3PPKA

Human b-raf kinase in complex with a non-oxime furopyridine inhibitor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
276
structure length
262
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Non-oxime inhibitors of B-Raf(V600E) kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 75
structure length 262
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ppkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ppkA01
4QTBA 4FIEA 5CY3A 3Q3BA 3NWWA 2CSNA 2F7EE 4L67A 3TNIA 2BZHB 2ONLC 1OBGA 5JH6A 3R1YA 2RF9A 3HMMA 3CJGA 4FTAA 4XV9A 4F7LA 2J50A 3CQUA 5LVLA 5KMOA 4FVQA 2UZBA 4XLIA 5AUXA 4IE9A 4QP6A 1O9UA 4YZMA 4XBUA 2XRWA 2XYNA 2BR1A 2ITZA 2W4JA 1WCCA 3KU2A 4K2RA 4UZHA 4X3FC 3RJCA 2C4GA 3DNDA 1OIRA 3NZ0A 4DE4A 3PLAE 4U43A 4DAWA 5GNKA 5EI6A 5KMNA 3T3VA 2YDIA 5HI2A 2WD1A 2FSOX 2PUIA 5J79A 2OJIA 4BDDA 3TTIA 1REJA 3W2RA 3SHEA 5LWMA 3D9VA 4OAVB 4MX9A 3E3PA 2BDJA 3KQ7A 4C4JA 3AT4A 5AR2A 3TNPC 3V51A 4BTMA 3BU5A 4PL3A 4QQCA 5CU3A 1K2PA 3LLAA 5BYYA 2F2CB 5EDPA 1O6KA 2VTSA 5BVDA 1UNGA 3AOXA 2PZYA 4BDFA 4TL0A 5A6NA 3MIAA 2CKPA 3R8MA 4CFWA 5E9EA 2OO8X 4EH2A 5KBQA 4U45A 4JJRA 5E8XA 4BL1A 2QQ7A 5EH0A 3F7WA 4MWIA 4E4LA 1R3CA 4QP2A 4PTCA 3PVWA 1KV1A 1CM8A 4U81A 1CMKE 1Y8YA 4U5JA 2BAQA 3CE3A 3F3UA 3WIGA 5JK3A 3FAAA 1SNUA 3O96A 1URWA 2OJ9A 4KS7A 4FTOA 4PMMA 3RI1A 4X2JA 2CNVA 4QP1A 2C6OA 2E9VA 3L9MA 5H9BA 2VNYA 3BRBA 2NP8A 4C38A 2YDKA 5EKOA 3IO7A 3AG9A 4JR7A 4MXAA 4QD6A 5HLNA 1WBNA 3TZ9A 5CNNA 4E3CA 1M17A 3BPRA 3GXLA 4BI2A 4H1MA 3E93A 5ANDA 2E2BA 2JDRA 2OZAA 3D7TA 4CTBA 2GS6A 3BCEA 3CKWA 3VQUA 4IWPA 2W0JA 2YACA 3COIA 2CNQA 2ITVA 5CSPA 2YERA 4MQ2A 3DU8A 4FV8A 3W2PA 3UC4A 4AOIA 4UMPA 5CAVA 5CI7A 5LQFA 3UBDA 3QKMA 5DBXA 3A8WA 2W1EA 3ZEPA 2BDWA 4APCA 5IPJA 4BIEA 4P7EA 3QA8A 3RAWA 1KE5A 2JIUA 3DA6A 3HLLA 4GYIA 4K33A 1YKRA 3RNIA 2ERZE 4IW0A 5EW9A 5DT4A 2Q0NA 1YHVA 1UWHA 2PE0A 2VX0A 3BU3A 1Q3DA 2P33A 3QA0A 4ZY5A 1UKHA 2YWVA 3SW4A 3DAJA 3T9IA 3GQIA 5HGIA 2QO9A 3R73A 1REKA 3LXNA 4ZSLA 1WBOA 1LR4A 4RX8A 4A4LA 4MHAA 5TR6A 3QTQA 5HU9A 2R3KA 4TRLA 3BLHA 4ERKA 5IA5A 1IASA 4IDVA 4ZJIA 4X7QA 4QPMA 4M13A 2BALA 5A4EA 2BIYA 4HGTA 4YTFA 1L3RE 3OWJA 5DEYA 3WZDA 4HVGA 4ARKA 4ASZA 1A9UA 3UIBA 4GFOA 1I44A 5T6KA 4JQ8A 4CG9A 1ZYLA 4W9WA 4O6LA 4OTGA 4KIKB 4BTJA 5JKGA 3HV6A 2HIWA 2FA2A 2WQMA 3PP0A 2ONLA 4BBFA 3RK5A 5ANOA 3FC2A 4H3BA 3CQWA 4DF3A 4FTQA 1OITA 5HCYA 3R7UA 5CT0A 2HAKA 2VWIA 2X8DA 3WZEA 4C8BA 5DT3A 5IUIA 2V22A 4APPA 3WF6A 4AX8A 5IQBA 1MQBA 3P7AA 4C3PA 4KS8A 3IK3A 2GSFA 1GNGA 2UV2A 2H96A 5AUYA 4FUXA 3R1QA 3Q2JA 2OZOA 3GU4A 3GT8A 3CJFA 2UW5A 2QOQA 4TNDA 5CF4A 4K18A 3UODA 4FSTA 4GG7A 5BX0A 5CXZA 4FT0A 5FDXA 5JQ5A 2P0CA 3TEIA 3KA0A 4O82A 1Q8WA 2DQ7X 4O7VA 1YWRA 1YXXA 2HZNA 2JKMA 5H8EA 4EOQA 2RFNA 3PG1A 4I22A 4F1OA 1FBNA 1W7HA 4BDGA 4GKIA 1CKIA 4GVAA 2JDOA 3FYJX 5CI6A 5IH4A 3QHWA 3KCFA 4DYMA 3JS2A 5KKRC 3Q32A 3KB7A 4DH5A 3RZBA 3VBTA 5GIPE 3HRBA 2F49A 3W18A 2G15A 2WKMA 2H34A 2LAVA 1YOMA 2VWVA 3U9NA 4F6WA 4UN0C 4DBXA 4J1RA 1H24A 4QMVA 3LMIA 2HZ0A 3E3BX 1V0BA 2PVFA 3RCDA 3FZOA 2ZV7A 4CD0A 4XP2A 1MRUA 1DM2A 3NSZA 4DFZE 1BX6A 4OLIA 4QMNA 4AGCA 3FLSA 4ZZOA 5D41A 3NVMB 3WARA 2JEDA 1FPUA 3TT0A 4Z3VA 4QMPA 3TI1A 5I4NA 4LRKA 4TZRA 2CHLA 2PMIA 3NLBA 4WNMA 4FSNA 5EM8A 4QYHA 4DFYA 3QD4A 2XM9A 4O7NA 3W2CA 4FTLA 1H1SA 3P0MA 4P5ZA 1OKVA 3TCPA 3F5XA 3HV5A 5AV2A 4J97A 1XH7A 4G3FA 4R3RA 4EL9A 2QOIA 4U9AA 2XJ1A 3KRJA 3QKLA 2EVAA 5TKDA 3A7IA 4Z16A 3JVSA 3FI4A 2YHVA 4O0SA 4HCVA 4FSYA 4BDIA 2WMXA 5CVFA 2QOBA 3UE4A 3QUDA 2ZB0A 5IDNA 2R3GA 4UWYA 4YZ9A 3HMPA 4NT4A 1JPAA 1Q5KA 3DPKA 3Q4ZA 4EHEA 4L6QA 4DN5A 3FUPA 2OXXA 5LXMA 5IKWA 5F4NA 2V5QA 2PVMA 4IZ5A 3ODZX 4JR3A 5CSVA 2VTLA 3OY3A 3CPCA 1OL1A 2PZ5A 3LQ8A 4JIAA 4W4XA 1R78A 4ASXA 1XBAA 4EYMA 2UW8A 3KREA 2BKZA 3FQEA 4JLCA 5JGBA 2G9XA 2JIVA 2C6LA 4EOKA 1CTPE 5M56A 4CQGA 5I5ZA 3AC3A 4XV2A 4PMTA 4M8TA 3F3VA 3VQHA 3KC3A 5GZ9A 5FQDC 4KAOA 2QURA 4CKIA 3D83A 5F95A 3D5VA 1PXIA 5KMIA 5CWZA 4RLLA 4XV1A 5DVRA 2UW4A 3M1SA 3FL5A 3E5AA 4ANLA 3S0OA 3E7VA 4H1JA 3A62A 4J99A 1BI7A 4NTSA 2Y6OA 4X2GA 4AACA 1CKJA 4FKIA 4BDCA 3C4EA 2PL0A 4LQMA 3UMWA 5A4LA 3BE9A 3PXYA 2BTRA 3DGKA 3R9NA 4CFMA 2RSVA 2ZM4A 3AMYA 3BLRA 2PVKA 1W82A 4WRGA 3V04A 4PNKA 5AA9A 3UP2A 2YCSA 4KA3A 2Y4PA 1H8FA 2IPXA 2WQBA 4DGLC 5AADA 3ZOSA 4JL9A 4ZK5A 3ACKA 2RG6A 3GOKA 3QZGA 2DUVA 2J0IA 3W33A 2WMRA 3LIJA 3PY1A 1BUHA 3ZU7A 4ZMEA 4F0IA 3UNKA 4P4CA 3NYXA 1IG1A 3MY1A 5AM7A 5EKNA 3IPHA 4O1PA 1PXOA 1BI8A 2GU8A 3LFSA 4FV2A 1GIHA 3C0GA 1M14A 3I0OA 5EFQA 3ZLSA 1WBVA 4EOOA 3DFCB 3HEGA 4F08A 3PJCA 3VC4A 5DT0A 3R7VA 2XM8A 4IX5A 2GMXA 3Q4UA 2XA4A 3QC9A 4NW5A 4RZVA 3FI8A 4BCPA 3EKNA 3PIZA 1W0XC 3Q53A 4DFXE 4DC2A 2EB3A 3QCQA 4F6UA 4IHPA 5IDPA 2Y9QA 3WE8A 2J5FA 1LEZA 2WOTA 3VF9A 4NZWB 4OBQA 3QZFA 3H9RA 4F7NA 5L2QA 3UO6A 1XKKA 2OICA 3ZDUA 5KZ0A 4KIKA 2UVXA 4YHTA 2YLFA 5ANGA 4DFNA 2PE2A 3OUKA 4FKVA 1SVGA 3FLWA 5A3XA 2O3PA 4YURA 4E4XA 2QOKA 1P4FA 4AQCA 4QMUA 4J8MA 4LOPA 3MWUA 4EQMA 4FNZA 5IH6A 1FMKA 2C5XA 4B8LA 4G17A 3FYKX 2O8YA 2PVNA 3KRXA 4DEEA 5L6PA 5E8VA 4BI1A 4KRCA 3BQCA 1K3AA 4LV5A 1OM1A 4O0WA 5AJQA 3K5UA 3MVLA 4DG2E 2YM4A 5K0XA 4PPCA 3PSDA 1IA9A 1UV5A 4DA5A 4X21A 3PRFA 1B39A 4FTNA 3K54A 2X2KA 2PHKA 4IAIA 3ROCA 1XBBA 2GDOA 3AGLA 3LFQA 3OVVA 2CGUA 3F69A 4PL4A 3I7BA 3WZUA 5LVMA 4FEUA 3O51A 4RIWB 2PSQA 2BCJA 5FXSA 2PUPA 3HKOA 4FZ6A 2JAMA 3BHHA 3FJQE 4KSPA 3BE2A 1AGWA 2OJFE 4FK3A 4XMOA 5E1SA 2VN9A 3PA3A 4FSRA 4LI5A 5F94A 5M55A 3DTCA 4DHFA 3OUNB 4QMQA 3RZFA 5CASA 3D5UA 3ENHA 3A7JA 2R3FA 2RKUA 2OGVA 4L9IA 2JGZA 5ANJA 3R30A 3QUPA 2F9GA 3V5QA 5C8NA 3GQLA 3UOHA 1VJYA 4TYIA 1ZWSA 3KN6A 2ITUA 4TN6A 4CMOA 4YO4A 2NNWB 5LMBA 5ACBC 4MK0A 2AYPA 4CXAA 4QMTA 4R1VA 3R21A 5G1XA 4BGHA 2YIQA 4R6VA 3PP1A 4U44A 4PMPA 5CQWA 4YMJA 5FM3A 4YJRA 1SVHA 3OBJA 4MD8E 2FUMA 4AAAA 4E73A 2J9MA 5L4QA 1MQ4A 3C5UA 2BRBA 4OGRA 3LFCA 2YIWA 4O2PA 4XOZA 2WTKC 3ID6C 5FEEA 4IX6A 2YIXA 2QU5A 3IOPA 4Y8DA 2OI4X 3TUDA 5DR9A 1ZLTA 5CZIA 3V3VA 1H00A 4KKGA 4U6RA 5HESA 3N4UA 2GPHA 2CGVA 1WMKA 4I23A 3TKIA 4BZOA 4FEXA 4MD7E 5HLPA 4WSQA 3TN8A 2HY0A 3LAUA 3PUPA 1YDTE 4IB3A 3UZPA 5AV3A 3UPZA 1MP8A 4WNPA 4FV0A 2FYSA 5I9XA 1U4DA 4HYHA 4UY9A 2H8HA 5DYJA 4DG3E 2OBJA 5ETIA 2PMNX 3LPBA 3ALNA 1OI9A 3K5VA 3V5JA 1X8BA 4IAKA 4D2VA 2WNTA 2QCSA 2WTIA 4Q5EA 3VUMA 4BI0A 3I1AA 2UW7A 2X1NA 4Y5QA 4A9SA 1NA7A 2BDFA 4LUEA 1OL6A 4EK6A 4KKEA 1W83A 2JFLA 5AX3A 4BCJA 3EL8A 5KMMA 3MH3A 3QWJA 4FG7A 4GUEA 4CT1A 2B9HA 5CLPA 3O7LB 4D5KA 4F63A 2BPMA 2ZVAA 3VUTA 4ERWA 4M15A 1DAWA 3PY0A 3F3ZA 4OBPA 3ZLWA 4C57A 4K0YA 4BCFA 4RVTA 4NM3A 2WB8A 2X8EA 3OBGA 5CEIA 5CEPA 3ENMA 3H30A 3L8XA 1JSTA 3CXWA 3LM0A 4ZSJA 3VUGA 5J8IA 2GNGA 4EORA 3UYTA 1OL2A 2I1MA 4AZFA 3BGZA 5D9HA 4BHNA 5DG5A 4L68A 1SYKA 4EK5A 3QTSA 4C3RA 4RSSA 5EM7A 4D0WA 1H01A 2V7OA 1PHKA 3UZTA 4DITA 4XJ0A 3VAPA 4U42A 4I0TA 4CNHA 3H0ZA 3EYGA 3OS3A 3EFKA 5JZNA 3E88A 5L8JA 2PYWA 2C6IA 4X3JA 3S4QA 5AWMA 3SA0A 1PXLA 3FMKA 3KXMA 4IJ9A 2W06A 4IVBA 4UEUA 4WG4A 3AC5A 1J1BA 3L8SA 3RP9A 5G6VA 5HEZA 2G2HA 4DFLA 4RVMA 4AW0A 4E4NA 2DS1A 2B1PA 3D94A 3SXRA 4O86A 3OTUA 4YTHA 4DEGA 3EQHA 4GIHA 2QO7A 2XK4A 3DZOA 3WILA 3D14A 2IW9A 1Z9XA 5JMSA 4EK8A 4CRSA 4GT5A 5AV1A 3JY0A 5IQEA 2G2FA 4FTKA 4R1YA 3COMA 3ZSHA 3ZFYA 3HAVA 1UNLA 1M7QA 4MXCA 1NVRA 5H2UA 3AQVA 2VWZA 4RGJA 3T8OA 2Y0AA 5AX9A 4L3LA 1OZ1A 2IVTA 4JOAA 2O2UA 2Y4IB 4RX7A 4CG8A 5HX6A 1TVOA 1DI9A 2OKRA 2XMYA 5IQCA 4K1BA 3VHEA 3SKCA 3UQGA 2EB2A 3A4OX 3DS6A 1NW1A 1LP4A 2FO0A 3RALA 3ZUVA 4AT4A 4GH2A 3R8LA 4DGMA 5AUWA 3MI9A 4AA5A 1KV2A 4YGAA 3OWLA 2E9OA 4F1MA 4F99A 5K9IA 2B7AA 3I5NA 4RA4A 3SLSA 3ZXZA 5CTPA 3IGOA 1M2QA 3A60A 1YI4A 2RFDA 3DDQA 4IZAA 4Y83A 5B7VA 5M4IA 4L42A 3V5WA 3RPRA 3CLYA 2OH4A 3WF7A 4U97A 4AS0A 3RAIA 3S3IA 1M2PA 4CZUA 4NK9A 5AR7A 4ZMFA 3EKKA 4BCKA 2C3KA 4QNYA 4WG5A 4ZJVA 4M0ZA 3PA4A 4RIWA 4EC9A 2CDZA 4O0XA 3N51A 4MKCA 4TKSA 3SAYA 4XBRA 4RX9A 4E20A 5EDRA 3E92A 4EH6A 5LMKA 5FP5A 4H58A 4E5BA 1SM2A 1U54B 4GU9A 4WA9A 3CCNA 4DEAA 4O0RA 3MFTA 2QOCA 4DEIA 3S1HA 4H3QA 4DGNA 5CAUA 4C3FA 4FV7A 1H1RA 4C35A 2X7OA 4CEGA 3W1FA 3MY5A 3QQGA 4QMYA 3E8EA 5CYIA 3QXPA 2WEIA 3GU5A 3JPVA 5HORA 2XRUA 1Y91A 1ZOGA 3MPAA 4RFZA 5CAQA 4UALA 3RPVA 3OT8A 4I0RA 3TWJA 1ZOEA 3C13A 3CR0A 4UX9A 4I92A 5FRIA 1H28A 4DFUA 2XH5A 4BKJA 2Y4IC 1O6YA 3VS0A 4EJNA 3LXKA 4Y46A 4FICA 4WNOA 4CFUA 4ZS4A 2JDVA 4FIIA 4C59A 3MTLA 3FQHA 2JAVA 4LV8A 2WQEA 4C61A 1KOBA 2PVRA 3GGFA 1BL6A 3I79A 2PUUA 1FOTA 2QOLA 3OEFX 4MQ1A 4WD5A 4NSTA 4X3FB 3QQLA 4E7WA 2ACXA 5B0XA 1V1KA 4J71A 1P2AA 2VAGA 2E9NA 2QOOA 2XKFA 2B52A 1RW8A 3P79A 4Q2AA 3PY3A 4UZDA 3TZ8A 1OIQA 4CLIA 3ZO2A 4XG7A 5GZ8A 2VU3A 2IZUA 5J87A 3RAKA 3TXOA 3GCPA 3EQCA 4LL5A 5CXHA 5AAGA 4J95A 5K3YA 5IF1A 4FV1A 4EZ3A 1NT2A 1UU3A 2BZKB 3NNXA 3POOA 4OTIA 1UNHA 4QP4A 2VGPA 3PXZA 5FG8A 4O7SA 3UJGA 5M4CA 2R3LA 3U6HA 4LGDA 4FL2A 4RC2A 2FSLX 4ANNA 2X8IA 3OOGA 3NYVA 3QTWA 4EBWA 4ALWA 2YZAA 2FGIA 3U51A 4CV9A 4CV8A 2PK9A 3TIZA 1PKDA 1IAHA 3TV7A 3SGCA 3DJ7A 3FMHA 2ZDTA 4IADA 3F66A 4JRVA 3VS7A 4WSYA 3A99A 3UDBA 3VW6A 3DT1A 4NKSA 1OPKA 2J51A 3VRYA 2UUEA 3OC1A 4EOLA 5J5SA 2WHBA 4N57A 3Q9YA 4AXAA 4UWBA 4GCJA 4Y72A 3SRVB 5IQIA 3P23A 4TWCA 2I40A 1Q8UA 4FIJA 4UMQA 2G1TA 3HMIA 2F2UA 3TACA 4B4LA 2QHMA 3FMMA 5C03A 4JRNA 5AP2A 4XUFA 4YP8A 4AT3A 4USDA 3OXZA 1SMHA 4PP9A 3HV4A 5C26A 2EWAA 2Z7LA 4F9AA 1M7NA 4CLJA 3HUCA 2VTOA 5LVPA 4C7TA 3TJCA 2YN8A 5M08A 3PJ8A 3Q9XA 5HNIX 2AC3A 4WIHA 2QI8A 4ANQA 4AW1A 1ZMUA 2W9ZB 3QBNA 5M09A 3UO4A 4LOQA 3VS5A 4EC8A 2YCQA 2WTJA 4GT4A 4BCOA 2R2PA 3PFQA 2RFEA 4JBVA 3H4JA 2ITYA 5HO8A 1UWJA 2R7IA 4OAUC 3FLQA 1R39A 3JXWA 4ZSAA 3CTJA 3AGMA 4F0FA 4L3JA 3MA6A 4EH7A 1I09A 2YCRA 4GG5A 3ZSIA 4YJQA 4DEBA 4ZLOA 3ZM4A 1Y57A 3DB8A 5IISA 4L8MA 4I5MA 4D4YA 3N4VA 5DRBA 2VRXA 4L01A 3BYOA 3KEXA 2BAJA 3F3WA 4E5WA 4G9CA 3MDYA 5AP5A 2PY3A 3NW5A 4GV1A 2WQOA 3THBA 3IDBA 2QC6A 4LMNA 2WXVA 1CKPA 4G16A 5HU3A 1YDRE 2BROA 2OIBA 2XZSA 3LJ2A 2ZMCA 3QQHA 2X81A 1OVEA 3RNYA 3DBDA 4PL5A 4C37A 4AW5A 4QO9A 3FV8A 3L9NA 3GFWA 4RIYB 4W4WA 2WIHA 3W2OA 3PJ3A 5CU4A 2UZWE 4XG2A 5HICA 5EW8A 2YCFA 3LCSA 4G3DA 1ERKA 3HNGA 4H3PA 4GYGA 4IWDA 3R83A 4HVIA 2R7BA 3TIYA 2I0EA 1MRVA 3IECA 2C69A 4FZ7A 4D9TA 3QTXA 5DR6A 2J6MA 1PJKA 1AQ1A 4KIOA 4J8NA 3SXSA 1Z57A 3DK7A 3R8PA 3RM6A 4KINA 3ORTA 4RFMA 3PIXA 4E4MA 4FZFB 3Q04A 4PWNA 2JLDA 4C4HA 2A19B 2OJJA 2X4FA 5FTQA 4D1ZA 2I0VA 4CRLA 5K4JA 4I3ZA 1YOJA 3DQWA 3A4PA 4I41A 2ETRA 4YHFA 3VBWA 4IEBA 3RBWA 3KMUA 5IMXA 1ZYDA 4FKRA 5KZIA 4EOPA 4MNEB 4RT7A 2BFXA 3R0TA 5E8WA 2XNPA 4FT5A 4IANA 4J96A 3UPXA 4BCIA 3ZUUA 3R9RA 1GZOA 5E8SA 2B53A 3AC8A 5AR3A 5EYMA 3DQXA 4FL1A 1OIYA 3DDPA 5KKRB 4KD1A 4S32A 2UZNA 3R63A 4XEYA 5GHVA 3G9LX 4L7SA 3EZVA 3PRIA 5HE0A 4GVJA 3ZFXA 4EHZA 3QX4A 4RJ4A 1U54A 5EYDA 3KK9A 3ZC5A 3Q2MA 2PVHA 3IQ7A 2EUFB 5CNOA 2C5VA 4QYFA 5DE2A 4JQ7A 1JAMA 4FI1A 4FV4A 2Z60A 4M14A 2CNUA 2AC5A 4PMSA 3EN7A 3DB6A 4OUCA 1GIIA 5FD2A 4GUBA 3OXIA 5HHWA 2UVYA 4IVDA 4P2KA 3IKAA 3O17A 4G3CA 4RWKA 4U7ZA 5BVWA 5EK7A 2WTVA 3BBTB 3NW7A 3PVGA 4ACGA 4GFGA 3PYYA 2PE1A 3PWYA 4ZTNA 4FIHA 4O0VA 1Q24A 3P5KA 4U3YA 4UB7A 4GL9A 1QL6A 3EMGA 4EOIA 4YU2A 1Q99A 2GHMA 4CFXA 2QG7A 3R1SA 3U54A 4X3FA 4JNWA 3P7CA 4RG0A 1IA8A 5ETFA 3NUXA 3R04A 3NPCA 4D2RA 2FH9A 3ANRA 2W1HA 3O0GA 3GC7A 4M12A 4FTTA 2R3PA 2R64A 4QTAA 3LXPA 3RPYA 5BMSA 2BFYA 4QMMA 5TOZA 1H1WA 4WBBB 5HTIA 3PSCA 4R5SA 3QQUA 3HP5A 2YABA 3ALOA 3F3TA 2ITXA 3Q9WA 5ANIA 1V0OA 1YOLA 4C58A 1U5RA 2PMOX 3HA6A 4C4FA 5LWNA 1XH8A 2R4BA 3NX8A 2YLEA 3EQPA 5KX8A 4M68A 1M52A 4FOCA 3FLNC 3TV4A 3F5PA 5BUIA 2W5AA 4E6QA 4KBKA 3VS6A 3GC9A 4ALVA 1NVQA 2XBAA 2XKDA 3PXRA 3RPOA 2C5YA 2C6TA 4JDJA 4YLJA 3G90X 3SRVA 4IAFA 4FYOA 3QHRA 1TKIA 4NEUA 3VUKA 2OK1A 2C3IB 3FZ1A 1SNXA 3QU0A 1J91A 4GU6A 3QAME 4LUDA 4NFMA 4PV0A 4WUNA 3UOLA 2BUJA 5HVYA 3S2PA 4JS8A 3P78A 1JKTA 2WU7A 5KMJA 2WTDA 5CQUA 5BYLA 5DFPA 5A14A 2WFYA 3QLGA 2QO2A 5B2MA 2BVAA 1B6CB 3KXNA 1BKXA 3VHKA 2VTIA 3ZLYA 2VGOA 2NRUA 2UW6A 2VTHA 3C4CA 3C4XA 5AUVA 5IMEA 3DK3A 4NM5A 2X9EA 1OKZA 4D58A 5LJJA 2YJRA 4FUYA 5IEVA 4I4EA 3BHTA 4LL0A 2HXLA 2XCKA 2W4OA 4FKTA 3B8RA 4FTUA 4JAJA 3GFEA 5HVJA 4N0SA 1GIJA 4IJPA 4HPUE 2EXMA 4ITJA 4P90A 4ZY4A 2ZV9A 2XP2A 5CAOA 1ATPE 1PY5A 4U3ZA 2HZ4A 5HTCA 3KXZA 3UIMA 3KXHA 3ZCLA 3C4ZA 5LMAA 3KMWA 3UQCA 4N4SA 4RIOA 3G6HA 4V01A 4FV5A 3O2MA 5HE3A 3R6XA 1YHWA 3IW7A 4RIXB 4BCQA 3NCZA 5D1JA 4ZJJA 5J1WA 3MFRA 1JNKA 5LVNA 3I6UA 5EW3A 4IWOA 4CCUA 3MJ1A 4AW2A 4JDHA 3O8UA 5AR5A 4C34A 4FZDB 1U46A 3VBXA 2OWBA 2ZB1A 2YIYA 4RIYA 4FGRA 2YAKA 1PMVA 3GCSA 3QQFA 5E4HA 2YDJA 4D5HA 4C0TA 5AR8A 3OW4A 1OKYA 4EUTA 5BYZA 2W9FB 4CTCA 4XG4A 3DCVA 2PTKA 4X0MA 5EI2A 3HV3A 5KNJA 5HCZA 1PXPA 2XNMA 1YHSA 1G8AA 3CIKA 5L2SA 2HYYA 2IG7A 1UA2A 3F6XA 3QTZA 3OCBA 4YJPA 3NNWA 5HG7A 3EL7A 2ZM1A 5IA1A 3DV3A 3EB0A 3F82A 5EDQA 3OFMA 4G9RA 1E9HA 4FSQA 3R00A 4QTDA 3UOKA 2C68A 4MNEA 1E1VA 1J3HA 4FC0A 4RVKA 5I3RA 2Z8CA 4BDJA 4A9UA 5ETCA 5HG5A 4AGDA 3PXKA 4BR3A 1HCKA 4MNFA 3ZO1A 2HW7A 3VIDA 3NUYA 3V5TA 4O2ZA 4L52A 3B8QA 2JKQA 1CSNA 4OT5A 1WVWA 5EI8A 5FUTA 1XBCA 2VO0A 2R9SA 1FINA 3QKKA 2PWLA 3OWPA 5D11A 4IX4A 4L00A 3UVPA 4EZ7A 5CALA 1QPEA 3TNQB 4RC3A 1S9JA 4YC3A 3U4WA 4UMUA 2ZMDA 3HMOA 1JOWB 5KUPA 5KMKA 3TM0A 4U40A 4KIQA 3EOCA 2F4JA 4FYNA 1LUFA 3OHTA 3ZS5A 2HELA 3NUNA 5JFSA 4R7BA 5T3QA 3RCJA 1ZXEA 3KXGA 2JITA 5EHLA 2ITTA 2X4ZA 1RE8A 2VWYA 3FY0A 4NUSA 3O7LD 4HGEA 5CX9A 3RGFA 3L8VA 3KVWA 3SVVA 2JFMA 4NCTC 1PMUA 4X2FA 3Q6WA 3Q5IA 3R01A 4JQEA 5D7AA 5DI1A 3U8WA 2V0DA 4F7JA 5CEOA 5HTBA 2Z02A 2HOGA 2PZPA 2VO7A 2WTKB 1PW2A 5DLSA 4ZTRA 4YR8A 4JDIA 3QALE 4A9RA 1PKGA 2BZJA 1PMEA 2W1CA 5F20A 2IVUA 3KULB 3KRWA 4BCMA 2GTMA 1WVYA 2YISA 4FKQA 4MCVA 4TYHB 3DBCA 3CKXA 3BHYA 1IAJA 3VBQA 2AUHA 4UV0A 5DH3A 4V05A 4XG6A 3GVUA 3FZSA 3HP2A 4XV3A 3VUDA 4UMRA 2VTAA 5E92A 4F09A 3QX2A 4H36A 3V8TA 3IONA 4MEDA 1T46A 3LFFA 2ITNA 3E8DA 3ZONA 4R7HA 3DK6A 2GNFA 4G31A 4OT6A 4B8MA 4QTEA 4QOXA 2WGJA 1OPLA 4NKAA 3BI6A 1H0VA 3KXXA 2PZRA 2QOHA 3QL8A 5FLFA 5LCKA 5BVNA 1RJBA 5M53A 4OTWA 3FZTA 3LFAA 2W1ZA 4DEHA 2XEYA 3M42A 5DPVA 3WOWA 4XRLA 1OGUA 4WKQA 5FWKK 5HIBA 2BTSA 3TJDA 4AN2A 5BVKA 4C02A 1WBSA 3HRCA 5EYCA 5FXRA 4I6FA 2WMSA 1GOLA 2BRMA 2B9FA 5HX8A 4X2NA 1UKIA 3GC8A 5A4QA 2JDSA 1UU8A 1K9AA 1P4OA 3QTUA 4TYEA 4CSVA 3PE1A 4IACA 4IC8A 5AV0A 4AOJA 3GC0A 3FY2A 2QG5A 3AD4A 2A2AA 5JFVA 3VUIA 3DBQA 3SV0A 2C0TA 4JBQA 4LYNA 3U9CA 2IZRA 2XYUA 5KHXA 3G15A 1Y6BA 3DAKA 3R7OA 4YLLA 4KABA 3BGPA 3MW1A 3NIZA 3FXWA 4B99A 5IU2A 3KGAA 5EHYA 3UQFA 4YZNA 4EH8A 3IW4A 3PA5A 4NWMA 3EWHA 3CBLA 5F9EA 4QQ5A 4JG7A 1VYWA 5A6OA 5HQ0A 3BEAA 1FMOE 5EG3A 1S9IA 2HK5A 2W5HA 3FPMA 4NTTA 4DLIA 1WVXA 2V62A 3KKVA 4I6BA 4WUAA 3OZ6A 4JG8A 2P55A 4FTJA 5CANA 3F2RA 4K6ZA 5DNRA 2Y6MA 4KBAA 3R28A 4GSBA 3ITZA 2I0YA 3HMNA 1SZMA 4FOBA 3VS1A 4KSQA 2WMQA 3MFUA 3QUEA 2VTMA 5HE1A 4HGLA 1WBWA 3WF9A 1DAYA 3SOCA 2XKCA 3ODYX 3PXFA 5KE0A 3EN5A 1MRYA 3C4WA 4IDTA 3RAHA 5L2WA 2C6EA 4AE6A 4R3PA 1H26A 3CC6A 3ZO4A 4GKHA 2UW9A 3GCUA 1KE8A 3L9LA 3PG3A 4O38A 3D4QA 4E8AA 1H08A 4JG6A 4RIXA 3AXWA 4P5QA 1URCA 2VNWA 2H9VA 2XKEA 4ZTSA 2GFSA 2YIRA 4G34A 4M67A 1XJDA 2JDTA 4Q9SA 1J1CA 1ZMWA 2QR8A 2ZV2A 3I7CA 3Q6UA 5HG8A 3RHXA 5L8LA 4M97A 2YA9A 3VO3A 2YEXA 3JUHA 3BWJA 3QTRA 5M51A 3KF4A 3HAMA 3SD0A 3HDMA 3MTFA 5IEYA 4FKSA 3D2KA 1VZOA 4C4GA 4RBLA 3MY0A 1BL7A 4TXCA 5FM2A 3W10A 5HG9A 4EZ5A 4F0GA 3AC4A 4OTPA 4F9WA 4HNIA 3P4KA 5AA8A 1R1WA 4YNEA 4KRDA 1ZY5A 4MXXA 3VW8A 2FVDA 3ZTXA 2XIZA 3L1SA 3ZLXA 4EOSA 2Q0BA 4DTBA 3D15A 3ZXTA 3HVCA 4GJ3A 2C1AA 4WOVA 1YI3A 2KTYA 3MB6A 5M44A 2ITOA 3EFLA 3CD3A 3O23A 4ZTHA 3ORMA 4DH1A 5IEXA 4QMWA 2Y7JA 4OTQA 1Q8TA 2CLXA 1W84A 5HBHA 1R0PA 2C1BA 2R5TA 4JX3A 4JX7A 3S95A 3W32A 3F2AA 2HENA 3P9JA 4OBOA 2HWPA 1BMKA 1OB3A 3LW0A 5CSXA 4HGSA 3CY3A 4PDSA 4FZAB 2R3IA 2GS2A 4TT7A 3F88A 4A06A 4QMSA 5J9ZA 1NVSA 2IZSA 5CU2A 4PTGA 2I7QA 3QRUA 4NW6A 3DJ5A 2JIIA 4AA4A 4YO6A 5D7VA 5DMZA 5TF9A 3CGFA 4AZTA 3T3UA 3ORIA 3PXQA 4D28A 3QXOA 5I0BA 5M4UA 2ZOQA 1H1QA 4HNFA 2JC6A 2WTWA 1F3MC 3I6WA 2WMWA 4CQEA 3TZ7A 4EUUA 3FMLA 3ZEWA 3QLFA 3E8CA 4USFA 4OR5A 2VWUA 2QOFA 4EWQA 1H27A 2XS0A 3F61A 4S33A 5FTOA 3U6JA 1PYEA 4EKLA 1VEBA 4XG9A 4YUQA 4O7WA 1RDQE 5J7HA 3GU7A 5HO6A 1M2RA 3G6GA 4B9DA 2A4LA 3FEGA 3IW6A 1CDKA 2W1GA 3WZKA 5M57A 5AAFA 4PQNA 2XF0A 3KULA 1YQJA 2C0OA 2RGPA 3BEGA 4DT8A 4TYHA 5EYKA 5BNJA 2J0KA 2UZTA 3OY1A 3NNUA 3VF8A 4F1TA 1A48A 1YDSE 4BDAA 3UIXA 2R3MA 5J7BA 3R7EA 2BHEA 4BTKA 3Q5ZA 1Q4LA 4RFYA 4OW8A 4GW8A 4N70A 5HOAA 2IJMA 3NYNA 2YITA 1FVTA 1OPJA 5EHOA 4AG8A 4BGGA 3UTOA 1YXSA 1YXTA 1XQZA 3UGCA 2J0JA 2YM5A 4MBLA 4Q9ZA 3QF9A 4FK6A 2B0QA 4O83A 4CMTA 3IG7A 3KRLA 4CKJA 3FKOA 3FSFA 3HV7A 2XK8A 3BYVA 4WBOA 1ZY4A 4ZTMA 3BYMA 4AA0A 3VVHA 3MN3A 4PDOA 2X7GA 2B9JA 4RJ6A 4E93A 3FXZA 2C0IA 4EJ7A 2BAKA 4EYJA 4NIFB 3NCGA 3KFAA 3U87A 4KIPA 4ONAA 4XS2A 1KOAA 3MVHA 2O65A 2H6DA 5IA4A 3VULA 2OF2A 3R2YA 5AP7A 3NS9A 4AZSA 1QPDA 3FC1X 4DLJA 3QYWA 3PSBA 4MAOA 4BICA 3U4UA 4NJ3A 5CENA 2GNHA 3BBWA 2UZDA 4TYJA 3ZMMA 4E5AX 4YSJA 2J7TA 1LPUA 3LLTA 4YNOA 3UIUA 3ZRKA 3GNIB 3RWPA 3FXXA 2X0GA 3BYUA 4QP9A 4K77A 5ANEA 4UXQA 4IFGA 5TT7A 5C01A 4AGWA 1KE9A 5J5TA 5JQ8A 2EXCX 2HY81 3KN5A 3RWQA 4TWOA 3SG9A 4I0SA 4LGGA 1PXMA 1YW2A 4V04A 2O64A 4UWCA 5ITAA 3TL8A 3NAXA 4O81A 3D2IA 3SQQA 3A8XA 3DKGA 4XG8A 3OCSA 4ZEGA 3BU6A 5HZNA 3D5WA 3N4TA 2PMLX 3OW3A 4IM3A 4AE9A 3SDJA 5D10A 4F7SA 3D5XA 4FSUA 4IWQA 4ZXTA 3OCTA 3IOKA 3ORKA 4RJ7A 2OIQA 4D4SA 4CZTA 4O1OA 5I3OA 3ZBXA 3R2BA 4BWKA 3SXFA 2RL5A 3FMEA 4CYIA 2ETKA 3TUBA 5IQFA 5JRQA 5IA2A 4LRMA 3DOGA 4C2VA 1JKKA 4NYEA 3O71A 2YM3A 3I0QA 3NW6A 3P1AA 5AUZA 4R5YA 1U5QA 3EQIA 2JKOA 1W8CA 2VWBA 4XHKB 1GJOA 2NPQA 4L43A 2QKWB 3ORZA 4TWNA 3ZRMA 4CZYB 3SX9A 1ZZ2A 2IN6A 3FZPA 3V8SA 3EQGA 3FSKA 4QQJA 3PVUA 3I4BA 4CFNA 3F5GA 4FTMA 4FEWA 2REIA 5FEQA 3KRRA 4FA2A 3A7HA 4YZDA 2CJMA 4O84A 4DTAA 2BZIB 3P86A 4PDPA 3A2CA 3C0HA 1XR1A 3II5A 4ID7A 4M69B 5EOLA 1L8TA 4MTAA 3AMBA 3KMMA 4XNEA 3H9OA 4YJOA 2QD9A 4FG8A 4EH9A 4IB0A 1JWHA 3NDMA 4FNWA 4UYAA 2W17A 2B9IA 3H10A 1G5SA 4KWPA 4A9TA 1UVRA 3CS9A 4ZOGA 3FL4A 5DOSA 1QMZA 3PTGA 4IH8A 4ZY6A 5JGDA 2ZJWA 4XOYA 4HPTE 3RMFA 5AEPA 3G51A 3LOKA 3MB7A 3MFSA 3MH1A 3QYZA 2P2HA 3EJ1A 4H39A 4YJTA 5AMNA 3FLYA 1O6LA 4RPVA 4BFMA 5KBRA 3RPSA 1WBTA 4EWHA 5A9UA 4M0YA 5AM6A 4FV3A 4UBAA 3ORXA 2J2IB 1OUKA 3DLZA 3FDNA 4FBXA 3UG2A 3NGAA 5L3AA 3NUUA 5C8MA 5D12A 3E8NA 4K9YA 2FB8A 2G01A 5HIDA 2ZYBA 4JDKA 4MBIA 5GJFA 3UG1A 4JT3A 5CVGA 3WYYA 4BDBA 4W9XA 4Y5HA 2CKEA 2OU7A 3DNEA 3LZBA 4WNKA 4F65A 3MJ2A 4XH6A 5E7RA 4JAIA 4BN1A 2B55A 2E9PA 4OTFA 4ZSGA 3ELJA 3LFEA 2GCDA 2G2IA 5L2TA 4IZ7A 4Y95A 2VZ6A 4TTHB 3ZO3A 5C9CA 4F9CA 3C50A 1AD5A 4HVHA 4L53A 2SRCA 4BWPA 4D2WA 3ZZEA 3LCKA 4MXZA 3AC1A 3L8PA 1J7UA 3PJ2A 1OL5A 5L6WL 4II5A 1JKSA 4UYNA 2WMUA 4KB8A 3FKLA 2QONA 2XBJA 4ZS0A 2WOUA 3MBLA 3FWQA 4BF2A 4C4IA 4F64A 1ND4A 4AZEA 3ZYAA 2BIKB 2GTNA 2I0HA 4ANBA 3MESA 5FP6A 5I9YA 4U41A 2PULA 4G2FA 4ZSEA 5I9UA 4GS6A 2OLCA 3U55A 2XIYA 1IEPA 1LEWA 2JBOA 3JY9A 2XK3A 2XK7A 3SOAA 1WBPA 3VJNA 2GQSA 4Z7HA 5JEBA 3ACJA 3RM7A 4FV6A 4MWHA 1P5EA 2GQGA 4FNXA 4IXPA 3K3IA 3R7GA 4XX9A 4YBKA 3EN6A 4U8ZA 5AIRA 5FEDA 1Q8ZA 3E64A 3TDWA 3HECA 4I20A 1FQ1B 3P08A 3GOPA 2LGCA 2WMAA 2VTNA 4V0GB 4F4PA 3HZTA 3HDNA 3QTIA 4PUZA 3CTQA 2WU6A 3W2QA 1BYGA 3MPTA 5CSWA 4L44A 3ZFMA 3GCQA 3F7ZA 2V55A 5KCVA 2FSMX 2GHLA 1XHAA 3R9DA 3G0FA 3EFJA 4FVPA 4R8QA 2XB7A 5AP6A 5M06A 2J0MB 5CS6A 1ZARA 4G5PA 5DWRA 3QQJA 3EN4A 5LOHA 1UU7A 3TNWA 4DT9A 4BDEA 4FTCA 4TWPA 2OF4A 4ZZNA 2C5NA 3W8LA 3P7BA 2WQNA 2WEVA 3SC1A 1F0QA 4NH1A 4YPSA 2YWPA 4YPDA 3LMHA 4AUAA 3EYHA 3HX4A 4JIKA 3DKCA 4MF0A 4CFFA 1Q41A 4RVLA 5C8KA 4NIFA 3GU8A 4ORKA 3MPMA 4JVGA 4QPSA 4USEA 3L9PA 2PU8A 4W8DA 3CP9A 5CEKA 3KK8A 5IZFA 4E26A 3R02A 2C3LA 4QMOA 5LCJA 4MD9E 1TQMA 4YSMA 4MYGA 3NUPA 4S2ZA 5LARA 4GEOA 2IW6A 4FIGA 3ZRLA 4CMUA 1H1PA 4D2TA 5JGAA 3GEQA 3UP7A 2W96B 4DH8A 1J7IA 4U79A 4FX3A 5DHJA 4TY1A 3R71A 3WIKA 4TYGA 3Q4TA 2ZV8A 3NVKI 5A46A 2QLUA 1PXJA 4U80A 4PNIA 5L8KA 3DAEA 3N9XA 4D1XA 3WZJA 1NY3A 5DIAA 4U0IA 1YWNA 1UU9A 1GAGA 1XWSA 4IMYA 5E8ZA 5J9LA 2GNIA 4PPAA 3AC2A 4NU1A 3NNVA 1P14A 5IUHA 5K4IA 2XK6A 3OWKA 3CD8A 3VBVA 3MIYA 2IVSA 4DGGA 3C5IA 3WYXA 3ZSGA 4BYJA 2JD5A 5IA0A 3LJ1A 1A06A 2WIPA 3UVRA 4FEQA 2WPAA 5CF6A 3D7ZA 1GY3A 3VNTA 3ERKA 4GT3A 1Y6AA 3O8TA 4IVAA 3ANQA 4EONA 4OTHA 5FXQA 3ZZWA 3MVMA 3IW5A 5H3QA 5L6OA 5DR2A 5AP0A 1XH6A 3UZRA 4S34A 3LXLA 2IO6A 2Z7SA 2HW6A 3QC4A 5FBOA 2QODA 4BY9E 5AP4A 5E1EA 4HYSA 2VTTA 2W4KA 3MH0A 2YM6A 2A1AB 3OD6X 5H8GA 1WZYA 2XVDA 4G6NA 3WE4A 4D2SA 1PMNA 1FVVA 4J52A 4M69A 2ITWA 5IQGA 2WTCA 3IS5A 3VS4A 1ZRZA 3VJOA 5EQPA 4FSZA 3E87A 3MSSA 4B7TA 4L46A 1HOWA 5DEWA 5F1ZA 4GMYA 2XCHA 3W8QA 4TPTA 4N6YA 4Z7GA 3NEWA 2FSTX 3C1XA 4DTKA 4EH4A 4ANMA 4ANSA 2OJGA 3OOMA 4QYGA 4XYFA 4C4EA 2XNOA 4I1ZA 2VWXA 4YHJA 4QYYA 3KVXA 4WG3A 5HD4A 3GCVA 2F57A 2YAAA 3FBVA 2W1IA 2B4SB 2ITPA 3ULZA 1PXNA 3VN9A 2QVSE 4EH3A 4I5CA 1Y8GA 4HCTA 4RJ3A 5AIKA 4R77A 3DTWA 4CVAA 4JXFA 4QT1A 4YJSA 1G3NA 3EQRA 2IWIA 3ZDIA 3SG8A 2XIXA 3BZ3A 4YTIA 3IGGA 5JN2A 3TG1A 1YXUA 4UXLA 3ATSA 3BLQA 1Z5MA 4ACMA 2HWOA 3LCOA 3TZMA 3I5ZA 2NO3A 1XH4A 1QPCA 1QCFA 4ZTQA 4HYIA 4WT6A 3RHKA 4KBCA 3DJ6A 3PE2A 4PX6A 3ZM9A 5CEMA 3FI2A 2NRYA 3LM5A 3ZBFA 3GB2A 4EBVA 2B54A 2R0IA 3OCGA 1Q62A 4FGBA 3UMXA 4M66A 4ACCA 5FDPA 4O21A 4QP3A 2BRHA 4I6HA 3SW7A 2OH0E 3E7OA 3RK7A 3QCXA 4L45A 1YRPA 4H05A 2CN5A 4FKWA 3CSVA 4XLVA 2J5EA 1TQPA 2XK9A 4QPAA 3GP0A 4QP8A 4D2PA 3EQBA 4K8AA 4ENXA 2CCIA 4CT2A 4QRCA 3BV2A 5AAEA 3E62A 3EQDA 3HUBA 4DFBA 4XCUA 4RJ8A 3V6SA 2VV9A 3UYSA 4IAYA 4HVSA 2QLQA 4QMLA 3NUSA 3MA3A 3AD5A 4R3CA 2J90A 4XP3A 4BYIA 4E1ZA 5IG1A 2CKOA 3TDVA 4HVDA 5CZHA 3TKUA 2HCKA 3HRFA 4D4VA 3Q96A 3V5LA 1STCE 2CMWA 4PPBA 2W1FA 3U6IA 4AT5A 3Q52A 1H0WA 4YZBA 3QRTA 2GQRA 4BB4A 4V0GA 3RKBA 4BWXA 3AT2A 2X6EA 3QQKA 4JBOA 3LFBA 4D0XA 3CQEA 1Q61A 1T45A 3QD2B 4AOTA 3WBLA 4TNBA 5C4LA 1OECA 2X39A 2XNEA 3G33A 4GRBA 5IH5A 2R3HA 3C4FA 1GZNA 4MVFA 2BHHA 5C1QB 4CKRA 3QZHA 5BUJA 1GZ8A 4KNBA 4FKOA 1IR3A 4WHZA 3WF5A 4J98A 2VTRA 4G6LA 3VS2A 4GIIA 4A4OA 5A4CA 2XUUA 3R9OA 4FE2A 4EEVA 3POZA 4I5HA 4RLKA 3FHIA 5GJGA 3AMAA 2ZAZA 2IVVA 2C6MA 3QD0A 3HL7A 5HVKA 4IC7A 3DKFA 5E8YA 5T68A 2GS7A 4O7LA 2PPQA 4NL0A 2W05A 4LGHA 4YZCA 5K5XA 3DBEA 4AN3A 5KMLA 3KCKA 3LCTA 4BIDA 4LM5A 4FKJA 4FR4A 3FMNA 5B2KA 4EOMA 5JSMA 2V7AA 2Y8OA 4RQVA 3V01A 5GZAA 4FKUA 1OKWA 3BIZA 3LQ5A 2CGWA 4MH7A 1JBPE 3RVGA 4O27B 3BHVA 1TQIA 4ZZMA 4YTCA 3ETAA 3G2FA 5JZJA 1PRYA 3VS3A 3PWDA 3QRKA 4CCBA 1JQHA 1YXVA 3B2TA 3OROA 4Y85A 3CPBA 3DXQA 2UVZA 4R78A 2VD5A 4MBJA 3RK9A 5KO1A 4FF8A 4MXOA 4DH3A 5B2LA 5CU0A 4I5PA 3HGKA 4IX3A 5AUUA 4JBPA 2XEZA 5E90A 2O63A 2CLQA 2UZEA 2YFXA 3QCSA 4WRSA 5J9YA 3WF8A 4BCGA 4ACHA 4QMXA 4O7RA 2RFSA 2OG8A 2R3OA 5CF5A 2IZTA 3M11A 2X7FA 5I9VA 2W5BA 4AFJA 1PYXA 3F5UA 4FNYA 3QFVA 3CGOA 5BMMA 3GENA 4N6ZA 2VTPA 3F2NA 2PVLA 2DWBA 2VWWA 3ORPA 1R0EA 2P2IA 3G0EA 3H9FA 5I9ZA 1ZOHA 5CF8A 3WI6A 2VUWA 4G3EA 4BIBA 1B38A 4W4YA 5GIOE 2UW0A 4D1SA 4XG3A 4FMQA 2A0CX 4FSWA 4LFIA 2WMTA 4FODA 4GK3A 4J53A 4HZRA 4W8EA 2VX3A 1EH4A 4X6RA 2I6LA 5AP3A 4IZYA 4O91A 3OF0A 3IDCA 4BBEA 2CKQA 2OFVA 3VBYA 1W98A 4RRVA 1KUTA 4IM0A 4AF3A 3DZQA 3DLSA 2F7ZE 3B2WA 3ORLA 4I24A 2EU9A 3FQSA 2GNJA 2WAJA 5DA3A 2RIOA 5AV4A 5DRDA 3G9NA 2KULA 3AD6A 3QWKA 1IRKA 4X2KA 5CVHA 4BDKA 5I9WA 3QRIA 3IW8A 4BKYA 4RA5A 1YVJA 2C3JA 3A7GA 3COHA 2CGXA 1H07A 5HO7A 2HZIA 1PXKA 3DFAA 4FG9A 3RINA 3ORNA 2ZM3A 5HD7A 1FGIA 3OT3A 4L7FA 2E9UA 4AN9A 4EH5A 3HYHA 3PPKA 2ERKA 2X6DA 5BVEA 4XP0A 4YJVA 5HNBA 4BTFA 2Z2WA 3A7FA 5BPYA 3UO5A 1FVRA 5HIEA 5HCXA 3DBFA 3QZIA 4QYEA 5JFXA 2J4ZA 2OIDA 4YLKA 4DINA 2P4IA 4AFEA 2YZLA 1JLUE 5TE0A 2PVJA 3FI3A 4FEVA 1VR2A 1KSWA 3MS9A 5CU6A 3OG7A 1OUYA 4B0GA 2X2MA 4I93A 2WZJA 5E8TA 4PTEA 3EQFA 3VRZA 4ITIA 3PDTA 4YC6A 3MGYA 1PF8A 2O0UA 1GZKA 3FMJA 5ICPA 4I21A 4HCUA 4L3PA 4EHGA 4CYJA 4YJUA 4W4VA 4EOJA 3W2SA 5BUEA 1H25A 4FT3A 3LQ3A 5EQYA 4KKHA 1MUOA 3K2LA 3NRMA 4IB1A 4RMZA 4RX5A 4PP7A 3R7YA 4O96A 4WO5A 4Z55A 5BQ0A 4Y73A 2XIRA 4HJOA 3FLZA 4FV9A 3LVPA 3TUCA 3AT3A 4NCTA 3PLSA 4J7BA 2ETMA 4PF4A 4EQCA 3COKA 5LMKC 5C4KA 2VX1A 1KE7A 4QMZA 3EH9A 1U59A 2XNBA 3EN9A 3UC3A 5JT2A 5CAPA 1F5QA 3BYSA 2R3QA 3QGWA 4RC4A 3UNJA 5IQAA 1Q97A 2WELA 1OBDA 5L2IA 4O22A 4BRXA 4FIFA 3NIEA 3R8ZA 4HZSA 4YJNA 3VUHA 2C30A 2J0LA 2R3NA 3PPZA 5E91A 2YJSA 3RTPA 4EKKA 4LOOA 4ITHA 3REPA 3KF7A 2IW8A 2QHNA 5HBJA 4PDYA 4F9YA 4IBMA 2C6DA 1YWVA 3LMGA 4A4XA 3TV6A 3JR1A 4BC6A 4A07A 2ESMA 4G3GA 5HBEA 4M84A 4ACDA 3PVBA 4Z9LA 2O5KA 4PY1A 1APME 1FGKA 3PZHA 4MF1A 3QD3A 5DGZA 4NM7A 3H0YA 3FHRA 4NJDA 5ACKA 5M4FA 2GHGA 1NXKA 3V8WA 3JYAA 4I6QA 2EXEA 3PIYA 4AGUA 4IAZA 4GJ2A 2UZVA 4C36A 4DCAA 4YC8A 3MH2A 2X2LA 4BCNA 2BRNA 3S00A 2QKRA 4A7CA 2OSCA 5EM6A 3M2WA 4RZWA 4FVRA 3ROYA 3T9TA 4QNAA 3ULIA 5M07A 3LHJA 5CT7A 3V5PA 4AZWA 3DXNA 2OXYA 5ANKA 3I60A 4FT7A 2GFCA 5H8BA 2RG5A 4X6QC 4EI4A 5K5NA 1BLXA 4IIRA 4D4RA 2CN8A 4ZIMA 4BHZA 3W55A 4G5JA 3ZUTA 2Z7QA 3NUAA 3TNHA 2Z7RA 4BVUA 1G8SA 4O7YA 1YI6A 4O7TA 3BX5A 4FT9A 3C51A 2VO6A 2XNGA 3KL8A 1RQQA 4BCHA 2PVYA 3C7QA 4M7IA 3ET7A 3FZRA 3JVRA 3BHUA 4ALUA 4BBMA 5A4TA 3UOJA 3EFWA 2OFUA 3R22A 3OMVA 4EK3A 3GU6A 2JKKA 3TKHA 3HA8A 3QGYA 5E8UA 5IA3A 3C0IA 1ZYCA 4GK2A 2UW3A 3QCYA 5CEQA 3ATTA 1JKLA 4FTIA 5HNGA 3BWFA 4AU8A 5K0KA 4NFNA 4OTDA 5GJDA 1OMWA 2QNJA 3LKMA 3LCDA 3OTVA 4KUJA 5AFVA 2WO6A 1WAKA 3V6RA 4F70A 2R3RA 4IB5A 3BV3A 3LE6A 5CSHA 4AP7A 1ZMVA 3LFDA 4DCEA 2VO3A 5FGKA 4ZAUA 4O0YA 3ZC6A 5HKMA 1VYZA 1DI8A 5EM5A 5ETAA 3FKNA 3K3JA 4Q5HA 3PPJA 2GNLA 4GK4A 2OZAB 1Q3WA 2QR7A 3CY2A 3D7TB 3UVQA 4R7IA 4IM2A 4ENYA 4DEDA 2R3JA 4S31A 3IDPA 4FL3A 3MVJA 2HXQA 4B6LA 3E63A 3O8PA 4QP7A 5AR4A 4ZLYA 5HLWA 2Q83A 4I94A 5C27A 2BMCA 4QTCA 1JSUA 2C47A 2PZIA 3I81A 4E6AA 1J7LA 4RJ5A 3DXPA 4K11A 2A27A 2CCHA 4ZTLA 3ZH8A 3R8UA 4BKZA 4AZVA 5EQEA 2C6KA 3DKOA 3Q60A 4RWIA 3R9HA 3ZHPC 4E6DA 4DH7A 3A61A 5AUTA 5IQHA 3PJ1A 2YM8A 3QRJA 4LG4A 3Q9ZA 2W99B 5DN3A 3GBZA 4HYUA 4OTRA 4UMTA 3NAYA 3EHAA 3FMDA 3GI3A 4NM0A 3FE3A 4HW7A 4DGOA 4RWLA 1XH9A 4DBNA 3O50A 1KE6A 4FSMA 2UZUE 4S30A 3C9WA 2OXDA 4AWIA 4D55A 5JFWA 3OXTA 3UNZA 1ZZLA 2JBPA 3W16A 2UZOA 3R1NA 5LVOA 2VTJA 4LMUA 4ASDA 4G1WA 4F9BA 3BKBA 1Q8YA 3EIDA 5TO8A 5KHWA 2WMBA 4FTRA 1ZYSA 4IAAA 5HE2A 3BELA 3CTHA 2XNNA 5A54A 3F9NA 4FKLA 2ITQA 1SVEA 3DY7A 3GUBA 4BDHA 4EQUA 2WMVA 3EZRA 3PZEA 2F7XE 4BZDA 4O6EA 1JVPP 4ZLZA 5IUGA 4FKPA 1OL7A 3BGQA 3MV5A 3R7IA 4C2WA 1KWPA 1XO2B 3NYOA 4RQKA 3OEZA 4DG0E 3D0EA 5AP1A 2R0UA 4GFMA 5IQDA 5FBNC 4M3QA 4MXYA 4PRJA 4FKGA 5JRSA 4D9UA 3Q4CA 4C33A 4CGAA 3OP5A 4CFVA 3H3CA 5J95A 5BVFA 1ZAOA 4I4FA 2CPKE 2ZDUA 4BZNA 2BILB 3R8VA 4F6SA 4TW9A 3NR9A 4O7ZA 2VTQA 5GINE 3KY2A 4E6CA 4BGQA 4EK4A 5BVOA 4O0TA 4EHVA 4QQTA 2YM7A 2XJ0A 4A9YA 2QU6A 2BRGA 2OW3A 3LFNA 1DS5A 1ZYJA 3LJ0A 1JSVA 4LRJA 4RWJA 4YBJA 2DYLA 2BKKA 4C62A 4O0UA 1OIUA 1QPJA 2C5OA 2W1DA 2XIKA 3MYGA 4IFCA 4IQ6A 4ZP5A 1XH5A 4G6OA 2PUNA 1V0PA 4ASEA 5EOBA 3BQRA 2P3GX 5J1VA 4ANOA 1WFCA 3FPQA 2UZLA 3CEKA 3TTJA 3VWAA 2X9FA 1E1XA 4HOKA 1H4LA 2W7XA 1HCLA 2XJ2A 3NMUF 4IVCA 5FTGA 3G5DA 4JI9A 4XRJA
chains in the Genus database with same CATH superfamily
4QTBA 4FIEA 5CY3A 3Q3BA 3NWWA 2CSNA 2F7EE 4L67A 3TNIA 2BZHB 2ONLC 1OBGA 5JH6A 3R1YA 2RF9A 3HMMA 3CJGA 4FTAA 4XV9A 4F7LA 2J50A 3CQUA 5LVLA 5KMOA 4FVQA 2UZBA 4XLIA 5AUXA 4IE9A 4QP6A 1O9UA 4YZMA 4XBUA 2XRWA 2XYNA 2BR1A 2ITZA 2W4JA 1WCCA 3KU2A 4K2RA 4UZHA 4X3FC 3RJCA 2C4GA 3DNDA 1OIRA 3NZ0A 4DE4A 3PLAE 4U43A 4DAWA 5GNKA 5EI6A 5KMNA 3T3VA 2YDIA 5HI2A 2WD1A 2FSOX 2PUIA 5J79A 2OJIA 4BDDA 3TTIA 1REJA 3W2RA 3SHEA 5LWMA 3D9VA 4OAVB 4MX9A 3E3PA 2BDJA 3KQ7A 4C4JA 3AT4A 5AR2A 3TNPC 3V51A 4BTMA 3BU5A 4PL3A 4QQCA 5CU3A 1K2PA 3LLAA 5BYYA 2F2CB 5EDPA 1O6KA 2VTSA 5BVDA 1UNGA 3AOXA 2PZYA 4BDFA 4TL0A 5A6NA 3MIAA 2CKPA 3R8MA 4CFWA 5E9EA 2OO8X 4EH2A 5KBQA 4U45A 4JJRA 5E8XA 4BL1A 2QQ7A 5EH0A 3F7WA 4MWIA 4E4LA 1R3CA 4QP2A 4PTCA 3PVWA 1KV1A 1CM8A 4U81A 1CMKE 1Y8YA 4U5JA 2BAQA 3CE3A 3F3UA 3WIGA 5JK3A 3FAAA 1SNUA 3O96A 1URWA 2OJ9A 4KS7A 4FTOA 4PMMA 3RI1A 4X2JA 2CNVA 4QP1A 2C6OA 2E9VA 3L9MA 5H9BA 2VNYA 3BRBA 2NP8A 4C38A 5BV3A 2YDKA 5EKOA 3IO7A 3AG9A 4JR7A 4MXAA 4QD6A 5HLNA 1WBNA 3TZ9A 5CNNA 4E3CA 1M17A 3BPRA 3GXLA 4BI2A 4H1MA 3E93A 5ANDA 2E2BA 2JDRA 2OZAA 3D7TA 4CTBA 2GS6A 3BCEA 3CKWA 3VQUA 4IWPA 2W0JA 2YACA 3COIA 2CNQA 2ITVA 5CSPA 2YERA 4MQ2A 3DU8A 4FV8A 3W2PA 3UC4A 4AOIA 4UMPA 5CAVA 5CI7A 5LQFA 3UBDA 3QKMA 5DBXA 3A8WA 2W1EA 3ZEPA 2BDWA 4APCA 5IPJA 4BIEA 4P7EA 3QA8A 3RAWA 1KE5A 1W2DA 2JIUA 3DA6A 3HLLA 4GYIA 1YKRA 4K33A 3RNIA 2ERZE 4IW0A 5EW9A 5DT4A 2Q0NA 1YHVA 1UWHA 2PE0A 2VX0A 3BU3A 1Q3DA 2P33A 3QA0A 4ZY5A 1UKHA 2YWVA 3SW4A 3DAJA 3T9IA 3GQIA 5HGIA 2QO9A 3R73A 1REKA 3LXNA 4ZSLA 1WBOA 1LR4A 3O5AA 4RX8A 4A4LA 4MHAA 5TR6A 3QTQA 5HU9A 2R3KA 4TRLA 3BLHA 4ERKA 5IA5A 1IASA 4IDVA 4ZJIA 4X7QA 4QPMA 3TYKA 4M13A 2BALA 5A4EA 2BIYA 4HGTA 4YTFA 1L3RE 3OWJA 5DEYA 3WZDA 4HVGA 4ARKA 4ASZA 1A9UA 3UIBA 4GFOA 1I44A 5T6KA 4JQ8A 4CG9A 1ZYLA 4W9WA 4O6LA 4OTGA 4KIKB 4BTJA 5JKGA 3HV6A 2HIWA 2FA2A 2WQMA 3PP0A 2ONLA 4BBFA 3RK5A 5ANOA 3FC2A 4H3BA 3CQWA 4DF3A 4FTQA 1OITA 5HCYA 3R7UA 5CT0A 2HAKA 2VWIA 2X8DA 3WZEA 4C8BA 5DT3A 5IUIA 2V22A 4APPA 3WF6A 4AX8A 5IQBA 1MQBA 3P7AA 4C3PA 4KS8A 3IK3A 2GSFA 1GNGA 2UV2A 2H96A 5AUYA 4FUXA 3R1QA 3Q2JA 2OZOA 3GU4A 3GT8A 3CJFA 2UW5A 2QOQA 4TNDA 5CF4A 4K18A 3UODA 4FSTA 4GG7A 5BX0A 5CXZA 4FT0A 5FDXA 5JQ5A 2P0CA 3TEIA 3KA0A 4O82A 1Q8WA 2DQ7X 4O7VA 1YWRA 1YXXA 2HZNA 2JKMA 5H8EA 4EOQA 2RFNA 3PG1A 4I22A 4F1OA 1FBNA 1W7HA 4BDGA 4GKIA 1CKIA 4GVAA 2JDOA 3FYJX 5CI6A 5IH4A 3QHWA 3KCFA 4DYMA 3JS2A 5KKRC 3Q32A 3KB7A 4DH5A 3RZBA 3VBTA 5GIPE 3HRBA 2F49A 3W18A 2G15A 2WKMA 2H34A 2LAVA 1YOMA 2VWVA 3U9NA 4F6WA 4UN0C 4DBXA 4J1RA 1H24A 4QMVA 3LMIA 2HZ0A 3E3BX 1V0BA 2PVFA 3RCDA 3FZOA 2ZV7A 4CD0A 4XP2A 1MRUA 1DM2A 3NSZA 4DFZE 1BX6A 4OLIA 4QMNA 4AGCA 3FLSA 4ZZOA 5D41A 3NVMB 3WARA 2JEDA 1FPUA 3TT0A 4Z3VA 4QMPA 3TI1A 5I4NA 4LRKA 4TZRA 2CHLA 2PMIA 3NLBA 4WNMA 4FSNA 5EM8A 4QYHA 4DFYA 3QD4A 2XM9A 4O7NA 3W2CA 4FTLA 1H1SA 3P0MA 4P5ZA 1OKVA 3TCPA 3F5XA 3HV5A 5AV2A 4J97A 1XH7A 4G3FA 4R3RA 4EL9A 2QOIA 4U9AA 2XJ1A 3KRJA 3QKLA 2EVAA 5TKDA 3A7IA 4Z16A 3JVSA 3FI4A 2YHVA 4O0SA 4HCVA 4FSYA 4BDIA 2WMXA 5CVFA 2QOBA 3UE4A 3QUDA 2ZB0A 5IDNA 2R3GA 4UWYA 4YZ9A 3HMPA 4NT4A 1JPAA 1Q5KA 3DPKA 3Q4ZA 4EHEA 4L6QA 4DN5A 3FUPA 2OXXA 5LXMA 5IKWA 5F4NA 2V5QA 2PVMA 4IZ5A 3ODZX 4JR3A 5CSVA 2VTLA 3OY3A 3CPCA 1OL1A 2PZ5A 3LQ8A 4JIAA 4W4XA 1R78A 4ASXA 1XBAA 4EYMA 2UW8A 3KREA 2BKZA 3FQEA 4JLCA 5JGBA 2G9XA 2JIVA 2C6LA 4EOKA 1CTPE 5M56A 4CQGA 5I5ZA 4I6LA 3AC3A 4LV7A 4XV2A 4PMTA 4M8TA 3F3VA 3VQHA 3KC3A 5GZ9A 5FQDC 4KAOA 2QURA 4CKIA 3D83A 5F95A 3D5VA 1PXIA 5KMIA 5CWZA 4RLLA 4XV1A 5DVRA 2UW4A 3M1SA 3FL5A 3E5AA 4ANLA 3S0OA 3E7VA 4H1JA 3A62A 4J99A 1BI7A 4NTSA 2Y6OA 4X2GA 4AACA 1CKJA 4FKIA 4BDCA 3C4EA 2PL0A 4LQMA 3UMWA 5A4LA 3BE9A 3PXYA 2BTRA 3DGKA 3R9NA 4CFMA 2RSVA 2ZM4A 3AMYA 3BLRA 2PVKA 1W82A 4O4FA 4WRGA 3V04A 4PNKA 3UP2A 5AA9A 2YCSA 4KA3A 2Y4PA 1H8FA 2IPXA 2WQBA 4DGLC 5AADA 3ZOSA 4JL9A 4ZK5A 3ACKA 2RG6A 3GOKA 3QZGA 2DUVA 2J0IA 3W33A 2WMRA 3LIJA 3PY1A 1BUHA 3ZU7A 4ZMEA 4F0IA 3UNKA 4P4CA 3NYXA 1IG1A 3MY1A 5AM7A 5EKNA 3IPHA 4O1PA 1PXOA 1BI8A 2GU8A 3LFSA 4FV2A 1GIHA 3C0GA 1M14A 3I0OA 5EFQA 3ZLSA 2XANA 1WBVA 4EOOA 3DFCB 3HEGA 4F08A 3PJCA 3VC4A 1G8JA 5DT0A 3R7VA 2XM8A 4IX5A 2GMXA 3Q4UA 2XA4A 3QC9A 4NW5A 4RZVA 3FI8A 4BCPA 3EKNA 3PIZA 1W0XC 3Q53A 4DFXE 4DC2A 2EB3A 3QCQA 4F6UA 4IHPA 5IDPA 2Y9QA 3WE8A 2J5FA 1LEZA 2WOTA 3VF9A 4NZWB 4OBQA 3QZFA 3H9RA 4F7NA 5L2QA 3UO6A 1XKKA 2OICA 3ZDUA 5KZ0A 4KIKA 2UVXA 4YHTA 2YLFA 5ANGA 4DFNA 2PE2A 3OUKA 4FKVA 1SVGA 3FLWA 5A3XA 2O3PA 4YURA 4E4XA 2QOKA 1P4FA 4AQCA 4QMUA 4J8MA 4LOPA 3MWUA 4EQMA 4FNZA 5IH6A 1FMKA 2C5XA 4B8LA 4G17A 3FYKX 2O8YA 2PVNA 3KRXA 4DEEA 5L6PA 5E8VA 4BI1A 4KRCA 3BQCA 1K3AA 4LV5A 1OM1A 4O0WA 5AJQA 3K5UA 3MVLA 4DG2E 2YM4A 5K0XA 4PPCA 3PSDA 1IA9A 1UV5A 4DA5A 4X21A 3PRFA 1B39A 4FTNA 3K54A 2X2KA 2PHKA 4IAIA 3ROCA 1XBBA 2GDOA 3AGLA 3LFQA 3OVVA 2CGUA 3F69A 4PL4A 3I7BA 3WZUA 5LVMA 4FEUA 3O51A 4RIWB 2PSQA 2BCJA 5FXSA 2PUPA 3HKOA 4FZ6A 2JAMA 3BHHA 3FJQE 4KSPA 3BE2A 1AGWA 2OJFE 4FK3A 4XMOA 5E1SA 2VN9A 3PA3A 4FSRA 4LI5A 5F94A 5M55A 3DTCA 4DHFA 3OUNB 4QMQA 3RZFA 5CASA 3D5UA 3ENHA 3A7JA 2R3FA 2RKUA 2OGVA 4L9IA 2JGZA 5ANJA 3R30A 3QUPA 2F9GA 3V5QA 5C8NA 3GQLA 3UOHA 1VJYA 4TYIA 1ZWSA 3KN6A 2ITUA 4TN6A 4CMOA 4YO4A 2NNWB 5LMBA 5ACBC 4MK0A 2AYPA 4CXAA 4QMTA 4R1VA 3R21A 5G1XA 4BGHA 2YIQA 4R6VA 3PP1A 4U44A 4PMPA 5CQWA 4YMJA 5FM3A 4YJRA 3AKKA 1SVHA 3OBJA 4MD8E 2FUMA 4AAAA 4E73A 2J9MA 5L4QA 1MQ4A 2IEWA 2BRBA 3C5UA 3LFCA 4OGRA 2YIWA 4O2PA 4XOZA 2WTKC 3ID6C 5FEEA 4IX6A 2YIXA 2QU5A 3IOPA 4Y8DA 2OI4X 3TUDA 5DR9A 1ZLTA 5CZIA 3V3VA 1H00A 4KKGA 4U6RA 5HESA 3KIOC 3N4UA 2GPHA 2CGVA 1WMKA 4I23A 3TKIA 4BZOA 4FEXA 4MD7E 5HLPA 4WSQA 3TN8A 2HY0A 3LAUA 3PUPA 1YDTE 4IB3A 3UZPA 5AV3A 3UPZA 1MP8A 4WNPA 4FV0A 2FYSA 5I9XA 1U4DA 4HYHA 4UY9A 2H8HA 5DYJA 4DG3E 2OBJA 5ETIA 2PMNX 3LPBA 3ALNA 1OI9A 3PFYA 3K5VA 3V5JA 1X8BA 4IAKA 4D2VA 2WNTA 2QCSA 2WTIA 4Q5EA 3VUMA 4BI0A 3I1AA 2UW7A 2X1NA 4Y5QA 4A9SA 1NA7A 2BDFA 4LUEA 1OL6A 4EK6A 4KKEA 1W83A 2JFLA 5AX3A 4BCJA 3EL8A 5KMMA 3MH3A 3QWJA 4FG7A 4GUEA 4CT1A 2B9HA 5CLPA 3O7LB 4D5KA 4F63A 2BPMA 2ZVAA 3VUTA 4ERWA 4M15A 1DAWA 3PY0A 3F3ZA 4OBPA 3ZLWA 4C57A 4K0YA 4BCFA 4RVTA 4NM3A 2WB8A 2X8EA 3OBGA 5CEIA 5CEPA 3ENMA 3H30A 3L8XA 1JSTA 3CXWA 3LM0A 4ZSJA 3VUGA 5J8IA 2GNGA 4EORA 3UYTA 1OL2A 2I1MA 4AZFA 3BGZA 5D9HA 4BHNA 5DG5A 4L68A 1SYKA 4EK5A 3QTSA 4C3RA 4RSSA 1ST0A 5EM7A 4D0WA 1H01A 2V7OA 1PHKA 3UZTA 4DITA 4XJ0A 3VAPA 4U42A 4I0TA 4CNHA 3H0ZA 4AXDA 3EYGA 3OS3A 3EFKA 3BL7A 5JZNA 3E88A 5L8JA 2PYWA 2C6IA 4X3JA 3S4QA 3W0NA 5AWMA 3SA0A 1PXLA 3FMKA 3KXMA 4IJ9A 2W06A 4IVBA 4UEUA 4WG4A 3AC5A 1J1BA 3L8SA 3RP9A 5G6VA 5HEZA 2G2HA 4DFLA 4RVMA 4AW0A 4E4NA 2DS1A 2B1PA 3D94A 3SXRA 4O86A 3OTUA 4YTHA 4DEGA 3EQHA 4GIHA 2QO7A 4FJVA 2XK4A 3DZOA 3WILA 3D14A 2IW9A 1Z9XA 5JMSA 4EK8A 4CRSA 4GT5A 5AV1A 3JY0A 5IQEA 2G2FA 4AXFA 4FTKA 4R1YA 3COMA 3ZSHA 3ZFYA 3HAVA 1UNLA 1M7QA 4MXCA 1NVRA 4DHIB 5H2UA 3AQVA 2VWZA 4RGJA 3T8OA 2Y0AA 5AX9A 4L3LA 1OZ1A 2IVTA 4JOAA 2O2UA 2Y4IB 4RX7A 4CG8A 5HX6A 1TVOA 1DI9A 2OKRA 2XMYA 5IQCA 4K1BA 3VHEA 3SKCA 3UQGA 2EB2A 3A4OX 3DS6A 1NW1A 1LP4A 2FO0A 3RALA 3ZUVA 4AT4A 2NYAA 4GH2A 3R8LA 4DGMA 5AUWA 3MI9A 4AA5A 1KV2A 4YGAA 3OWLA 2E9OA 4F1MA 4F99A 5K9IA 2B7AA 3I5NA 4RA4A 3SLSA 3ZXZA 5CTPA 3IGOA 1M2QA 3A60A 1YI4A 2RFDA 3DDQA 4IZAA 4Y83A 5B7VA 5M4IA 4L42A 3V5WA 3RPRA 3CLYA 2OH4A 3WF7A 4U97A 4AS0A 3RAIA 3S3IA 1M2PA 4CZUA 4NK9A 5AR7A 4ZMFA 3EKKA 4BCKA 2C3KA 4QNYA 4WG5A 4ZJVA 4M0ZA 3PA4A 4RIWA 4EC9A 2CDZA 4O0XA 3N51A 4MKCA 4TKSA 3SAYA 4XBRA 4RX9A 4E20A 5EDRA 3E92A 4EH6A 5LMKA 5FP5A 4H58A 4E5BA 1SM2A 1U54B 4GU9A 4WA9A 3CCNA 4DEAA 4O0RA 3MFTA 2QOCA 4DEIA 3S1HA 4H3QA 4DGNA 5CAUA 4C3FA 4FV7A 1H1RA 4C35A 2X7OA 3BL9A 4CEGA 3W1FA 3MY5A 3QQGA 4QMYA 3E8EA 5CYIA 3QXPA 2WEIA 3GU5A 3JPVA 5HORA 2XRUA 1Y91A 1ZOGA 3MPAA 4RFZA 5CAQA 4UALA 3RPVA 3OT8A 4I0RA 3TWJA 1ZOEA 3C13A 3CR0A 4UX9A 4I92A 5FRIA 1H28A 4DFUA 2XH5A 4BKJA 2Y4IC 1O6YA 3VS0A 4EJNA 3LXKA 4Y46A 4FICA 4WNOA 4CFUA 4ZS4A 2JDVA 4FIIA 4C59A 3MTLA 3FQHA 2JAVA 4LV8A 2WQEA 4C61A 1KOBA 2PVRA 3GGFA 1BL6A 3I79A 2PUUA 1FOTA 2QOLA 3OEFX 4MQ1A 4WD5A 4NSTA 4X3FB 3QQLA 4E7WA 2ACXA 5B0XA 1V1KA 4J71A 1P2AA 2VAGA 2E9NA 2QOOA 2XKFA 2B52A 1RW8A 3P79A 4Q2AA 3PY3A 4UZDA 3TZ8A 1OIQA 4CLIA 3ZO2A 4XG7A 5GZ8A 2VU3A 2IZUA 5J87A 3RAKA 3TXOA 3GCPA 3EQCA 4LL5A 5CXHA 5AAGA 4J95A 5K3YA 5IF1A 4FV1A 4EZ3A 1NT2A 1UU3A 2BZKB 3NNXA 3POOA 4OTIA 1UNHA 4QP4A 2VGPA 3PXZA 5FG8A 4O7SA 3UJGA 5M4CA 2R3LA 3U6HA 4LGDA 4FL2A 4RC2A 2FSLX 4ANNA 2X8IA 3OOGA 3NYVA 3QTWA 4EBWA 4ALWA 2YZAA 2FGIA 3U51A 4CV9A 4CV8A 2PK9A 3TIZA 1PKDA 1IAHA 3TV7A 3SGCA 3DJ7A 3FMHA 2ZDTA 4IADA 3F66A 4JRVA 3VS7A 4WSYA 4QDVA 3A99A 3UDBA 3VW6A 3DT1A 4NKSA 1OPKA 2J51A 3VRYA 2UUEA 3OC1A 4EOLA 5J5SA 2WHBA 4N57A 3Q9YA 4AXAA 4UWBA 4GCJA 4Y72A 3SRVB 5IQIA 3P23A 4TWCA 2I40A 1Q8UA 4FIJA 4UMQA 2G1TA 3HMIA 2F2UA 3TACA 4B4LA 2QHMA 3FMMA 5C03A 4JRNA 5AP2A 4XUFA 4YP8A 4AT3A 4USDA 3OXZA 1SMHA 4PP9A 3HV4A 5C26A 2EWAA 2Z7LA 4F9AA 1M7NA 4CLJA 3HUCA 2VTOA 5LVPA 4C7TA 3TJCA 2YN8A 5M08A 3PJ8A 3Q9XA 5HNIX 2AC3A 4WIHA 2QI8A 4ANQA 4AW1A 1ZMUA 2W9ZB 3QBNA 5M09A 3UO4A 4LOQA 3VS5A 4EC8A 2YCQA 2WTJA 4GT4A 4BCOA 2R2PA 3PFQA 2RFEA 4JBVA 3H4JA 2ITYA 5HO8A 1UWJA 2R7IA 4OAUC 3FLQA 1R39A 3JXWA 4ZSAA 3CTJA 3AGMA 4F0FA 4L3JA 3MA6A 4EH7A 1I09A 2YCRA 4GG5A 3ZSIA 4YJQA 4DEBA 4ZLOA 3ZM4A 1Y57A 3DB8A 5IISA 4L8MA 4I5MA 4D4YA 3N4VA 2AQXA 5DRBA 2VRXA 4L01A 3BYOA 3KEXA 2BAJA 3F3WA 4E5WA 4G9CA 3MDYA 5AP5A 2PY3A 3NW5A 4GV1A 2WQOA 3THBA 3IDBA 2QC6A 4LMNA 2WXVA 1CKPA 4G16A 5HU3A 1YDRE 2BROA 2OIBA 2XZSA 3LJ2A 2ZMCA 3QQHA 2X81A 1OVEA 3RNYA 3DBDA 4PL5A 4C37A 4AW5A 4QO9A 3FV8A 3L9NA 3GFWA 4RIYB 4W4WA 2WIHA 3W2OA 3PJ3A 5CU4A 2UZWE 4XG2A 5HICA 5EW8A 2YCFA 3LCSA 4G3DA 1ERKA 3HNGA 4H3PA 4GYGA 4IWDA 3R83A 4HVIA 2R7BA 3TIYA 2I0EA 1MRVA 3IECA 2C69A 4FZ7A 4D9TA 3QTXA 5DR6A 2J6MA 1PJKA 1AQ1A 4KIOA 4J8NA 3SXSA 1Z57A 3BLAA 3DK7A 3R8PA 3RM6A 4KINA 3ORTA 4RFMA 3PIXA 4E4MA 4FZFB 3Q04A 4PWNA 2JLDA 4C4HA 2A19B 2OJJA 2X4FA 5FTQA 4D1ZA 2I0VA 4CRLA 5K4JA 4I3ZA 1YOJA 3DQWA 3A4PA 4I41A 2ETRA 4YHFA 3VBWA 4IEBA 3RBWA 3KMUA 5IMXA 1ZYDA 4FKRA 5KZIA 4EOPA 4MNEB 4RT7A 2BFXA 3R0TA 5E8WA 2XNPA 4FT5A 4IANA 4J96A 3UPXA 4BCIA 3ZUUA 3R9RA 1GZOA 5E8SA 2B53A 1TZDA 3AC8A 5AR3A 3DQXA 4FL1A 5EYMA 1OIYA 4DHZA 3DDPA 5KKRB 4KD1A 4S32A 2UZNA 3R63A 4XEYA 5GHVA 3G9LX 4L7SA 3EZVA 3PRIA 5HE0A 4GVJA 3ZFXA 4EHZA 3QX4A 4RJ4A 1U54A 5EYDA 3KK9A 3ZC5A 3Q2MA 2PVHA 3IQ7A 2EUFB 4LDTA 5CNOA 2C5VA 4QYFA 5DE2A 4JQ7A 1JAMA 4FI1A 4FV4A 2Z60A 4M14A 1G8KA 2AC5A 4PMSA 2CNUA 3EN7A 3DB6A 4OUCA 1GIIA 5FD2A 4GUBA 3OXIA 5HHWA 2UVYA 4IVDA 4P2KA 3IKAA 3O17A 4G3CA 4RWKA 4U7ZA 5BVWA 5EK7A 1XMMA 2WTVA 3BBTB 3NW7A 3PVGA 4ACGA 4GFGA 3PYYA 2PE1A 3PWYA 4ZTNA 4FIHA 4O0VA 1Q24A 3P5KA 4U3YA 4UB7A 4GL9A 1QL6A 3EMGA 4EOIA 4YU2A 1Q99A 2GHMA 4CFXA 2QG7A 3R1SA 3U54A 4X3FA 4JNWA 3P7CA 4RG0A 1IA8A 5ETFA 3AKLA 3NUXA 3R04A 3NPCA 4D2RA 2FH9A 3ANRA 2W1HA 3O0GA 3GC7A 4M12A 4FTTA 2R3PA 2R64A 4QTAA 3LXPA 3RPYA 5BMSA 2BFYA 4QMMA 5TOZA 1H1WA 4WBBB 5HTIA 3PSCA 4R5SA 3QQUA 3HP5A 2YABA 3ALOA 3F3TA 2ITXA 3Q9WA 5ANIA 1V0OA 1YOLA 4C58A 1U5RA 2PMOX 3HA6A 4C4FA 5LWNA 1XH8A 2R4BA 3NX8A 2YLEA 3EQPA 5KX8A 4M68A 1M52A 4FOCA 3FLNC 3TV4A 3F5PA 5BUIA 2W5AA 4E6QA 4KBKA 3VS6A 3GC9A 4ALVA 1NVQA 2XBAA 2XKDA 3PXRA 3RPOA 2C5YA 2C6TA 4JDJA 4YLJA 3G90X 3SRVA 4IAFA 4FYOA 3QHRA 1TKIA 4NEUA 3VUKA 2OK1A 2C3IB 3FZ1A 1SNXA 3QU0A 1J91A 4GU6A 3QAME 4LUDA 4NFMA 4PV0A 4WUNA 3UOLA 2BUJA 5HVYA 3S2PA 4JS8A 3P78A 1JKTA 2WU7A 5KMJA 3ML1A 2WTDA 5CQUA 5BYLA 5DFPA 5A14A 2WFYA 3QLGA 2QO2A 5B2MA 2BVAA 1B6CB 3KXNA 1BKXA 3PUFC 3VHKA 2VTIA 3ZLYA 2VGOA 2NRUA 2UW6A 2VTHA 3C4CA 3C4XA 5AUVA 5IMEA 3DK3A 4NM5A 2X9EA 1OKZA 4D58A 5LJJA 2YJRA 4FUYA 5IEVA 4I4EA 3BHTA 4LL0A 2HXLA 2XCKA 2W4OA 4FKTA 3B8RA 4FTUA 4JAJA 3GFEA 5HVJA 4N0SA 1GIJA 4IJPA 4HPUE 2EXMA 4ITJA 4P90A 4ZY4A 2ZV9A 2XP2A 5CAOA 1ATPE 1PY5A 4U3ZA 2HZ4A 5HTCA 3KXZA 3UIMA 3KXHA 3ZCLA 3C4ZA 5LMAA 3KMWA 3UQCA 4N4SA 4RIOA 3G6HA 4V01A 4FV5A 3O2MA 5HE3A 3R6XA 1YHWA 3IW7A 4RIXB 4BCQA 3NCZA 5D1JA 4ZJJA 5J1WA 3MFRA 1JNKA 5LVNA 3I6UA 5EW3A 4IWOA 4CCUA 3MJ1A 4AW2A 4JDHA 3O8UA 5AR5A 4C34A 4FZDB 1U46A 3VBXA 2OWBA 2ZB1A 2YIYA 4RIYA 4FGRA 2YAKA 1PMVA 3GCSA 3QQFA 5E4HA 2YDJA 4D5HA 4C0TA 5AR8A 3OW4A 1OKYA 4EUTA 5BYZA 2W9FB 4CTCA 4XG4A 3DCVA 2PTKA 4X0MA 5EI2A 3HV3A 5KNJA 5HCZA 1PXPA 2XNMA 1YHSA 1G8AA 3CIKA 5L2SA 2HYYA 2IG7A 1UA2A 3F6XA 3QTZA 3OCBA 4YJPA 3NNWA 5HG7A 3EL7A 2ZM1A 5IA1A 3DV3A 3EB0A 3F82A 5EDQA 2ZFYA 3OFMA 4G9RA 1E9HA 4FSQA 3R00A 4QTDA 3UOKA 2C68A 4MNEA 1E1VA 1J3HA 4FC0A 4RVKA 5I3RA 2Z8CA 4BDJA 4A9UA 1W2FA 5ETCA 5HG5A 3PXKA 4AGDA 4BR3A 1HCKA 4MNFA 3ZO1A 2HW7A 3VIDA 3NUYA 3V5TA 4O2ZA 4L52A 3B8QA 2JKQA 1CSNA 4OT5A 1WVWA 5EI8A 5FUTA 1XBCA 2VO0A 2R9SA 1FINA 3QKKA 2PWLA 3OWPA 5D11A 4IX4A 4L00A 3UVPA 4EZ7A 5CALA 1QPEA 3TNQB 4RC3A 1S9JA 4YC3A 3U4WA 4UMUA 2ZMDA 3HMOA 1JOWB 5KUPA 5KMKA 3TM0A 4U40A 4KIQA 3EOCA 2F4JA 4FYNA 1LUFA 3OHTA 4DHJA 3ZS5A 2HELA 3NUNA 5JFSA 4R7BA 5T3QA 3RCJA 1ZXEA 3KXGA 2JITA 5EHLA 2ITTA 2X4ZA 1RE8A 2VWYA 3FY0A 4NUSA 3O7LD 4HGEA 5CX9A 3RGFA 3L8VA 3KVWA 3SVVA 2JFMA 4NCTC 1PMUA 4X2FA 3Q6WA 3Q5IA 3R01A 4JQEA 5D7AA 5DI1A 3U8WA 2V0DA 4F7JA 5CEOA 5HTBA 2Z02A 2HOGA 2PZPA 2VO7A 2WTKB 3TMOA 1PW2A 5DLSA 4ZTRA 4YR8A 4JDIA 3QALE 4A9RA 1PKGA 2BZJA 1PMEA 2W1CA 5F20A 2IVUA 3KULB 3KRWA 4BCMA 2GTMA 1WVYA 2YISA 4FKQA 4MCVA 4TYHB 3DBCA 3CKXA 3BHYA 1IAJA 3VBQA 2AUHA 4UV0A 5DH3A 4V05A 4XG6A 3GVUA 3FZSA 3HP2A 4XV3A 3VUDA 4UMRA 2VTAA 5E92A 4F09A 3QX2A 4H36A 3V8TA 3IONA 4MEDA 1T46A 3LFFA 2ITNA 3E8DA 3ZONA 4R7HA 3W0RA 3DK6A 2GNFA 4G31A 4OT6A 4B8MA 4QTEA 4QOXA 2WGJA 1OPLA 4NKAA 3BI6A 1H0VA 3KXXA 2PZRA 2QOHA 3QL8A 5FLFA 5LCKA 5BVNA 1RJBA 5M53A 4OTWA 3FZTA 3LFAA 2W1ZA 4DEHA 2XEYA 3M42A 5DPVA 3WOWA 4XRLA 1OGUA 4WKQA 5FWKK 5HIBA 2BTSA