3SLSA

Crystal structure of human mek-1 kinase in complex with ucb1353770 and amppnp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
304
structure length
292
Chain Sequence
MTLQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIGAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Engineering human MEK-1 for structural studies: A case study of combinatorial domain hunting.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 292
sequence length 304
chains with identical sequence B
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2011-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3slsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3slsA01
3ZZEA 4XV9A 3G0FA 3HDNA 4OTRA 2XJ2A 5IG1A 2PE0A 3FI4A 3P86A 4EYJA 4NK9A 4FTAA 3HUCA 5HO7A 5LWMA 1DS5A 3PE2A 4I0SA 4UEUA 3OWLA 3QHRA 2RG6A 2B7AA 2WTWA 5AAFA 4C8BA 5IQBA 4KKEA 3MVMA 4NW5A 3WE8A 5FXSA 5JMSA 4KRDA 3FL4A 5HIEA 2YIQA 4UWYA 3MN3A 4CLIA 4B0GA 2JITA 5FP5A 3E3BX 5JFWA 4ANLA 4YJVA 3I81A 3I79A 3QFVA 2QONA 2R3LA 1BYGA 3ZRMA 3AG9A 4X21A 1UV5A 3ZHPC 3OHTA 3OWKA 2PVJA 4S31A 3TEIA 2H8HA 4LOOA 4G3EA 4BVUA 4E73A 5FLFA 1APME 1ZY4A 3OCGA 5A4LA 5KCVA 5D1JA 4FG8A 5AUVA 1PXPA 4Y5HA 2QODA 3QCSA 1Q61A 4FTUA 2CNQA 4AFJA 2HY81 4U81A 2XA4A 3AD5A 4USEA 5EYDA 3GCQA 4DCAA 1XBBA 4O86A 4F63A 4R6VA 4DITA 5EKNA 3AD6A 5EYMA 4ZLZA 3RGFA 1ZYDA 3FKNA 4CFMA 3CKXA 5HNGA 3DQXA 4QNYA 5TF9A 4MH7A 5GJDA 3FZOA 4GYGA 1BMKA 3AMBA 1Y91A 4LOPA 3CQUA 4QP6A 3KMWA 5CX9A 2WMUA 2WTDA 2OXDA 5KE0A 4QP7A 3DS6A 2A19B 4DGGA 4P5QA 5J1WA 4GUEA 3TUCA 2F7ZE 2J0IA 4AWIA 3EKNA 4KIQA 5FBOA 2FA2A 3A2CA 4G9RA 5AR8A 5C1QB 3R9NA 5KMLA 3LAUA 3GFWA 3KXGA 4TXCA 4GG7A 2PVMA 3CJGA 2F4JA 3LXLA 4GIIA 4QP4A 4X0MA 4J7BA 3ZSGA 3FC1X 5HBJA 4BYJA 2OJGA 2BVAA 3LFAA 2GHLA 4IVCA 5HE3A 3KXZA 4F70A 5IA2A 2ZV2A 2HZ0A 2H6DA 4IC7A 4MWHA 4MNFA 4WG3A 3LVPA 3R73A 2QU5A 3NW5A 3R7OA 5HCYA 2EXMA 3ORZA 4U45A 4C7TA 5LQFA 2XUUA 3HYHA 5E8WA 5IKWA 1Q3DA 3LW0A 4RBLA 2J0LA 5J9ZA 4MYGA 4UALA 5EQPA 3KU2A 3TV6A 4MQ2A 3WF9A 4KAOA 2HZIA 5F1ZA 3PIZA 2R0IA 2PVNA 5L8KA 3KQ7A 3Q9YA 3GCUA 3RK7A 4FV6A 4WBOA 4AOJA 3OCBA 4G3FA 4AT5A 5KX8A 1YWNA 2GDOA 3T9TA 4AZEA 5IEYA 3DLZA 3V6RA 4QP8A 5AP5A 2JEDA 2P2HA 4PV0A 5L2QA 4XS2A 1Y6BA 1WBOA 4EOKA 1NVSA 2PUIA 1YHWA 2AYPA 2F7EE 2W06A 4AN3A 4D28A 4EHVA 5I9YA 4N4SA 2UZEA 4QMNA 1QMZA 5AMNA 3F3UA 4EZ3A 3FHIA 3FC2A 3FLSA 3TXOA 4C35A 4ZTRA 2OXXA 3D0EA 4CMOA 3BBTB 4NU1A 4RJ5A 4YZBA 2R9SA 3QX4A 5IUHA 1XKKA 4MXAA 5I4NA 4ACHA 4ZZMA 4WRGA 3NX8A 4IFGA 3QCYA 4AZVA 1UWHA 2IVUA 4FTRA 4WD5A 3NUYA 4EH5A 4YHFA 1Q8TA 5M51A 4FSWA 3SXFA 4M0YA 2I0YA 3VS7A 1JQHA 1W83A 4WG5A 3VHKA 4NWMA 3W55A 1Y8YA 1NXKA 2UZBA 2WTKC 4M15A 3IS5A 3CSVA 3NNVA 3D7TB 4JDJA 5DEYA 5LCKA 1M17A 3DTCA 3FHRA 2GS6A 2XNEA 4KBKA 4Y8DA 3UC4A 1KV2A 3IGGA 3FZRA 2SRCA 4XNEA 2BRMA 4PMPA 5DMZA 3POZA 5KKRC 1OIQA 3BHVA 5B2LA 5K0KA 4BCKA 3N9XA 2UW3A 4H1MA 5GJFA 3ANQA 5FD2A 3G2FA 3MH2A 3BZ3A 4MNEA 2JBPA 2ZAZA 3QXPA 2ZDUA 4M8TA 4TNDA 4JQ7A 3MIYA 3Q6WA 4IM3A 5E4HA 3OW4A 4L44A 2H34A 2OBJA 4QYGA 4X2FA 5DA3A 2VNYA 4IWPA 2C5OA 3VBWA 4I6QA 4EK8A 3EJ1A 2BRHA 2FO0A 4FKJA 5FP6A 4UMPA 2JKQA 3AXWA 4AGWA 5CU2A 4NCTC 4H1JA 2BR1A 4XH6A 4F7NA 1OIYA 4DGMA 4XG7A 5AR5A 1ND4A 3VC4A 3SXSA 4FV9A 2ONLC 2X2LA 3G33A 4ZLOA 3UP7A 4AUAA 4XLIA 5EI8A 2DUVA 3EH9A 3GU5A 4MXXA 5KUPA 4E1ZA 3O8TA 4P4CA 3LCOA 4J96A 4R8QA 5GINE 4IADA 3QC9A 5A6OA 3TTIA 4ARKA 2UW8A 3R00A 4DH3A 4E5WA 2WTIA 2PVFA 4DEAA 4AE9A 5A9UA 4OW8A 3F3VA 2O8YA 3GCVA 2Z02A 4FGBA 3JUHA 4GVJA 5A4TA 4HGTA 4IHPA 4WOVA 3ZONA 3D4QA 4DFZE 4CD0A 5LVMA 2RG5A 3N4UA 3NUNA 3PP1A 4FR4A 5C03A 4IIRA 2W99B 4NM5A 2ITXA 2WHBA 3O7LB 3BGPA 4WT6A 5FUTA 4LYNA 1JKKA 4IWDA 2GNGA 4KSPA 2O0UA 3SOAA 5JGDA 3S2PA 3F61A 3EN6A 4H3PA 4R7HA 1VZOA 4GK3A 4TYEA 5HNBA 4RG0A 3COMA 5ITAA 4MBIA 3PVUA 5ETCA 2PY3A 1WVXA 2OG8A 1MP8A 4YJUA 4I5MA 4IAZA 3ZOSA 3ORKA 3TT0A 3SLSA 2I1MA 5I3RA 1M2RA 5GNKA 3KRJA 1B6CB 4OTGA 5CYIA 3H9FA 4JS8A 4K77A 2WMWA 3FI3A 3JYAA 1XQZA 4K2RA 4AZTA 3EQHA 5HORA 3DBFA 4F1OA 2A4LA 3LFDA 2XNNA 3QA8A 4P90A 3IDPA 2GNLA 4TKSA 2VTRA 4CFVA 1XR1A 2BPMA 5EW8A 4EOPA 4DFLA 3MFSA 3QTSA 4GFOA 1PXLA 1B38A 4QMMA 1Q8UA 3LJ0A 3FMJA 4NKAA 3FZPA 2C30A 3W2OA 4BDKA 3C4FA 4Y72A 2V7AA 1QPCA 5BUJA 2P2IA 4BDGA 5CI6A 4BY9E 4FNZA 3BPRA 5HD7A 4RJ7A 4N6YA 3MY0A 3KK9A 4FL2A 4BZNA 5A14A 1DI9A 3CR0A 3LFEA 5JZJA 4KRCA 2BIYA 4FV7A 1H1RA 2XNOA 2XRWA 4IAKA 4L67A 3SG9A 4TYIA 1XWSA 4BCQA 3P4KA 3ZEPA 3F9NA 4I41A 4CQEA 5HLNA 3OCSA 3PG1A 3F88A 2X4FA 2WMBA 4GL9A 3QKLA 4BKYA 2ITOA 4R3PA 2FSTX 3DAEA 3BE9A 3BRBA 4A9YA 4ZSLA 5KMOA 5AP2A 3ZLSA 4C3PA 5FEDA 2X6DA 3G90X 5DT3A 1SZMA 2WOTA 3FXXA 1O6LA 3DTWA 3TNWA 3ZO2A 4EWHA 3THBA 2C0TA 2GMXA 3DBEA 5CSWA 5H2UA 4BDFA 3BYUA 2BRNA 2R3JA 2UVXA 4S33A 5GJGA 4TPTA 2GU8A 4JL9A 3AQVA 2ITPA 4ZSGA 4HYIA 5BVOA 3EQRA 2WMTA 5M4UA 3BEGA 4EK4A 3NCZA 2OZAB 3HMOA 4EOSA 4QMPA 2EXCX 4OTIA 4CFXA 4G16A 2XYNA 4QYHA 2CLXA 3C5UA 2JIVA 4QQ5A 1CTPE 5DRDA 4JDKA 4UXQA 3E8DA 5M09A 2VWVA 3JVRA 3RPYA 3G15A 3QTIA 1FGIA 2BAJA 1YI4A 4U3ZA 5E8TA 2E9NA 4FT5A 3SRVB 2WTKB 4ALVA 1KUTA 4CQGA 2OF4A 3BI6A 3GQLA 4JR7A 4MD7E 3ZZWA 4EONA 3TUBA 4F6UA 3ZH8A 3A60A 5TT7A 1PMVA 5EDPA 2LAVA 1GZKA 3R01A 5DR6A 4DEEA 3H9OA 5A46A 5KKRB 1ZZLA 3DK3A 4N0SA 4XRJA 2OXYA 5M56A 2BDJA 1VYWA 2ESMA 4O84A 4IXPA 4O22A 4QP9A 4JQ8A 3FMMA 4UZHA 3WZDA 3R7UA 4WSYA 2EVAA 3P7CA 4YZCA 4USFA 3R1YA 1B39A 3NRMA 1W82A 5AUWA 2VRXA 4ZEGA 3FDNA 2Z60A 4M7IA 5LMAA 4FTCA 3R9OA 3EFLA 2YFXA 4FZDB 3RPVA 3R63A 4G31A 4RQVA 5CAPA 4I0RA 1ZMVA 2XK4A 3CGFA 5BYZA 4JDHA 4QMVA 2XBAA 3U6HA 3BELA 4M97A 3AC8A 2ZDTA 2X8IA 2YJSA 3C1XA 4CZUA 5K9IA 4O0RA 4LMNA 4ZMFA 4KABA 1M7QA 1CSNA 2IW8A 5ANIA 2IPXA 3PVGA 4A4XA 2OKRA 4CMTA 2JC6A 2PSQA 1GZNA 1WVYA 3E5AA 4F1MA 3MJ1A 4FSMA 4EH7A 4QTCA 1GZOA 4O7TA 3GU4A 5HNIX 4IDVA 3KC3A 4YJTA 4BIDA 5CWZA 3OUNB 5FXQA 4BF2A 4NTSA 3EQCA 5C8KA 2WQOA 3KVWA 2O5KA 3C0HA 5DE2A 5CSVA 5L6PA 2PMOX 4ONAA 3E88A 3R71A 4JBPA 4PY1A 1Q4LA 3NYVA 3UOHA 4YZDA 4ZJJA 2AC5A 3OY3A 1JBPE 2PZPA 3UOKA 2BALA 4WNPA 1WBPA 4IAAA 5D10A 3QRJA 4TYJA 4CG9A 2W5HA 3ORLA 5AUYA 4O7ZA 4RFYA 3Q2JA 2HZNA 1ATPE 4E26A 5K4IA 1LP4A 4ITJA 3WZKA 2YM7A 2O2UA 3LZBA 3TIZA 2E2BA 2ZMCA 5I5ZA 5AM6A 2VV9A 4YSMA 5JKGA 4H05A 3LFQA 3MA3A 4ENYA 4D0WA 4CKRA 3BE2A 3NNWA 1OECA 1ZYSA 3QWJA 3ZFXA 3CQEA 4JX7A 4Y5QA 4KUJA 2W1GA 1PXNA 3VVHA 5IPJA 2ZVAA 4QO9A 2YHVA 3ODZX 4XOZA 4CZTA 5BVNA 3LFSA 2Y4IC 4ZMEA 4O7RA 4ERWA 2X7GA 4X3FC 3NUUA 4OBPA 4Z3VA 3BV2A 3EL7A 5IUIA 2XCKA 4JLCA 1GY3A 4C2WA 2HIWA 4EQUA 1IAJA 5CALA 4MD8E 2JDTA 3PRIA 3QD4A 4QTEA 4CTBA 3DXNA 3A99A 3R7EA 3CC6A 4FTJA 1KE9A 5FBNC 4HGLA 3V5JA 5J7HA 2G9XA 2WXVA 2HZ4A 3DT1A 4FL1A 4O2PA 4XRLA 3UQFA 2HXLA 4CFFA 5HU9A 5JSMA 4FK3A 3OXIA 3TKUA 5I0BA 3FLQA 3UJGA 4F09A 2RKUA 2JKOA 2GS7A 4C4GA 3PA3A 2ZV9A 2A2AA 3DZOA 5HESA 3TZ9A 3D15A 4P2KA 1YXXA 1OGUA 4KSQA 3UIMA 4U7ZA 3HV3A 4AOTA 1KSWA 5EYCA 3PVBA 2ZV7A 4RC2A 5C27A 2XNPA 4AGCA 3AT4A 1A48A 4S34A 5HO8A 2VX0A 5H3QA 4EWQA 1BL7A 4OR5A 1PYEA 3OZ6A 4P5ZA 3MV5A 5BPYA 5CAVA 5IA4A 1BX6A 3IOPA 4F9BA 2YDKA 3CKWA 4MX9A 3ZYAA 4XP2A 2O65A 4D9TA 2JBOA 3FLYA 4IAIA 3SAYA 4G3GA 4IB1A 4C4JA 5CNNA 1WBVA 4QP1A 2B4SB 3HKOA 3TJDA 3FXWA 3W1FA 4E7WA 5EQYA 5IQFA 2WOUA 5L6WL 1OKZA 4CYJA 4FZAB 4BDIA 2PVLA 3F3TA 3U6JA 2VTAA 3EL8A 2IG7A 2PK9A 3OP5A 3ODYX 3I4BA 3QUDA 3VF9A 4EH3A 4G9CA 5DG5A 5IUGA 4YBJA 1PXKA 4NEUA 4PL4A 3ZLYA 4D2TA 1PKGA 3VNTA 4YR8A 2F57A 4KBCA 3VBTA 1KE8A 3PFQA 4AU8A 4L01A 3SC1A 5A54A 3R1QA 4BBFA 4C38A 5CQUA 2UW5A 4PMSA 1ZOEA 2XBJA 4V01A 5DGZA 4R77A 3IW8A 1O6YA 4TZRA 3ZM9A 4PMTA 2Y6MA 5H9BA 1I44A 3BGZA 4I6FA 4AAAA 1FINA 3A7HA 2YZAA 3EFKA 3MTLA 5HE0A 2CNUA 4FSZA 5CAOA 3CBLA 2QLUA 3HV6A 3VF8A 3BHYA 5CS6A 2XK8A 5CEIA 4EJ7A 3DJ6A 5IU2A 2EUFB 3UP2A 4HGSA 3BWFA 4AZSA 3TWJA 2J5FA 3D5XA 4RZVA 4AW1A 4YURA 3SD0A 4FG7A 5I9UA 3LQ8A 4MK0A 2QLQA 4BDBA 2C69A 4NSTA 1J7UA 4ZOGA 3GXLA 3CS9A 4RX7A 3CXWA 2XCHA 4PTGA 3OWJA 2J7TA 4DT9A 3N4VA 5C9CA 4HVDA 3QTXA 4FSUA 3VIDA 4DEBA 3GOPA 4EQMA 3DK7A 3VS1A 1H1QA 3RWQA 4BCGA 3IK3A 2UVYA 3MY5A 3L9MA 2RF9A 2YAKA 4R78A 4YJPA 3PXZA 2OWBA 2VTIA 3MS9A 3NW6A 4M14A 2GNHA 5ANEA 4A9TA 3OFMA 4IZ7A 5EI6A 1ZMUA 4B8LA 4O1PA 2W1EA 4ZK5A 1F5QA 4CTCA 4G2FA 3MVHA 3RNYA 2CMWA 1OUYA 5FEEA 5JFVA 2ETKA 1GOLA 3QAME 4TNBA 5JZNA 3UQGA 4DH7A 3FY2A 2UZVA 3PPZA 2ETRA 5I9ZA 1WBWA 3V51A 4YO4A 4OBOA 4RX8A 4GKHA 4IDTA 1A06A 4Q9SA 3VS6A 2W1DA 4E6AA 2G2FA 1V0PA 3UBDA 4FK6A 2XJ1A 3BYVA 1PMNA 5GZ8A 2WQMA 1FQ1B 3O23A 4ASXA 4C33A 3U51A 2I0EA 5TR6A 2IWIA 2GNIA 2C6IA 3I6WA 3R7IA 2R3GA 4FV0A 4FEVA 3FMNA 4D58A 4RRVA 5LCJA 3TI1A 4E93A 5AA9A 3VUHA 4J99A 1ZZ2A 5M57A 3OXTA 3V8SA 4QP3A 4I21A 3U8WA 4ACGA 3LFBA 1JSVA 1XBAA 3S3IA 3SXRA 3MY1A 3SW7A 2BZKB 3OUKA 2J2IB 2IN6A 3FV8A 1LEZA 4M69A 2PZYA 3OBGA 3TL8A 3UNJA 5CEOA 5LJJA 1R1WA 5AR3A 2ETMA 5LVLA 4IZYA 5I9XA 1VJYA 3Q4CA 4A06A 3QC4A 3ZO1A 4O7SA 1SVHA 2GFSA 2GTMA 2R3IA 4ZTQA 4EHZA 1PXIA 2HCKA 4DH1A 4UMQA 3LOKA 2XP2A 1DI8A 2OIDA 1H8FA 1W7HA 2R3RA 2WB8A 3A8XA 3OVVA 5IH4A 3NVMB 3DGKA 4E6DA 1WBSA 3OEFX 5LMKC 3CLYA 1ERKA 2ITZA 2RSVA 2Y4IB 3E8EA 3FSFA 3BYOA 4PPBA 4Q2AA 4UZDA 3ACKA 2QOHA 4AP7A 3MVJA 3M42A 3RZBA 4LL5A 2C3JA 4NM7A 1L3RE 1RQQA 3KRLA 1Q3WA 1M14A 3UPXA 4YP8A 3PG3A 5AUZA 1GIIA 3TZ8A 3FKLA 5E9EA 3C4XA 2UW4A 2O64A 3DLSA 5EKOA 1ZYLA 2VTSA 4BN1A 3LMGA 3Q9WA 1AQ1A 3DJ7A 1H08A 3MJ2A 3QBNA 2W9ZB 5TOZA 3VUKA 5DRBA 5EHOA 3LLAA 1OKYA 2F2CB 4ERKA 3V5PA 3P23A 3SQQA 4FKWA 4PDOA 5CTPA 4YZMA 5EW9A 3R8LA 3PZEA 1OIUA 3FI2A 3Q53A 1ZMWA 4JIKA 2BZHB 5EYKA 4OAVB 3GBZA 4G5JA 4EJNA 3R9DA 3IG7A 4B4LA 3EZVA 2YDIA 5EM8A 2E9UA 4O96A 4LRKA 3CPCA 2YEXA 5KBQA 1HOWA 4O82A 1I09A 4U6RA 5HD4A 3W8QA 5TE0A 3ZSIA 4RX5A 4FOCA 2YZLA 1QCFA 2I0VA 5AUXA 4E5BA 4F64A 2PTKA 3QUPA 3LJ2A 4CT2A 4YZNA 3FQSA 1H26A 4DEIA 3CE3A 2CNVA 4ORKA 4GT3A 1SMHA 4F6SA 4AGUA 5HTIA 4BTKA 4ZTMA 5KMIA 4CEGA 4F4PA 2G15A 2G2HA 3Q4UA 4FKQA 3MSSA 4FKVA 4EYMA 4O7LA 4U43A 3WYXA 1H01A 2BIKB 1VEBA 5K0XA 2YM4A 2UZTA 4U42A 3NUPA 1XBCA 1CM8A 3QZHA 4X7QA 3E92A 3MBLA 2YIWA 2GNFA 1WVWA 3DDQA 4UXLA 5CSXA 2WTVA 5J9YA 4A9SA 4DT8A 3L9PA 5ANOA 2BTRA 4C61A 3CTHA 1XH7A 3ORIA 2XIZA 3QZIA 5AV3A 1R39A 2WIPA 2WTJA 4ITHA 4QMWA 4O0YA 2CGXA 3F2NA 4ACMA 3P9JA 2XM8A 4NKSA 2QO7A 3HP5A 5E7RA 1V0BA 3P08A 3F3WA 3WF8A 5AV1A 1YDRE 5CNOA 3R04A 4ANMA 3Q96A 3O71A 2VO0A 2YM5A 4B9DA 1W8CA 2NRUA 4BCJA 2BHEA 4K33A 3ZLWA 1Z5MA 4KS8A 2X8DA 4GK2A 5CEQA 1OM1A 2XRUA 3LM5A 4NM3A 2VTOA 3TZMA 3EMGA 4DF3A 4CMUA 4OAUC 3ZFMA 4IW0A 4I92A 3QL8A 3V5WA 2WU7A 4YTFA 4N57A 1KOAA 4YTIA 4BZDA 2C0IA 2I0HA 3QLGA 3HEGA 5JK3A 1XO2B 3KMMA 4LOQA 4EH4A 2Z7RA 2OO8X 1WBTA 2B9HA 2WQBA 2YIRA 2VWXA 3Q9XA 4ANNA 3DFCB 3QWKA 5K4JA 3R1NA 3KCFA 3PRFA 3IW4A 1VYZA 3P79A 4RVMA 2QOKA 3RCJA 4EL9A 4BDAA 4S32A 1H25A 4R5YA 3NYOA 4I5CA 4FYNA 2YM6A 2Z7QA 4RQKA 3F5XA 3FMDA 1A9UA 3GC8A 4FEQA 3EFWA 4J71A 4CGAA 3ET7A 4C3RA 4A4LA 3GGFA 4L6QA 4RT7A 4GIHA 5E8VA 4ZSAA 3VS3A 3LE6A 4FSQA 4KIOA 4GRBA 2C3LA 1TVOA 4O0SA 2YWPA 2BRGA 3WBLA 3OC1A 4YPSA 4D1XA 4O6EA 4B99A 2R3QA 1H0WA 1WCCA 3O7LD 4AF3A 1YKRA 4JT3A 5KZ0A 3M1SA 4Q5HA 2VTMA 3AGMA 4IB3A 4GVAA 4JJRA 2ZMDA 3QGWA 3KL8A 5DT0A 1JOWB 1R78A 3I7BA 2G2IA 2BCJA 4Y95A 4Q9ZA 3W33A 3TJCA 3O0GA 1IRKA 2XKEA 3Q5IA 3SV0A 4E20A 4EC9A 3E3PA 4GMYA 4BBEA 1GNGA 3NEWA 1YXTA 1SVEA 3BU3A 4HYHA 1H07A 3VUIA 4K11A 5CU4A 3W18A 4BC6A 4BCOA 2GS2A 2P33A 4NIFB 4ZY5A 5M4CA 3GFEA 3R7YA 4AW5A 2J6MA 3LKMA 5CQWA 2X1NA 2CJMA 4WHZA 4C62A 3F82A 3NYNA 4QPMA 2W1CA 4O83A 3PYYA 3OMVA 2IZSA 2OFUA 3K3IA 5AM7A 4BTJA 3BIZA 4UYAA 1FPUA 3W8LA 3A61A 4XV2A 4FV5A 1BI7A 5CXHA 2WGJA 3DDPA 5BNJA 3DXQA 1PMEA 3UZTA 4RGJA 3G5DA 3VRZA 2EXEA 5AAGA 3MB7A 2R2PA 4IX4A 3EFJA 4O91A 4U80A 4ENXA 1OBDA 2VX3A 4GT4A 3FEGA 3E8NA 4E6CA 4HVGA 3IPHA 5HOAA 3HRFA 1GZ8A 5AFVA 4E6QA 5J5SA 5JH6A 4RVTA 4R3RA 3TG1A 2UZNA 2J4ZA 4LUDA 2IW6A 1MRVA 3ATSA 1IA8A 2QD9A 4QNAA 3BEAA 3H30A 3FUPA 4CSVA 2QKWB 2X81A 3IECA 3LXKA 4ZAUA 4H3QA 5K5NA 5KMNA 4RFZA 4U40A 3MPAA 4DEGA 2VWWA 4AG8A 3IQ7A 2ITUA 2FSLX 4H3BA 1SNXA 1PW2A 4LGGA 5HVJA 5HBEA 4BCHA 3NVKI 5BVEA 2C68A 3MB6A 1JSUA 4HPTE 2YISA 3DJ5A 5EOLA 2BDFA 3A7JA 2R3NA 2W1IA 3DY7A 3NWWA 4DGOA 2PUNA 2OZOA 1IASA 4QMOA 2B0QA 3HRBA 2ACXA 3A62A 3ZS5A 3R8MA 3RBWA 3WF6A 3CD8A 4FIIA 1JVPP 4V05A 3OCTA 4LGHA 2ERKA 1LEWA 3CCNA 4N6ZA 4NIFA 4UYNA 5FDXA 4D2VA 4HVIA 3BU6A 3D7TA 3VBQA 2YCFA 2W1ZA 2BZJA 2UW7A 3JY9A 4GG5A 2WIHA 3ELJA 3ORTA 4GFGA 4GU9A 3ZBFA 2WU6A 5CF4A 4IJ9A 4ZIMA 3FMEA 5KHXA 2H96A 3FLWA 3CGOA 2PPQA 5AV2A 5HG9A 4NTTA 4BI1A 1BUHA 4C37A 3D94A 4EI4A 5IF1A 4D2SA 3PSBA 4L43A 4RIWB 5ANGA 3JPVA 3L8SA 1U54B 2PU8A 2UZDA 4G6OA 3VO3A 2C3IB 5FM3A 3OEZA 4YLKA 3EN9A 4A07A 4E4XA 3UOJA 5CF5A 3LFCA 4EC8A 3OTUA 4O1OA 3HMPA 3KRRA 2GQGA 1UKIA 2OJFE 3ITZA 2F2UA 3O96A 4X2NA 5CSHA 4DYMA 3W10A 2QOOA 3TNHA 5IA0A 4D2PA 2EWAA 3FMHA 4FF8A 4GFMA 3T3UA 1JKLA 3L1SA 3F7WA 2W1HA 2BDWA 3ZEWA 4TWPA 4XCUA 4HZSA 2R64A 2B9JA 2GCDA 5JGAA 3BU5A 3EQFA 2PZ5A 4I1ZA 3S00A 3HV5A 1XH8A 2PE2A 3H10A 3ZO4A 5L3AA 4ZTNA 4EUTA 1BL6A 1CMKE 5H8EA 5M55A 3R7VA 2WMXA 3ZRKA 3NUSA 3MH1A 1Y6AA 3BX5A 4WUNA 4YTCA 3UO5A 2RFSA 2W0JA 1ZOHA 5JEBA 5A4CA 1Q8WA 1V1KA 5D7AA 3TNIA 3Q52A 4ANQA 3F5PA 3V3VA 1UA2A 1U59A 4ACCA 4F0GA 4F9CA 3BKBA 4I4FA 4MQ1A 2WNTA 3W2QA 4ZLYA 3PJ3A 2F49A 3WE4A 3BQCA 2R5TA 3DPKA 3IONA 5DOSA 3SX9A 3VN9A 3ATTA 4L3JA 3FXZA 2J0JA 1J3HA 5ICPA 3PWYA 4K1BA 5KNJA 3VW8A 4F7SA 4CKIA 4BDJA 3LMIA 2UZLA 2HAKA 3AT2A 5EDQA 3BLRA 1ZXEA 3QTZA 4RIXB 1H28A 2HK5A 4JOAA 3R8PA 2Z2WA 2XF0A 4ITIA 3SHEA 4BICA 5CI7A 5DBXA 2ZM4A 3LJ1A 3ZUTA 2VNWA 3MGYA 4XX9A 5CVHA 2RFDA 5CAQA 4RA5A 4DGNA 3HX4A 2ITVA 1JPAA 2JDVA 1R0PA 3I5ZA 5AADA 2YCRA 4FSYA 5J1VA 4MBLA 3MVLA 4UMRA 2XKDA 3HAVA 5HIBA 4YZ9A 1W0XC 4GK4A 4EORA 3MESA 3FI8A 3E64A 3OT3A 4X2KA 3KN5A 3P7AA 1YHVA 4XP3A 1E1VA 4WUAA 2VTPA 3GOKA 4ZJVA 4QMTA 2OIQA 5G6VA 4XYFA 4EK5A 4RWJA 4YLLA 3GEQA 5CLPA 3RNIA 4Z9LA 3RINA 1G8SA 3SDJA 4KS7A 4C58A 4RMZA 2FVDA 2WMAA 4APPA 2ZJWA 4C57A 3KXMA 1SM2A 3PP0A 5B2MA 1ZWSA 2XEZA 4PP9A 3IKAA 3FZSA 4FSRA 4RIYB 5IQAA 2W4OA 3JVSA 4JG8A 4QT1A 3V6SA 4YHTA 5HTCA 2AC3A 2XYUA 4DH8A 4H39A 5LXMA 3DBQA 4FIEA 3COKA 3NYXA 3WI6A 3UVQA 1Q24A 4A7CA 2C6EA 4CT1A 2CKOA 4O6LA 3VQUA 2PZRA 3VBXA 2OU7A 3GP0A 3RPRA 3EQBA 5L8LA 3LLTA 2REIA 4FT7A 2ITNA 2YIXA 2QCSA 3EN7A 3GENA 4ZSEA 2QHMA 1UNLA 3I60A 4FZ7A 4CCUA 5DR2A 4IH8A 4GU6A 3KVXA 4BIBA 4RIXA 1K3AA 3Q04A 1PY5A 3OBJA 1Q8YA 4FV3A 4PTEA 5J79A 4EOQA 2VWBA 1H0VA 2WZJA 3S95A 5KMMA 3U55A 3W2CA 1J1BA 5HKMA 1ZYJA 2BRBA 3QRIA 5F95A 3ZSHA 3UVPA 4D5HA 3DZQA 3NMUF 1H00A 1H1WA 4W4VA 3UDBA 4LM5A 5G1XA 5CENA 3A4PA 1YW2A 4NM0A 1PF8A 4AT4A 1PYXA 4JX3A 3SA0A 4FEXA 5EH0A 1OBGA 1YOMA 3CJFA 3CY2A 3RKBA 5AP6A 3PA4A 4MHAA 2QNJA 3N51A 3C51A 3TN8A 3WYYA 4BFMA 3F2AA 4BDEA 4EK6A 4TWCA 2QVSE 2W5BA 2YA9A 4MXCA 4UWCA 2J50A 4IEBA 3DOGA 3VS5A 3KY2A 2XNGA 3RPSA 4O0XA 2QOQA 4I23A 4JG6A 2QOBA 4DFBA 4LRMA 2VD5A 2OZAA 3NCGA 2B1PA 3QD0A 4M67A 4AFEA 3OOMA 3H4JA 1ZYCA 5E1SA 4HCTA 4FTIA 3ZMMA 5DR9A 1P2AA 3W16A 1YXSA 3EKKA 3FYKX 3OTVA 3PUPA 4RIYA 3TZ7A 1Y8GA 2X4ZA 2YAAA 3PZHA 5AJQA 1MQBA 3A8WA 5HE2A 5CU0A 3SRVA 4NH1A 5BYYA 4QMQA 4RC4A 1M7NA 3FWQA 4MWIA 2CGUA 3KN6A 4F7JA 3ZUUA 4PQNA 5L2TA 3D9VA 4HZRA 4J1RA 4CFNA 3AC3A 5KBRA 5JQ5A 4D4SA 2WELA 3UNKA 4XUFA 2CGWA 1YXUA 1Y57A 4MEDA 3GB2A 5E92A 5HG5A 2VTNA 3LCDA 4ACDA 1U46A 4M13A 4I93A 3O51A 2ZM3A 3BBWA 3LM0A 2KULA 4BDDA 3FY0A 3R8UA 3VBVA 4AA4A 4CZYB 3PJ2A 2FYSA 3DNDA 1IR3A 5EFQA 1UU9A 1XHAA 3DK6A 3O17A 3QA0A 4NFNA 4RFMA 2YCSA 4TYHB 5EM6A 3E62A 1K2PA 3UIUA 4AE6A 4C3FA 5HEZA 3PDTA 4DFXE 4XV3A 4NZWB 4PF4A 1YOLA 4DFNA 3F66A 4NCTA 3TKIA 5DIAA 3CY3A 3QQLA 5ETFA 4L3LA 4XBUA 4I3ZA 2B53A 4EOLA 4O0WA 4BB4A 4BIEA 2ONLA 4CCBA 2Y6OA 4TN6A 2UV2A 3MFRA 3BV3A 4FZFB 4GV1A 4JRVA 3LMHA 2C6TA 2WMVA 3LXNA 3CQWA 4YBKA 4U97A 5CXZA 4DN5A 1UWJA 5HG7A 4KKGA 3ORMA 3QRKA 4NJDA 3PSCA 3K5VA 4DGLC 3R21A 2Y8OA 3AC5A 2QR8A 3EN5A 3R28A 5E91A 4PDYA 4MTAA 2BROA 2VZ6A 5IEVA 3LQ3A 3QLFA 3BHHA 2R3OA 4YMJA 3NNUA 4A9UA 2JIUA 4GH2A 5AV0A 5CF8A 3H9RA 4U8ZA 4IWOA 4YC3A 4AA5A 5CEPA 3PTGA 1J7IA 2XMYA 3FAAA 3NW7A 4JBOA 3UG1A 3WOWA 3K2LA 4B8MA 4BHZA 4CNHA 5H8BA 3PY1A 5LOHA 3ZM4A 4MF0A 5IQIA 4D4VA 2PUPA 4D4RA 1PKDA 4BDHA 2E9VA 3R1SA 2XIRA 4C4FA 2VWZA 3K3JA 5IA5A 3OY1A 2LGCA 2A0CX 3KF4A 4L52A 4XP0A 4BCNA 3IOKA 4JVGA 3TNPC 3IW7A 4FSNA 4OT5A 1X8BA 3ROCA 2X39A 1DAYA 4RLLA 2WAJA 3RALA 2ERZE 4HOKA 3JS2A 2X9EA 2PMNX 3D2IA 2A1AB 3IO7A 5BMMA 4TYHA 5M07A 1BKXA 1Z57A 4E5AX 2YDJA 4BI0A 4BKZA 5AEPA 3RHXA 4L53A 4L45A 3E87A 5CU6A 3PJCA 3PPKA 3TTJA 3UC3A 2J9MA 3FYJX 5HGIA 2ZOQA 1MRYA 5JN2A 4NT4A 4ZTHA 3U4WA 4PNIA 4DTBA 4YLJA 4Z16A 5EG3A 3SKCA 4DC2A 1RW8A 4EUUA 2CN5A 3NIZA 2C5NA 3K54A 3U9NA 5CEKA 1SYKA 3QQJA 4ZTLA 4BZOA 2UUEA 3VUDA 4J53A 4OLIA 1SNUA 4XG8A 4R1YA 5CSPA 2ZYBA 1K9AA 1TQIA 4JI9A 3UTOA 1URWA 2FSMX 2Y7JA 2A27A 4D2RA 3ZTXA 4RVKA 3O8PA 4WRSA 4NYEA 5DH3A 2B54A 5AR4A 4APCA 4FGRA 2C5YA 3NPCA 3DKCA 1P14A 2OH4A 3QD3A 3KXHA 5CU3A 3NAXA 3UZRA 2QU6A 3MPMA 3U54A 2W4KA 5I3OA 2NRYA 2XK3A 2W9FB 2Y0AA 3GU8A 5JGBA 3QYZA 3VWAA 1OL5A 4LV5A 4NW6A 4QYFA 3UO6A 4F99A 2Z7SA 1OITA 4QOXA 3C4CA 1UNHA 2J51A 4TWOA 3VJOA 4WSQA 3F5UA 1LUFA 3OG7A 3V01A 3DU8A 4Y85A 3WF7A 5BVDA 4D55A 2NP8A 2C5VA 3ZRLA 3QXOA 3MDYA 2PMLX 2XK9A 4YNOA 3ZDIA 4QMYA 4W9XA 2V5QA 4DG3E 2YERA 4L9IA 2BAQA 1EH4A 3GQIA 1UU7A 5T3QA 3ZDUA 4BGQA 5AP4A 3RCDA 4DE4A 4WKQA 2QURA 2VO3A 3P1AA 4HPUE 4KINA 4OTWA 1NT2A 2FH9A 4XLVA 2JFLA 2W5AA 4CG8A 1NA7A 2J0KA 1OL6A 3RAWA 4FIGA 2HOGA 4DBNA 4L7SA 4BR3A 3FMKA 3TV7A 4IJPA 4ASEA 4G17A 3PIXA 4EKLA 5JT2A 4F0IA 1L8TA 3WARA 3ZFYA 2WMRA 4G5PA 1PHKA 2PL0A 3D5WA 5L2IA 4KIKB 4FKPA 4QPAA 3UVRA 2IZUA 4YTHA 1KE7A 2OF2A 4PPAA 3LCSA 5CY3A 4O0TA 4QMLA 4D9UA 2IZTA 3H0ZA 2FGIA 4EOIA 4CFUA 2CN8A 4EBWA 2UVZA 4OTDA 3C7QA 4ALWA 3WF5A 3BYSA 2VWIA 3QTWA 2OICA 3DAKA 3RAKA 4CV9A 4IAYA 3QQFA 2BILB 4I22A 1YI3A 4U41A 5LARA 3M11A 2OIBA 4JDIA 3RZFA 2I7QA 4MAOA 4FKUA 1ZAOA 4UY9A 4HVSA 5AUUA 5EDRA 4MXYA 2GSFA 4MD9E 3C13A 5A4QA 4QTDA 1JNKA 5ETIA 5AUTA 3DQWA 3MFUA 2P3GX 4J8MA 4ZZOA 3HVCA 4UMTA 2YWVA 4S30A 4X3FB 4OTPA 3P0MA 5C01A 5IQDA 5FTOA 3FKOA 4YJNA 1S9IA 1OPKA 4XJ0A 3QRTA 5L6OA 2HW6A 2OLCA 1OL1A 2JKKA 3SG8A 4PWNA 4KNBA 3Q2MA 5KMJA 2JGZA 3RHKA 4WNMA 3I6UA 4BCIA 3A7FA 3UYTA 3CEKA 2CLQA 2J5EA 3QUEA 4D1SA 2VWYA 2YLFA 4RWKA 1OKWA 2YM8A 3R2BA 3GU7A 2BAKA 3EHAA 1RDQE 4L3PA 5EI2A 4MCVA 3QCXA 1Q99A 3I0QA 4GSBA 1GAGA 4QTAA 5T6KA 5LVNA 2ITTA 5FGKA 1UVRA 3A4OX 3GC7A 3L9LA 1OPLA 3E7OA 3EWHA 4J95A 3UG2A 1URCA 3KGAA 3W2PA 3S1HA 4C02A 1PRYA 2W4JA 2X2MA 1CDKA 4XG3A 4YU2A 2XH5A 3RAHA 4LMUA 1TKIA 3ZCLA 3HA8A 4DLJA 4RC3A 3QQHA 3PJ1A 4IX5A 4FKOA 1PXOA 3PWDA 4IBMA 4FT9A 3MW1A 5LWNA 4FT0A 4BCFA 5HX6A 4W4XA 3EZRA 4X6QC 5A6NA 1NW1A 3VJNA 4JRNA 4MKCA 4J97A 2BZIB 3EYGA 4JAIA 4LV8A 5E8UA 3ZUVA 5DN3A 4F9WA 3KULB 4G34A 4LFIA 5HTBA 5HO6A 5M53A 5AX3A 3QRUA 2HWPA 4GKIA 4XMOA 1M52A 3MWUA 1P4FA 4U0IA 4IAFA 4AX8A 4AZWA 2QO9A 2V0DA 1P5EA 2IO6A 4HGEA 5KZIA 1IG1A 1DAWA 2CCHA 3P78A 4RWLA 5AIRA 4AS0A 5IH6A 2NPQA 3BGQA 5DT4A 5IDPA 4FTOA 4X3FA 5HBHA 3ZBXA 2PHKA 3T9IA 2PWLA 4QRCA 3AOXA 4MBJA 4MF1A 2O3PA 4BGGA 3Q5ZA 4ASZA 3UNZA 2X9FA 5IA1A 5KO1A 4AA0A 1QPJA 4O0UA 2C1AA 2WMSA 2CKPA 3UODA 2GFCA 3HMNA 5JQ8A 3NDMA 4PRJA 4DTKA 2YLEA 3NIEA 3PLSA 2VWUA 1WMKA 4HNIA 5FXRA 3ZXTA 5HVKA 2GPHA 2WFYA 4ALUA 3AC4A 3PE1A 4O7VA 1M2QA 4YJRA 3PXYA 2PULA 2OGVA 4QPSA 2CCIA 4M0ZA 4X3JA 5J9LA 5L2WA 2F9GA 4TL0A 3PY3A 4O0VA 3BYMA 3RM6A 1YQJA 4R1VA 1UU8A 3RK5A 2XEYA 2Y9QA 4ZZNA 4HVHA 5CVGA 4FTQA 2OK1A 5CAUA 1PXMA 5HHWA 4E8AA 3E7VA 1ZY5A 4C4HA 3F6XA 4FV8A 5HLPA 3VUMA 2VO7A 4I94A 4AN2A 2C6KA 2WEIA 3MPTA 4PTCA 4XOYA 4ANSA 4QQTA 4ZTSA 5CVFA 3WZEA 2QG7A 2UZOA 2QOFA 4CV8A 4KBAA 4IACA 3KULA 4TY1A 2WD1A 3CTJA 2Y4PA 4WNKA 3FPQA 3W2SA 3PJ8A 2WTCA 2YIYA 4FOBA 3R9HA 3ALNA 5CZIA 5FTGA 5LVOA 4DG2E 3CD3A 4FTLA 3LCTA 2HXQA 3SW4A 2I6LA 2QHNA 5EK7A 1ZRZA 3II5A 1G5SA 3RMFA 4E4NA 4MNEB 2C6MA 4EOJA 2KTYA 4RSSA 3E93A 4FSTA 5M08A 4IVBA 2IVTA 3Q6UA 4FX3A 1T46A 5IEXA 3QX2A 1IEPA 1PMUA 3ZU7A 3WIKA 4B7TA 4UB7A 1IA9A 4O7YA 4FL3A 5B7VA 4CFWA 3D83A 3BHTA 3HGKA 4C36A 4DAWA 3ID6C 3FZ1A 2XZSA 4IM0A 4PUZA 3H0YA 4U79A 5CASA 2VO6A 3L8XA 3HMIA 3U87A 2YN8A 5C4LA 3QQGA 1JWHA 3QCQA 1CKPA 2UW9A 4IMYA 4ZSJA 2X7OA 2YCQA 4FTNA 4PNKA 5FTQA 2DQ7X 1PXJA 3JY0A 3HAMA 3SOCA 3QU0A 1YWRA 3ZC5A 4F6WA 2CDZA 3ZO3A 2PE1A 3MTFA 5HQ0A 2DWBA 4CRLA 4W4WA 5AP7A 2FSOX 3V5LA 4EHGA 2R3MA 3RVGA 3QD2B 3I0OA 3P7BA 3QYWA 4W4YA 3RWPA 3Q4TA 3V5TA 4D2WA 1YXVA 4AGDA 3ENHA 3FL5A 1YDTE 4FNXA 2W17A 1G3NA 3RPOA 4L42A 4R3CA 5EQEA 3Q3BA 4M68A 2FB8A 2QKRA 3AMAA 1JKSA 2JAVA 3NR9A 3O2MA 2WEVA 5DFPA 1PJKA 4TW9A 4IZAA 1NY3A 4JIAA 3G9LX 3D5VA 1E9HA 4ANBA 1QPDA 2B9FA 2EB2A 2OH0E 3GVUA 4YJQA 4YPDA 3H3CA 3UE4A 5IZFA 2BMCA 4YGAA 5E8ZA 4EZ5A 1WFCA 2VTQA 3CIKA 3LFNA 3DNEA 4Z7GA 4O38A 4R7IA 4F9AA 3AMYA 2R0UA 4G6LA 4IZ5A 1Z9XA 3NNXA 3QZGA 3FQEA 3T8OA 3AD4A 5AIKA 5IMXA 3LXPA 3BQRA 3PSDA 4FMQA 4DHFA 4I5PA 4KB8A 4YJSA 3UQCA 4Y83A 1OUKA 3HP2A 4XHKB 2RFNA 3LFFA 2PVHA 4RJ8A 3GI3A 4GJ3A 2RIOA 4AXAA 4G3CA 4PX6A 1GIHA 2GHMA 2VGPA 2YACA 2OI4X 4B6LA 4W8DA 3PXQA 1H1PA 1YOJA 4M84A 5ACBC 2WPAA 5I9VA 4TT7A 2H9VA 5ANDA 3A7IA 1Q8ZA 3AGLA 3CP9A 2BUJA 2ITYA 4LG4A 1KV1A 4WIHA 4CVAA 2XIKA 3D14A 2V7OA 5M4IA 1J1CA 4YUQA 3PXRA 3BHUA 1FVRA 1QPEA 4P7EA 2C5XA 4ZY6A 4D4YA 4YSJA 2GQSA 3FPMA 5J95A 5HCXA 2X7FA 2BFXA 4FTTA 3BLQA 4J98A 4JR3A 3UPZA 3QHWA 4M3QA 5HIDA 2R3FA 3PXFA 3R7GA 3DB8A 2WMQA 3LHJA 5IDNA 3TCPA 2C4GA 2VTTA 4GW8A 2B55A 5M06A 4FNYA 4HCVA 5LMKA 4FC0A 4E4MA 2OJ9A 5E90A 2CGVA 3FMLA 4LRJA 3OS3A 3TNQB 5IMEA 5IA3A 2E9PA 1H24A 5EM5A 1OI9A 4IVDA 4XBRA 3OD6X 4PPCA 5BUEA 1OIRA 2R3HA 4AOIA 3WZUA 1REJA 3B2WA 3FQHA 1E1XA 4HNFA 1AGWA 2PVKA 4YJOA 4A4OA 3TDWA 3OT8A 3G9NA 4FTMA 4ZS0A 5F9EA 3C50A 4FNWA 3ULIA 4R7BA 2C47A 2VUWA 4EHEA 4L8MA 5D7VA 5I9WA 3I1AA 2XB7A 3W2RA 3ACJA 4YC8A 4EH9A 5BMSA 1TQMA 2BKZA 3JR1A 5A3XA 5JFXA 2PZIA 5C4KA 1WZYA 5E8SA 1YDSE 4II5A 4L46A 4DINA 3E63A 4UMUA 4FKSA 4ZP5A 1T45A 4IQ6A 2V62A 3EOCA 4J52A 2PVRA 4NFMA 4BRXA 3QZFA 4EKKA 2P4IA 4QD6A 3RM7A 3GT8A 1H1SA 2X6EA 5EHYA 3R30A 3BWJA 4IWQA 3RTPA 4FVQA 4EZ7A 2QG5A 5D12A 5TO8A 1YHSA 4OTQA 3HL7A 4L00A 5IH5A 5J87A 1H27A 3B8QA 3VULA 5BVWA 2ITQA 4PDSA 5BUIA 3GCPA 3DCVA 1YVJA 4FIJA 5KHWA 4BYIA 4GEOA 4GS6A 3C0GA 5EW3A 3WIGA 3IDBA 4FA2A 4RIWA 1IAHA 5KMKA 4LI5A 1U54A 2JDRA 4C34A 2IJMA 3GC0A 1REKA 2DS1A 5B2KA 2VU3A 4E3CA 3HV4A 4FKIA 3Q32A 4F1TA 3KMUA 4XG2A 4KIPA 1R3CA 4S2ZA 2C6LA 4ASDA 4WO5A 5L8JA 3ORPA 3PA5A 4FTKA 2IW9A 4U3YA 4DEDA 3KXXA 4X6RA 3GNIB 3C0IA 3MA6A 3DFAA 4FV1A 5DLSA 5J7BA 5HLWA 4RX9A 4LL0A 2UZWE 3PPJA 4DLIA 3GUBA 5K3YA 4KA3A 4O81A 3KKVA 2GNJA 2BFYA 2J90A 3KK8A 4AQCA 3VS2A 4AACA 3LIJA 4HW7A 3FE3A 2QQ7A 3LCKA 3GU6A 2WQNA 5M4FA 3VHEA 2X0GA 3REPA 3TV4A 4LGDA 2UW6A 4O7WA 4KWPA 3HMMA 5BYLA 3MH0A 4FIFA 3EQGA 4AT3A 5DEWA 2Z8CA 4IX3A 4BGHA 4DFUA 3UOLA 3HRCA 3OW3A 4FV4A 4MXOA 4C59A 5AX9A 4DH5A 5LVPA 3LPBA 5DYJA 3AC2A 3DKGA 4PL5A 3UMXA 3FJQE 3KEXA 2C3KA 2PYWA 1NVRA 4QMUA 5J8IA 4MXZA 3VAPA 3ALOA 2AUHA 2G01A 2JIIA 4QYEA 3RK9A 3BCEA 1OVEA 2P55A 4IE9A 4HYSA 4IB0A 1OKVA 4WA9A 4IFCA 5FEQA 1BI8A 4JQEA 3R83A 2HY0A 2GTNA 4N70A 3Q60A 3ULZA 5IQGA 3G51A 5CZHA 4EH2A 2UW0A 2JD5A 4CKJA 2XKCA 4FG9A 2XJ0A 5AAEA 3DBCA 1AD5A 2X2KA 4DA5A 2VTHA 4K0YA 4DTAA 3F7ZA 5DNRA 4I20A 5C8NA 3NUAA 3IW6A 4AZFA 4EBVA 3QALE 3R0TA 4NUSA 4Q5EA 3JXWA 2XNBA 4LQMA 4RJ6A 5ANJA 5E8YA 1FBNA 4DFYA 4NJ3A 3PLAE 3PVWA 5HICA 4F7LA 3RI1A 3S0OA 4OT6A 3R2YA 2RL5A 3U9CA 5DHJA 5DVRA 5AA8A 4QP2A 4BKJA 5AP1A 1FOTA 3ZC6A 5IQHA 4IVAA 5AV4A 5T68A 3T3VA 3C4EA 4U9AA 4JBQA 3O8UA 3HLLA 3HZTA 5JFSA 4K9YA 1Q62A 1UU3A 2ZM1A 4FICA 3U4UA 3V8WA 1UNGA 3AC1A 3HDMA 4I6BA 4F08A 5A4EA 4L68A 3UZPA 3SGCA 2R7BA 3HNGA 1YWVA 3KFAA 4OUCA 5GZ9A 3ZLXA 1J91A 3W32A 4UN0C 3FZTA 4R5SA 2C6OA 4Z7HA 4FEWA 2XS0A 2XNMA 1STCE 4K6ZA 5IQEA 3CTQA 1WBNA 5ACKA 4KD1A 2XK7A 2QI8A 5K5XA 3FBVA 3L9NA 4RJ3A 5HVYA 4EH8A 3VUGA 3F2RA 2VTLA 4FODA 1YRPA 3BLHA 3DB6A 3V04A 1ZARA 2QR7A 2CKQA 4XG4A 1KE5A 2IVVA 5AP0A 3POOA 2W1FA 4BL1A 4FBXA 5HX8A 4GCJA 3SVVA 5F20A 3KB7A 4Y73A 3RP9A 2O63A 4FT3A 4QMXA 4D1ZA 4W9WA 1O9UA 2QOCA 2CKEA 5M44A 1OB3A 4FIHA 4HYUA 2BKKA 3I7CA 4ZXTA 4BTMA 2GQRA 5AR2A 3RAIA 3R6XA 4GJ2A 4O21A 3OXZA 4LUEA 2PVYA 1DM2A 2R7IA 3P5KA 4U44A 4AN9A 2XM9A 2R3PA 4RZWA 4F9YA 5GIPE 2HELA 3C5IA 4WNOA 1XJDA 2UZUE 5DWRA 1FMOE 1FVVA 3L8VA 4BCPA 4EEVA 1W98A 5AR7A 2XK6A 4BWXA 2BHHA 1YI6A 2WKMA 3QKKA 3PY0A 5FQDC 4DCEA 3OWPA 5BX0A 5J5TA 3ORNA 2VGOA 3ZXZA 3D7ZA 2DYLA 1TQPA 1R0EA 4CXAA 3I5NA 2RFEA 3FLNC 3HECA 4QMSA 4I5HA 2YABA 2XVDA 2W7XA 2QC6A 3C4WA 4WG4A 4X2JA 4ANOA 3KREA 3ANRA 3F69A 1FGKA 2ZB1A 3PXKA 4EK3A 3EQDA 3DKOA 3ETAA 1RJBA 1XH4A 4A9RA 2OSCA 3MIAA 5HU3A 4D5KA 3NS9A 2W96B 5BVKA 4RPVA 3WILA 3NSZA 4QQCA 4YO6A 1HCLA 1XH5A 3CPBA 3D2KA 3FLZA 4FKLA 4IC8A 1JAMA 3PIYA 4GYIA 4L7FA 1Q5KA 4BBMA 2WO6A 4JG7A 4ZJIA 3O50A 3KRXA 3VS4A 3QQUA 1LPUA 3EQIA 4HCUA 4AW0A 1JSTA 3EB0A 4F0FA 4AW2A 4CLJA 3EN4A 3HUBA 5TKDA 5E8XA 1NVQA 3MI9A 4K8AA 2JFMA 5D9HA 3S4QA 2QOLA 3QTRA 3VUTA 4ZY4A 3N4TA 4FI1A 3HA6A 2VX1A 3G0EA 3HV7A 3B8RA 4F65A 3TIYA 1HCKA 5EM7A 4D0XA 2RGPA 5CANA 3F3ZA 4Y46A 5D41A 5BVFA 4DG0E 5HCZA 4M66A 5E1EA 3KCKA 3Q4ZA 4M12A 1U4DA 4FUYA 4YHJA 4QMZA 3C4ZA 4YNEA 1VR2A 3OOGA 2W05A 3QQKA 3R22A 4TWNA 3QKMA 3G6GA 4JAJA 5CT7A 3QF9A 5FG8A 2WQEA 4BDCA 5HZNA 4BCMA 4FVRA 4UV0A 4XV1A 1OPJA 4C2VA 4V04A 5FDPA 3KXNA 5C26A 3R9RA 1Q97A 5F4NA 1LR4A 4C0TA 1FVTA 3EYHA 5JRSA 4PP7A 3TDVA 2OJIA 2V55A 4GUBA 3V8TA 3MH3A 4V0GB 1H4LA 2HWOA 4QTBA 2NO3A 2HENA 3NZ0A 2I40A 3DAJA 3NLBA 1G8AA 3C9WA 3M2WA 2GHGA 3R8ZA 5CEMA 4OTFA 4XG6A 4BHNA 5F94A 5BQ0A 3Q9ZA 4FYOA 3TKHA 3IGOA 1SVGA 3GCSA 3IDCA 3KRWA 4I6HA 5D11A 5B0XA 4OBQA 1V0OA 4BWKA 5EOBA 2B9IA 2PUUA 3AT3A 5AP3A 2IZRA 2R3KA 2YITA 5C8MA 3V5QA 3U6IA 3VS0A 1BLXA 5JRQA 4FE2A 4TTHB 1XH9A 4TRLA 1WAKA 4U5JA 4DEHA 4EH6A 4UBAA 1U5RA 1W84A 4M69B 3ERKA 5L2SA 2ZV8A 5HI2A 4HJOA 4EOOA 2X8EA 2CHLA 5HE1A 3VW6A 3COHA 4WBBB 3R8VA 1KE6A 3QTQA 4UX9A 5L4QA 3TUDA 4RVLA 4NL0A 1OL7A 2JAMA 2EB3A 4QYYA 2NNWB 4PDPA 3NUXA 4FVPA 1CKJA 1U5QA 4ID7A 2VN9A 4YC6A 2YM3A 5ETAA 3ROYA 4OTHA 2VAGA 3COIA 3UO4A 4RLKA 2C1BA 3A7GA 3DV3A 4IANA 2QOIA 1FMKA 3LQ5A 4OGRA 3UIBA 4XEYA 3VQHA 2JLDA 2HYYA 1OZ1A 1UKHA 1JLUE 4X2GA 2G1TA 2XIXA 3OROA 4FKTA 1O6KA 1S9JA 1JKTA 2C6DA 1CKIA 2CPKE 2HW7A 2R4BA 3DBDA 2PMIA 2Q0NA 4RIOA 5ANKA 4G3DA 4C4IA 3WZJA 1QL6A 3RJCA 4QQJA 5CT0A 4CRSA 4IB5A 4FV2A 4IM2A 5DI1A 4E4LA 4V0GA 2P0CA 2YJRA 4FKRA 3K5UA 5HG8A 1GIJA 4XG9A 1Q41A 1OL2A 2XKFA 2ZB0A 4RA4A 4PL3A 5LMBA 1P4OA 2OFVA 3GC9A 4O2ZA 5EHLA 1MRUA 1ZOGA 4G1WA 3KA0A 2V22A 3MFTA 4O27B 1MUOA 3B2TA 4J8NA 2C0OA 4K18A 1M2PA 2ITWA 3KF7A 3QTUA 4FUXA 4I24A 5IISA 1J7LA 4RWIA 4RJ4A 5FRIA 4DBXA 4BTFA 3EIDA 1KWPA 2QO2A 3D5UA 4KKHA 4MVFA 4H58A 4BWPA 2XIYA 4Z55A 4FKGA 3DXPA 2J0MB 3ENMA 3ORXA 2B52A 5DPVA 3VBYA 4W8EA 3F5GA 3QGYA 3DA6A 4JBVA 4BI2A 2BTSA 5GHVA 2F7XE 3DKFA 3L8PA 3OF0A 4I0TA 4JNWA 1OMWA 4ZS4A 5H8GA 2Q0BA 2FUMA 5AWMA 3EQPA 4PMMA 4JXFA 4CYIA 3TM0A 3E8CA 3IW5A 1MQ4A 3MYGA 4I4EA 3UGCA 4EOMA 5CF6A 4USDA 3G6HA 1KOBA 1F3MC 1ZLTA 3UMWA 4EQCA 4IX6A 2IVSA 2JDSA 2OW3A 3UYSA 2OJJA 4G6NA 3UIXA 5GIOE 4GT5A 5FWKK 2CSNA 4TYGA 2Q83A 5FM2A 4O7NA 4C4EA 4UWBA 4H36A 4FEUA 3NAYA 2JKMA 1F0QA 2Z7LA 2JDOA 3FSKA 4KIKA 3TACA 5IQCA 1RE8A 2E9OA 1XH6A 2VTJA 2EU9A 3NGAA 1GJOA 4FZ6A 5GZAA 3VRYA 3R02A
chains in the Genus database with same CATH superfamily
3ZZEA 4XV9A 3G0FA 3HDNA 4OTRA 2XJ2A 5IG1A 2PE0A 3FI4A 3P86A 4EYJA 4NK9A 4FTAA 3HUCA 5HO7A 5LWMA 1DS5A 3PE2A 4I0SA 4UEUA 3OWLA 3QHRA 2RG6A 2B7AA 2WTWA 5AAFA 4C8BA 5IQBA 4KKEA 3MVMA 4NW5A 3WE8A 5FXSA 5JMSA 4KRDA 3FL4A 5HIEA 2YIQA 4UWYA 3MN3A 4CLIA 4B0GA 2JITA 5FP5A 3W0RA 3E3BX 5JFWA 4ANLA 4YJVA 4DDIA 3I81A 3I79A 3QFVA 2QONA 2R3LA 1BYGA 3ZRMA 3AG9A 4X21A 1UV5A 3ZHPC 3OHTA 3OWKA 2PVJA 4S31A 3TEIA 2H8HA 4LOOA 4G3EA 4BVUA 4E73A 5FLFA 1APME 1ZY4A 3OCGA 5A4LA 5KCVA 5D1JA 4FG8A 5AUVA 1PXPA 4Y5HA 2QODA 3QCSA 1Q61A 3P5JC 4FTUA 2CNQA 4AFJA 2HY81 4U81A 2XA4A 3AD5A 4USEA 5EYDA 3GCQA 4DCAA 1XBBA 4O86A 4F63A 4R6VA 4DITA 5EKNA 3AD6A 5EYMA 4ZLZA 3RGFA 1ZYDA 3FKNA 4CFMA 3CKXA 5HNGA 3DQXA 4QNYA 5TF9A 4MH7A 5GJDA 3FZOA 4GYGA 1BMKA 3AMBA 1Y91A 4LOPA 3CQUA 4QP6A 3KMWA 5CX9A 2WMUA 2WTDA 2OXDA 5KE0A 4QP7A 3DS6A 2A19B 4DGGA 4P5QA 5J1WA 4GUEA 3TUCA 2F7ZE 2J0IA 4AWIA 3EKNA 4KIQA 5FBOA 2FA2A 3A2CA 4G9RA 5AR8A 5C1QB 3R9NA 5KMLA 3LAUA 3GFWA 3KXGA 4TXCA 4GG7A 2PVMA 3CJGA 2F4JA 3LXLA 4GIIA 4QP4A 4X0MA 4J7BA 3ZSGA 3FC1X 5HBJA 4BYJA 2OJGA 2BVAA 3LFAA 2GHLA 4IVCA 5HE3A 3KXZA 4F70A 5IA2A 2ZV2A 2HZ0A 2H6DA 4IC7A 4MWHA 4MNFA 4WG3A 3LVPA 3R73A 2QU5A 3NW5A 1W2CA 3R7OA 5HCYA 2EXMA 3ORZA 4U45A 4C7TA 5LQFA 2XUUA 3HYHA 5E8WA 5IKWA 1Q3DA 3LW0A 4RBLA 2J0LA 5J9ZA 4MYGA 4UALA 5EQPA 3KU2A 3TV6A 4MQ2A 3WF9A 4KAOA 2HZIA 5F1ZA 3PIZA 2R0IA 2PVNA 3O5AA 5L8KA 3KQ7A 3Q9YA 3GCUA 3RK7A 4FV6A 4WBOA 4AOJA 3OCBA 4G3FA 4AT5A 5KX8A 1YWNA 2GDOA 3T9TA 4AZEA 5IEYA 3DLZA 3V6RA 4QP8A 5AP5A 2JEDA 2P2HA 4PV0A 5L2QA 4XS2A 1Y6BA 1WBOA 4EOKA 1NVSA 2PUIA 1YHWA 2AYPA 2F7EE 2W06A 4AN3A 4D28A 4EHVA 5I9YA 4N4SA 2UZEA 4QMNA 1QMZA 5AMNA 3F3UA 4EZ3A 3FHIA 3FC2A 3FLSA 3TXOA 4C35A 4ZTRA 2OXXA 3D0EA 4CMOA 3BBTB 4NU1A 4RJ5A 4YZBA 2R9SA 3QX4A 2X0QA 5IUHA 1XKKA 4MXAA 5I4NA 4ACHA 4ZZMA 4WRGA 3NX8A 4IFGA 3QCYA 4AZVA 1UWHA 2IVUA 4FTRA 4WD5A 3NUYA 4EH5A 4YHFA 1Q8TA 5M51A 4FSWA 3SXFA 4M0YA 2I0YA 3VS7A 1JQHA 1W83A 4WG5A 3VHKA 4NWMA 3W55A 1Y8YA 1NXKA 2UZBA 2WTKC 4M15A 3IS5A 3CSVA 3NNVA 3D7TB 4JDJA 5DEYA 5LCKA 1M17A 3DTCA 3FHRA 2GS6A 2XNEA 4KBKA 4Y8DA 3UC4A 1KV2A 3IGGA 3FZRA 2SRCA 4XNEA 2BRMA 4PMPA 5DMZA 3POZA 5KKRC 1OIQA 3BHVA 5B2LA 5K0KA 4BCKA 3N9XA 2UW3A 4H1MA 5GJFA 3ANQA 5FD2A 3G2FA 3MH2A 3BZ3A 4MNEA 2JBPA 2ZAZA 3QXPA 2ZDUA 4M8TA 4TNDA 4JQ7A 3MIYA 3Q6WA 4IM3A 5E4HA 3OW4A 4L44A 2H34A 2OBJA 4QYGA 4X2FA 5DA3A 2ZFYA 2VNYA 4IWPA 2C5OA 3VBWA 4I6QA 4EK8A 3EJ1A 3ML1A 2BRHA 2FO0A 4FKJA 5FP6A 4UMPA 2JKQA 3AXWA 4AGWA 5CU2A 4NCTC 4H1JA 2BR1A 4XH6A 4F7NA 1OIYA 4DGMA 4XG7A 5AR5A 1ND4A 3VC4A 3SXSA 4FV9A 2ONLC 2X2LA 3G33A 4ZLOA 3UP7A 4AUAA 4XLIA 5EI8A 2DUVA 3EH9A 3GU5A 4MXXA 5KUPA 4E1ZA 3O8TA 4P4CA 3LCOA 4J96A 4R8QA 5GINE 4IADA 3QC9A 5A6OA 3TTIA 4ARKA 2UW8A 3R00A 4DH3A 4E5WA 2WTIA 2PVFA 4DEAA 4AE9A 5A9UA 4OW8A 3F3VA 2O8YA 3GCVA 2Z02A 4FGBA 3JUHA 4GVJA 5A4TA 4HGTA 4IHPA 4WOVA 3ZONA 3D4QA 4DFZE 4CD0A 5LVMA 2RG5A 3N4UA 3NUNA 3PP1A 4FR4A 5C03A 4IIRA 2W99B 4NM5A 2ITXA 2WHBA 3O7LB 3BGPA 4WT6A 5FUTA 4LYNA 1JKKA 4IWDA 2GNGA 4KSPA 2O0UA 3SOAA 5JGDA 3S2PA 3F61A 3EN6A 4H3PA 4R7HA 1VZOA 4GK3A 4TYEA 5HNBA 4RG0A 3COMA 5ITAA 4MBIA 3PVUA 5ETCA 2PY3A 1WVXA 2OG8A 1MP8A 4YJUA 4I5MA 4IAZA 3ZOSA 3ORKA 3TT0A 3SLSA 2I1MA 5I3RA 1M2RA 5GNKA 3KRJA 1B6CB 4OTGA 5CYIA 3H9FA 4JS8A 4K77A 2WMWA 3FI3A 3JYAA 1XQZA 4K2RA 4AZTA 3EQHA 5HORA 3DBFA 4F1OA 2A4LA 3LFDA 2XNNA 3QA8A 4P90A 3IDPA 2GNLA 4TKSA 2VTRA 4CFVA 1XR1A 2BPMA 5EW8A 4EOPA 4DFLA 3MFSA 3QTSA 4GFOA 1PXLA 1B38A 4QMMA 1Q8UA 3LJ0A 3FMJA 4NKAA 3FZPA 2C30A 3W2OA 4AAYA 4BDKA 3C4FA 4Y72A 2V7AA 1QPCA 5BUJA 2P2IA 4BDGA 5CI6A 4BY9E 4FNZA 3BPRA 5HD7A 4RJ7A 4N6YA 3MY0A 3KK9A 4FL2A 4BZNA 5A14A 1DI9A 3CR0A 3LFEA 5JZJA 4KRCA 2BIYA 4FV7A 3BLAA 1H1RA 2XNOA 2XRWA 4IAKA 4L67A 3SG9A 4TYIA 1XWSA 4BCQA 3P4KA 3ZEPA 3F9NA 4I41A 4CQEA 5HLNA 3OCSA 3PG1A 3F88A 2X4FA 2WMBA 1ST4A 4GL9A 3QKLA 4BKYA 2ITOA 4R3PA 4I6LA 2FSTX 3DAEA 3BE9A 3BRBA 4A9YA 4ZSLA 5KMOA 5AP2A 3ZLSA 4C3PA 5FEDA 2X6DA 3G90X 5DT3A 1OGYA 1SZMA 2WOTA 3FXXA 1O6LA 3DTWA 3TNWA 3ZO2A 4EWHA 3THBA 2C0TA 2GMXA 3DBEA 5CSWA 5H2UA 4BDFA 3BYUA 2BRNA 2R3JA 2UVXA 4S33A 5GJGA 4TPTA 2GU8A 4JL9A 3AQVA 2ITPA 4ZSGA 4HYIA 5BVOA 3EQRA 2WMTA 5M4UA 3BEGA 4EK4A 3NCZA 2OZAB 3HMOA 4EOSA 4QMPA 2EXCX 4OTIA 4CFXA 4G16A 2XYNA 4QYHA 2CLXA 3C5UA 2JIVA 4QQ5A 1CTPE 5DRDA 4JDKA 4UXQA 3E8DA 5M09A 2VWVA 3JVRA 3RPYA 3G15A 3QTIA 1FGIA 2BAJA 1YI4A 4U3ZA 5E8TA 2E9NA 4FT5A 3SRVB 2WTKB 4ALVA 1KUTA 4CQGA 2OF4A 3BI6A 3GQLA 4JR7A 4MD7E 3ZZWA 4EONA 3TUBA 4F6UA 4O4FA 3A60A 5TT7A 3ZH8A 1PMVA 5EDPA 2LAVA 1GZKA 3R01A 5DR6A 4DEEA 3H9OA 5A46A 5KKRB 1ZZLA 3DK3A 4N0SA 4XRJA 2OXYA 5M56A 2BDJA 1VYWA 2ESMA 4O84A 4IXPA 4O22A 4QP9A 3VONA 4JQ8A 3FMMA 4UZHA 3WZDA 3R7UA 4WSYA 2EVAA 3P7CA 4YZCA 4USFA 3R1YA 1B39A 3NRMA 1W82A 5AUWA 2VRXA 4ZEGA 3FDNA 2Z60A 4M7IA 5LMAA 4FTCA 3R9OA 3EFLA 2YFXA 4FZDB 3RPVA 3R63A 4G31A 4RQVA 5CAPA 4I0RA 1ZMVA 2XK4A 3CGFA 5BYZA 4JDHA 4QMVA 2XBAA 3U6HA 3BELA 4M97A 3AC8A 2ZDTA 2X8IA 2YJSA 3C1XA 4CZUA 5K9IA 2XARA 4O0RA 4LMNA 4ZMFA 4KABA 1M7QA 1CSNA 2IW8A 5ANIA 2IPXA 3PVGA 4A4XA 2OKRA 4CMTA 2JC6A 2PSQA 1GZNA 1WVYA 3E5AA 4F1MA 3MJ1A 4FSMA 4EH7A 4QTCA 1GZOA 4O7TA 3GU4A 5HNIX 4IDVA 3KC3A 4YJTA 4BIDA 5CWZA 3OUNB 5FXQA 4BF2A 4NTSA 3EQCA 5C8KA 2WQOA 3KVWA 2O5KA 3C0HA 5DE2A 5CSVA 5L6PA 2PMOX 4ONAA 3E88A 3R71A 4JBPA 4PY1A 1Q4LA 3NYVA 3UOHA 4YZDA 4ZJJA 2AC5A 3OY3A 1JBPE 2PZPA 3UOKA 2BALA 4WNPA 1WBPA 4IAAA 5D10A 3QRJA 4TYJA 4CG9A 2W5HA 3ORLA 5AUYA 4O7ZA 4RFYA 3Q2JA 2HZNA 1ATPE 4E26A 5K4IA 1LP4A 4ITJA 3WZKA 2YM7A 2O2UA 3LZBA 3TIZA 2E2BA 2ZMCA 5I5ZA 5AM6A 2VV9A 4YSMA 5JKGA 4H05A 3LFQA 3MA3A 4ENYA 4D0WA 4CKRA 3BE2A 3NNWA 1OECA 1ZYSA 3QWJA 3ZFXA 3CQEA 4JX7A 4Y5QA 4KUJA 2W1GA 1PXNA 3VVHA 5IPJA 2ZVAA 4QO9A 2YHVA 3ODZX 4XOZA 4CZTA 5BVNA 3LFSA 2Y4IC 4ZMEA 4O7RA 4ERWA 2X7GA 4X3FC 3NUUA 4OBPA 4Z3VA 3BV2A 3EL7A 5IUIA 2XCKA 4JLCA 1GY3A 4C2WA 2HIWA 2IF8A 4EQUA 1IAJA 5CALA 4MD8E 2JDTA 3PRIA 3QD4A 4QTEA 4CTBA 3DXNA 3A99A 3R7EA 3CC6A 4FTJA 1KE9A 5FBNC 4HGLA 3V5JA 5J7HA 2G9XA 2WXVA 2HZ4A 3DT1A 4FL1A 4O2PA 4XRLA 3UQFA 2HXLA 4CFFA 5HU9A 5JSMA 4FK3A 3OXIA 3TKUA 5I0BA 3FLQA 3UJGA 4F09A 2RKUA 2JKOA 2GS7A 4C4GA 3PA3A 2ZV9A 2A2AA 3DZOA 5HESA 3TZ9A 3D15A 4P2KA 1YXXA 1OGUA 4KSQA 3UIMA 4U7ZA 3HV3A 4AOTA 1KSWA 5EYCA 3PVBA 2ZV7A 4RC2A 5C27A 2XNPA 4AGCA 3AT4A 1A48A 4S34A 5HO8A 2VX0A 5H3QA 4EWQA 1BL7A 4OR5A 1PYEA 3OZ6A 4P5ZA 3MV5A 5BPYA 5CAVA 5IA4A 1BX6A 3IOPA 4F9BA 2YDKA 3CKWA 4MX9A 3ZYAA 4XP2A 2O65A 4D9TA 2JBOA 3FLYA 4IAIA 3SAYA 4G3GA 4IB1A 4C4JA 3UDSA 5CNNA 1WBVA 4QP1A 2B4SB 3HKOA 3TJDA 3FXWA 3W1FA 4E7WA 5EQYA 5IQFA 2WOUA 5L6WL 1OKZA 4CYJA 4FZAB 4BDIA 2PVLA 3F3TA 3U6JA 2VTAA 3EL8A 2IG7A 2PK9A 3OP5A 3ODYX 3I4BA 3QUDA 3VF9A 4EH3A 4G9CA 5DG5A 5IUGA 4YBJA 1PXKA 4NEUA 4PL4A 3ZLYA 4D2TA 1PKGA 3VNTA 4YR8A 2F57A 4KBCA 3VBTA 1KE8A 3PFQA 4AU8A 4L01A 3SC1A 5A54A 3R1QA 4BBFA 4C38A 5CQUA 2UW5A 4PMSA 1ZOEA 2XBJA 4V01A 5DGZA 4R77A 3IW8A 1O6YA 4TZRA 3ZM9A 4PMTA 2Y6MA 5H9BA 1I44A 3BGZA 4I6FA 4AAAA 1FINA 3A7HA 2YZAA 3EFKA 3MTLA 5HE0A 2CNUA 4FSZA 5CAOA 3CBLA 2QLUA 3HV6A 3VF8A 3BHYA 5CS6A 2XK8A 5CEIA 4EJ7A 3DJ6A 5IU2A 2EUFB 3UP2A 4HGSA 3BWFA 4AZSA 3TWJA 2J5FA 3D5XA 4RZVA 4AW1A 4YURA 3SD0A 3PUFC 4FG7A 5I9UA 3LQ8A 4MK0A 2QLQA 4BDBA 2C69A 4NSTA 1J7UA 4ZOGA 3GXLA 3CS9A 4RX7A 3CXWA 2XCHA 4PTGA 3OWJA 2J7TA 4DT9A 3N4VA 5C9CA 4HVDA 3QTXA 4FSUA 3VIDA 4DEBA 3GOPA 4EQMA 3DK7A 3VS1A 1H1QA 3RWQA 4BCGA 3IK3A 2UVYA 3MY5A 3L9MA 2RF9A 2YAKA 4R78A 4YJPA 3PXZA 3BL7A 2OWBA 2VTIA 3MS9A 3NW6A 4M14A 2GNHA 5ANEA 4A9TA 3OFMA 4IZ7A 5EI6A 1ZMUA 4B8LA 4O1PA 2W1EA 4ZK5A 1F5QA 4CTCA 4G2FA 3MVHA 3RNYA 2CMWA 1OUYA 5FEEA 5JFVA 2ETKA 1GOLA 3QAME 4TNBA 5JZNA 3UQGA 4DH7A 3FY2A 2UZVA 3PPZA 2ETRA 5I9ZA 1WBWA 3V51A 4YO4A 4OBOA 4RX8A 4GKHA 4O4CA 4IDTA 1A06A 4Q9SA 3VS6A 2W1DA 4E6AA 2G2FA 1V0PA 3UBDA 4FK6A 2XJ1A 3BYVA 1PMNA 5GZ8A 2WQMA 1FQ1B 3O23A 4ASXA 4C33A 3U51A 2I0EA 5TR6A 2IWIA 2GNIA 2C6IA 3I6WA 3R7IA 2R3GA 4FV0A 4FEVA 3FMNA 4D58A 4RRVA 5LCJA 3TI1A 4DDGA 4E93A 5AA9A 3VUHA 4J99A 1ZZ2A 5M57A 3OXTA 3V8SA 4QP3A 4I21A 3U8WA 4ACGA 3LFBA 1JSVA 1XBAA 3S3IA 3SXRA 3MY1A 3SW7A 2BZKB 3OUKA 2J2IB 2IN6A 3FV8A 1LEZA 4M69A 2PZYA 3OBGA 3TL8A 3UNJA 5CEOA 5LJJA 1R1WA 5AR3A 2ETMA 5LVLA 4IZYA 5I9XA 1VJYA 3Q4CA 4A06A 3QC4A 3ZO1A 4O7SA 1SVHA 2GFSA 2GTMA 2R3IA 4ZTQA 4EHZA 1PXIA 2HCKA 4DH1A 4UMQA 3LOKA 2XP2A 1DI8A 2OIDA 1H8FA 1W7HA 2R3RA 2WB8A 3A8XA 3OVVA 5IH4A 3NVMB 3DGKA 4E6DA 1WBSA 3OEFX 5LMKC 3CLYA 1ERKA 2ITZA 2RSVA 2Y4IB 3E8EA 3FSFA 3BYOA 4PPBA 4Q2AA 4UZDA 3ACKA 2QOHA 4AP7A 3MVJA 3M42A 3RZBA 4LL5A 3AKJA 2C3JA 4NM7A 1L3RE 1RQQA 3KRLA 1Q3WA 1M14A 3UPXA 1TZDA 4YP8A 3PG3A 5AUZA 1GIIA 3TZ8A 3FKLA 5E9EA 3C4XA 2UW4A 2O64A 3DLSA 5EKOA 1ZYLA 2VTSA 4BN1A 3LMGA 3Q9WA 1AQ1A 3DJ7A 1H08A 3MJ2A 3QBNA 2W9ZB 5TOZA 3VUKA 5DRBA 5EHOA 3LLAA 1OKYA 2F2CB 4ERKA 3V5PA 3P23A 3SQQA 4FKWA 4PDOA 5CTPA 2XALA 4YZMA 5EW9A 3R8LA 3PZEA 1OIUA 3FI2A 3Q53A 1ZMWA 4JIKA 2BZHB 5EYKA 4OAVB 3GBZA 4G5JA 4EJNA 3R9DA 3IG7A 4B4LA 3EZVA 2YDIA 5EM8A 2E9UA 4O96A 4LRKA 3CPCA 2YEXA 3W0PA 5KBQA 1HOWA 4O82A 1I09A 4U6RA 5HD4A 3W8QA 5TE0A 3ZSIA 2X0PA 4FOCA 4RX5A 2YZLA 1QCFA 2I0VA 5AUXA 4E5BA 4F64A 2PTKA 3QUPA 3LJ2A 4CT2A 4YZNA 3FQSA 1H26A 4DEIA 3CE3A 2CNVA 4ORKA 4GT3A 1SMHA 4F6SA 4AGUA 5HTIA 4BTKA 4ZTMA 5KMIA 4CEGA 4F4PA 2G15A 2G2HA 3Q4UA 4FKQA 3MSSA 4FKVA 4EYMA 4O7LA 4U43A 3WYXA 1H01A 2BIKB 1VEBA 5K0XA 2YM4A 2UZTA 4U42A 3NUPA 4AXEA 1XBCA 1CM8A 3QZHA 4X7QA 3E92A 3MBLA 2YIWA 2GNFA 1WVWA 3DDQA 4UXLA 1W2DA 2WTVA 5CSXA 5J9YA 4A9SA 4DT8A 3L9PA 5ANOA 2BTRA 4C61A 3CTHA 1XH7A 3ORIA 2XIZA 3QZIA 5AV3A 1R39A 2WIPA 2WTJA 4ITHA 4QMWA 4O0YA 2CGXA 3F2NA 4ACMA 3P9JA 2XM8A 4NKSA 2QO7A 3HP5A 5E7RA 1V0BA 3UDTA 3P08A 3F3WA 3WF8A 5AV1A 1YDRE 5CNOA 3R04A 4ANMA 3Q96A 3O71A 2VO0A 2YM5A 4B9DA 1W8CA 2NRUA 4BCJA 2BHEA 4K33A 3ZLWA 1Z5MA 4KS8A 2X8DA 4GK2A 5CEQA 1OM1A 2XRUA 3LM5A 4NM3A 2VTOA 3TZMA 3EMGA 4DF3A 4CMUA 4OAUC 3ZFMA 4IW0A 4I92A 3QL8A 3V5WA 2WU7A 4YTFA 4N57A 1KOAA 4YTIA 4BZDA 2C0IA 2I0HA 3QLGA 3HEGA 5JK3A 1XO2B 3KMMA 4LOQA 4EH4A 2Z7RA 2OO8X 1WBTA 2B9HA 2WQBA 2YIRA 2VWXA 3Q9XA 4ANNA 3DFCB 3QWKA 5K4JA 3R1NA 3KCFA 3PRFA 3IW4A 1VYZA 3P79A 4RVMA 2QOKA 3RCJA 4EL9A 4BDAA 4S32A 1H25A 4R5YA 3NYOA 4I5CA 4FYNA 2YM6A 2Z7QA 4RQKA 3F5XA 3FMDA 1A9UA 3GC8A 4FEQA 3EFWA 4J71A 4CGAA 3ET7A 4C3RA 4A4LA 3GGFA 4L6QA 4RT7A 4GIHA 5E8VA 4ZSAA 3VS3A 3LE6A 4FSQA 4KIOA 4GRBA 2C3LA 1TVOA 4O0SA 2YWPA 2BRGA 3WBLA 3OC1A 4YPSA 4D1XA 4O6EA 4B99A 2R3QA 1H0WA 1WCCA 3O7LD 4AF3A 1YKRA 4JT3A 5KZ0A 3M1SA 3W0MA 4Q5HA 2VTMA 3AGMA 4IB3A 4GVAA 4JJRA 2ZMDA 3QGWA 3KL8A 5DT0A 1JOWB 1R78A 3I7BA 2G2IA 2BCJA 4Y95A 4Q9ZA 3W33A 3TJCA 3O0GA 1IRKA 2XKEA 3Q5IA 3SV0A 4E20A 4EC9A 3E3PA 4GMYA 4BBEA 1GNGA 3NEWA 1YXTA 1SVEA 3BU3A 4HYHA 1H07A 2XAOA 3VUIA 1TFFA 4K11A 5CU4A 3W18A 4BC6A 4BCOA 2GS2A 2P33A 4NIFB 4ZY5A 5M4CA 3GFEA 3R7YA 4AW5A 2J6MA 3LKMA 5CQWA 2X1NA 2CJMA 4WHZA 4C62A 3F82A 3NYNA 4QPMA 2W1CA 4O83A 3PYYA 3OMVA 2IZSA 2OFUA 3K3IA 5AM7A 4BTJA 3BIZA 4UYAA 1FPUA 3W8LA 3A61A 4XV2A 4FV5A 1BI7A 5CXHA 2WGJA 3DDPA 5BNJA 3DXQA 1PMEA 3UZTA 4RGJA 3G5DA 3VRZA 2EXEA 5AAGA 3MB7A 2R2PA 4IX4A 3EFJA 4O91A 4U80A 4ENXA 1OBDA 3W0NA 2VX3A 4GT4A 3FEGA 3E8NA 4E6CA 4HVGA 3IPHA 5HOAA 3HRFA 1GZ8A 5AFVA 4E6QA 5J5SA 5JH6A 4RVTA 4R3RA 3TG1A 2UZNA 2NYAA 2J4ZA 3TYKA 4LUDA 2IW6A 1MRVA 3ATSA 1IA8A 2QD9A 4QNAA 3BEAA 3H30A 3FUPA 4CSVA 2QKWB 2X81A 3IECA 3LXKA 4ZAUA 4H3QA 5K5NA 5KMNA 3AKLA 4RFZA 4U40A 3MPAA 4DEGA 2VWWA 4AG8A 3IQ7A 2ITUA 2FSLX 4H3BA 1SNXA 1PW2A 4LGGA 5HVJA 5HBEA 4BCHA 3NVKI 5BVEA 2C68A 3MB6A 1JSUA 4HPTE 2YISA 3DJ5A 5EOLA 2BDFA 3A7JA 2R3NA 2W1IA 3DY7A 3NWWA 4DGOA 2PUNA 2OZOA 1IASA 4QMOA 2B0QA 3HRBA 2ACXA 3A62A 3ZS5A 3R8MA 3RBWA 3WF6A 3CD8A 4FIIA 1JVPP 4V05A 3OCTA 4LGHA 2ERKA 1LEWA 3CCNA 4N6ZA 4NIFA 4UYNA 5FDXA 4D2VA 4HVIA 3BU6A 3D7TA 3VBQA 2YCFA 2W1ZA 2BZJA 2UW7A 3JY9A 4GG5A 2WIHA 3ELJA 3ORTA 4GFGA 4GU9A 3ZBFA 2WU6A 5CF4A 4IJ9A 4ZIMA 3FMEA 5KHXA 2H96A 3FLWA 3CGOA 2PPQA 5AV2A 5HG9A 4NTTA 4BI1A 1BUHA 4C37A 3D94A 4EI4A 5IF1A 4D2SA 1G8JA 3PSBA 4L43A 4RIWB 5ANGA 3JPVA 3L8SA 1U54B 2PU8A 2UZDA 4G6OA 3VO3A 2C3IB 5FM3A 3OEZA 4YLKA 3EN9A 4A07A 4E4XA 3UOJA 5CF5A 3LFCA 4EC8A 3OTUA 4O1OA 3HMPA 3KRRA 2GQGA 1UKIA 2OJFE 3ITZA 2F2UA 3O96A 4X2NA 4LDTA 5CSHA 4DYMA 3W10A 2QOOA 3TNHA 5IA0A 4D2PA 2EWAA 3FMHA 4FF8A 4GFMA 3T3UA 1JKLA 3L1SA 3F7WA 2W1HA 2BDWA 3ZEWA 4TWPA 4XCUA 4HZSA 2R64A 2B9JA 2GCDA 5JGAA 3BU5A 3EQFA 2PZ5A 4I1ZA 3S00A 3HV5A 1XH8A 2PE2A 3H10A 3ZO4A 5L3AA 4ZTNA 4EUTA 1BL6A 3AKKA 1CMKE 5H8EA 5M55A 3R7VA 2WMXA 3ZRKA 3NUSA 3MH1A 1Y6AA 3BX5A 4WUNA 4YTCA 3UO5A 2RFSA 2W0JA 1ZOHA 5JEBA 5A4CA 1Q8WA 1V1KA 5D7AA 3TNIA 3Q52A 4ANQA 3F5PA 3V3VA 1UA2A 1U59A 4ACCA 4F0GA 4F9CA 3BKBA 4I4FA 4MQ1A 2WNTA 3W2QA 4ZLYA 3PJ3A 2F49A 3WE4A 3BQCA 2R5TA 3DPKA 3IONA 5DOSA 3SX9A 3VN9A 3ATTA 4L3JA 3FXZA 2J0JA 1J3HA 5ICPA 3PWYA 4K1BA 5KNJA 3VW8A 4F7SA 4CKIA 4BDJA 3LMIA 2UZLA 2HAKA 3AT2A 5EDQA 3BLRA 4AXCA 1ZXEA 3QTZA 4RIXB 1H28A 2HK5A 4JOAA 3R8PA 2Z2WA 2XF0A 4ITIA 3SHEA 4BICA 5CI7A 5DBXA 2ZM4A 3LJ1A 3ZUTA 2VNWA 3MGYA 4XX9A 5CVHA 2RFDA 5CAQA 4RA5A 4DGNA 3HX4A 2ITVA 1JPAA 2JDVA 1R0PA 3I5ZA 5AADA 2YCRA 4FSYA 5J1VA 4MBLA 3MVLA 4UMRA 2XKDA 3HAVA 5HIBA 4YZ9A 1W0XC 4GK4A 4EORA 3MESA 3FI8A 3E64A 3OT3A 4X2KA 3KN5A 3P7AA 1YHVA 4XP3A 1E1VA 4WUAA 2VTPA 3GOKA 2X0OA 4ZJVA 4QMTA 2OIQA 5G6VA 4XYFA 4EK5A 4RWJA 4YLLA 3GEQA 5CLPA 3RNIA 4Z9LA 3RINA 1G8SA 3SDJA 4KS7A 4C58A 4RMZA 2FVDA 2WMAA 4APPA 2ZJWA 4C57A 3KXMA 1SM2A 3PP0A 5B2MA 1ZWSA 2XEZA 4PP9A 3IKAA 3FZSA 4FSRA 4RIYB 5IQAA 2W4OA 3JVSA 4JG8A 4QT1A 3V6SA 4YHTA 5HTCA 2AC3A 2XYUA 4DH8A 4H39A 5LXMA 4AQKA 3DBQA 4FIEA 2IEWA 3COKA 3NYXA 3WI6A 3UVQA 1Q24A 4A7CA 2C6EA 4CT1A 2CKOA 4O6LA 3VQUA 2PZRA 3VBXA 2OU7A 3GP0A 3RPRA 3EQBA 5L8LA 3LLTA 2REIA 4FT7A