 4BI0A 4F70A 3PSBA 3VN9A 3LMIA 3A2CA 1YI3A 2QQ7A 4DEBA 4EOPA 1JVPP 2R3OA 3DPKA 2XANA 4PRJA 3DBDA 4QQ5A 2OGVA 4IVCA 4LUDA 1GIIA 3ODYX 5CZIA 1SZMA 5L2TA 5DA3A 5I3OA 3W33A 4FODA 3RKBA 3KVXA 5EFQA 3UE4A 4FICA 2X7FA 4IWQA 3JR1A 2QHMA 4D1ZA 3CEKA 3LJ2A 5CEQA 2OU7A 4G1WA 1JLUE 3LXPA 4EK3A 4E26A 2HY0A 2OICA 4IZYA 4V04A 2Z7QA 4AU8A 3FXZA 5AV2A 2G15A 4DEGA 4JXFA 5I9XA 2O64A 3GU6A 4IZ5A 3OWPA 3ML1A 4BWKA 4HCTA 1UV5A 2Q0NA 5HGIA 4JMQA 4ITHA 4YJSA 3W0MA 4XH6A 3NUUA 3PSCA 5EHYA 4Q2AA 4H3BA 4L00A 4O6LA 3JPVA 2YZAA 3NUNA 4W4XA 4H3QA 2J4ZA 2GS7A 2CNQA 2X4FA 1VZOA 3JVSA 2ZV8A 1GIJA 5L6PA 5AR3A 4BCJA 1G8KA 1YXUA 4F9AA 1Y8GA 2R0UA 5TF9A 5CALA 3LFAA 2UW7A 3HZTA 4TNBA 3R1QA 2JLDA 3N9XA 3OOMA 4EK6A 5TO8A 5IZFA 1FINA 4FTJA 2VO6A 1JWHA 4D2VA 4GK3A 2HZNA 5M4UA 3QTIA 4QMSA 3V6RA 4R5YA 3WARA 4BGQA 4BCQA 4I21A 2UZEA 1LR4A 4O0VA 2FSLX 4O38A 3CJGA 1YHVA 1YWVA 4F1OA 4C62A 1CKJA 1BYGA 2QC6A 2VTSA 4PNIA 4B6LA 3I6WA 3N4TA 3BIZA 2C6LA 3SRVA 1NVSA 2YJRA 3EJ1A 3ZTXA 1JKSA 3Q9XA 3WE8A 2BROA 1MRVA 4U8ZA 2YCQA 4ZZOA 3RNYA 1QPDA 2DWBA 4PL3A 3EFWA 1SVEA 3SD0A 2W5AA 3V5PA 2CSNA 3VS2A 4LMUA 5CYIA 5D9HA 3QCSA 4XEYA 1W82A 4BYIA 5I5ZA 4O2PA 4I5MA 5E1EA 4IWPA 4UXQA 3OWKA 1I44A 4C02A 5A6NA 4HVIA 4FT0A 4NFNA 3PWDA 3VUTA 4BGHA 3VULA 3FL4A 5KZIA 4FG8A 5J87A 2YDJA 3E5AA 1OM1A 3UO5A 4CMOA 3U9NA 4R1YA 3F5GA 4G3CA 2XNBA 4EZ5A 2VO7A 3EB0A 1M17A 2HZIA 3R1NA 4WHZA 3QU0A 3V3VA 4F9CA 4BZOA 2PMIA 5BMSA 5EI8A 4JX7A 4KIKB 2IZTA 1A06A 4GUEA 2PTKA 4R7BA 3W0RA 2ITVA 3N4UA 1BL7A 3RI1A 4S31A 1WBTA 3BQRA 4XNEA 1P2AA 3BRBA 4APCA 5E8SA 1KWPA 3CBLA 3FI2A 3OBGA 2OF4A 5E4HA 3FY2A 5JGBA 4BDHA 5DRDA 3R6XA 3KCFA 2YCSA 5FEEA 4L3PA 4EOOA 4MH7A 2UZOA 3WF8A 4J53A 2I0HA 5CX9A 3BGQA 2J0IA 4CFXA 4P4CA 3W2SA 1W83A 2VU3A 5HQ0A 2GNJA 4U40A 2E9NA 4R5SA 1TZDA 2X8IA 2GHLA 1R3CA 3BE2A 3ANQA 3QCXA 4BYJA 1JQHA 2ZB1A 4YJVA 3ZEWA 4PNKA 4PPBA 3DT1A 3TZ8A 1W2CA 3MVHA 3I4BA 4F6WA 2CCIA 3DFCB 4WSQA 4ZLOA 2G01A 3P7CA 5AUYA 3RAKA 4GT5A 4B8LA 5HVJA 4QMWA 4FTMA 5DLSA 1MRYA 2W5BA 3NIEA 3U87A 1Q8ZA 4K18A 3U6JA 3MH0A 5H2UA 5K9IA 2VX0A 4FEWA 3UQFA 5CASA 2UW8A 4F9WA 4ANSA 3GFEA 3BWJA 2X0QA 4AW2A 3D5VA 2UZLA 3S4QA 4DG3E 1OL1A 4O7VA 3MVLA 4J95A 5AP2A 4PF4A 2P0CA 1REKA 3P9JA 5HE1A 3UOKA 3PE1A 2IO6A 4K1BA 2ZV2A 2J9MA 4P5ZA 4MD9E 1XO2B 4YHFA 4ZIMA 3HYHA 3MS9A 3ZLWA 4FKPA 3QWKA 4QMVA 3COIA 2O65A 4NM3A 4UB7A 2WD1A 3E62A 2BFYA 5E8XA 4O7RA 3R9DA 4Z3VA 2OBJA 3KIOC 2YA9A 3V5LA 2VWZA 4OBQA 4N57A 5DR9A 2R64A 4YBKA 2B9JA 4FEQA 4E93A 3E7OA 1O6YA 5EW9A 3R73A 3MV5A 3ZZWA 3NVKI 3TUDA 3KU2A 5AWMA 2JFLA 3W2QA 4RJ7A 3WE4A 4ACDA 2OXYA 4C4EA 5IA4A 3UZRA 2F2UA 3TIYA 5JN2A 4IAYA 4AG8A 3QXOA 5HCZA 2GHMA 3RBWA 3N4VA 3OCSA 3LQ5A 5FD2A 1SNUA 1BKXA 4N6ZA 3WYYA 5EKNA 3R2BA 3V51A 1Y91A 3CIKA 3KREA 3NX8A 1OKZA 4QTAA 4P90A 2HZ4A 3H30A 3C0GA 4A7CA 4FV8A 5HCYA 4DGMA 3DAKA 3DAJA 1OIRA 4CLJA 1YRPA 4WKQA 2W1GA 4U6RA 2HK5A 1DAWA 3VNTA 4K0YA 3RK5A 2W06A 4FT9A 5B2LA 3U4WA 4NM5A 4PMMA 1S9IA 3ENMA 5KMNA 4FNYA 5EQYA 3H9RA 4IM3A 3D5XA 4ZSJA 2F2CB 4FRFA 5G6VA 2ITWA 3ALOA 4MXYA 1UNLA 2ZJWA 4IVAA 3VS1A 1XKKA 3AGLA 3LHJA 4FK3A 4S2ZA 1XH4A 2RKUA 3KCKA 4FIGA 4CG8A 4OTDA 4NCTC 3ZSHA 2ETRA 5C4KA 5HVYA 4ZJIA 3DZOA 5AA9A 2BDWA 4XG2A 3TV6A 4QDEA 4ALUA 2GTMA 5CF5A 2W9FB 3TG1A 2JD5A 2WEVA 4QMPA 5DEWA 3LXLA 2QOLA 3ORPA 2YISA 4BWPA 5CU0A 3SX9A 1WVXA 4H1MA 5H8BA 2BHEA 3DBFA 1JSUA 5ICPA 2VTHA 4LG4A 2YIWA 3OCTA 5ETFA 4LV7A 3NYOA 4E5BA 3QD2B 4MXOA 3PIXA 3C0HA 4FSTA 4UZHA 2RG5A 4U80A 2JKQA 5E1SA 4BFMA 3QBNA 3AC3A 4RIWB 3VW8A 4XLIA 5IQAA 3K5UA 5AUTA 2YM6A 3QTWA 3LJ0A 5EQPA 3IONA 3QTUA 4CQEA 2KTYA 4H39A 4S30A 3P7AA 3GCUA 4ZOGA 2UW5A 5KMMA 4LYNA 5C1QB 3WZKA 4AUAA 3R83A 3NNVA 5LVPA 4WNMA 3DLSA 2GSFA 4L7SA 2C5YA 3UOJA 2JDOA 1V1KA 2YJSA 4TXCA 3UOHA 3EWHA 2R3FA 2B9FA 3PY0A 3MIAA 3KY2A 2C5XA 3I6UA 2ITZA 3F69A 4GJ3A 2QLQA 4IZ7A 4Z55A 2GQSA 2PUPA 2GNHA