3SLSA

Crystal structure of human mek-1 kinase in complex with ucb1353770 and amppnp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
304
structure length
292
Chain Sequence
MTLQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIGAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Engineering human MEK-1 for structural studies: A case study of combinatorial domain hunting.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 292
sequence length 304
chains with identical sequence B
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2011-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3slsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3slsA01
2BRNA 3Q2MA 3MTLA 1Q61A 1H1SA 4IM3A 3MW1A 3GCVA 3H30A 2CKPA 5CT7A 2ZV9A 3CGFA 4O7LA 4FICA 4EC8A 2Y9QA 4F64A 1CSNA 2IZSA 4AOIA 1ZOHA 4TNDA 2P3GX 3FKOA 3L1SA 1V0BA 3T9IA 3UG1A 5IG1A 4FV1A 3QL8A 3AGLA 3CP9A 3H9RA 3U9NA 1DI9A 2QO7A 5AP5A 4DH8A 2VTMA 3EQFA 3MB6A 1H01A 2R3HA 4QMWA 5AIKA 3LXNA 3EWHA 2AUHA 4BY9E 1TVOA 3BU6A 2IG7A 1J7IA 3CTHA 4Q2AA 1XH7A 4Y95A 3ULIA 5CEMA 1M14A 4XOYA 1Q8UA 5EM7A 4U5JA 4ACMA 3CCNA 3NAYA 2JIUA 4N0SA 4APPA 3L9PA 1GZKA 3PP1A 4OBPA 4S32A 3WZDA 5FP5A 4AW5A 5GIOE 3MFUA 4S34A 2W06A 4EH8A 2QONA 3O8PA 3VQUA 5J9LA 4A7CA 3O7LB 1UV5A 2HY81 3IO7A 3LQ8A 5CY3A 4YZNA 2ZV8A 3G9NA 4WKQA 2WFYA 1BUHA 4P5ZA 4HVDA 2X81A 3GEQA 1WBSA 2ETMA 4DGMA 3RPRA 5HVJA 4EHEA 1WBNA 3A8WA 3OW3A 2G1TA 3BI6A 4XG3A 3RWQA 4GIHA 1LEZA 1M2QA 4IX5A 3DOGA 3FMHA 3L9NA 4PMSA 5F1ZA 3KU2A 1E1VA 3WF9A 4CG9A 4IB3A 4ZSJA 3ZM9A 3O2MA 4ITIA 3ZSHA 4EH9A 4K18A 5DHJA 4IWDA 2XM8A 4FG7A 4IVBA 4RIYA 3VO3A 2NP8A 3LKMA 2FO0A 4O7WA 4RZVA 5BYZA 2UZOA 4NEUA 3EZVA 1QPJA 4NM5A 4D28A 3B8RA 3UG2A 4XG2A 5AM6A 2B9IA 3RPOA 4EHVA 3CJGA 4NWMA 2VWYA 5AUXA 2RFEA 3W33A 2EXCX 1FVRA 4DEIA 5FDXA 5IEVA 4PX6A 3TIZA 2XCHA 2P2HA 3WILA 3TZMA 1H4LA 3RM7A 2CNUA 2GNHA 2HZNA 4AACA 4RG0A 4RJ8A 3LM0A 4O91A 4BCKA 3NPCA 4GH2A 3BQRA 3PG1A 3KGAA 1QPEA 3O8UA 3VBYA 4BCFA 3LFEA 3PSDA 5FLFA 1IG1A 4MF0A 2RSVA 4GS6A 4QP2A 5I0BA 2CGUA 4FUXA 3MVMA 3GU6A 2IN6A 3IOKA 2OFVA 4B0GA 1H1RA 1S9JA 5J8IA 1SYKA 5L3AA 2YM3A 1PHKA 1XBBA 5H2UA 4G6OA 4P90A 3RWPA 3LQ3A 4EOKA 5I3RA 2R5TA 4D0WA 2JGZA 5EDPA 3IW4A 4JR7A 2XBJA 3D9VA 3BLQA 5EKNA 4ANMA 5H3QA 4X7QA 3JVRA 3ALOA 4R1YA 4BHNA 4ZMEA 2YWVA 1OMWA 3DS6A 1MRUA 2QOLA 4QO9A 4Z7HA 4BCIA 4F6WA 2BAJA 5HVKA 3H0ZA 4OTDA 4PP9A 4WBBB 2XYNA 2BDJA 1OIUA 2QOHA 3FMEA 3OOGA 5ANOA 2VX3A 1YI3A 3GB2A 3RAHA 3NNUA 5BUEA 1OBDA 3I5ZA 4FTUA 1UU3A 1W98A 3HP2A 3L8VA 4O84A 3QD2B 3EIDA 4JG8A 5IA3A 4H3QA 4OTQA 3FSFA 3RZBA 3BEGA 3LFFA 4KRDA 4FV5A 2R2PA 4FNWA 4A9RA 5FG8A 4H05A 4EYMA 1Y8YA 1G3NA 5J1VA 4L44A 3ZTXA 4NZWB 1P5EA 1OPJA 4DGGA 5KE0A 1XHAA 3IW7A 3PXZA 4CFNA 3EQGA 4EJNA 2XNMA 1PKDA 3QHWA 4UZDA 4TYJA 2B7AA 4U44A 4ZTHA 5DG5A 4BN1A 2X8IA 4FC0A 5CAUA 4EZ7A 5K5XA 5AX3A 3EHAA 3P1AA 2CN5A 4FV2A 4RWIA 3EKKA 3OC1A 4J95A 4TXCA 4W9WA 4AE9A 4UXQA 4RFYA 4O0YA 3C0IA 4DFBA 4FL2A 2QR8A 4B99A 4PDYA 3EKNA 4BHZA 2VWZA 2W1ZA 3DKFA 3TNPC 3O51A 4JI9A 1XH6A 3G2FA 3KK8A 4FKQA 4KKEA 3PYYA 4DCAA 4AWIA 4A9UA 3QX2A 2BKZA 3GU8A 3OZ6A 4HYIA 4LOQA 4ZTMA 5FTGA 4ZSLA 3V3VA 3AT3A 4AT3A 3Q9WA 5LXMA 4O0TA 1O6LA 2ZDUA 4CFVA 4L3PA 3B2TA 4FVQA 2C0TA 4C62A 1PXPA 3R30A 5BUIA 3DTWA 3PJCA 3MSSA 5TKDA 4CTBA 5CQUA 5AX9A 2XIRA 5M53A 4QTCA 3F2NA 4BYJA 3DFAA 3UTOA 3FZRA 4AOJA 2CLQA 3W2PA 2B55A 4K6ZA 4W4XA 4O7TA 1JKLA 3JYAA 4FIHA 5JGAA 3TZ8A 2XNPA 4TL0A 3LCKA 4OLIA 3TACA 3ZH8A 3R83A 2UZBA 3EQRA 4S30A 4YC6A 3AQVA 4IWQA 4TWPA 4EWQA 4HYHA 4LM5A 4FEVA 2F9GA 4JT3A 4MVFA 3RNYA 2BAKA 2C6KA 3P86A 5LVOA 5K4IA 2ZMCA 4QMXA 5KO1A 3BV2A 4FSMA 5CALA 4DBXA 3NS9A 2QR7A 3ORPA 4QMYA 3JVSA 4XP3A 5HCZA 3SXRA 1Q3WA 2PE1A 3I4BA 3ZUTA 4AA4A 2VWVA 4MXOA 2JIIA 1SMHA 4PQNA 4R1VA 2RFSA 4I20A 4BGGA 2NNWB 4QMPA 2C1BA 2QOQA 5K3YA 4CQEA 3DXNA 2B9HA 3TIYA 3G15A 4MQ2A 2YM7A 3DNDA 5CNOA 5HESA 3FMLA 4FKPA 2ZM4A 5A14A 4QTAA 3KF4A 4I5MA 3W2CA 3G6GA 3ZEWA 4WG3A 2C47A 4CV9A 4DH5A 1ZZ2A 4M67A 1OKZA 1JSVA 4XRLA 3O96A 3ZXZA 4EEVA 3R9RA 5B0XA 1URWA 3RNIA 2HW6A 3FPMA 4YBJA 2FVDA 4JIKA 4XV1A 4CRSA 2I7QA 5ANDA 5M4CA 3FWQA 4DFUA 3O7LD 4JJRA 4L42A 5D7VA 3VJOA 3LVPA 3VULA 1XO2B 4E8AA 4ZZMA 3CY2A 3P0MA 4OTHA 5IA1A 4OW8A 4I0RA 4RA4A 3ROCA 1XQZA 5A3XA 2W1EA 4GUBA 5DVRA 3BBWA 2VTQA 5GJGA 3NIEA 5HICA 4DLIA 2VTHA 2VWWA 3SRVB 4FEUA 4BWPA 5JZNA 4FSUA 5JN2A 2CCHA 4MD8E 5D10A 2VWUA 5D9HA 3VWAA 1ZY5A 4ZSGA 4IB0A 4FV6A 3V5WA 4O86A 1UNLA 3NNXA 3MH0A 1WZYA 5M4FA 1YDTE 3JS2A 1PKGA 5DT0A 5CEOA 3Q96A 4EK5A 2BVAA 3PA4A 4C59A 1EH4A 1I44A 4MX9A 5CSHA 4B4LA 3MTFA 3VUGA 2QURA 4CD0A 3KULA 2GNFA 4TZRA 5CU2A 4IX3A 2CN8A 1OKWA 4ASDA 3D5UA 3IDPA 1FINA 1REKA 1YXSA 2X0GA 3FZOA 3EFJA 3AMBA 3OCTA 3HECA 4ERWA 5BVDA 5HTBA 5IZFA 2ITNA 2YFXA 3WYYA 1ZRZA 2HAKA 4NW5A 1XBCA 5A6NA 4BIEA 4D4VA 4F7NA 2WHBA 3AD6A 4NTSA 3R9NA 2XCKA 3LMIA 3CSVA 3R1QA 4EL9A 2EVAA 1UU9A 4DFYA 1OUKA 1WVYA 4GW8A 4EONA 3ZRLA 3PPZA 2X4ZA 4J96A 3WYXA 3VF9A 4FTKA 3LCOA 5IQCA 4ARKA 4O96A 4C37A 1P4OA 2YIWA 4A4LA 3QCSA 4RBLA 4HGTA 5EM6A 3MH1A 3PJ1A 5KZIA 3HAVA 4CLIA 3LQ5A 2WOUA 4BDFA 3V5JA 1FVVA 2NRUA 4FE2A 5KZ0A 4CFMA 4ITHA 1M7QA 2A27A 3QTUA 4IM0A 4EUUA 3DBDA 4L67A 1YWNA 5CSWA 5FUTA 1B6CB 2PZRA 2J0MB 1Q97A 3LLTA 3LM5A 2PHKA 3PVUA 2XJ2A 4KIKB 3RAIA 3HDNA 3E7OA 3C13A 3RAKA 2QG7A 2WOTA 5CSXA 4MNEB 4AGUA 3BHUA 3LLAA 2CKOA 4KSPA 4HVIA 3A8XA 5FXSA 5A4CA 4U79A 4BDKA 1G8SA 1U4DA 3CPBA 3D2IA 1PXMA 4J8MA 3UVRA 2YISA 3WIKA 1B39A 4ORKA 1OPLA 3S4QA 3BLRA 2OO8X 4R78A 2V7AA 4QP1A 3DT1A 4PPBA 3PRFA 5CU6A 2R3NA 4F99A 4FKWA 2PMNX 5K4JA 4K2RA 2PYWA 3E8NA 5IUGA 2BKKA 4TTHB 3ZDUA 3E8CA 5GIPE 3C1XA 1GZOA 2V7OA 3EQCA 4DT8A 1OIQA 4JR3A 3QQLA 4QMLA 5EKOA 3VS0A 3GGFA 4FVRA 3QWJA 3SV0A 4CT2A 5AP6A 3PXKA 4ZOGA 4RVMA 4EH2A 3EN5A 5AP1A 4E3CA 3R7YA 2NRYA 4UMTA 1XKKA 2QQ7A 2XH5A 3VBTA 3Q32A 4BCPA 1PYXA 4WD5A 3CE3A 4JG7A 3FMDA 4M15A 4EH7A 3ANQA 3F3VA 1OL5A 1W84A 5M4IA 5EQPA 3TV4A 5BVNA 4LI5A 4X2FA 1UNGA 2G01A 1MRYA 2E9NA 3OY1A 1GIHA 4M12A 4KBCA 4BCQA 3OS3A 4AZEA 3SLSA 4DH7A 5J95A 2WIHA 4UBAA 3HUBA 4IVAA 4G3GA 3ZO2A 3CR0A 3KB7A 3N9XA 4D55A 1KE9A 4U80A 3FKLA 3CS9A 4RGJA 4E6DA 3T3VA 2CGVA 4JS8A 4TNBA 3MIAA 2XEZA 2JDTA 5J5TA 5FBOA 3QYWA 4II5A 4BTMA 3LJ1A 2VO3A 1GAGA 2F7XE 4ZAUA 2PZYA 4QMZA 4X2GA 2JKMA 4RSSA 3BU5A 3AMAA 3RCJA 2OZAA 1Q8TA 2RG6A 5EYCA 5HZNA 3G0EA 3ZO4A 3EN6A 4CXAA 4JNWA 4KBKA 2W1CA 4K1BA 3UZPA 4X2NA 3CKXA 3EZRA 3TTJA 3PXYA 4ITJA 3G0FA 5EW8A 5GHVA 4XOZA 4KKGA 4YO4A 5AAGA 3BGQA 4BTFA 4O21A 3VRYA 4DFXE 2E9PA 4IAFA 4J99A 1AGWA 2A1AB 3KXHA 2W1IA 4XMOA 4ANSA 5BYYA 5AV0A 5L8LA 2CNQA 4BI2A 5AUUA 2WPAA 3W55A 4C38A 3F7WA 4UN0C 1P4FA 2C1AA 4Z16A 4XV9A 1NVRA 2XB7A 3DKOA 3LCSA 4V0GB 3KCFA 2GNGA 3EYHA 2E9UA 1Y57A 4FT3A 3ZC5A 3BHHA 4QQCA 3QFVA 5KX8A 1CKPA 3DTCA 1HOWA 4DGNA 4D58A 3Q4CA 3R8LA 2GHGA 3TNWA 4ASEA 4EQMA 2X6EA 5KMLA 3A60A 5DR2A 5AM7A 4D2VA 1F0QA 2OZOA 3M2WA 1J7LA 3UIMA 4OT5A 4YMJA 1BI8A 4FEXA 2GS7A 2XIKA 2C6DA 2XRUA 2Z2WA 4L3LA 1O6KA 1Q99A 5AV3A 4CMTA 1S9IA 2ITXA 2VO7A 4YJUA 1J91A 5EK7A 4RX8A 3LMGA 4RPVA 5L6WL 2QI8A 3QQKA 1Y6AA 4PTGA 4QYFA 3D4QA 2WTDA 2CNVA 2HY0A 4LV8A 4IDTA 2B1PA 3MPTA 2G2IA 4AZTA 2X9FA 4BCGA 1OECA 4ZS4A 1YRPA 4DH3A 4J97A 4CCUA 4OT6A 5LMAA 3H9OA 1OL1A 4KSQA 5GZ9A 3HLLA 1M2RA 1ZMVA 3R6XA 4M69A 4QP6A 1IRKA 5TOZA 3OP5A 3BE9A 1OKVA 4Y5HA 3TCPA 3I1AA 1OVEA 3D7TB 4QOXA 4WSQA 5EDRA 4E4NA 4I94A 3UODA 2FUMA 4FSNA 1PXJA 2W1GA 5IQIA 1BKXA 3F5XA 4IAZA 1ZARA 1NW1A 4ACGA 3LIJA 3E3BX 3ZXTA 4DE4A 5IU2A 4GCJA 4NW6A 5EYKA 4EK3A 4IC8A 3NVMB 3IW8A 4TYGA 5IH5A 2BZKB 3EJ1A 4TPTA 4O7RA 4EQUA 5HE1A 4C4JA 2C69A 5JFVA 5HQ0A 1GNGA 3HL7A 3BBTB 5HLWA 3P23A 3RALA 3TKHA 3K5VA 5K5NA 4CGAA 3HA6A 4TYEA 3KRJA 2GQRA 2B9FA 3W10A 3CEKA 1H1QA 2R4BA 4L52A 4W8EA 4C36A 3ACJA 4KIQA 2XJ1A 1SVGA 4PY1A 4RVLA 3I81A 5GZAA 4FTJA 1YHVA 5IISA 3CTJA 4HCTA 2JIVA 5E8UA 3HVCA 2WELA 4WA9A 1SM2A 3KY2A 2PUUA 3UOLA 2X8DA 4FTAA 4AT4A 4IIRA 3A7IA 3D7ZA 2ZB1A 3G33A 4AP7A 1HCLA 1JBPE 2VNWA 2P2IA 3GU4A 4HJOA 5IMEA 4M84A 1Q3DA 4CKJA 3KK9A 4MD7E 4FL1A 2J9MA 2QOIA 2UZUE 4JRVA 4L53A 4FKGA 5KCVA 4X21A 3MIYA 3F2AA 4FOCA 4GK3A 4XG8A 5AR7A 2OSCA 5A4TA 4UYNA 4R3CA 4A9YA 4YSJA 3PJ8A 3H3CA 2ZVAA 3M11A 1YXVA 4JVGA 4LQMA 1F5QA 5K0KA 3DKCA 4G3EA 1ND4A 4BZDA 3ZHPC 4X2JA 2ITUA 1VZOA 4E7WA 4APCA 5CEIA 5JRSA 3CPCA 2OW3A 3D0EA 3DLSA 2VTTA 1MRVA 4B6LA 2UVZA 4O6LA 2X7GA 3U6IA 4ZLOA 3FLYA 3SVVA 2X4FA 1NA7A 4KNBA 4H1MA 4EOMA 3ZU7A 1Z9XA 4HZSA 2PVMA 4GMYA 1ZMWA 5KMNA 3BYUA 2O2UA 4FNXA 3FMJA 3TJCA 3KRRA 4G3CA 3FI3A 3GCUA 3LXLA 4UZHA 4YTIA 4R77A 3G6HA 3MS9A 3ORTA 4YZBA 4ZY5A 4ZLZA 5BUJA 2WTIA 2YITA 4X6QC 3R22A 3ODZX 4TYHA 4D4RA 4O7ZA 5J9ZA 5HLPA 3HRFA 4YURA 3DBFA 4MF1A 2IWIA 4EI4A 4IJPA 4Y5QA 4GKHA 2OJGA 3HGKA 5DT3A 3AC2A 4AG8A 5E8WA 3BWJA 2QG5A 2PK9A 3GNIB 3NGAA 2RF9A 2LGCA 2W17A 3NUXA 3PP0A 4TY1A 4YNOA 2DQ7X 5J87A 4IHPA 4DG2E 1GOLA 4USEA 1RQQA 2BAQA 5KMIA 5BMMA 2BIKB 3NLBA 4FTRA 1ZYDA 1R39A 3QZIA 4XBRA 4FKJA 3ORLA 3EQHA 1G5SA 1R0PA 4RIYB 5ANEA 2UZNA 5A4QA 4NFMA 3RPVA 5HX8A 4AN3A 5IA4A 2GMXA 2GFSA 3K54A 5AR2A 4F70A 5E8VA 4PRJA 1UVRA 3BHVA 3PY3A 3E5AA 3H0YA 2GFCA 3Q60A 3SW4A 4I4EA 3KMMA 2XM9A 1OB3A 3GU7A 3QQUA 4G3FA 3O8TA 1QMZA 2A4LA 3Q3BA 2XEYA 3MY5A 3Q4TA 4YO6A 3EN7A 3UMXA 3V6SA 3EL8A 4R7BA 3ZMMA 4KIPA 4OTPA 2OU7A 2P33A 4FK6A 5EDQA 4YJOA 3VHEA 3QWKA 3NAXA 3F5GA 4OGRA 3FY0A 3EFKA 5AP3A 4G9RA 4U40A 5IH6A 4HGLA 3UVPA 3DA6A 3DAKA 3GT8A 1IR3A 1H26A 2H9VA 2WNTA 3R7IA 4CV8A 5C26A 5CEKA 3GVUA 3PPJA 4RX9A 3ZOSA 3UZRA 5DR9A 3VS1A 5AUTA 3QCQA 3R7GA 3TI1A 4MXAA 5HIBA 3ZCLA 3SAYA 4BBMA 4U81A 5TO8A 5IQHA 4O38A 4QQJA 5E8YA 2NO3A 5EI2A 5EI8A 2QOFA 4GRBA 4F9YA 4HNIA 5C03A 2UW4A 5DLSA 5F4NA 3F82A 1YW2A 2WMVA 3C4XA 4IX4A 3HMIA 2P55A 4QMUA 3DCVA 3LFAA 4FTLA 4JDJA 3BYOA 3TKIA 5L2WA 1UU8A 4G1WA 4RVTA 2X1NA 2ITWA 3A4OX 4HOKA 3SOAA 3LFDA 3MH2A 3MYGA 4ZJVA 4RWLA 4JDHA 3EN9A 4BCHA 4ASZA 5IEXA 3W32A 4FSQA 5DIAA 2HXQA 5LVNA 2CGXA 1H8FA 3BHTA 4HZRA 4ANQA 4IB5A 3S3IA 3E88A 4PPCA 5B2MA 3ZLWA 3N4VA 2YEXA 2VTPA 2F2CB 5BMSA 3NIZA 5E1EA 3BLHA 2Z7SA 2O64A 4WO5A 3RBWA 2ETKA 3QBNA 2CDZA 4S31A 4H3BA 4FA2A 2NPQA 2WQNA 4AN9A 1NXKA 2JKKA 3O0GA 4BVUA 3LXKA 4GG7A 4RA5A 2W5HA 3FXZA 3OCGA 4BGQA 2QNJA 3NWWA 3VUHA 4CEGA 2WMTA 3ZSIA 2IVUA 2FYSA 2Z7QA 3EL7A 3IPHA 4M13A 3VS2A 2I40A 3MGYA 2BHEA 4YJPA 4IZ7A 5HBHA 1LEWA 3ORKA 4Z7GA 3H9FA 4MXYA 3PVBA 3IQ7A 5L4QA 3BPRA 4FBXA 3F9NA 4NM7A 5IEYA 2EWAA 1DM2A 5L6PA 4RLKA 3FI2A 3U6JA 1LUFA 4HPTE 2UW0A 3DJ7A 4G5JA 5BVOA 2EB3A 4F1OA 1REJA 3Q6WA 5J9YA 2UW7A 4XS2A 4CZYB 4ZTRA 4RQKA 3ZO1A 2UW9A 5J79A 3OWPA 4DFLA 3FMNA 2BUJA 4LGDA 3ANRA 5I9YA 3CXWA 3LJ2A 4BR3A 3NYNA 4RC4A 5E4HA 4AFJA 5CU3A 1JLUE 2ZDTA 4BDHA 1KUTA 4TWOA 4XG7A 2J2IB 2XKEA 3A7JA 1OL6A 3LPBA 4HPUE 4C3PA 2KULA 1RW8A 4L00A 4RC2A 4L6QA 3DPKA 4RMZA 3V51A 3KN6A 3CBLA 1KE7A 4FF8A 3SXFA 4D4SA 3OUNB 1B38A 2VX0A 4ZXTA 3LHJA 3MVHA 3BX5A 2BCJA 3HP5A 4UX9A 4YJSA 2GSFA 3C7QA 3UYTA 4RFZA 2FH9A 4F65A 4F09A 3F2RA 4OBOA 3WF6A 3ITZA 5DBXA 4D2SA 4QTBA 2EU9A 4FGBA 4ZEGA 3ULZA 3VBWA 4F08A 3RKBA 4HVGA 4XHKB 5KMMA 3F6XA 3DK3A 4QMQA 2XYUA 3FYKX 3OY3A 4UMPA 3ATSA 1H08A 2BILB 4EH6A 3VUMA 3E93A 4IAAA 4QMVA 1J3HA 4RLLA 4L7SA 4MXCA 2YWPA 3ODYX 4OTIA 3LOKA 2YDIA 4L8MA 3ZFMA 1TQIA 4NKAA 2OFUA 5D7AA 4DGOA 4NYEA 3EB0A 4Q9ZA 3KXGA 4O0WA 2C4GA 3HZTA 5DH3A 4ZZNA 3ZONA 2UW5A 4HNFA 4QPSA 5I9VA 5AP2A 4WG4A 1H28A 5K9IA 4IAKA 3ZM4A 3W8QA 4RVKA 5JRQA 5CZHA 4BCOA 2YCRA 4BC6A 2W0JA 3LFQA 2W05A 4AUAA 5A54A 5L2SA 1Y8GA 1YVJA 5EOLA 3QTRA 4EOJA 3R8PA 3UQFA 3R9OA 3AC3A 2BIYA 1FMKA 4EH3A 5ACKA 4PMPA 3JPVA 5CXZA 5CF5A 1WBVA 5JSMA 1W7HA 4QMSA 3QQGA 4MEDA 3RTPA 3WZJA 3OT3A 1Q4LA 4BF2A 4C7TA 3PTGA 1LR4A 4ZTNA 4JQ8A 4RIWA 4YP8A 2E9VA 2J90A 4DINA 4EOQA 1P2AA 3M42A 2ITOA 1L3RE 4GKIA 4U8ZA 4FIFA 3SXSA 3O50A 4BKJA 2YZAA 4IW0A 3A7FA 4FIEA 4YC8A 3R71A 3FZ1A 4WRSA 4AT5A 4TT7A 5AEPA 4FTOA 4K77A 3ZLSA 4BI0A 1IAJA 4YR8A 4M3QA 1NVSA 4GIIA 3GBZA 4FV9A 4KKHA 2GS6A 2JITA 3EMGA 3IDBA 2SRCA 1W8CA 3GCPA 2HXLA 2IO6A 2OK1A 2GPHA 2WMSA 3FQSA 3KULB 2C6LA 5BVWA 3UBDA 3OW4A 4C3FA 2WTVA 5BNJA 4I23A 3NUPA 3W1FA 1XH5A 3QA0A 1JNKA 2ITQA 2O5KA 4FZ7A 2HYYA 4I93A 5C8MA 2F2UA 3PJ3A 5AP0A 4R7HA 1YDSE 3E3PA 4KA3A 3I7CA 4Y8DA 5E91A 4DHFA 4KUJA 1JPAA 4GSBA 4PWNA 5CEQA 3F7ZA 2W1FA 3OG7A 4JAJA 3UYSA 4M0YA 5HVYA 5JMSA 3L8SA 4RJ5A 4U3YA 5EG3A 5EM8A 3TUDA 1ZYSA 1Q8YA 2J4ZA 3BYMA 3R2YA 5JK3A 3ID6C 2QOKA 2OF4A 4FT7A 3VUDA 3VS3A 1Z5MA 2W5BA 4Z3VA 4DT9A 3OWLA 4QQ5A 2GNIA 5IQGA 3FXXA 5IA2A 2PTKA 4G31A 1NT2A 2O8YA 3SQQA 3E7VA 2OG8A 3NZ0A 1FGIA 5KMJA 4FIJA 5F95A 4JRNA 4U42A 5ANIA 5CAQA 5LMBA 4YLKA 5M57A 3DXPA 1UWJA 5KMKA 4AN2A 4RX7A 3NW7A 3V6RA 1YQJA 2R3FA 2VWIA 2XKFA 3DY7A 4EOPA 4KIOA 3QC9A 4M97A 3F5UA 4G16A 4DITA 3COKA 3HMPA 3QD4A 4ZJIA 4YPSA 4WNPA 3PJ2A 5CNNA 2WQBA 1GIJA 4MK0A 5IQFA 3Q5IA 3UE4A 4GEOA 2ONLA 4D4YA 3I6UA 4LG4A 2W9ZB 3ENHA 1VYWA 2BRBA 1E9HA 2OF2A 2J5FA 4BWXA 2VN9A 4OBQA 1ZOGA 1SNXA 3WE4A 4C4HA 3KRLA 4EK6A 1IA9A 3JY0A 3OEZA 4KWPA 3PXFA 2C3LA 4FMQA 2YJSA 3HDMA 4FNZA 4QPAA 2YM6A 2ZV7A 5LWNA 1VJYA 4GT3A 4NH1A 3DKGA 5HKMA 3TZ7A 3VC4A 3PSBA 4PV0A 2AYPA 3HRCA 4QMMA 3VS6A 5CF4A 4WUAA 5EYMA 3F3TA 5EHYA 4D2RA 1DS5A 5EOBA 1YI6A 3BGZA 4XLVA 1JKSA 2Y6OA 3DB8A 3IGOA 2WQOA 3TN8A 4DGLC 5I9ZA 4NUSA 2PMOX 4ZY4A 4GK2A 2YLFA 3P9JA 3RJCA 4K33A 2UW6A 3VF8A 4E6AA 3MVLA 2Z8CA 2I1MA 5FM3A 2WKMA 5HOAA 3DDQA 4BI1A 3WZKA 4E6QA 3MY1A 1PXOA 3CJFA 5JGDA 3MV5A 4QNAA 5KHXA 2FSTX 4L3JA 3KA0A 2UZLA 3DJ5A 3JY9A 5CAVA 3MY0A 3W2RA 1H0VA 4D5KA 3L9MA 4LUDA 5EHOA 1CKJA 5AR4A 3HX4A 2QO2A 2ZJWA 4D1XA 4E1ZA 1MQ4A 1JOWB 3CQWA 4NSTA 4PMTA 4ZTLA 3RGFA 4L43A 2ETRA 3R04A 1XH8A 3PXQA 2C5YA 4ACDA 4ZZOA 2HIWA 3E64A 5FTOA 2YDJA 4I6QA 3FPQA 3OBJA 1AD5A 3QXOA 2GQSA 4N57A 4YU2A 4GG5A 2OZAB 2ZV2A 5F94A 1KOAA 3QQHA 4QT1A 4WRGA 4DH1A 4YHJA 3W16A 5LJJA 2GTMA 2F4JA 1JSTA 4J1RA 1U5RA 4IBMA 2Y4IC 3QTZA 2JDSA 4M14A 4BCMA 4FV7A 3C4FA 4CZUA 4ANOA 1R3CA 3KMWA 5CVFA 4RQVA 4FZAB 3LW0A 4F1MA 4ENXA 3UMWA 2VUWA 4PNIA 3SG8A 3GC9A 3P4KA 3UO6A 2J0IA 5IUHA 2O65A 2E9OA 2ZYBA 4LL5A 5FEEA 3WARA 3UIUA 4KABA 4NKSA 3CD8A 2Y4IB 2XS0A 4I3ZA 2QO9A 4FODA 1MQBA 3TT0A 3U55A 4A06A 4NIFA 3RPSA 1PY5A 1Q41A 4GK4A 3LCTA 4QRCA 5DEWA 3FC1X 3KVXA 4YZMA 1RJBA 4HGSA 2XVDA 2YERA 5ETAA 2Q83A 3OCBA 3ZEPA 2W1DA 3K3JA 3LJ0A 3P79A 2F7EE 3WF5A 4EYJA 1SVHA 4V05A 4YZDA 2IVTA 4EK8A 4Y46A 4IQ6A 5FTQA 3LAUA 5LMKC 4ZLYA 1CM8A 4L68A 3TWJA 4MNFA 2XMYA 3KEXA 3WZUA 4P5QA 2PVFA 3DU8A 3ZFXA 4CZTA 3NYVA 3DAEA 5HG7A 4O83A 3I0OA 4KRCA 1OITA 4EOOA 2W4OA 5JKGA 4DF3A 2WGJA 1G8AA 4QMTA 4FKTA 3THBA 2OBJA 3TM0A 4D2TA 1XR1A 2B9JA 2WU6A 3CY3A 3JUHA 2QVSE 4FZFB 4M69B 5C01A 3QRKA 4FEQA 2UW3A 3QTQA 4H58A 4TWCA 2BHHA 5E8TA 3I7BA 4FZDB 4QP3A 2Z7RA 2EXEA 4QP9A 4BDIA 4FG9A 4AGWA 1J7UA 4F7LA 4DA5A 3FHIA 3CQEA 1YWRA 3S2PA 5L8JA 3RVGA 2VTNA 4IFGA 1U54A 3B2WA 2FSOX 3P7CA 3V8TA 4AGDA 4MYGA 4C2VA 5ETCA 4J53A 5M07A 2RGPA 4MBLA 3I79A 2BRGA 1PMUA 3VRZA 3QQFA 2VO6A 3WZEA 2PU8A 3BZ3A 2WMBA 3DGKA 2WXVA 2PULA 3R73A 4KS7A 3Q9ZA 3VBQA 3V5LA 5IQEA 3NW6A 1XBAA 4FT9A 5EH0A 4AA0A 3DAJA 4AOTA 2VZ6A 2C5OA 2YA9A 4UEUA 4YJTA 4IADA 2VAGA 3NR9A 4ENYA 4W8DA 2OI4X 4ANBA 4BKYA 3GI3A 3PFQA 4JBOA 4BB4A 1Z57A 4I21A 5HNIX 3MWUA 4FTIA 3ALNA 2J0LA 4XX9A 3HV3A 2QU5A 4C58A 4R5YA 3VHKA 2ZMDA 2WAJA 3MI9A 3A99A 4UB7A 3FLWA 4O2ZA 4AX8A 5BX0A 3BELA 3ERKA 4I5CA 3WE8A 2WQMA 4IMYA 4R5SA 2W99B 4XRJA 2XRWA 3FAAA 4G2FA 4OTWA 4EKLA 3SW7A 1OM1A 1OZ1A 2ITPA 2IVSA 5HD4A 4E5WA 2JLDA 2FB8A 1WVWA 2WD1A 2OXYA 2A2AA 5AAEA 2Z02A 3RHXA 3DQWA 3MBLA 5ICPA 2XUUA 5LQFA 2OKRA 2V0DA 3I60A 5E8ZA 3ROYA 2W1HA 4XLIA 2YN8A 4GYGA 2CCIA 5AMNA 4K0YA 3TL8A 5C1QB 3GP0A 1H27A 3NUYA 3T9TA 4LOPA 4E4LA 1TQMA 2BMCA 1Y6BA 2ITTA 2BPMA 3MPMA 5FM2A 4W4WA 2UZEA 3HEGA 5T6KA 2B52A 5FQDC 1APME 4L01A 1XWSA 4WG5A 2VTLA 3DBCA 5I9WA 3D14A 4IXPA 3ZBXA 3MESA 5D41A 5LMKA 4BTJA 5DRDA 1KE6A 3OOMA 4G5PA 4J52A 4CVAA 3TNIA 5CZIA 3E8EA 5L8KA 1ZYJA 4G17A 2YIYA 4RJ3A 4FTMA 1K2PA 3SHEA 5FBNC 5GJDA 3CTQA 4HCUA 4DC2A 4YC3A 1GZ8A 5A46A 3OF0A 1IA8A 2XKCA 4MBJA 4BDJA 4IAYA 3GENA 1UKIA 3R8MA 4HCVA 3ORXA 4WOVA 3QU0A 4KAOA 3SD0A 4GFMA 3UC4A 5JQ5A 5HIEA 2WIPA 4BDCA 3WF7A 4C57A 3KF7A 1ZAOA 2R9SA 4V01A 3QYZA 4RJ6A 4XG9A 2J50A 5L6OA 3D5VA 5E7RA 4GUEA 4IVCA 2V62A 1IAHA 4L45A 4PDOA 1GZNA 3P7AA 5ETFA 4AW0A 4TYHB 4I92A 3NRMA 2VD5A 4UY9A 3R1NA 4FTTA 4EH4A 4FSWA 4X2KA 4NL0A 3FL5A 4QNYA 3W2QA 4D9TA 4DLJA 5KKRC 3RM6A 2CKQA 2HK5A 3MFRA 3HUCA 4L9IA 2CGWA 3BHYA 2PVJA 2JBPA 4GVJA 1BLXA 3COIA 1H00A 3F88A 4CT1A 4QP7A 3NW5A 1H0WA 1PMNA 2QOCA 2X39A 4ZTSA 2BDWA 1JSUA 4FKVA 5I3OA 3R7VA 3Q9YA 4N6ZA 4IAIA 5EI6A 5FXQA 2UZVA 5AFVA 2W96B 4FTCA 1WAKA 5M06A 1YXUA 2W7XA 3ACKA 4XG6A 3ZC6A 5CEPA 2C6TA 2ESMA 3RPYA 4XEYA 3FUPA 3KQ7A 1SNUA 2F57A 1M17A 5LWMA 5DE2A 2OH0E 3FMKA 3LE6A 3TUBA 4Y73A 2JEDA 4EUTA 5AUVA 3A7GA 2PZIA 5C8NA 2BFYA 1QPCA 2IW8A 5F9EA 2WMXA 4I24A 3E63A 2ZM3A 4YZCA 4NT4A 3QLFA 4RZWA 4WHZA 2EXMA 4D9UA 4J8NA 3IW6A 5HLNA 5I5ZA 2O63A 4WT6A 4DTBA 2XNNA 4F6SA 4PL5A 3GQIA 3LXPA 2FSMX 2GQGA 4TWNA 5CSVA 3U4UA 1FVTA 4XP0A 3FZTA 5CQWA 1JQHA 3PDTA 4I6HA 3VQHA 4F9CA 2HENA 3IK3A 3WF8A 2C0OA 3PRIA 4BZNA 4WNMA 2C5VA 5B7VA 4BDGA 2JKQA 1KV1A 2PUIA 3BE2A 5CI7A 4EOLA 5GINE 3PE2A 3A61A 5LCKA 2C68A 4IFCA 2PZPA 3GFEA 4UMRA 1WBTA 5DYJA 4LRMA 1LP4A 3QRJA 3LFBA 4RIXA 1YHSA 3ELJA 3P08A 2WTWA 2X6DA 3U9CA 3UVQA 4CMOA 3UP2A 4BGHA 4BWKA 4DTAA 5C4LA 3OXZA 2XK6A 3EH9A 3NCGA 2LAVA 4C4FA 4D2PA 1M7NA 4BCJA 1VR2A 4AAAA 4NJDA 2X9EA 1O6YA 3QGYA 4BIDA 1M2PA 3QCXA 2CPKE 3L8PA 1KE8A 4TW9A 4CCBA 3OWJA 4U7ZA 5HGIA 5M55A 5HCYA 1PW2A 4CMUA 1OL2A 3DXQA 1QPDA 4FV4A 4CFXA 4YJQA 2IW9A 4YLLA 4MXZA 3HV7A 3OEFX 5ETIA 3HKOA 3GC7A 1RE8A 3U4WA 3PY1A 3QZFA 5EQEA 4H39A 1FMOE 2J51A 4LV5A 4BCNA 5LCJA 2XF0A 3A2CA 2OICA 5M4UA 1PJKA 4F4PA 2C6MA 3RAWA 4FIGA 4PNKA 3L9LA 5LVMA 2R3IA 4U6RA 5FEDA 3OBGA 4AXAA 4PTEA 1OPKA 3D15A 4O0VA 5A6OA 2J0KA 4MBIA 3NSZA 5HG9A 2OJJA 2ZOQA 3BKBA 5C8KA 3UPZA 1W83A 5J7BA 4HYSA 5IQAA 3UDBA 1H1WA 4AGCA 5CASA 1FPUA 2BROA 4PUZA 4EKKA 1OUYA 1O9UA 1KV2A 2BDFA 3DDPA 3FZPA 3I0QA 4RJ4A 1YHWA 3E92A 4XNEA 5AV1A 5HNBA 4G9CA 5B2KA 4BRXA 3NEWA 5CAOA 4KINA 2H8HA 5HHWA 3SGCA 3HRBA 4QP8A 1F3MC 3LCDA 4TN6A 4ZIMA 5HU9A 3MN3A 1E1XA 2UUEA 4M0ZA 2O0UA 2WMQA 3R9HA 2YCFA 3E62A 3DZOA 3GQLA 3IOPA 2ITYA 3ENMA 5E8XA 3ZRKA 5KMOA 3PUPA 3DNEA 3FV8A 3W2OA 3PPKA 5B2LA 2Y7JA 2CKEA 2ACXA 1V1KA 4AW1A 2BRHA 3GC0A 3ZLYA 3ETAA 3DBEA 5IA5A 5GZ8A 4O7NA 2VTOA 3UNKA 1T45A 4YJNA 3UJGA 2V55A 4BBEA 2IW6A 3Q2JA 1UNHA 3NUUA 5IKWA 5GNKA 4F0GA 4O1PA 2XIZA 2XNBA 3UO4A 4ZSAA 4X3FA 1GY3A 3WOWA 4HVSA 2GNLA 2JDRA 2QCSA 4I1ZA 4TRLA 3RHKA 5M08A 2H96A 3Q53A 4LL0A 3LFNA 4U45A 2AC3A 3LFSA 2ERKA 5T3QA 5HBJA 3OFMA 2XA4A 2I0HA 3BV3A 3UGCA 2R64A 4BBFA 5LVLA 4FI1A 1PMVA 3R1YA 3OHTA 4XJ0A 3T3UA 4GU9A 4GYIA 3HYHA 3KXMA 5E1SA 4QTEA 2ZB0A 2R7IA 5CS6A 2Z60A 4P7EA 1UU7A 2QKWB 2JFMA 4GU6A 2QC6A 2YM4A 5CYIA 4S33A 4UYAA 1GJOA 3UPXA 1AQ1A 1BL6A 5ITAA 4AU8A 3ZDIA 2JAVA 5EW3A 2JKOA 3V5PA 4FKSA 3QALE 4PF4A 4CKIA 4XP2A 5BQ0A 4FR4A 3VS7A 2W4JA 4B7TA 4D2WA 3WBLA 4FT5A 1NVQA 1PMEA 2QLQA 2PMLX 3F69A 4USFA 5D12A 2CJMA 4U3ZA 3V5QA 4K8AA 4A9SA 3EN4A 4MQ1A 2V22A 3C5IA 3LZBA 4JX7A 4NM3A 5AAFA 3DK7A 4JBQA 3FQEA 4CRLA 2WQEA 4TKSA 4C02A 3TUCA 3DJ6A 3R2BA 1TQPA 3KFAA 1PXKA 4EHGA 3NNVA 1BYGA 4FKRA 3HAMA 3QD0A 2RIOA 3UQGA 1ZMUA 4O6EA 2QHNA 3FMMA 3F5PA 3WI6A 4RIWB 4LFIA 3SA0A 2PPQA 4IE9A 1FGKA 3TEIA 4UWYA 3PIYA 3OROA 4RWJA 5AADA 1WBWA 3D5XA 2YM8A 1YXTA 5FRIA 4BZOA 5K0XA 5C4KA 4Q9SA 4AE6A 4D0XA 4CQGA 5E9EA 2YIXA 2ZM1A 3KREA 3VBVA 3QTIA 2J5EA 4UV0A 5H8GA 1YOJA 5HI2A 1BX6A 5AP4A 3RZFA 2QU6A 2RFNA 4FL3A 3AD4A 4CTCA 3QQJA 4Z55A 3PLAE 3I6WA 3C0HA 2BRMA 4XH6A 4UALA 2R3KA 3TNHA 5JT2A 5G6VA 5L2TA 4YPDA 2BR1A 4U0IA 2CMWA 4NCTC 3K3IA 5IMXA 4W4YA 5CX9A 3O71A 4RJ7A 3RK5A 4FTQA 2QODA 3AGMA 3FSKA 4JG6A 2R3PA 3RMFA 5HE0A 3FLSA 2R0IA 2HOGA 2EUFB 3GC8A 2ZAZA 4FSZA 3REPA 5HU3A 3U6HA 5IQDA 5I9XA 5IPJA 1OBGA 4X3JA 4P2KA 4QYEA 3UZTA 4FSYA 4BICA 2I0YA 3GXLA 2E2BA 2VX1A 4DTKA 4ZSEA 3R01A 4R8QA 2JDOA 5HO6A 4CG8A 2R3JA 2Y0AA 3C51A 3MPAA 3OXTA 2W4KA 3Q4UA 4IZ5A 5HEZA 2J6MA 2G2FA 2WTKC 1J1CA 5FD2A 5AR8A 3AMYA 3U51A 4DCEA 4DYMA 5DGZA 2W5AA 3KMUA 2ONLC 4P4CA 2C30A 4U41A 4HGEA 2CLXA 2OGVA 3ZZEA 4FG8A 4XUFA 4D1ZA 5HX6A 4YUQA 1M52A 4GFOA 4GT4A 4ONAA 2C0IA 5CXHA 3KC3A 2CSNA 2GHMA 3GOPA 3ORZA 2C6OA 2R3RA 5A9UA 5HTIA 5HE2A 2RKUA 2WTKB 2R7BA 4E20A 4YTHA 2OXXA 4CFFA 2DWBA 2REIA 4BDDA 4LRJA 5D1JA 3T8OA 3AT2A 4Y85A 4DG0E 4BYIA 5IDNA 3QX4A 2J0JA 2YABA 3HMOA 5FWKK 4WBOA 3PSCA 2AC5A 1WCCA 4QMOA 5CF6A 2GTNA 5AA8A 5I4NA 5G1XA 3Q5ZA 2YZLA 1R0EA 2R3QA 2WMAA 2YAKA 2PE0A 3DZQA 3HA8A 3QTSA 4W9XA 3F3WA 4KD1A 1STCE 3U8WA 2IVVA 3PA3A 4FTNA 4O2PA 1DAWA 3QZGA 3ZUUA 3ATTA 5JFXA 1LPUA 2I0VA 4LOOA 4ZY6A 2JBOA 1PF8A 2ERZE 5KBRA 2XKDA 1YOMA 3QZHA 4QP4A 2Q0BA 4DEDA 4J98A 1WFCA 4Q5HA 3KN5A 3P5KA 4U97A 2CHLA 4F0FA 4N6YA 4J7BA 5CVHA 4NM0A 2VO0A 4UXLA 4JQEA 2PSQA 4O0XA 1K9AA 4I0TA 1BMKA 3OT8A 5AP7A 5H8EA 3SG9A 3FXWA 3M1SA 4RIOA 2JC6A 3C4WA 4CYJA 5CANA 1A48A 3MFSA 3N4UA 2XNGA 1KWPA 4RX5A 4C61A 3TJDA 3QAME 5AR5A 4MWIA 5BVFA 2A19B 1JKTA 3KRWA 4BKZA 5LOHA 4K9YA 1BI7A 2VTJA 3OD6X 3EOCA 2Z7LA 3BCEA 1JAMA 1ZLTA 2GHLA 4R3PA 2G9XA 4KS8A 5M56A 5HO7A 4AZFA 3CC6A 5ANGA 4FKLA 5IUIA 5M51A 1ZYLA 5BVKA 3C4CA 4NCTA 4I0SA 2BALA 2UZDA 1X8BA 5JEBA 3CLYA 4G3DA 4TYIA 3AC5A 3POOA 3PY0A 4HYUA 5M09A 3MA3A 4BFMA 3VUIA 3PA5A 3VUTA 2HWPA 1TKIA 2HW7A 2WMWA 5FGKA 4AA5A 4CNHA 3JR1A 4O7VA 2P0CA 1ZY4A 1Q8ZA 4PMMA 3R02A 2IPXA 3FJQE 4NU1A 3ET7A 4AFEA 3NUSA 4NTTA 4FT0A 3ZBFA 4M66A 3PZEA 3K2LA 5HG8A 3E8DA 3QXPA 4YLJA 5LARA 3AOXA 1YI4A 2WMUA 4FIIA 4UMUA 2OJFE 2VU3A 2A0CX 5DEYA 2R3LA 3G51A 4FKOA 2DUVA 2XK9A 1YOLA 3R63A 4IVDA 4LRKA 4RC3A 4OAVB 4QYHA 5BYLA 3U54A 1NY3A 4NFNA 3QRIA 1Q62A 4E5AX 4IJ9A 4IZYA 3BIZA 3UIXA 3PWDA 3COMA 1V0PA 3AXWA 3FQHA 3KKVA 4ALUA 3C50A 3W2SA 4MKCA 3UNJA 4BIBA 2HCKA 3TDVA 4ZP5A 3NUNA 4N70A 4H1JA 3MB7A 1IASA 2GNJA 2WTJA 3PWYA 3OWKA 2BFXA 3VVHA 4F9BA 3KVWA 4NIFB 5KHWA 2J7TA 3FHRA 3QLGA 4XV2A 3PG3A 4FZ6A 2PE2A 4YJRA 3R0TA 4X0MA 5E90A 5JFSA 4ZTQA 3NUAA 4EOSA 2C3KA 4J71A 1R78A 2UZTA 4YGAA 3FL4A 4CSVA 4C4GA 4OUCA 1DAYA 4MH7A 3TXOA 3OVVA 2R0UA 1CKIA 4ERKA 4MWHA 5A4EA 3C0GA 3ORIA 1OKYA 2XNOA 2JAMA 4YZ9A 3V01A 1ZWSA 5JQ8A 3NVKI 4C3RA 4PDSA 4QYYA 3RI1A 2WU7A 1MP8A 3KCKA 1PXIA 2W9FB 3P78A 4ALVA 1IEPA 5DFPA 4QD6A 5EW9A 3LMHA 5AA9A 2Y4PA 2PVRA 3C9WA 3S00A 4O7YA 3BQCA 1Q5KA 4V04A 4E6CA 4B8LA 3DFCB 3NDMA 3MJ2A 3FZSA 3PZHA 3W8LA 4F7JA 2QD9A 4C4EA 1UKHA 4DFZE 2XK4A 4I6FA 3COHA 4AZVA 3Q6UA 3F3ZA 3IG7A 3N4TA 4C34A 1MUOA 1HCKA 5AJQA 3SDJA 4DG3E 1U54B 3EFLA 2QLUA 4I41A 3WIGA 5JFWA 5H9BA 1SVEA 4C35A 4MCVA 2B54A 2YLEA 3O17A 1ATPE 4IWPA 5TE0A 4FYNA 4U43A 5KBQA 3HMMA 2B4SB 3IGGA 3KXZA 3UC3A 1UWHA 3DV3A 3V8SA 5KNJA 4F0IA 1P14A 5HG5A 4YTFA 1FQ1B 5HIDA 4YHFA 5AV4A 5HTCA 1CDKA 1Q24A 5ANJA 1XJDA 1WMKA 2GU8A 4FOBA 3ZYAA 2I6LA 3IKAA 2BTRA 2FSLX 1ERKA 4O27B 2UV2A 3H10A 5AV2A 3KXNA 1OIYA 4X6RA 4PTCA 3ZRMA 2X8EA 3FDNA 3UOHA 3H4JA 3CKWA 4O81A 2IZTA 4IANA 5AUWA 5DWRA 4CKRA 4ACHA 4I5PA 5LVPA 4Z9LA 4ZK5A 3VUKA 3FLNC 3AG9A 1FBNA 2IZRA 2DS1A 2X2KA 4JIAA 3ZO3A 3ZS5A 5DMZA 3AT4A 3G9LX 1ZXEA 5CVGA 4JX3A 4PP7A 2BZJA 2XK3A 1SZMA 2H34A 2BZHB 5J5SA 1VEBA 3SRVA 2WO6A 4OTRA 3IS5A 4R7IA 3OXIA 3R00A 4LGHA 2OIQA 3AC1A 2OXDA 3QHRA 3S1HA 5FDPA 4IACA 2RL5A 5C27A 3IW5A 3D2KA 5HNGA 3UOJA 2X7OA 2PZ5A 2XP2A 3CQUA 3QRUA 2ITVA 3OCSA 5J7HA 2HWOA 3VS5A 2KTYA 1U46A 5IF1A 3F61A 4FGRA 4EH5A 3HV5A 2C6IA 2QOBA 4DEBA 1CMKE 2Y8OA 2FA2A 1OGUA 4LGGA 1T46A 4UMQA 5IA0A 3RINA 4PL3A 4DEHA 2WEVA 3Q04A 4M68A 4QPMA 5BVEA 2C5NA 3GOKA 2PVHA 5IDPA 3BRBA 4W4VA 2QKRA 3QKLA 4EZ5A 4LUEA 3R21A 2QHMA 4XG4A 3ZFYA 4ZMFA 3BU3A 4R3RA 2BZIB 2WB8A 1WBOA 4H3PA 3DQXA 3BYVA 4IM2A 5ANKA 2C6EA 4BDAA 2G15A 2WZJA 1KSWA 3K5UA 4F7SA 4EJ7A 3FE3A 1YKRA 4YSMA 3EYGA 1U59A 3VAPA 3OMVA 3FC2A 4H36A 4MXXA 3R7UA 5CENA 3KXXA 5T68A 5GJFA 2OWBA 4M7IA 2JD5A 4YBKA 5CU0A 5BPYA 3OUKA 3TNQB 3QKMA 2XBAA 3RP9A 3FY2A 3MVJA 3QCYA 3AC4A 3FYJX 1Q8WA 4GT5A 5L2QA 4ANLA 3A7HA 4FVPA 2C3JA 1WBPA 4BTKA 4RRVA 2X2LA 2VGOA 1YXXA 1Y91A 2PVNA 3EFWA 3EQPA 4GFGA 3D5WA 1WVXA 2RG5A 4JOAA 4M8TA 4PPAA 5D11A 3R8VA 3VNTA 3KL8A 4FKUA 4IWOA 4AZSA 3FKNA 4O1OA 3MH3A 4KIKA 2VTRA 1JVPP 3R7EA 4S2ZA 4EBVA 1PRYA 4MNEA 4RFMA 5E8SA 5HE3A 3R28A 4WIHA 2VTAA 3TDWA 1DI8A 2F49A 5CLPA 5AUZA 2YIRA 3DBQA 5F20A 3D83A 2PVLA 3ZZWA 3UIBA 4JAIA 3II5A 4F9WA 3GCQA 3C4EA 3B8QA 3R8ZA 2PY3A 4IC7A 2WMRA 3AD5A 3VIDA 2ITZA 1A9UA 4ALWA 5J1WA 2OIBA 4ZS0A 4C8BA 3QUEA 1W0XC 1PXLA 3L8XA 5EM5A 3SX9A 3TKUA 4DN5A 4DAWA 2UW8A 3GU5A 1XH4A 3OTVA 2O3PA 3SKCA 3F3UA 3NCZA 1QL6A 4YJVA 5EHLA 3G5DA 4DEGA 2RFDA 2VTSA 5CSPA 4JBPA 4LMUA 3DK6A 3EQBA 1UA2A 4O0UA 5KUPA 1FOTA 3R8UA 4XCUA 4QTDA 3QRTA 5ACBC 2PVKA 1XH9A 4GV1A 5DA3A 4USDA 4E93A 2F7ZE 1CTPE 4FNYA 4QYGA 4AF3A 1U5QA 3EQIA 3PXRA 5L2IA 2VV9A 3IECA 1PXNA 2QOOA 4O0SA 4IEBA 3R9DA 2C5XA 4O7SA 4IX6A 2YCSA 4RIXB 2VWXA 4C0TA 4JLCA 2Y6MA 5AWMA 5HD7A 5JGBA 2B53A 3TV6A 4EORA 4DFNA 5JZJA 3FLZA 2YM5A 3QUPA 4JL9A 1JKKA 5CU4A 5DT4A 4FEWA 4MD9E 1L8TA 4NK9A 4YTCA 5M44A 4R6VA 2XJ0A 1H24A 4I4FA 5TT7A 2YJRA 4DEAA 3E87A 4C4IA 2UVYA 1H25A 3P7BA 3FI8A 4FK3A 2C3IB 2VGPA 3MJ1A 3QC4A 3QTWA 2Q0NA 3Q9XA 2HZ4A 4OTGA 1GIIA 2UZWE 1ZYCA 3RCDA 1V0OA 3UNZA 3IONA 4CFWA 4A9TA 4I5HA 2YDKA 4OTFA 1H07A 4MAOA 2OLCA 4I6BA 2R3MA 4WSYA 4JDIA 4BDEA 4FV3A 3Q52A 5AUYA 1R1WA 2HZ0A 5AR3A 3R1SA 3ZLXA 2OH4A 4A4OA 1BL7A 1OIRA 4O0RA 2FGIA 5KKRB 5AIRA 5IH4A 2WEIA 5H8BA 2H6DA 5HORA 3NNWA 4FV8A 1KE5A 3N51A 3PIZA 1W82A 4WNKA 4K11A 2JFLA 4ID7A 2I0EA 1ZZLA 3PE1A 4RWKA 2VWBA 4EZ3A 4FV0A 4B9DA 4D1SA 4NJ3A 5EFQA 3BEAA 3SOCA 4EHZA 5I9UA 4RT7A 1H1PA 3BYSA 4QMNA 4Y72A 4ASXA 4V0GA 2IZUA 2PL0A 4AQCA 2OJ9A 4L46A 4E4MA 3NX8A 4JDKA 4L7FA 5CF8A 3AC8A 3GFWA 3HV6A 5DI1A 1YDRE 2G2HA 2B0QA 5DRBA 3KRXA 4QQTA 5HO8A 3QTXA 1A06A 1ZOEA 4LYNA 1I09A 4B8MA 1K3AA 2XIYA 3CD3A 3MDYA 5DN3A 3O23A 4FSTA 4WNOA 3VW6A 4U9AA 2PVYA 3CGOA 4N4SA 2YHVA 3A62A 3F66A 4O82A 4E4XA 2HELA 4FUYA 3QA8A 2XK8A 4FX3A 4IZAA 3DLZA 2V5QA 4FKIA 2YIQA 3BWFA 3UOKA 4PDPA 4F63A 4HVHA 4CLJA 3ZUVA 4X3FC 2HZIA 2PMIA 3DB6A 4GJ2A 2BTSA 3HMNA 5E92A 5CI6A 5A4LA 5FXRA 2P4IA 1OI9A 1OL7A 3OTUA 3QF9A 1YWVA 3POZA 4UWBA 4BL1A 2XZSA 4EWHA 5IQBA 1JWHA 3FI4A 4OR5A 2UVXA 3ORNA 3VW8A 4GJ3A 4WUNA 4A4XA 3PVWA 2GS2A 4A07A 4DEEA 4E73A 2PUPA 4EK4A 4GVAA 3Q4ZA 4CFUA 3TZ9A 2XIXA 3NYXA 4IB1A 4X3FB 5CTPA 5DR6A 3ZSGA 4ACCA 3D7TA 2XK7A 4MHAA 2GDOA 4YNEA 5DOSA 5FEQA 3S95A 4C2WA 3UP7A 2JDVA 3W18A 3QGWA 5EQYA 2VRXA 4XBUA 2VTIA 2YAAA 5C9CA 3NYOA 3RK7A 4F6UA 3A4PA 4FSRA 2PUNA 3HV4A 4EQCA 4XV3A 3BGPA 4UWCA 4G34A 3VS4A 4Y83A 2XNEA 3MA6A 5DPVA 4CYIA 2R3OA 4OAUC 4EC9A 4G6LA 4PL4A 4ZJJA 3R7OA 3VJNA 3TV7A 1PYEA 4AZWA 3GUBA 4BDBA 3NMUF 4GL9A 2X7FA 3UO5A 4JXFA 3U87A 3FEGA 1URCA 3EQDA 3V8WA 2YCQA 4AS0A 2GCDA 3VBXA 4E5BA 3D94A 4KB8A 2OIDA 4E26A 4KBAA 2WTCA 2DYLA 5CAPA 3PVGA 4IDVA 1QCFA 3V04A 4DBNA 3PLSA 1J1BA 3MFTA 4IH8A 4FYOA 4Q5EA 4XYFA 3I5NA 3SC1A 4AW2A 2EB2A 3GCSA 3IDCA 2R3GA 2YACA 3G90X 4YHTA 3V5TA 4LMNA 4EOIA 3FLQA 5DNRA 3VN9A 4C33A 3LFCA 5TR6A 4O22A 3S0OA 5HBEA 3TTIA 4ANNA 4F9AA 4I22A 3ORMA 5CT0A 1VYZA 4EBWA 4F1TA 3QD3A 3C5UA 4G6NA 2VNYA 3JXWA 3C4ZA 5HCXA 2PWLA 5FP6A 5EYDA 4D5HA 3PIXA 2X2MA 3CIKA 3RK9A 3HNGA 1KOBA 2IJMA 3QKKA 4HW7A 3FBVA 2OJIA 3QUDA 3TG1A 4JBVA 4JQ7A 4MTAA 3UQCA 5TF9A 1RDQE 5CWZA 5JH6A
chains in the Genus database with same CATH superfamily
2BRNA 3Q2MA 3MTLA 1Q61A 1H1SA 4IM3A 3MW1A 3GCVA 3H30A 2CKPA 5CT7A 2ZV9A 3CGFA 4O7LA 4FICA 4EC8A 2Y9QA 4F64A 1CSNA 2IZSA 4AOIA 1ZOHA 4TNDA 2P3GX 3FKOA 3L1SA 1V0BA 3T9IA 3UG1A 5IG1A 4FV1A 3QL8A 3AGLA 3CP9A 3H9RA 3U9NA 1DI9A 2QO7A 5AP5A 4DH8A 2VTMA 3EQFA 3MB6A 1H01A 2R3HA 4QMWA 5AIKA 3LXNA 3EWHA 2AUHA 4BY9E 1TVOA 3BU6A 2IG7A 1J7IA 3CTHA 3W0PA 4Q2AA 1XH7A 4Y95A 3ULIA 5CEMA 1M14A 4XOYA 1Q8UA 5EM7A 4U5JA 4ACMA 3CCNA 3NAYA 2JIUA 4N0SA 4APPA 3L9PA 1GZKA 3PP1A 4OBPA 4S32A 3WZDA 5FP5A 4AW5A 5GIOE 3MFUA 4S34A 2W06A 4EH8A 2QONA 4QDEA 3O8PA 3VQUA 5J9LA 4A7CA 3O7LB 1UV5A 2HY81 3IO7A 3LQ8A 5CY3A 4YZNA 2ZV8A 3G9NA 4WKQA 2WFYA 1BUHA 4P5ZA 4HVDA 2X81A 3GEQA 1WBSA 2ETMA 4DGMA 3RPRA 5HVJA 4EHEA 1XMLA 1WBNA 3A8WA 3OW3A 2G1TA 3BI6A 4XG3A 3RWQA 4GIHA 1LEZA 1M2QA 4IX5A 3DOGA 3FMHA 3L9NA 4PMSA 5F1ZA 3KU2A 1E1VA 3WF9A 4CG9A 1XMMA 4IB3A 4ZSJA 3ZM9A 3O2MA 4ITIA 3ZSHA 4EH9A 4K18A 5DHJA 4IWDA 2XM8A 4FG7A 4IVBA 4RIYA 3VO3A 2NP8A 3LKMA 2FO0A 4O7WA 4RZVA 5BYZA 2UZOA 4NEUA 3EZVA 1QPJA 4NM5A 4D28A 3B8RA 3UG2A 4XG2A 5AM6A 2B9IA 3RPOA 4EHVA 3CJGA 4NWMA 2VWYA 5AUXA 2RFEA 3W33A 2EXCX 1FVRA 4DEIA 5FDXA 5IEVA 3KIOC 4PX6A 3TIZA 2XCHA 2P2HA 3WILA 3TZMA 1H4LA 3RM7A 2CNUA 2GNHA 2HZNA 4AACA 4RG0A 4RJ8A 3LM0A 4O91A 4BCKA 3NPCA 4GH2A 3BQRA 4O4FA 3PG1A 3KGAA 1QPEA 3O8UA 3VBYA 4BCFA 3O5AA 3LFEA 3PSDA 5FLFA 1IG1A 4MF0A 2RSVA 4GS6A 4QP2A 5I0BA 2CGUA 4FUXA 3MVMA 3GU6A 2IN6A 3IOKA 2OFVA 4B0GA 1H1RA 1S9JA 5J8IA 1SYKA 5L3AA 2YM3A 1PHKA 1XBBA 5H2UA 4G6OA 4P90A 3RWPA 3LQ3A 4EOKA 5I3RA 2R5TA 4D0WA 2JGZA 5EDPA 3IW4A 4JR7A 2XBJA 3D9VA 3BLQA 5EKNA 4ANMA 5H3QA 4X7QA 3JVRA 3ALOA 4R1YA 4BHNA 4ZMEA 2YWVA 1OMWA 3DS6A 1MRUA 2QOLA 4QO9A 4Z7HA 4BCIA 4F6WA 3PUFC 2BAJA 5HVKA 3H0ZA 4OTDA 4PP9A 4WBBB 2XYNA 2BDJA 1OIUA 2QOHA 3FMEA 3OOGA 5ANOA 2VX3A 1YI3A 3GB2A 3RAHA 3NNUA 5BUEA 1OBDA 3I5ZA 4FTUA 1UU3A 1W98A 3HP2A 3L8VA 4O84A 3QD2B 3EIDA 4JG8A 5IA3A 4H3QA 4OTQA 3FSFA 3RZBA 3BEGA 3LFFA 4KRDA 4FV5A 2R2PA 4FNWA 4A9RA 5FG8A 4H05A 4EYMA 1Y8YA 1G3NA 5J1VA 4L44A 3ZTXA 4NZWB 1P5EA 1OPJA 4DGGA 5KE0A 1XHAA 3IW7A 3PXZA 4CFNA 3EQGA 4EJNA 2XNMA 1PKDA 3QHWA 4UZDA 4TYJA 2B7AA 4U44A 4ZTHA 5DG5A 4BN1A 2X8IA 4FC0A 5CAUA 4EZ7A 5K5XA 5AX3A 3EHAA 3P1AA 2CN5A 4FV2A 4RWIA 3EKKA 2XALA 3OC1A 4J95A 4TXCA 4W9WA 4AE9A 4UXQA 4RFYA 4O0YA 3C0IA 4DFBA 4FL2A 2QR8A 4B99A 4PDYA 3EKNA 4BHZA 2VWZA 2W1ZA 3DKFA 3TNPC 3O51A 4JI9A 1XH6A 3G2FA 3KK8A 4FKQA 4KKEA 3PYYA 4DCAA 4AWIA 4A9UA 3QX2A 2BKZA 3GU8A 3OZ6A 4HYIA 4LOQA 4ZTMA 5FTGA 3W0QA 4ZSLA 3V3VA 3AT3A 4AT3A 3Q9WA 5LXMA 4O0TA 1O6LA 2ZDUA 4CFVA 4AXDA 4L3PA 3B2TA 4FVQA 2C0TA 4C62A 1PXPA 3R30A 5BUIA 3DTWA 3PJCA 3MSSA 5TKDA 4CTBA 5CQUA 5AX9A 2XIRA 5M53A 4QTCA 3F2NA 4BYJA 3DFAA 3UTOA 3FZRA 4AOJA 2CLQA 3W2PA 2B55A 4K6ZA 4W4XA 4O7TA 1JKLA 3JYAA 4FIHA 5JGAA 3TZ8A 2XNPA 4TL0A 3LCKA 4OLIA 3TACA 3ZH8A 3R83A 2UZBA 3EQRA 4S30A 4YC6A 3AQVA 4IWQA 4TWPA 4EWQA 4HYHA 4LM5A 4FEVA 4QEBA 3TMOA 2F9GA 4JT3A 4MVFA 3RNYA 2BAKA 2C6KA 3P86A 5LVOA 5K4IA 2ZMCA 4QMXA 5KO1A 3BV2A 4FSMA 5CALA 4DBXA 3NS9A 2QR7A 3ORPA 4QMYA 3JVSA 4XP3A 5HCZA 3SXRA 1Q3WA 2PE1A 3I4BA 3ZUTA 4AA4A 2VWVA 4MXOA 2JIIA 1SMHA 4PQNA 4R1VA 2RFSA 4I20A 4BGGA 2NNWB 4QMPA 2C1BA 2QOQA 5K3YA 4CQEA 3DXNA 2B9HA 3TIYA 3G15A 4MQ2A 2YM7A 3DNDA 5CNOA 5HESA 3FMLA 4FKPA 2ZM4A 5A14A 4QTAA 3KF4A 4I5MA 3W2CA 3G6GA 3ZEWA 4WG3A 2C47A 4CV9A 4DH5A 1ZZ2A 4M67A 4AAYA 1OKZA 4LDTA 1JSVA 4XRLA 3O96A 3ZXZA 4EEVA 3R9RA 5B0XA 1URWA 3RNIA 2HW6A 3FPMA 4YBJA 2FVDA 3AKLA 4JIKA 4XV1A 4CRSA 2I7QA 5ANDA 5M4CA 3FWQA 4DFUA 3O7LD 4JJRA 4L42A 5D7VA 3VJOA 3LVPA 3VULA 1XO2B 4E8AA 4ZZMA 3CY2A 3P0MA 4OTHA 5IA1A 4OW8A 4I0RA 4RA4A 3ROCA 1XQZA 5A3XA 2W1EA 4GUBA 5DVRA 3BBWA 2VTQA 5GJGA 3NIEA 5HICA 4DLIA 2VTHA 2VWWA 3SRVB 4FEUA 4BWPA 5JZNA 4FSUA 5JN2A 2CCHA 4MD8E 5D10A 2VWUA 5D9HA 3VWAA 1ZY5A 4ZSGA 4IB0A 4FV6A 3V5WA 4O86A 1UNLA 3NNXA 3MH0A 1WZYA 5M4FA 4O4BB 1YDTE 3JS2A 1PKGA 5DT0A 5CEOA 3Q96A 4EK5A 2BVAA 3PA4A 4C59A 1EH4A 1I44A 4MX9A 5CSHA 4B4LA 3MTFA 3VUGA 2QURA 4CD0A 3KULA 2GNFA 4TZRA 5CU2A 4IX3A 2CN8A 4AXEA 1OKWA 4ASDA 3D5UA 3IDPA 1FINA 1REKA 1YXSA 2X0GA 3FZOA 3EFJA 3AMBA 3OCTA 3HECA 4ERWA 5BVDA 5HTBA 5IZFA 2ITNA 2YFXA 3WYYA 1ZRZA 2HAKA 4NW5A 1XBCA 5A6NA 4BIEA 4D4VA 4F7NA 2WHBA 3AD6A 4NTSA 3R9NA 2XCKA 3LMIA 3CSVA 3R1QA 4EL9A 2EVAA 1UU9A 4DFYA 1OUKA 1WVYA 4GW8A 4EONA 3ZRLA 3PPZA 2X4ZA 4J96A 3WYXA 3VF9A 4FTKA 3LCOA 5IQCA 4ARKA 4O96A 4C37A 1P4OA 2YIWA 4A4LA 3QCSA 4RBLA 4HGTA 5EM6A 3MH1A 3PJ1A 5KZIA 3HAVA 4CLIA 3LQ5A 2WOUA 4BDFA 3V5JA 1FVVA 2NRUA 4FE2A 5KZ0A 4CFMA 4ITHA 1M7QA 2A27A 3QTUA 4IM0A 4EUUA 3DBDA 4L67A 1YWNA 5CSWA 5FUTA 1B6CB 2PZRA 2J0MB 1Q97A 3LLTA 3LM5A 2PHKA 3PVUA 2XJ2A 4KIKB 3RAIA 3HDNA 3E7OA 3C13A 3RAKA 2QG7A 2WOTA 5CSXA 4MNEB 4AGUA 3BHUA 3LLAA 2CKOA 4KSPA 4HVIA 3A8XA 5FXSA 5A4CA 4U79A 4BDKA 1G8SA 1U4DA 3CPBA 3D2IA 1PXMA 4J8MA 3UVRA 2YISA 3WIKA 1B39A 4ORKA 1OPLA 3S4QA 3BLRA 2OO8X 3W0RA 4R78A 2V7AA 4QP1A 3DT1A 4PPBA 3PRFA 5CU6A 2R3NA 4F99A 4FKWA 2PMNX 5K4JA 4FJVA 4K2RA 2PYWA 3E8NA 5IUGA 2BKKA 4TTHB 3ZDUA 3E8CA 4JMQA 5GIPE 3C1XA 1GZOA 2V7OA 3EQCA 4DT8A 1OIQA 4JR3A 3QQLA 4QMLA 5EKOA 3VS0A 3GGFA 4FVRA 3QWJA 3SV0A 4CT2A 5AP6A 3PXKA 4ZOGA 4RVMA 4EH2A 3EN5A 5AP1A 4E3CA 3R7YA 2NRYA 4UMTA 1XKKA 2QQ7A 2XH5A 3VBTA 3Q32A 4BCPA 1PYXA 4WD5A 3CE3A 4JG7A 3FMDA 4M15A 4EH7A 3ANQA 3F3VA 1OL5A 1W84A 5M4IA 5EQPA 3TV4A 5BVNA 4LI5A 4X2FA 1UNGA 2G01A 1MRYA 2E9NA 3OY1A 1GIHA 4M12A 4KBCA 4BCQA 3OS3A 4AZEA 3SLSA 4DH7A 5J95A 2WIHA 4UBAA 3HUBA 4IVAA 4G3GA 3ZO2A 3CR0A 3KB7A 3N9XA 4D55A 1KE9A 4U80A 3FKLA 3CS9A 4RGJA 4E6DA 3T3VA 2CGVA 4JS8A 4TNBA 3MIAA 2XEZA 2JDTA 5J5TA 5FBOA 3QYWA 4II5A 4BTMA 3LJ1A 2VO3A 1GAGA 2F7XE 4ZAUA 3NFGB 2PZYA 4QMZA 4X2GA 2JKMA 4RSSA 3BU5A 3AMAA 3RCJA 2OZAA 1Q8TA 2RG6A 5EYCA 5HZNA 3G0EA 3ZO4A 3EN6A 4CXAA 4JNWA 4KBKA 2W1CA 4K1BA 3UZPA 4X2NA 3CKXA 3EZRA 3TTJA 3PXYA 4ITJA 3G0FA 5EW8A 3PFYA 5GHVA 4XOZA 4KKGA 4YO4A 5AAGA 4QDVA 3BGQA 4BTFA 3BL7A 4O21A 3VRYA 4DFXE 3UDTA 2E9PA 4IAFA 4J99A 1AGWA 2A1AB 3KXHA 2W1IA 4XMOA 4ANSA 5BYYA 5AV0A 5L8LA 2CNQA 4BI2A 5AUUA 2WPAA 3W55A 4C38A 3F7WA 4UN0C 1P4FA 2C1AA 4Z16A 4XV9A 1NVRA 3W0MA 2XB7A 3DKOA 3LCSA 4V0GB 3KCFA 2GNGA 3EYHA 2E9UA 1Y57A 4FT3A 3ZC5A 3BHHA 4QQCA 3QFVA 5KX8A 1CKPA 3DTCA 1HOWA 4DGNA 4D58A 3Q4CA 3R8LA 2GHGA 3TNWA 4ASEA 4EQMA 2X6EA 5KMLA 3A60A 5DR2A 5AM7A 4D2VA 1F0QA 2OZOA 3M2WA 1J7LA 3UIMA 4OT5A 4YMJA 1BI8A 4FEXA 2GS7A 2XIKA 2C6DA 2XRUA 2Z2WA 4L3LA 1O6KA 1Q99A 5AV3A 4CMTA 1S9IA 2ITXA 2VO7A 4YJUA 1J91A 5EK7A 4RX8A 3LMGA 4RPVA 5L6WL 2QI8A 3QQKA 1Y6AA 4PTGA 4QYFA 3D4QA 2WTDA 2CNVA 2HY0A 4FRFA 4LV8A 2X0PA 2B1PA 3MPTA 2G2IA 4IDTA 4AZTA 2X9FA 4BCGA 1OECA 4ZS4A 1YRPA 4DH3A 4J97A 4CCUA 4OT6A 5LMAA 3H9OA 4BJJA 1OL1A 4KSQA 5GZ9A 3HLLA 1M2RA 1ZMVA 3R6XA 4M69A 4QP6A 3UDSA 1IRKA 5TOZA 3OP5A 3BE9A 1OKVA 4Y5HA 3TCPA 3I1AA 1OVEA 3D7TB 4QOXA 4WSQA 5EDRA 4E4NA 4I94A 3UODA 2FUMA 4FSNA 1PXJA 2W1GA 5IQIA 1BKXA 3F5XA 4IAZA 1ZARA 1NW1A 4ACGA 3LIJA 3E3BX 3ZXTA 4DE4A 5IU2A 4GCJA 4NW6A 5EYKA 4EK3A 4IC8A 3NVMB 3IW8A 4DDGA 4TYGA 5IH5A 2BZKB 3EJ1A 4TPTA 4O7RA 4EQUA 5HE1A 4C4JA 2C69A 4F78A 5JFVA 5HQ0A 1GNGA 3HL7A 3BBTB 5HLWA 3P23A 3RALA 3TKHA 3K5VA 5K5NA 4CGAA 3HA6A 4TYEA 3KRJA 2GQRA 2B9FA 3W10A 3CEKA 1H1QA 2R4BA 4L52A 4W8EA 4C36A 3ACJA 4KIQA 2XJ1A 1SVGA 4PY1A 4RVLA 3I81A 5GZAA 4FTJA 1YHVA 5IISA 3CTJA 4HCTA 2JIVA 5E8UA 3HVCA 2WELA 4WA9A 1SM2A 3KY2A 2PUUA 3UOLA 2X8DA 4FTAA 4AT4A 4IIRA 3A7IA 3D7ZA 2ZB1A 3G33A 4AP7A 1HCLA 1JBPE 2VNWA 2P2IA 3GU4A 4HJOA 5IMEA 4M84A 1Q3DA 4CKJA 3KK9A 4MD7E 4FL1A 2J9MA 2QOIA 2UZUE 4JRVA 4L53A 4FKGA 5KCVA 4X21A 3MIYA 3F2AA 4FOCA 4GK3A 4XG8A 5AR7A 2OSCA 5A4TA 4UYNA 4R3CA 4A9YA 4YSJA 3PJ8A 3H3CA 2ZVAA 3M11A 1YXVA 4JVGA 4LQMA 1F5QA 5K0KA 3DKCA 4G3EA 1ND4A 4BZDA 3ZHPC 4X2JA 2ITUA 1VZOA 4LV7A 4E7WA 4APCA 5CEIA 5JRSA 3CPCA 2OW3A 3D0EA 3DLSA 2VTTA 1MRVA 4B6LA 2UVZA 4O6LA 2X7GA 3U6IA 4ZLOA 3FLYA 3SVVA 2X4FA 1NA7A 4KNBA 4H1MA 4EOMA 3ZU7A 1Z9XA 4HZSA 2PVMA 4GMYA 1ZMWA 5KMNA 4AXFA 3BYUA 1W2CA 2O2UA 4FNXA 3FMJA 3TJCA 3KRRA 4G3CA 3FI3A 3GCUA 3LXLA 4UZHA 4YTIA 4R77A 3G6HA 3MS9A 3ORTA 4YZBA 4ZY5A 4ZLZA 5BUJA 2WTIA 2YITA 4X6QC 3R22A 3ODZX 4TYHA 4D4RA 4O7ZA 5J9ZA 5HLPA 3HRFA 4YURA 3DBFA 4MF1A 2IWIA 4EI4A 4IJPA 4Y5QA 4GKHA 2OJGA 3HGKA 5DT3A 3AC2A 4AG8A 2NYAA 4AQKA 5E8WA 3BWJA 2QG5A 2PK9A 3GNIB 3NGAA 2RF9A 2LGCA 2W17A 3NUXA 3PP0A 4TY1A 4YNOA 2DQ7X 5J87A 4IHPA 4DG2E 1GOLA 4USEA 1RQQA 2BAQA 5KMIA 5BMMA 2BIKB 3NLBA 4FTRA 1ZYDA 1R39A 3QZIA 4XBRA 4FKJA 3ORLA 3EQHA 1G5SA 1R0PA 4RIYB 5ANEA 2UZNA 5A4QA 4NFMA 3RPVA 5HX8A 4AN3A 5IA4A 2GMXA 2GFSA 3K54A 5AR2A 4F70A 4DHJA 5E8VA 4PRJA 1UVRA 3BHVA 3PY3A 3E5AA 3H0YA 2GFCA 3Q60A 3SW4A 3W0NA 4I4EA 3KMMA 2XM9A 1OB3A 3GU7A 3QQUA 4G3FA 3O8TA 1QMZA 2A4LA 3Q3BA 2XEYA 3MY5A 3Q4TA 4YO6A 3EN7A 3UMXA 3V6SA 3EL8A 4R7BA 3ZMMA 4KIPA 2XAOA 4OTPA 2OU7A 2P33A 4FK6A 5EDQA 4YJOA 3VHEA 3QWKA 3NAXA 3F5GA 4OGRA 3FY0A 3EFKA 5AP3A 4G9RA 4U40A 5IH6A 4HGLA 3UVPA 3DA6A 3DAKA 3GT8A 1IR3A 1H26A 2H9VA 2WNTA 3R7IA 4CV8A 5C26A 5CEKA 3GVUA 3PPJA 4RX9A 3ZOSA 3UZRA 5DR9A 3VS1A 5AUTA 3QCQA 3R7GA 3TI1A 4MXAA 5HIBA 3ZCLA 3SAYA 4BBMA 4U81A 5TO8A 5IQHA 4O38A 4QQJA 5E8YA 2NO3A 5EI2A 5EI8A 2QOFA 4GRBA 4F9YA 4HNIA 5C03A 2UW4A 5DLSA 5F4NA 3F82A 1YW2A 2WMVA 3C4XA 4IX4A 3HMIA 2P55A 4QMUA 3DCVA 3LFAA 4FTLA 4JDJA 3BYOA 3TKIA 5L2WA 1UU8A 4G1WA 4RVTA 2X1NA 2ITWA 3A4OX 4HOKA 3SOAA 3LFDA 3MH2A 3MYGA 4ZJVA 1ST0A 4RWLA 4JDHA 3EN9A 4BCHA 4ASZA 5IEXA 3W32A 4FSQA 5DIAA 2HXQA 5LVNA 2CGXA 1H8FA 3BHTA 4HZRA 4ANQA 4IB5A 3S3IA 3E88A 4PPCA 5B2MA 3ZLWA 3N4VA 2YEXA 2VTPA 2F2CB 5BMSA 3NIZA 5E1EA 3BLHA 2Z7SA 2O64A 4WO5A 3RBWA 2ETKA 3QBNA 2CDZA 4S31A 4H3BA 4FA2A 2NPQA 2WQNA 4AN9A 1NXKA 2JKKA 3O0GA 4BVUA 3LXKA 4GG7A 2X0QA 4RA5A 2W5HA 3FXZA 3OCGA 4BGQA 2QNJA 3NWWA 3VUHA 4CEGA 2WMTA 3ZSIA 2IVUA 2FYSA 2Z7QA 3EL7A 3IPHA 4M13A 3VS2A 2I40A 3MGYA 2BHEA 4YJPA 4IZ7A 5HBHA 1LEWA 3ORKA 4Z7GA 3H9FA 4MXYA 3PVBA 3IQ7A 5L4QA 3BPRA 4FBXA 3F9NA 4NM7A 5IEYA 2EWAA 1DM2A 5L6PA 4RLKA 3FI2A 3U6JA 1LUFA 4HPTE 2UW0A 3DJ7A 4G5JA 5BVOA 2EB3A 4F1OA 1REJA 3Q6WA 5J9YA 2UW7A 4XS2A 4CZYB 4ZTRA 4RQKA 3ZO1A 2UW9A 5J79A 3OWPA 4DFLA 3FMNA 2BUJA 4LGDA 3ANRA 5I9YA 3CXWA 3LJ2A 4BR3A 3NYNA 4RC4A 5E4HA 4AFJA 5CU3A 1JLUE 2ZDTA 4BDHA 1KUTA 4TWOA 4XG7A 2J2IB 2XKEA 3A7JA 1OL6A 3LPBA 4HPUE 4C3PA 2KULA 1RW8A 4L00A 4RC2A 4L6QA 3DPKA 4RMZA 3V51A 3KN6A 3CBLA 1KE7A 4FF8A 3SXFA 4D4SA 3OUNB 1B38A 2VX0A 4ZXTA 3LHJA 3MVHA 3BX5A 2BCJA 3HP5A 4UX9A 1TFFA 4YJSA 2GSFA 3C7QA 3UYTA 4RFZA 2FH9A 4F65A 4F09A 3F2RA 4OBOA 3WF6A 3ITZA 5DBXA 4D2SA 4QTBA 2EU9A 4FGBA 4ZEGA 3ULZA 3VBWA 4F08A 3RKBA 4HVGA 4XHKB 5KMMA 3F6XA 3DK3A 4QMQA 2XYUA 3FYKX 3OY3A 4UMPA 3ATSA 1H08A 2BILB 4EH6A 3VUMA 3E93A 4IAAA 4QMVA 1J3HA 4RLLA 4L7SA 4MXCA 2YWPA 3ODYX 4OTIA 3LOKA 2YDIA 4L8MA 3ZFMA 1TQIA 4NKAA 2OFUA 5D7AA 4DGOA 4NYEA 3EB0A 4Q9ZA 3KXGA 4O0WA 2C4GA 3HZTA 5DH3A 4ZZNA 3ZONA 2UW5A 4HNFA 4QPSA 5I9VA 5AP2A 4WG4A 1H28A 5K9IA 4IAKA 3ZM4A 3W8QA 4RVKA 5JRQA 5CZHA 4BCOA 2YCRA 4BC6A 2W0JA 3LFQA 2W05A 4AUAA 5A54A 5L2SA 1Y8GA 1YVJA 5EOLA 3QTRA 4EOJA 3R8PA 3UQFA 3R9OA 3AC3A 2BIYA 1FMKA 4EH3A 5ACKA 4PMPA 3JPVA 5CXZA 5CF5A 1WBVA 5JSMA 1W7HA 4QMSA 3QQGA 4MEDA 3RTPA 3WZJA 3OT3A 1Q4LA 4BF2A 4C7TA 3PTGA 1LR4A 4ZTNA 4JQ8A 4RIWA 4YP8A 2E9VA 2J90A 4DINA 4EOQA 1P2AA 3M42A 2ITOA 1L3RE 4GKIA 4U8ZA 4FIFA 3SXSA 3O50A 4MUQA 4BKJA 2YZAA 4IW0A 4AXCA 3A7FA 4FIEA 4YC8A 3R71A 3FZ1A 2IEWA 4WRSA 1G8JA 4AT5A 4TT7A 5AEPA 4FTOA 4K77A 3ZLSA 4BI0A 1IAJA 4YR8A 4M3QA 1NVSA 4GIIA 3GBZA 4FV9A 4KKHA 2GS6A 2JITA 3EMGA 3IDBA 2SRCA 1W8CA 3GCPA 2HXLA 2IO6A 2OK1A 2GPHA 2WMSA 3FQSA 3KULB 2C6LA 5BVWA 3UBDA 3OW4A 4C3FA 2WTVA 5BNJA 4I23A 3NUPA 3W1FA 1XH5A 3QA0A 1JNKA 2ITQA 2O5KA 4FZ7A 2HYYA 4I93A 5C8MA 2F2UA 3PJ3A 5AP0A 4R7HA 1YDSE 3E3PA 4KA3A 3I7CA 4Y8DA 5E91A 4DHFA 4KUJA 1JPAA 4GSBA 4PWNA 5CEQA 3F7ZA 2W1FA 3OG7A 4JAJA 3UYSA 4M0YA 5HVYA 5JMSA 3L8SA 4RJ5A 4U3YA 5EG3A 5EM8A 3TUDA 1ZYSA 1Q8YA 2J4ZA 3BYMA 3R2YA 5JK3A 3ID6C 2QOKA 2OF4A 4FT7A 3VUDA 3VS3A 1Z5MA 2W5BA 4Z3VA 4DT9A 3OWLA 4QQ5A 2GNIA 5IQGA 3FXXA 5IA2A 2PTKA 4G31A 1NT2A 2O8YA 3SQQA 3E7VA 2OG8A 3NZ0A 1FGIA 5KMJA 4FIJA 5F95A 4JRNA 4U42A 5ANIA 5CAQA 5LMBA 4YLKA 5M57A 3DXPA 1UWJA 5KMKA 4AN2A 4RX7A 3NW7A 3V6RA 1YQJA 2R3FA 2VWIA 2XKFA 3DY7A 4EOPA 4KIOA 3QC9A 4M97A 3F5UA 4G16A 4DITA 3COKA 3HMPA 3QD4A 4ZJIA 4YPSA 4WNPA 3PJ2A 5CNNA 2WQBA 1GIJA 4MK0A 5IQFA 3Q5IA 3UE4A 4GEOA 2ONLA 4D4YA 3I6UA 4LG4A 2W9ZB 3ENHA 1VYWA 2BRBA 1E9HA 2OF2A 2J5FA 4BWXA 2VN9A 4OBQA 1ZOGA 1SNXA 3WE4A 4C4HA 3KRLA 4EK6A 1IA9A 3JY0A 3OEZA 4KWPA 3PXFA 2C3LA 4FMQA 2YJSA 3HDMA 4FNZA 4QPAA 2YM6A 2ZV7A 5LWNA 1VJYA 4GT3A 4NH1A 3DKGA 5HKMA 3TZ7A 3VC4A 3PSBA 4PV0A 2AYPA 3HRCA 4QMMA 3VS6A 5CF4A 4WUAA 5EYMA 3F3TA 5EHYA 4D2RA 1DS5A 5EOBA 1YI6A 3BGZA 4XLVA 1JKSA 2Y6OA 3DB8A 3IGOA 2WQOA 3TN8A 4DGLC 5I9ZA 4NUSA 2PMOX 4ZY4A 4GK2A 2YLFA 3P9JA 3RJCA 4K33A 2UW6A 3VF8A 4E6AA 3MVLA 2Z8CA 2I1MA 5FM3A 2WKMA 5HOAA 3DDQA 4BI1A 3WZKA 4E6QA 3MY1A 1PXOA 3CJFA 5JGDA 3MV5A 4QNAA 5KHXA 2FSTX 4L3JA 3KA0A 2UZLA 3DJ5A 3JY9A 5CAVA 3MY0A 3W2RA 1H0VA 4D5KA 3L9MA 4LUDA 5EHOA 1CKJA 5AR4A 3HX4A 2QO2A 2ZJWA 4D1XA 4E1ZA 1MQ4A 1JOWB 3CQWA 4NSTA 4PMTA 4ZTLA 3RGFA 4L43A 2ETRA 3R04A 1XH8A 3PXQA 2C5YA 4ACDA 4ZZOA 2HIWA 3E64A 5FTOA 2YDJA 4I6QA 3FPQA 3OBJA 1AD5A 3QXOA 2GQSA 4N57A 4YU2A 4GG5A 2OZAB 2ZV2A 5F94A 1KOAA 3W0OA 3QQHA 4QT1A 4WRGA 4DH1A 4YHJA 3W16A 5LJJA 2GTMA 2F4JA 1JSTA 4J1RA 1U5RA 4IBMA 2Y4IC 3QTZA 2JDSA 4M14A 4BCMA 4FV7A 3C4FA 4CZUA 4ANOA 1R3CA 3KMWA 5CVFA 4RQVA 4FZAB 3LW0A 4F1MA 4ENXA 3UMWA 2VUWA 4PNIA 3SG8A 3GC9A 3P4KA 3UO6A 2J0IA 5IUHA 2O65A 2E9OA 2ZYBA 4LL5A 5FEEA 3WARA 3UIUA 4KABA 4NKSA 3CD8A 2Y4IB 2XS0A 4I3ZA 2QO9A 4FODA 1MQBA 3TT0A 3U55A 4A06A 4NIFA 3RPSA 1PY5A 1Q41A 4GK4A 3LCTA 4QRCA 5DEWA 3FC1X 3KVXA 4YZMA 1RJBA <