3CS9A

Human abl kinase in complex with nilotinib
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
268
structure length
264
Chain Sequence
b'DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Characterization of AMN107, a selective inhibitor of native and mutant Bcr-Abl
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 264
sequence length 268
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cs9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cs9A01
2YDJA 3MIYA 4FICA 3BRBA 4I0TA 4R5SA 5DBXA 3FZPA 4EH3A 2WPAA 3VBVA 1QMZA 3QRUA 4NM3A 4F4PA 3RVGA 4IZ7A 4FKQA 3VWAA 2BDFA 4BR3A 2IPXA 5AR7A 3RCDA 1RDQE 3U9CA 1GJOA 4IB0A 3VQHA 4AW1A 3UZTA 5H8BA 2CGUA 5CU6A 4ZOGA 4L53A 3Q5IA 3ORPA 2YACA 3KRXA 3ZEPA 4DLJA 1OI9A 4ZSGA 5BMMA 3TTJA 5M57A 4DFYA 2B0QA 4N57A 2YDKA 2XIRA 4QMPA 4I4FA 4WSYA 3UPZA 4IC8A 4E7WA 4UMUA 4YURA 2PMNX 5IQDA 2W4KA 4XOZA 5FBNC 2EB2A 5BQ0A 4K1BA 4MXCA 3PWDA 4CKIA 3VS4A 4M3QA 5M07A 4IVBA 3D5WA 3L8PA 4ZTHA 4ACCA 2E2BA 2XM8A 3QQKA 4O6LA 3D5XA 3TZMA 1H28A 3EQBA 4NSTA 3UVPA 3GQIA 3LMHA 1BL7A 3SQQA 3KGAA 2YWPA 3G6GA 4G3GA 4AF3A 3MPTA 4CFFA 3DXNA 1FVVA 4EZ7A 4QP6A 3U87A 1H1QA 4EZ5A 4O91A 5GHVA 3VUKA 1UU7A 3VS6A 2OIDA 4YU2A 3V6RA 3AC1A 4BCHA 4AZVA 3SRVA 3KVWA 5GNKA 5D7AA 4BTFA 1Q4LA 3MBLA 4C4EA 4YTCA 1R0PA 5CXZA 1Y91A 1ATPE 3OBGA 1OBDA 1H07A 3F3WA 4FNZA 4PTGA 3U51A 4E6DA 2IW6A 4HJOA 4RWIA 3UDBA 4JI9A 3ZSHA 1XO2B 2C6EA 2JD5A 2I0EA 4NTSA 1ZYJA 3AMBA 4EH5A 3NR9A 2UW9A 3KFAA 5ACKA 3PYYA 4BKJA 3BU6A 2O65A 3Q4CA 3COKA 3AC2A 1M2PA 1B6CB 1PW2A 1WBWA 4UX9A 1Q3WA 5CENA 4I92A 3RPSA 3IOKA 3I4BA 5A3XA 5KCVA 4FIEA 4O82A 2OJ9A 3Q4ZA 3UJGA 4ZY5A 2I40A 4O7NA 3R8ZA 3A8WA 4A07A 4FV4A 3EQHA 5F20A 3R8MA 2QG5A 4YJUA 3KMWA 3VS1A 1T45A 2HAKA 2W5HA 2XK4A 4CFWA 4GFOA 2HIWA 4E5BA 1SVGA 3BGQA 1WCCA 1H26A 4LGDA 4TKSA 3H9RA 5HD7A 5E8VA 4DTBA 1BX6A 2OJGA 3ACJA 4X3JA 2GMXA 3ORNA 1XBCA 3SHEA 5HU9A 2R7BA 2YAKA 3Q3BA 5HX8A 3TZ9A 3JUHA 2DWBA 2F49A 4A06A 4TYHB 2R3NA 3NDMA 4AACA 2O3PA 2Z60A 3EQDA 4XS2A 3DTWA 3GFEA 5I3OA 4PP7A 5G1XA 4AGCA 1R39A 1T46A 2J0MB 3OG7A 4D2RA 1GZKA 4U80A 4I41A 4WG3A 3RNIA 3UIXA 2J0LA 3CC6A 4KIKB 2YERA 3ZRKA 4WO5A 4TYGA 4M67A 4IX3A 5FM3A 4FYNA 2B9HA 3FLNC 2C6IA 5FDPA 1OPLA 2OFUA 3CEKA 1NY3A 3PLSA 2BVAA 2WTIA 3LW0A 3PE1A 4OW8A 2QOHA 3QD2B 4Z9LA 5IG1A 2VTRA 4RVTA 4GIIA 4PWNA 1UNLA 1UNHA 3CR0A 2RIOA 2VX1A 3KVXA 4HZRA 4APPA 2CKEA 3FKOA 1TQMA 4RQKA 3PSCA 3DOGA 1A9UA 3OROA 5LVLA 2XMYA 3QCSA 3BLQA 4R8QA 4ZS0A 5C8NA 4HGSA 5M44A 1OB3A 4GJ2A 4IACA 2HW7A 3BV3A 4FV7A 3SXSA 5HU3A 1Q5KA 5JK3A 4QNYA 2YCQA 4IVCA 3DCVA 4CD0A 2XIXA 3PA3A 3O96A 1Q99A 3MY0A 3OVVA 5GIPE 2IW9A 1BYGA 3DJ6A 3IW8A 4ZZOA 2OJIA 3FXWA 4BDDA 4YUQA 5LCJA 2PYWA 3L8SA 3PA4A 5FLFA 4CXAA 1LUFA 4O7RA 1OUYA 2ZJWA 4DBNA 3D2IA 3SGCA 4BDAA 1OPKA 3C4WA 4XBRA 1PXKA 4XP0A 1E9HA 2BRMA 2PVLA 3VO3A 3L9PA 2ITNA 4LMNA 3A7HA 4XCUA 2OU7A 4IM0A 3UOHA 4O81A 2R2PA 3FKNA 3R00A 2OXDA 3Q2JA 4M0YA 5E92A 3CTQA 4TNBA 4MF0A 4F9CA 5M4IA 4QD6A 3OBJA 4ITJA 2OJJA 2PVJA 3WF6A 3ZONA 3TV4A 4W4VA 4Y72A 3P08A 4CYJA 4JBOA 3Q4TA 3PVUA 5ETIA 5I9YA 4FVRA 3PXRA 4GYGA 4FZAB 4BRXA 4EI4A 3UNZA 4W8EA 2X2MA 3HRFA 4YC3A 2B9JA 5EYDA 4M7IA 2UW3A 3UIBA 3BBTB 5TKDA 4UXQA 2YM6A 3A7JA 5KMLA 5GJGA 3LE6A 4YJNA 3ZDUA 2XNGA 2YITA 2PE0A 3O8PA 5D12A 5ANJA 4ZMEA 3H10A 3NS9A 3H9OA 4JS8A 2ZV7A 5IZFA 3FY0A 2W1DA 5DGZA 2QCSA 4ZLOA 2EVAA 4L8MA 2W9ZB 3LCDA 4C2WA 4CFVA 4CG8A 2VWVA 3DTCA 2QOFA 2UW7A 1PKDA 4UYAA 3RK7A 3VRZA 2XNBA 2IZTA 2V22A 3HGKA 4LRJA 5CQUA 2BDWA 3FBVA 4AN2A 5GJDA 3UIUA 4DGLC 4ASXA 3F3TA 2O8YA 5EDRA 3LFDA 1YKRA 2V7AA 4RWJA 3OT8A 1PXJA 1SNUA 2ZOQA 5CVFA 1ZZLA 4CYIA 1NW1A 4QNAA 5EYKA 5E9EA 5AUYA 4LGGA 3U4UA 4NKSA 2G2FA 4GW8A 2Z02A 4AUAA 4C4FA 2YFXA 4UWBA 1CKJA 3BHYA 4I22A 4DEBA 4OR5A 1JQHA 4HZSA 4ERWA 3SLSA 3H0ZA 3MTFA 2DUVA 3GT8A 2OIBA 3MFTA 4LRMA 1WBOA 5D7VA 1H1WA 2SRCA 2V7OA 4WG5A 4JBVA 4B99A 5KBQA 1PMUA 1MP8A 3BGZA 3FPMA 5EM7A 4XEYA 4BDIA 4OUCA 3ZUUA 4DH5A 2XCKA 3AC4A 3U6HA 2JAVA 2HXLA 3ZEWA 3EQIA 4G5PA 1XH9A 1ZMUA 4L01A 4BB4A 4GS6A 5DT4A 1RW8A 3NCZA 4NWMA 4BBMA 3EKKA 2IZRA 3NGAA 4WUNA 3ROYA 4WNKA 3V8WA 3HDNA 3QWKA 2VWIA 3RZFA 3MGYA 3NWWA 4G16A 3ZRMA 4AW5A 4C57A 1OIQA 2VD5A 1ZAOA 1U59A 2GTNA 4HPTE 3G2FA 3GQLA 4ANBA 2B7AA 4QMMA 3QA8A 4DFBA 1IRKA 5DNRA 2WMRA 3GXLA 3LMIA 3SD0A 2Q83A 4KBKA 5IU2A 2PWLA 2R5TA 5L2IA 5ICPA 2QOLA 1UKHA 4JL9A 3EQRA 4RZVA 4DH1A 4U97A 4E4XA 5JGDA 2GNJA 4IQ6A 2FH9A 1YWNA 2R64A 5GZAA 4YO4A 4QQ5A 3W2PA 3SC1A 3VBTA 2C68A 5D1JA 4BDJA 5IQBA 3QX4A 4JBQA 5TOZA 1K9AA 2A19B 3OXZA 3P79A 5CASA 4MQ1A 3Q2MA 4I5MA 4D1XA 3BV2A 3PSBA 5CAOA 4O7TA 3S00A 1UWHA 1YHWA 4XV2A 3VUMA 4FEWA 5DMZA 3QUPA 1VEBA 4USFA 5GINE 2OZOA 3D4QA 4JBPA 4NZWB 4PNIA 2R3PA 4IFCA 5LMKA 1DAWA 1H27A 4RLLA 1GZOA 3W16A 4E6AA 4IMYA 3FQHA 3DK3A 5KUPA 4QMLA 5JMSA 3NUSA 3D5VA 3SOAA 3ZMMA 5DWRA 3TNQB 1U46A 4KSQA 3V5QA 2HZNA 4JJRA 3N4UA 3F69A 5JQ8A 4FOCA 4PMPA 2GU8A 4MTAA 3TM0A 3E92A 2G2HA 3MJ2A 3ID6C 3BU3A 4P4CA 5M4CA 3WF7A 2FSTX 4J53A 2I1MA 2XCHA 2UZDA 2YCFA 3GI3A 5E8UA 3QD0A 2C0TA 2V0DA 3QTXA 5IA0A 3ELJA 3MPMA 4M68A 3T3UA 5T68A 2VTSA 3C5UA 2JGZA 5HTIA 3IDPA 2JDVA 3PTGA 5HNBA 4FVQA 2J2IB 4C62A 3TZ7A 4U0IA 1S9JA 2ETMA 2ZB1A 5AA8A 4FGBA 3R8UA 2G2IA 4RZWA 3SX9A 3WBLA 4EUTA 1OMWA 4F0GA 5C26A 3DV3A 4QOXA 4ZMFA 4QYHA 1OECA 5E8SA 5BYYA 4GCJA 2IZSA 3K2LA 4OBQA 3FL5A 5ANIA 4KBCA 5CAVA 3CD8A 1BL6A 3G51A 4O7ZA 3A62A 4KIPA 4A4LA 3DK6A 2YA9A 4DEEA 4O7VA 2J7TA 3K5VA 3R9OA 3UODA 3FC2A 3RAHA 1ERKA 2OH0E 3NYXA 3C0GA 4U5JA 4OTIA 3GUBA 5AMNA 4UWYA 5HNGA 3PPJA 1PXMA 1Y8YA 3PSDA 4YNOA 4ZTMA 3FI8A 4JNWA 4JQEA 1WVXA 4O0RA 3HA8A 4RGJA 3WARA 4EOPA 4RJ4A 5EYMA 2R3MA 5CVHA 3VW6A 3WF9A 3L8XA 1H1RA 3FL4A 5HORA 3KN5A 5K5XA 1XH7A 2I0VA 4HCUA 4I1ZA 4J99A 4U43A 3WZDA 3DQXA 1MRYA 2VV9A 4A9SA 4BIDA 2OI4X 2BR1A 4Z7GA 4ZAUA 1OZ1A 3UQCA 4BGHA 4UZDA 2WD1A 2XK7A 5D9HA 5C01A 2AUHA 4QRCA 2JIUA 3MH3A 4QYGA 2JDRA 2OFVA 2ITUA 4YLKA 1OL2A 3PP0A 4IWDA 4GMYA 5TR6A 3R6XA 3ZU7A 1Q62A 4FKSA 4R7HA 5AUWA 1U54B 5AUXA 5HG8A 4GK3A 3ZRLA 4AN3A 3AG9A 3DS6A 5AUTA 2I7QA 3VRYA 4AOTA 4FYOA 4D0XA 3NLBA 4HNFA 3VQUA 3HMMA 3OOMA 4M84A 2PSQA 4PMSA 4ERKA 4E26A 4O0VA 4V0GA 3ZH8A 5LVOA 4O0UA 3ENHA 5E8TA 5FEEA 3B2WA 2W1GA 4V01A 2BHHA 4Y95A 2VX3A 3MYGA 5IA4A 4FKIA 2X7GA 2PVHA 2UW6A 3FZSA 4FSWA 4F6UA 3BWJA 4X2NA 1PYEA 2FA2A 4X7QA 5J7HA 2G01A 3ZFMA 2QODA 3OWLA 3F5GA 4JT3A 1UU3A 3QGWA 4J52A 3OXIA 4NEUA 2WTCA 4RFYA 4WNPA 2C1BA 2GTMA 4F0FA 5D10A 2LGCA 3QQFA 5BVOA 4FT5A 1DI9A 2R3QA 4KRCA 4MXOA 4LYNA 4DYMA 4L44A 3QHWA 3BQRA 4FK3A 3FI4A 1H01A 3EN9A 4NU1A 3W8QA 1MQ4A 2E9NA 4FV3A 3VNTA 3AQVA 4RWLA 2R3HA 2YEXA 5KBRA 4Z7HA 4TWPA 4L7SA 4M69B 3EFLA 5AP7A 3PPZA 4ZXTA 4DFXE 2A2AA 2ITVA 3E8CA 5AM7A 4EH8A 5DI1A 4CFNA 2VO0A 3PRIA 3FMJA 3M2WA 3QF9A 3U8WA 1B39A 2Z8CA 3SOCA 2PPQA 2YLEA 4NFMA 4QYEA 2B54A 2ZDUA 4FTLA 5EW3A 3W10A 4QP8A 3GFWA 2X81A 2YIRA 3F3ZA 3GCPA 5DT0A 3KXHA 3PJ3A 4YTFA 1L8TA 2XNNA 4IZAA 4IWQA 4DGOA 3DKCA 5JGAA 4FV8A 5K4JA 1YWVA 5HE3A 4RC3A 4P5QA 2H6DA 2WFYA 2C6KA 4WSQA 1OPJA 1VYZA 5I0BA 3FMMA 4EL9A 3G5DA 4QMNA 5CSWA 3LXNA 1XWSA 3ZLSA 1HCKA 4J96A 2WTKB 5CEQA 4AFJA 2PVFA 4RWKA 5FXQA 5ITAA 3FEGA 4JDHA 5J9ZA 3RZBA 5AP2A 2VWWA 4ACMA 1JAMA 4HVDA 4EORA 1Q8YA 1B38A 3HUCA 5J79A 3NUUA 2VTNA 1OIUA 2JFLA 2QR8A 4PDOA 2W1CA 4BDHA 5EI6A 3S3IA 3VBQA 3MFUA 4ZSEA 2QOOA 3HV3A 4GIHA 4CMTA 1OL1A 2UVYA 1W0XC 2C4GA 3SA0A 3CKXA 3I7CA 3R22A 4BI1A 5CU0A 2H96A 3NNVA 2X39A 3IECA 3L1SA 3NAXA 4RLKA 1FMKA 3OW4A 4ANOA 4D58A 4G1WA 2QVSE 4ZSJA 3EZVA 4K6ZA 1K2PA 2BZIB 3UIMA 4UWCA 4ZEGA 2CKPA 4H36A 1CKPA 3HAMA 4BHNA 4K11A 4PPBA 3THBA 4YJVA 4HVHA 2WMWA 2VTOA 3BYUA 3FZTA 4E4LA 3HMOA 1R1WA 4KIQA 3TKUA 3H4JA 3GCSA 3I60A 3GGFA 2HXQA 2YISA 4FTUA 4BCOA 3OD6X 2Y8OA 1YI6A 5B0XA 4PDYA 4WIHA 5HD4A 4FZ6A 3N4TA 2XIYA 2GHGA 3PJCA 3UO6A 2VN9A 2GHLA 3VW8A 4EWHA 4EH6A 3RBWA 2QOQA 3C4CA 1JKTA 3NRMA 2WGJA 4O1OA 5I9VA 3TNIA 2OG8A 3LFSA 3TV6A 4MWIA 4G3DA 3U9NA 4M13A 3HLLA 3VAPA 3H9FA 4YTIA 1GIIA 4HYIA 4OTFA 5HTCA 3RINA 4KAOA 3E93A 2VGOA 4GU6A 2Y4PA 5JT2A 3HRBA 2C5OA 4C4HA 3FQEA 4J1RA 4CRSA 2FUMA 5CAPA 3AMYA 3R9HA 4KRDA 4BYIA 2Q0BA 4EUUA 4QMVA 4KD1A 4I0RA 4GEOA 5F9EA 1UU8A 4O0SA 4I6QA 1OGUA 3VUDA 2UW8A 3KXZA 4RFMA 3W8LA 2WMTA 4HPUE 4MWHA 5DEWA 2OXYA 3F82A 4EH9A 2ZAZA 3QQHA 4J7BA 3ZUVA 2BZHB 4AZWA 2PUIA 2YWVA 3HVCA 4DG0E 4S33A 1GIHA 1ZY4A 4LFIA 2GHMA 2GQGA 4FE2A 2PVMA 2O2UA 3DDPA 4I4EA 2NNWB 3TG1A 3IO7A 3QRIA 3OEZA 5KZ0A 4EOLA 4YC8A 2JIIA 3ULIA 4NT4A 4UALA 5KO1A 5BVFA 5KNJA 2C5VA 1ZY5A 2NRYA 3DBEA 5FP5A 1W8CA 2VTLA 4DTKA 4N6YA 4DGNA 3KQ7A 4D0WA 2R7IA 5CY3A 4F7SA 3KXGA 2W1EA 2YDIA 4YZCA 3DPKA 4RVMA 2WQEA 2F7EE 4EZ3A 3ZOSA 5AIRA 2W1FA 3D7TB 3JY0A 2HWOA 5I9ZA 4DE4A 1XH8A 4F1MA 3GP0A 5CANA 5HKMA 3LXLA 5EM5A 5JSMA 4C36A 5HLNA 5C03A 5IQCA 5L2QA 5K3YA 5DEYA 4NIFB 4FEUA 2C6LA 3W33A 4IVDA 3BIZA 4J71A 5HG9A 5CNOA 3R71A 5KMMA 3ZZWA 3K3IA 4OLIA 5J1VA 3HAVA 4XH6A 1SM2A 3UOLA 2BALA 4ASEA 5KMNA 1J1CA 3FLSA 4CCBA 2P0CA 2NP8A 4PV0A 4GKIA 2XK8A 3G33A 3GCQA 3ETAA 5A9UA 4BCKA 4YHFA 5M55A 2HOGA 3HRCA 3D0EA 3IGGA 4XP2A 3I7BA 3CSVA 4K33A 4L43A 2XK9A 3LLTA 2VTAA 1JKKA 5M4UA 5KKRB 4KBAA 3TN8A 1PXNA 1KOAA 3H3CA 1G3NA 3CIKA 4F6WA 2W06A 3QYZA 3OWJA 4JOAA 2JKKA 3UNKA 3PG3A 4X0MA 5F1ZA 1FGIA 4U42A 4J8NA 3D14A 4DG2E 2OBJA 5AAEA 3BBWA 4FKRA 5EI8A 5AV1A 3HUBA 3Q9YA 4FTIA 4GL9A 5AUVA 5KX8A 2XYUA 4DCEA 4HVGA 3V5JA 5DR9A 3W55A 2CPKE 3II5A 4UN0C 2CNUA 3ZCLA 1OVEA 4LV5A 2XEZA 4MNEA 4BDEA 3N51A 3GB2A 3F2RA 1MRVA 1Z9XA 4FV5A 4IAIA 2C5NA 1DS5A 1FVRA 3CKWA 2P2IA 3HNGA 4KA3A 3VHKA 1H1PA 3U6JA 3ZO3A 4F9BA 4E5WA 4FL3A 4C4IA 3NUAA 4CV9A 2GFSA 1YI4A 2VWZA 3UC3A 3QC4A 3MH1A 4U9AA 4UXLA 1REKA 4DAWA 4RSSA 4XRLA 3ZYAA 4OT6A 3RWQA 1L3RE 2BIYA 2HZ4A 3C50A 3WE8A 2GS7A 4QMQA 2FSMX 5CTPA 3TNPC 1OITA 2FSOX 2VX0A 1H24A 2XNEA 3ANQA 5EW9A 4JIKA 2X4ZA 5E7RA 2UZBA 3FZRA 3QQUA 5T6KA 4Q9ZA 5A6NA 1A06A 3RNYA 3JXWA 4J8MA 5JFSA 3ATTA 3R8LA 3TDWA 4JG8A 3OS3A 5FWKK 2HZ0A 2VO3A 3VS3A 5JEBA 4FZ7A 3DBQA 4OTQA 3EFJA 3OWKA 4FSYA 4I6FA 3UOKA 4MXYA 4D5HA 3SAYA 4K18A 4QTBA 3POOA 3QTIA 3VUIA 2REIA 2V62A 4UEUA 4MEDA 2UW5A 4EQUA 4N0SA 3R0TA 2PMIA 5DHJA 3JY9A 4BDFA 4ANLA 2R3GA 4CFUA 1ZYCA 2B1PA 2WTKC 4RIYB 4CT1A 3CY3A 4G9CA 3LLAA 5GZ9A 3RPVA 2WMVA 2IVVA 4W9WA 5F4NA 5IKWA 4XLVA 5J5SA 2FYSA 2RGPA 2PUPA 1DAYA 3MVMA 4YGAA 3DB6A 1IASA 4BIBA 4MNFA 4O7WA 2XS0A 5IMXA 1Q61A 3NUNA 3O17A 3PIZA 3ZM4A 2R0UA 2W9FB 3QTSA 2HYYA 2C0IA 5E1SA 3CBLA 2Y6MA 3C13A 4Y5HA 2X6EA 1ZLTA 2EUFB 4QP4A 1F5QA 4B8LA 2QONA 4NM5A 5KHWA 3QXOA 2VTJA 3Q5ZA 4R7IA 2VO7A 2CCHA 4KKHA 5DN3A 2QD9A 4FTKA 4K8AA 2UZOA 5DH3A 3BHHA 2PZIA 3ZXZA 2OLCA 1HCLA 4JAJA 4I23A 3C9WA 3MTLA 5FQDC 1U4DA 1V0PA 5M08A 4RVKA 4ZJVA 2J5EA 3MJ1A 3E3BX 3HP2A 4QO9A 5GJFA 5CYIA 3LHJA 4HW7A 3SXFA 3PE2A 2BTSA 1JNKA 3WYXA 4PP9A 3HV5A 4U41A 3EL7A 3FMLA 3FMDA 1XHAA 4EJNA 5L2WA 1SZMA 4O38A 5CI6A 5IDPA 5IEVA 4ZTLA 1WVYA 4AAAA 1H00A 2C5YA 5CWZA 3RALA 4K9YA 4FUYA 4R5YA 2E9PA 2PZRA 5ANDA 4C35A 4TN6A 4R3CA 4ARKA 2PUUA 4PF4A 4ANSA 1Y6AA 4AGWA 5LWMA 4D9UA 2CDZA 4G3CA 4F09A 3NVMB 4H1JA 3PFQA 3V51A 2J90A 4CZUA 4J97A 4FGRA 4O86A 4Y85A 5D41A 2X6DA 3LPBA 2X2KA 3FYJX 4FV9A 4GUEA 3QKMA 4H3BA 4MXXA 4XUFA 5CZHA 4HCTA 4EOIA 5FTOA 4AA0A 5IQFA 1LR4A 3IDBA 2UZUE 4OTDA 2VTMA 3GOPA 2ITXA 2XRUA 3HYHA 4A4OA 4L7FA 3HZTA 5DRDA 4GT5A 2VAGA 3OEFX 2WTJA 1O6LA 2YAAA 3GVUA 4L45A 4MBLA 4OTHA 3VUTA 1NXKA 1FPUA 3P5KA 5LVPA 2W4OA 1W98A 3GU4A 1G8SA 2RFSA 4I20A 4O7SA 4EK5A 2CSNA 3SDJA 2F4JA 4FV0A 3WZJA 3H30A 4UMTA 2B9FA 4FKGA 3IOPA 4F7JA 4EOKA 1UKIA 3MB7A 4OT5A 2QI8A 5HLWA 4OBOA 4TYHA 3KY2A 4BDKA 1OKYA 1H0VA 1KV2A 3F7WA 3QFVA 4I3ZA 5CSHA 4IAKA 5J5TA 3LKMA 4ZY4A 4FTQA 2CN5A 1ZWSA 2OO8X 2XYNA 4HGEA 4TWOA 2BTRA 3ZBXA 2YHVA 2QO9A 2OKRA 4HYHA 2QO7A 3ORLA 5DLSA 3S2PA 4MD9E 3W32A 3IK3A 4KABA 3EL8A 1NVQA 3R8VA 3LFBA 2BRBA 4KIKA 4EC9A 5HHWA 1REJA 3LCTA 3JR1A 4S32A 4MD8E 4RC2A 3RPRA 4IIRA 4P5ZA 5H2UA 4GG5A 5A4TA 3UO5A 3N9XA 5L6OA 4Y46A 4F9YA 3DBDA 4IBMA 1Y57A 3KK8A 5B7VA 4F7LA 1AD5A 2JBPA 3RCJA 3FXXA 4YPSA 5FDXA 4AZFA 4WD5A 3Q32A 3F3UA 4YZDA 3FE3A 5ETFA 3NW6A 3MFSA 4QTAA 3KXNA 3F66A 2ONLC 4FKTA 3ZC5A 5CXHA 2OW3A 5KKRC 4F1OA 4MBIA 3C4EA 1XR1A 3HL7A 2CN8A 3NX8A 2VNYA 2Y9QA 4QQCA 3AGMA 4FUXA 3ODYX 3R7YA 1M17A 5DT3A 3ZFYA 1PY5A 2VNWA 4QTEA 1YXVA 3HMIA 3TWJA 4IX4A 4WNMA 3LJ1A 4EKKA 5BVNA 3IPHA 3NVKI 3KRLA 4DH3A 4AQCA 4QP7A 4XHKB 3ROCA 4NH1A 1P2AA 2PU8A 1K3AA 3LQ3A 3DNEA 3RM7A 3QCYA 4HYSA 5J1WA 2NPQA 2G9XA 5LWNA 2OGVA 4Z55A 3WOWA 3ZDIA 2BDJA 5JFXA 3AD4A 4ZS4A 1YI3A 5HIEA 4I5PA 4IX5A 1PXIA 3EWHA 4JVGA 4WHZA 2PY3A 4EK4A 3ZS5A 3ZLYA 3FQSA 2PUNA 3MSSA 3MFRA 2QG7A 5IQAA 2BFYA 4E73A 4JRNA 3FHRA 4H3QA 3FKLA 4EBWA 4EK8A 2YCSA 3HX4A 3NIZA 4L9IA 3UZPA 3W2RA 2W96B 2OZAB 4R3RA 3G90X 1WFCA 1FQ1B 4R3PA 4R78A 2C6TA 1JVPP 3C4ZA 5AV2A 4EK3A 4Z3VA 4EONA 3IW5A 2R0IA 4FNYA 4FIIA 3GNIB 4FTCA 5AUZA 5LVMA 2QNJA 4B8MA 2R3IA 3LQ5A 4P90A 4KNBA 3SG8A 2C1AA 4YNEA 4I93A 4EWQA 4RJ8A 2A1AB 3O2MA 4D1ZA 4HYUA 5J95A 4RIOA 1UV5A 4NM7A 1FVTA 5AWMA 2OH4A 2IW8A 2QOIA 3F61A 1RJBA 3HV6A 1Q8UA 3O51A 4QPAA 3TXOA 1PMVA 5HO7A 4BC6A 3DBFA 3PVWA 1XH6A 2CGXA 4E8AA 4ACDA 3A61A 2JBOA 4JDKA 3F7ZA 3TI1A 1Y8GA 3IG7A 4AOIA 4ENXA 3E8DA 5JZNA 3Q9XA 5M06A 2RFNA 3COIA 3SW4A 2WMXA 3E3PA 3GCVA 4O2ZA 2XEYA 5CLPA 4DG3E 5CEKA 5HI2A 4YJSA 4GRBA 1QPDA 4O6EA 4IAFA 4D28A 4XYFA 4YO6A 4S31A 4BYJA 4P7EA 5E8WA 1LPUA 2HW6A 3L9NA 3QCXA 4GVJA 4B4LA 3NNWA 4M12A 4ACHA 4CGAA 2XK6A 3QBNA 4ZTSA 3TT0A 3ZTXA 4JX3A 3TNWA 3DNDA 1U5QA 4LV8A 4JR3A 4RVLA 3DJ7A 3GC0A 4RA4A 4GUBA 5CAUA 5IISA 3ORMA 4BWKA 5J87A 3DAJA 2BAKA 5LQFA 4G17A 1TVOA 3PZHA 2FB8A 2J5FA 1IR3A 4JX7A 3PY3A 2OZAA 2Y0AA 3UTOA 3VF9A 5J7BA 2Z7SA 3DKFA 3GBZA 2KULA 3OHTA 4FG8A 3D7ZA 3COMA 3VJOA 5IF1A 1JKSA 3UVQA 4D5KA 1A48A 3HMNA 5EQEA 2IVTA 5AV4A 2E9VA 2R3JA 3QKLA 4TL0A 1IA8A 2HZIA 3KRJA 4H3PA 4LUEA 1XJDA 5DE2A 5FBOA 4FOBA 4XV9A 5BVDA 2UZEA 4DT8A 3QZFA 4X2KA 5DFPA 3DQWA 4MBJA 4CT2A 1UVRA 4LI5A 1PF8A 3QA0A 4FIGA 4FKWA 4JLCA 2RFDA 5EFQA 3HMPA 5G6VA 2XKEA 4R1VA 2YM4A 1YDRE 2YJRA 3UYTA 3DKGA 3MN3A 4A9TA 3OZ6A 4ALUA 4BVUA 4XMOA 2R3FA 1J7IA 1H25A 4F08A 2OK1A 4I24A 4XJ0A 3G0EA 5EM8A 2PHKA 2UV2A 4DHFA 4IB1A 2BCJA 5ETCA 4GH2A 4AZTA 3CQWA 3PP1A 3E7OA 3B8RA 4GK4A 2R3OA 3BPRA 4ID7A 1WVWA 4AGUA 5I4NA 5JQ5A 4FEVA 4X2JA 3I81A 5C8MA 3REPA 4PL4A 4DFZE 2EWAA 3I5ZA 4YSMA 1OKVA 2JKQA 2X4FA 3EOCA 3IS5A 5CS6A 5DVRA 3RGFA 2O5KA 3DAKA 3I5NA 4CKRA 3NZ0A 5HCZA 4U81A 2BRGA 4L3JA 3QRJA 3TKHA 4BN1A 4V04A 2XKDA 3ZLWA 5H8GA 4IW0A 5A4EA 2GDOA 1YOJA 3ORKA 3BX5A 1UNGA 3FI3A 5CEPA 5D11A 3JPVA 3CTHA 3NW5A 4FSUA 3PXYA 2ACXA 3P9JA 4G31A 4ITHA 4EK6A 3P23A 3NNUA 2DS1A 4MAOA 2OWBA 4RIWB 5TF9A 3VUHA 4MKCA 2UZTA 3WE4A 4BZNA 1E1XA 3VS2A 3QGYA 2XBJA 4C3RA 3GCUA 4D4SA 4EHEA 3CQUA 1CTPE 3AT2A 2JFMA 4YHTA 4C58A 5AR3A 5AJQA 4DINA 4QMWA 3PXZA 4D2SA 2W99B 4Y73A 2QURA 3O50A 1SYKA 3OXTA 4EOSA 3R1SA 3F5XA 3ZO4A 2ZM1A 3NUPA 3DFAA 3LFQA 1IG1A 4K77A 3PA5A 1YDTE 4NCTC 4DH7A 1ZOEA 4DGMA 5KZIA 5IEXA 5KMJA 2ZYBA 5IQIA 3CLYA 4QQJA 3P4KA 3OCGA 2IVSA 2R3RA 2ZM4A 4Q2AA 2WMQA 4IJPA 1BKXA 4NFNA 3W1FA 2G1TA 1OL6A 5HO6A 2UZNA 3TACA 4XV3A 1KWPA 5CT7A 5A4CA 1EH4A 2HY81 4BCFA 2OXXA 3GC7A 4DC2A 5HZNA 4FEQA 5FXRA 4CLIA 3W18A 4C33A 4HGTA 1QPEA 4QMOA 1JLUE 1PHKA 3MY5A 2BZKB 3GEQA 4IH8A 5EG3A 4FX3A 3ZLXA 2WU7A 2X9FA 5J8IA 3VBYA 5JRSA 2QR7A 4B6LA 5HCYA 4C59A 4CZYB 5HTBA 1YDSE 3KRRA 1ZOGA 5C9CA 4TY1A 3M11A 4U6RA 3QAME 2AC3A 3JS2A 2CGVA 3WYYA 2WTDA 5CF5A 5KMKA 1WZYA 2WO6A 5LXMA 1CKIA 5LVNA 3R2BA 2WIHA 3FMHA 4FTJA 4IFGA 4M97A 5AR2A 4F9AA 2FSLX 4JXFA 4R77A 4IWPA 4D55A 4RJ3A 5F94A 5AP4A 5AIKA 3KXXA 3ODZX 2E9UA 1JPAA 4BDGA 4FMQA 3QD4A 1QL6A 4RIWA 4FTNA 4A9YA 2PL0A 4A7CA 5FEDA 2XJ2A 4L52A 3D2KA 3QTZA 1HOWA 3MA3A 4RIXB 1YRPA 4DGGA 1WBPA 4W4WA 5BUJA 2QKRA 1PRYA 5IH4A 3R7VA 4EQMA 2FO0A 2JKMA 2WELA 3ATSA 4EH4A 3O0GA 3FWQA 4AA5A 1APME 4C2VA 4UV0A 3PG1A 1OM1A 1YQJA 3QWJA 2C6MA 4HOKA 4JQ7A 5HG7A 4DEIA 4E4NA 2XVDA 4IX6A 3TIYA 5HE2A 3QL8A 3I1AA 3DXPA 4FTTA 3KF7A 4YHJA 2XH5A 3EMGA 3BZ3A 3LFEA 5AAFA 4C7TA 2UZWE 4Y8DA 2Y7JA 5E8XA 1OBGA 5HO8A 1Q3DA 2PMOX 2WQBA 1P14A 2BRHA 1IAJA 1U54A 5AR8A 5E1EA 4EJ7A 1W7HA 2F2UA 3U54A 3WF8A 3F2AA 3EZRA 1KE6A 3VULA 1GZ8A 3NW7A 3W2CA 4L46A 5L8JA 1VR2A 2WMBA 3ENMA 3R9DA 4W8DA 3BQCA 4KS7A 2I0HA 4PDSA 2YIQA 4NM0A 5AP5A 4MQ2A 2XF0A 5AEPA 3C7QA 3UZRA 4FK6A 4HGLA 4WBBB 5B2MA 4XG3A 1W84A 3AC3A 1OUKA 3CGFA 1GNGA 4PY1A 1V1KA 3LFCA 5E90A 4Z16A 3KXMA 3WI6A 5CF6A 4LL0A 4I5HA 1STCE 4OTRA 3EB0A 3RP9A 4EHVA 1FBNA 1ZYLA 4D2VA 4H39A 5HESA 1Q97A 2CKOA 2RFEA 1JSUA 1LEZA 2JDTA 2ERZE 3OW3A 4U7ZA 2LAVA 4FZFB 2EXCX 4DTAA 2PVRA 4ZY6A 1XQZA 4I21A 4YJOA 1M2RA 3M1SA 5ETAA 2H34A 4BWPA 3DGKA 4GT4A 4X3FB 4M69A 3E63A 2CJMA 2VTIA 2PVNA 5BX0A 4JDJA 4FNXA 5CF8A 3R1YA 2V55A 1PKGA 1URCA 3HKOA 4IADA 4XG2A 4ASZA 2R9SA 2XZSA 3RTPA 2VUWA 2WQNA 3PJ1A 1X8BA 3O8UA 3MVJA 2VTHA 4FBXA 2JDSA 3KL8A 1G8AA 2AC5A 1VZOA 4M66A 5HBJA 5M56A 4FODA 3EH9A 3A8XA 4TRLA 2W05A 3QU0A 4MK0A 4TWNA 4NW6A 3EQCA 4UZHA 3NYOA 3S95A 5IUHA 1FOTA 1H4LA 4M14A 2UVXA 5LJJA 5DYJA 2VGPA 3MDYA 4NUSA 4UB7A 2JKOA 3FZ1A 5CEIA 1Q24A 2R3KA 4AXAA 3N4VA 3FZOA 2YJSA 4LOPA 2B55A 3NUXA 4CV8A 3LZBA 2XRWA 4MHAA 1OKWA 3CD3A 3BE2A 3VC4A 4PUZA 4F6SA 4MD7E 3MH2A 3AGLA 3DA6A 4Q5EA 5FP6A 1F3MC 3P7BA 4L6QA 3UVRA 3OUKA 1E1VA 3SV0A 1ND4A 2PVYA 4GFMA 1KE7A 3D15A 4IVAA 1NA7A 4B0GA 4CRLA 5IA5A 3KK9A 3H0YA 5JGBA 1IA9A 4OAVB 4FV2A 4YBJA 2XNOA 2KTYA 3OFMA 2YIYA 3Q9ZA 3V5WA 1KV1A 2BKZA 4YJPA 4IC7A 5CEOA 3UQFA 4GVAA 3QZIA 3NYVA 2Z7QA 3E8NA 5TO8A 3MVHA 2Z7RA 2CCIA 2WB8A 4ANQA 4EH7A 3MWUA 1YOMA 5HX6A 4GYIA 2YN8A 4MYGA 4DEHA 4BBEA 2OJFE 2WQMA 3WF5A 2Q0NA 4FG7A 3EFKA 1O6YA 1F0QA 5I9XA 3DLSA 4DCAA 5CX9A 3Q53A 4CLJA 5IUIA 4WNOA 3P7AA 4EOQA 1R78A 4KUJA 4C37A 2BHEA 5K4IA 3FMKA 1GOLA 3UNJA 1O9UA 4O0TA 5HIDA 4AS0A 4F63A 4ZLZA 2DQ7X 5AP1A 4B9DA 5L3AA 2QO2A 1OKZA 4U3ZA 3EJ1A 5FTGA 4CVAA 3HP5A 2HWPA 4C0TA 4EOMA 4IDTA 3PVBA 5DIAA 3C0IA 2YLFA 3OY1A 4TT7A 3V8SA 3ERKA 3QTUA 3CGOA 2BFXA 3PRFA 4M8TA 5GIOE 2VWUA 4LL5A 2RG6A 4TW9A 4RBLA 3EQFA 5CSPA 4DBXA 3QTRA 3UE4A 4BKYA 4E1ZA 4C4JA 1WBTA 5EQYA 1G5SA 3L8VA 4OTGA 3ANRA 2WOUA 2X9EA 4LM5A 3ALNA 2BAJA 1BI8A 2F7ZE 2WEVA 4II5A 2WU6A 4WUAA 3S4QA 4J95A 3G0FA 3R30A 3I0OA 3FPQA 4RX5A 1CMKE 3ZSGA 4F1TA 2WQOA 2ZVAA 2CNVA 2CLXA 2VWBA 3A4PA 2I0YA 4FT3A 3FLYA 4PRJA 4EYJA 1FINA 3RI1A 4U3YA 3DAEA 4FVPA 5DRBA 3P0MA 2J0JA 5K5NA 1XBBA 3F5PA 4BF2A 3SRVB 3R7UA 2BROA 2ITTA 1ZYDA 4BDBA 4G2FA 4UMRA 3G6HA 3QYWA 4NKAA 5F95A 4ASDA 3HEGA 1WMKA 1GY3A 3VUGA 5AV0A 4AT4A 5CALA 4S34A 2P4IA 3BHTA 3CJGA 4FSQA 4BDCA 4ACGA 1RQQA 2QKWB 4FKJA 2JDOA 5EH0A 4QP2A 4TYJA 3NPCA 3BCEA 1H0WA 3EYHA 2OF4A 3D7TA 3F3VA 2BUJA 3HV4A 3RAKA 4BCNA 4APCA 3Q4UA 3KA0A 1ZXEA 3LIJA 4QPMA 3UO4A 3EHAA 3F9NA 4KSPA 4TWCA 2JC6A 4CZTA 4D2TA 4F64A 4XG9A 5EYCA 5L4QA 1YHVA 3U4WA 2XKFA 4LMUA 2A27A 3AD5A 4AZSA 5BMSA 4NIFA 4O0WA 3LOKA 4RJ5A 4G6LA 4GT3A 3QUEA 3VF8A 2RG5A 4LOQA 2UW0A 3CTJA 1TQPA 4FIJA 4QPSA 4YC6A 4BBFA 1W83A 4R1YA 5CU3A 5BUIA 1BMKA 4HNIA 3QALE 2ITWA 3NYNA 1O6KA 2I6LA 4KB8A 1WBVA 4RX8A 4HVSA 5M51A 2EXMA 5AFVA 4C38A 5H3QA 4BY9E 5AX3A 5HIBA 2XK3A 5M09A 3E7VA 1LP4A 4QMYA 2FVDA 4IJ9A 3EIDA 4LRKA 2P3GX 2GNIA 3ZZEA 4YJQA 4BCPA 2V5QA 4DA5A 5E91A 2IVUA 2ITOA 3BELA 2ONLA 3VS0A 2ZV8A 5EKNA 5IQHA 4RX9A 4D2WA 4Q5HA 2X2LA 4IM2A 3KEXA 4F9WA 2HENA 3BLRA 3R73A 5CQWA 3R8PA 5BVKA 4CMOA 1M52A 3QCQA 2WAJA 1KE9A 3QZGA 3MW1A 4YP8A 5A4QA 2VO6A 4WG4A 2Y6OA 2QLQA 3PIYA 3GC9A 1U5RA 2OF2A 2EB3A 4K2RA 3LFAA 5IMEA 5IH6A 3WZUA 4QP9A 1GZNA 4AU8A 2Z2WA 1YXXA 3E62A 5DR6A 5ACBC 3DFCB 2H8HA 4BZDA 3DU8A 4C02A 3DDQA 5E8ZA 4YZBA 4IAAA 4YZNA 4PQNA 2QC6A 3OMVA 3R04A 1GAGA 1AGWA 2RL5A 5CEMA 2C3LA 5L6WL 4C61A 4FEXA 2RF9A 4I6HA 4AW0A 2E9OA 2PK9A 4FV1A 5M4FA 4ANMA 1OIYA 3UC4A 4AOJA 3BYSA 3R9NA 2FGIA 4H1MA 4X3FC 3PVGA 3V8TA 4U44A 4MX9A 2GFCA 2PULA 3TUBA 3G15A 5LARA 2C0OA 4NK9A 3NUYA 3LFFA 1YXTA 4WBOA 1H8FA 1PJKA 3QXPA 4RT7A 4AT3A 3MIAA 4FTRA 4YMJA 1YWRA 4X6QC 3TZ8A 3EN7A 1R3CA 2ITQA 1V0BA 4LUDA 1H1SA 2ITYA 4BZOA 2CKQA 4DLIA 5L8LA 5BYLA 3NAYA 4L00A 2B52A 3F6XA 3SW7A 4Y83A 4ZTQA 3QLGA 2GSFA 3ZO2A 3IDCA 3LCKA 5IA2A 5DPVA 3UBDA 1CDKA 4EHGA 1YVJA 4C8BA 2X7OA 4F70A 5FM2A 2DYLA 4RIYA 3BHUA 4TPTA 5CSVA 2CMWA 5LMBA 3D94A 4W4XA 5CZIA 5HVYA 1SNXA 4QQTA 4G5JA 4V05A 4DFNA 4AE6A 5JH6A 2ESMA 3WIGA 2G15A 4CEGA 5JZJA 5H8EA 3FMNA 4IZYA 5EKOA 3P78A 5BPYA 1Q8TA 4E6QA 3V04A 4YZMA 2XB7A 4IHPA 2ITPA 2C69A 3ZC6A 1OIRA 2PE1A 2B9IA 2O0UA 3IGOA 2ZM3A 3R01A 3FY2A 5A14A 3BE9A 2C6OA 3OCTA 4IAZA 1ZMVA 1FGKA 3TUDA 2X8EA 3OP5A 4X2FA 4KWPA 3U55A 2GS2A 3Q52A 4G9RA 3IQ7A 3KRWA 3RPOA 4PMTA 2YM8A 3FC1X 2YZAA 4X21A 1IAHA 5IQEA 4M0ZA 5FG8A 3A2CA 3E8EA 4QT1A 5AR5A 1Y6BA 4FT7A 1M7QA 3QTWA 2C6DA 3BYOA 3CP9A 5IA1A 1J1BA 2F9GA 4NL0A 1UA2A 4PPAA 3AC8A 2ZDTA 5EI2A 3R63A 4OTPA 4IDVA 5IH5A 1M2QA 3S0OA 4CFMA 2IWIA 3EQPA 1XBAA 2PVKA 3RMFA 4C4GA 1Q41A 3OTVA 2XNMA 3GOKA 1J7UA 4N4SA 4AX8A 3Q9WA 4RPVA 1IEPA 3EN5A 3AT3A 4ZTNA 4HVIA 1W82A 4QYFA 3TCPA 1M7NA 4TZRA 4E20A 1OL5A 4XX9A 4AZEA 4AA4A 1VYWA 5EDQA 3VS7A 4YR8A 4GKHA 2CNQA 4DFUA 2GNHA 3MS9A 3KMUA 3Q04A 3A99A 3MB6A 2X8DA 4P2KA 3FXZA 4MXZA 3T3VA 3FUPA 1SVEA 4U45A 3AOXA 1WBNA 4RRVA 4E4MA 3L9MA 4OAUC 4BCJA 3BLHA 1LEWA 3OF0A 5A54A 3ITZA 3LM5A 3LQ8A 3O7LB 5AX9A 2J51A 5FD2A 3PJ8A 3ORIA 2W7XA 2NRUA 4EHZA 4H05A 4TYIA 5HGIA 4O21A 4D4RA 3ZBFA 4IE9A 3QUDA 3JYAA 3ULZA 4EEVA 4ZIMA 2IJMA 4JG7A 1QCFA 4FIHA 4N6ZA 4ITIA 3SG9A 2BPMA 2W5AA 1PMEA 3VS5A 4G6NA 3P7CA 3KN6A 3UPXA 4D4VA 3UOJA 2WMAA 4UMQA 3C1XA 3UMXA 3NMUF 2X8IA 3LMGA 4Q9SA 3RM6A 4RFZA 4FTMA 4O0XA 2O63A 1YXUA 1JKLA 4FG9A 5A4LA 3DXQA 2YABA 4DFLA 3AXWA 5CT0A 3U6IA 1Q8WA 2ETRA 1MUOA 3O71A 2A4LA 4FSTA 3T8OA 1JOWB 4A9UA 2RKUA 3D9VA 3RHXA 1KOBA 2WTVA 4UYNA 4YJRA 3QTQA 3PXFA 2C5XA 2UUEA 4PDPA 4R7BA 2UVZA 1KE5A 5EOLA 2XKCA 3AT4A 3A60A 4O84A 4NCTA 5EHOA 3OC1A 3BI6A 2F2CB 3O7LD 1I44A 4FKVA 4F65A 3CY2A 5GZ8A 2GCDA 1XH5A 4DITA 3PJ2A 4FSMA 2R4BA 1Q8ZA 4ANNA 3HDMA 3OCSA 3QLFA 4LOOA 3W2OA 5AAGA 3IONA 3DY7A 5HE0A 1KUTA 2ERKA 2X0GA 3TNHA 2XUUA 4W4YA 4RG0A 1SMHA 3NNXA 2YZLA 2BZJA 3M42A 4FKLA 2W17A 4AWIA 3KULB 3Q6WA 3QQGA 5ANGA 3IW7A 4Y5QA 3PUPA 4FT0A 2WKMA 3ORTA 4NYEA 2GNFA 4ZJIA 3QZHA 4XV1A 3LVPA 4GU9A 5AP6A 5C4KA 3AD6A 5L2TA 3JVRA 3QHRA 5IUGA 3CXWA 3KU2A 5FTQA 4XG7A 3G9LX 3ORXA 4JDIA 2UZVA 5AR4A 5DR2A 4ZSLA 2J50A 4O83A 4GV1A 3VIDA 3TEIA 5C4LA 4GSBA 4JR7A 2JAMA 4PX6A 2C30A 2XP2A 3DBCA 3V5LA 4AP7A 1R0EA 2RSVA 2W5BA 3F2NA 3FDNA 1XKKA 3OT3A 2QU5A 2WEIA 3I0QA 5BVWA 3R28A 2P55A 3PY1A 4E93A 1ZARA 1YOLA 4MCVA 4CKJA 3SVVA 2ZB0A 3ZHPC 3IW4A 5IA3A 2Z7LA 3LJ0A 4DH8A 4FR4A 3R7GA 2HK5A 2YM7A 5C8KA 2C47A 3Q6UA 2UZLA 2Y4IB 3CPCA 4FC0A 1V0OA 3C0HA 3K5UA 4RJ7A 5JKGA 5FRIA 2BAQA 2OICA 3E88A 3LAUA 3PXQA 4AT5A 5L8KA 2VTQA 3R1QA 1P4OA 2J6MA 3A7GA 4ZK5A 2VTTA 5EQPA 5CI7A 3MH0A 1RE8A 2JLDA 1BLXA 4CQGA 4UBAA 1UWJA 3LJ2A 3COHA 3KCKA 4IANA 4YSJA 1YW2A 3V5TA 3MESA 1ZOHA 5BUEA 4A4XA 2J0IA 2JIVA 2O64A 2PZPA 4IEBA 3R9RA 3PWYA 1JBPE 3EKNA 4D2PA 1ZZ2A 3KULA 2YCRA 2ZMCA 4YPDA 2WIPA 2B53A 4L67A 4O0YA 2J9MA 3TUCA 5IQGA 4ZJJA 5C1QB 3FLZA 2J4ZA 1MQBA 4FA2A 4EQCA 1WAKA 3DLZA 1WBSA 5L6PA 4J98A 4O22A 1DM2A 4TNDA 3OWPA 3WZEA 3CCNA 3VN9A 2HY0A 3C4FA 4I94A 4S2ZA 3G9NA 5FEQA 4JG6A 5HEZA 5HVJA 3DK7A 3MA6A 4PTCA 4BIEA 4FI1A 4JRVA 4B7TA 3SXRA 2A0CX 4G34A 5AUUA 3UQGA 1YHSA 3F5UA 4G3FA 3VHEA 2BIKB 3EYGA 3PY0A 4LGHA 5AP3A 2GPHA 3R1NA 4YJTA 5KHXA 4KS8A 3EN4A 4BHZA 4DEDA 2ZMDA 4O27B 4BGQA 1NVSA 2HCKA 1URWA 2QLUA 5IPJA 5T3QA 4BGGA 3VVHA 3BWFA 2W4JA 4KKGA 3ZUTA 5L2SA 4L42A 3MV5A 4FL2A 3BHVA 3OTUA 3ZO1A 5HLPA 4ONAA 3TJCA 2PZ5A 3RKBA 4EBVA 4RA5A 5DG5A 2W1HA 2IG7A 4V0GB 4A9RA 3RJCA 3CQEA 5FUTA 4IM3A 4AG8A 3E87A 4U79A 1J91A 1ZYSA 3HV7A 3KB7A 1BI7A 4WRSA 3GC8A 5DOSA 3OCBA 4FTAA 4CTCA 4GFGA 4IZ5A 4QMUA 3LCOA 4JIAA 3GU6A 4YBKA 2WTWA 5CAQA 4RQVA 4DT9A 4XRJA 3T9IA 2WOTA 4OBPA 4BI0A 5I9WA 3LXPA 3KC3A 2WHBA 5CU4A 2PZYA 5JN2A 4AN9A 2PTKA 4OTWA 4PNKA 4M15A 4XNEA 4QYYA 3KMMA 2JEDA 5JFVA 4D1SA 3NEWA 4ZSAA 4K0YA 1UU9A 1S9IA 2YM3A 4O1PA 4QMSA 4GJ3A 1XH4A 5AM6A 3V5PA 1J7LA 5TT7A 4U40A 4E3CA 5J9LA 4KINA 4E5AX 4TXCA 2CHLA 2EXEA 3QQLA 3I6WA 1JSTA 2QOCA 4AGDA 3EN6A 1FMOE 4LQMA 4TYEA 2ZV9A 4CFXA 4ZLYA 1PMNA 5K0KA 2HELA 1MRUA 4BCIA 3S1HA 3B2TA 3GU7A 4ALVA 3EFWA 4YLJA 4BICA 1QPJA 2VWXA 3TJDA 3KREA 3CS9A 5CNNA 4WRGA 2XJ1A 4L3LA 3EQGA 4XLIA 1NT2A 4XBUA 3C5IA 2QQ7A 3O8TA 3NCGA 4FT9A 4BTJA 3UG2A 4CTBA 4BL1A 2R3LA 4G6OA 3W2SA 1DI8A 1OL7A 2YIWA 2YIXA 4ZZMA 2VWYA 4ENYA 1GIJA 5M53A 3R7EA 5I9UA 3TDVA 5DA3A 4C3PA 4IB3A 3QX2A 5I5ZA 5CF4A 5IEYA 2QHMA 4BCGA 1I09A 3FSKA 4ZZNA 1J3HA 3TV7A 3QD3A 1Z5MA 3UP7A 3FMEA 5KMIA 2XIZA 1PXLA 4MF1A 3P1AA 4I0SA 4LG4A 3FV8A 4PL5A 3BU5A 4OGRA 4EOOA 3PXKA 4I6BA 5CSXA 4BCQA 2XJ0A 4N70A 5LCKA 5K9IA 3ZM9A 4O2PA 2WXVA 3BGPA 4AE9A 4ALWA 1PXOA 1TQIA 1BUHA 2W0JA 3QRTA 3A7IA 3QC9A 4O7LA 4BWXA 3QQJA 4WA9A 3GENA 5A46A 5JFWA 3FLQA 5B2LA 4RC4A 2PMLX 3ET7A 4C3FA 4WKQA 4MH7A 4CMUA 3DZOA 4IB5A 4WT6A 3O23A 4IXPA 4FKPA 4ZTRA 3E64A 4H58A 4PTEA 5BNJA 4GG7A 3RWPA 2XNPA 3WIKA 5HOAA 5AP0A 4UMPA 3DB8A 4FF8A 2VU3A 4DN5A 1QPCA 4FIFA 5LMKC 3UP2A 4F99A 4NW5A 2VRXA 3ZSIA 4L3PA 2GQRA 3SKCA 2J0KA 5E4HA 4RJ6A 2OIQA 3NIEA 1SVHA 5TE0A 3A4OX 5FGKA 2F57A 3KF4A 4EC8A 3NSZA 5ANKA 3FAAA 5CU2A 5EHYA 3C51A 4BI2A 3PLAE 1VJYA 5EOBA 5HVKA 4EYMA 4USDA 2VZ6A 3GU5A 4QMTA 3QKKA 5EM6A 5HBEA 2C3KA 3I6UA 4FKUA 3V3VA 2UW4A 3QRKA 4MVFA 5C27A 4EKLA 2BILB 2QHNA 3LM0A 3FJQE 5I3RA 3W2QA 4FZDB 2IZUA 2QU6A 4R6VA 4KIOA 5HICA 2P2HA 1AQ1A 4FTOA 3R2YA 3DJ5A 2X1NA 4FSZA 3MVLA 4RIXA 5BVEA 2BRNA 2ETKA 2WMSA 2H9VA 3CJFA 3D5UA 5JRQA 5LOHA 3RHKA 4YZ9A 4E6CA 3R83A 4JAIA 4PMMA 2CGWA 5KMOA 3ZFXA 4DEAA 2C3IB 1JSVA 2Y4IC 3Q60A 3OOGA 4QP1A 3RK9A 3F88A 5J9YA 1NVRA 5AV3A 2GNGA 4CSVA 2F7XE 1M14A 4DEGA 3MY1A 3PZEA 3FHIA 2BMCA 3IKAA 2AYPA 4X2GA 4XG6A 5B2KA 4F0IA 4BFMA 3C4XA 4D4YA 4AFEA 5FXSA 4C34A 4EOJA 5HCXA 5ANEA 1H08A 4QTDA 2IO6A 2XBAA 1KE8A 2WZJA 3R7OA 1ZMWA 4BTKA 3PIXA 4UY9A 3RPYA 3V01A 4X6RA 3HA6A 5IDNA 3BEAA 4EH2A 4RMZA 3L9LA 2GS6A 4XG8A 3OUNB 2QOKA 3TKIA 3CE3A 3RK5A 2IN6A 4U8ZA 1PXPA 2P33A 5CVGA 4BKZA 3RAWA 2VTPA 3TL8A 2WNTA 2BKKA 5A6OA 3IW6A 3HECA 1TKIA 3BKBA 3GU8A 2W1IA 5AA9A 5HBHA 3BYMA 2CLQA 4L68A 4FSNA 2W1ZA 4QP3A 2XA4A 2GQSA 2NO3A 5EDPA 3R02A 3WZKA 3KKVA 3LCSA 4PPCA 2QOBA 3FLWA 4WOVA 5EK7A 3VBWA 2B4SB 3A7FA 3AC5A 4XG4A 3ALOA 3MPAA 3AMAA 4TTHB 3LFNA 4W9XA 4X3FA 3R7IA 5BYZA 4AW2A 4FL1A 5LMAA 4CQEA 3JVSA 4QMZA 5HNIX 3I79A 3VBXA 1CSNA 4ORKA 4PL3A 3K54A 2EU9A 3E5AA 4XP3A 2C3JA 1JWHA 3KCFA 4I5CA 4NJDA 4RX7A 4IAYA 2YM5A 5EHLA 4QMXA 4YLLA 1KSWA 5ANOA 5EW8A 5HQ0A 4FV6A 4JQ8A 3UYSA 2X7FA 4D9TA 5K0XA 3CPBA 4O7YA 4NTTA 4FNWA 4MNEB 3OY3A 4O96A 5H9BA 4FSRA 4CCUA 3VJNA 1YXSA 3FSFA 4MXAA 5HE1A 3WILA 3D83A 3UG1A 1ZRZA 3P86A 4XOYA 5KE0A 2ITZA 4BCMA 4FKOA 4HCVA 4F7NA 5AADA 4IWOA 2GNLA 4QTCA 3PPKA 3ORZA 3ZXTA 4KKEA 5HG5A 3V6SA 4ZP5A 4S30A 2PE2A 3T9TA 3ACKA 3RAIA 2OSCA 3UGCA 3FYKX 3Q96A 4CG9A 1P5EA 4CNHA 1PYXA 3B8QA 3LXKA 3DKOA 3POZA 3BYVA 4GK2A 1Z57A 3K3JA 2WMUA 4BTMA 4DF3A 3BEGA 3TIZA 4G3EA 2JITA 1P4FA 5E8YA 3FI2A 3UMWA 3PDTA 2XIKA 3MI9A 2ZV2A 3R21A 4USEA 4YTHA 3DZQA 4NJ3A 2XM9A 3TTIA 3DT1A 1CM8A
chains in the Genus database with same CATH superfamily
2YDJA 3MIYA 4FICA 3BRBA 4I0TA 4R5SA 5DBXA 3FZPA 4EH3A 2WPAA 3VBVA 1QMZA 3QRUA 4NM3A 4F4PA 3RVGA 4IZ7A 4FKQA 3VWAA 2BDFA 4BR3A 2IPXA 5AR7A 3RCDA 1RDQE 3U9CA 1GJOA 4IB0A 3VQHA 4AW1A 3UZTA 5H8BA 2CGUA 5CU6A 4ZOGA 4L53A 3Q5IA 3ORPA 2YACA 3KRXA 3ZEPA 4DLJA 1OI9A 4ZSGA 5BMMA 3TTJA 5M57A 4DFYA 4O4FA 4N57A 2YDKA 2XIRA 4QMPA 4I4FA 4WSYA 3UPZA 4IC8A 4E7WA 4UMUA 4YURA 2PMNX 5IQDA 2W4KA 4XOZA 5FBNC 2EB2A 5BQ0A 4K1BA 4MXCA 3PWDA 4CKIA 3VS4A 4M3QA 5M07A 4IVBA 3D5WA 3L8PA 4ZTHA 4ACCA 2E2BA 2XM8A 3QQKA 4O6LA 3D5XA 3TZMA 1H28A 3EQBA 4NSTA 3UVPA 3GQIA 3LMHA 1BL7A 3SQQA 3KGAA 2YWPA 3G6GA 4G3GA 4AF3A 3MPTA 4CFFA 3DXNA 1FVVA 4EZ7A 4QP6A 3U87A 1H1QA 4EZ5A 4O91A 5GHVA 3VUKA 1UU7A 3VS6A 2OIDA 4YU2A 3V6RA 3AC1A 4BCHA 4AZVA 3SRVA 3KVWA 5GNKA 5D7AA 4BTFA 1Q4LA 3MBLA 4C4EA 4YTCA 1R0PA 5CXZA 1Y91A 1ATPE 3OBGA 1OBDA 1H07A 3F3WA 4FNZA 4PTGA 3U51A 4E6DA 2IW6A 4HJOA 4RWIA 3UDBA 4JI9A 3ZSHA 1XO2B 2C6EA 2JD5A 2I0EA 4NTSA 1ZYJA 3AMBA 4EH5A 3NR9A 2UW9A 3KFAA 5ACKA 3PYYA 4BKJA 3BU6A 2O65A 3Q4CA 3COKA 3AC2A 1M2PA 1B6CB 1PW2A 1WBWA 4UX9A 1Q3WA 5CENA 4I92A 3RPSA 3IOKA 3I4BA 5A3XA 5KCVA 4FIEA 4O82A 2OJ9A 3Q4ZA 3UJGA 4ZY5A 3TYKA 2I40A 4O7NA 3R8ZA 3A8WA 4A07A 4FV4A 3EQHA 5F20A 3R8MA 2QG5A 4YJUA 3KMWA 3VS1A 1T45A 2HAKA 2W5HA 2XK4A 4CFWA 4GFOA 2HIWA 4E5BA 1SVGA 3BGQA 1WCCA 1H26A 4LGDA 4TKSA 2ZFYA 3H9RA 5HD7A 5E8VA 4DTBA 1BX6A 2OJGA 3ACJA 4X3JA 2GMXA 3ORNA 1XBCA 3SHEA 5HU9A 2R7BA 2YAKA 3Q3BA 5HX8A 3TZ9A 3JUHA 2DWBA 2F49A 4A06A 4TYHB 2R3NA 3NDMA 4AACA 2O3PA 2Z60A 3EQDA 4XS2A 3DTWA 3GFEA 5I3OA 4PP7A 5G1XA 4AGCA 1R39A 1T46A 2J0MB 3OG7A 4D2RA 1GZKA 4U80A 4I41A 4WG3A 3RNIA 3UIXA 2J0LA 3CC6A 4KIKB 2YERA 3ZRKA 4QEBA 4WO5A 4TYGA 4M67A 4IX3A 5FM3A 4FYNA 2B9HA 3FLNC 2C6IA 5FDPA 1OPLA 2OFUA 3CEKA 1NY3A 3PLSA 2BVAA 2WTIA 3LW0A 3PE1A 4OW8A 2QOHA 3QD2B 4Z9LA 5IG1A 2VTRA 4RVTA 4GIIA 4PWNA 1UNLA 1UNHA 3CR0A 2RIOA 2VX1A 3KVXA 4HZRA 4APPA 2AEGA 2CKEA 3FKOA 1TQMA 4RQKA 3PSCA 1XMLA 3DOGA 1A9UA 3OROA 5LVLA 2XMYA 3QCSA 3BLQA 4R8QA 4ZS0A 4BJJA 5C8NA 4HGSA 5M44A 1OB3A 4GJ2A 1XMMA 4IACA 2HW7A 3BV3A 4FV7A 3SXSA 5HU3A 1Q5KA 5JK3A 4QNYA 2YCQA 4IVCA 3DCVA 4CD0A 2XIXA 3PA3A 3O96A 1Q99A 3MY0A 3OVVA 5GIPE 2IW9A 1BYGA 3DJ6A 3IW8A 4ZZOA 2OJIA 3FXWA 4BDDA 4YUQA 5LCJA 2PYWA 3L8SA 3PA4A 5FLFA 4CXAA 1LUFA 4O7RA 1OUYA 4DDIA 2ZJWA 4DBNA 3D2IA 3SGCA 4BDAA 1OPKA 3C4WA 4XBRA 1PXKA 4XP0A 1E9HA 2BRMA 2PVLA 3VO3A 3L9PA 2ITNA 4LMNA 3A7HA 4XCUA 2OU7A 4IM0A 3UOHA 4O81A 2R2PA 3FKNA 3R00A 2OXDA 3Q2JA 4M0YA 5E92A 3CTQA 4TNBA 4MF0A 4F9CA 5M4IA 4QD6A 3OBJA 4ITJA 2OJJA 2PVJA 3WF6A 3ZONA 3TV4A 4W4VA 4Y72A 3P08A 4CYJA 4JBOA 3Q4TA 3TMOA 3PVUA 5ETIA 5I9YA 4FVRA 3PXRA 4GYGA 4FZAB 4BRXA 4EI4A 3UNZA 4W8EA 2X2MA 3HRFA 4YC3A 2B9JA 5EYDA 4M7IA 2UW3A 3UIBA 3BBTB 5TKDA 4UXQA 2YM6A 3A7JA 5KMLA 5GJGA 3LE6A 4YJNA 3ZDUA 2XNGA 2YITA 2PE0A 3O8PA 5D12A 5ANJA 4ZMEA 3H10A 3NS9A 3H9OA 4JS8A 2ZV7A 5IZFA 3FY0A 2W1DA 5DGZA 2QCSA 4ZLOA 2EVAA 4L8MA 1W2DA 2W9ZB 3LCDA 4C2WA 4CFVA 4CG8A 2VWVA 3DTCA 2QOFA 2UW7A 1PKDA 4UYAA 3RK7A 3VRZA 2XNBA 2IZTA 2V22A 3HGKA 4LRJA 5CQUA 2BDWA 3FBVA 4AN2A 5GJDA 3UIUA 4DGLC 4ASXA 3F3TA 2O8YA 5EDRA 3LFDA 1YKRA 2V7AA 4RWJA 3OT8A 1PXJA 1SNUA 2ZOQA 5CVFA 1ZZLA 4CYIA 1NW1A 4QNAA 5EYKA 5E9EA 5AUYA 4LGGA 3U4UA 4NKSA 2G2FA 4GW8A 2Z02A 4AUAA 4C4FA 2YFXA 4UWBA 1CKJA 3BHYA 4I22A 4DEBA 4OR5A 1JQHA 4HZSA 4ERWA 3SLSA 3H0ZA 3MTFA 2DUVA 3GT8A 2OIBA 3MFTA 4LRMA 1WBOA 5D7VA 1H1WA 2SRCA 2V7OA 4WG5A 4JBVA 4B99A 5KBQA 1PMUA 1MP8A 3BGZA 3FPMA 5EM7A 4XEYA 4BDIA 4OUCA 3ZUUA 4DH5A 2XCKA 3AC4A 3U6HA 2JAVA 2HXLA 3ZEWA 3EQIA 4G5PA 1XH9A 1ZMUA 4L01A 4BB4A 4GS6A 5DT4A 1RW8A 3NCZA 4NWMA 4BBMA 3EKKA 2IZRA 3NGAA 4WUNA 3ROYA 4WNKA 3V8WA 3HDNA 3QWKA 2VWIA 3RZFA 3MGYA 3NWWA 4G16A 3ZRMA 4AW5A 4C57A 1OIQA 2VD5A 1ZAOA 1U59A 2GTNA 4HPTE 3G2FA 3GQLA 4ANBA 2B7AA 4QMMA 3QA8A 4DFBA 1IRKA 5DNRA 2WMRA 3GXLA 3LMIA 3SD0A 2Q83A 4KBKA 5IU2A 2PWLA 2R5TA 5L2IA 5ICPA 2QOLA 1UKHA 4JL9A 3EQRA 4RZVA 4DH1A 4U97A 4E4XA 5JGDA 2GNJA 4IQ6A 2FH9A 1YWNA 2R64A 5GZAA 4YO4A 4QQ5A 3W2PA 3SC1A 3VBTA 2C68A 5D1JA 4BDJA 5IQBA 3QX4A 4JBQA 5TOZA 1K9AA 2A19B 3OXZA 3P79A 5CASA 4MQ1A 3Q2MA 4I5MA 4D1XA 3BV2A 3PSBA 5CAOA 4O7TA 3S00A 1UWHA 1YHWA 4XV2A 3VUMA 4FEWA 5DMZA 3QUPA 1VEBA 4USFA 5GINE 2OZOA 3D4QA 4JBPA 4NZWB 4PNIA 2R3PA 4IFCA 5LMKA 1DAWA 1H27A 4RLLA 1GZOA 3W16A 4E6AA 4IMYA 3FQHA 3DK3A 5KUPA 4QMLA 5JMSA 3NUSA 3D5VA 3SOAA 3ZMMA 5DWRA 3TNQB 1U46A 4KSQA 3V5QA 2HZNA 4JJRA 3N4UA 3F69A 5JQ8A 4FOCA 4PMPA 2GU8A 4MTAA 3TM0A 3E92A 2G2HA 3MJ2A 3ID6C 3BU3A 4P4CA 5M4CA 3WF7A 2FSTX 4J53A 2I1MA 2XCHA 2UZDA 4DHJA 2YCFA 3GI3A 5E8UA 3QD0A 2C0TA 2V0DA 3QTXA 5IA0A 3ELJA 3MPMA 4M68A 3T3UA 5T68A 2VTSA 3C5UA 2JGZA 5HTIA 3IDPA 2JDVA 3PTGA 5HNBA 4FVQA 2J2IB 4C62A 3TZ7A 4U0IA 1S9JA 2ETMA 2ZB1A 5AA8A 4FGBA 3R8UA 2G2IA 4RZWA 3SX9A 3WBLA 4EUTA 1OMWA 4F0GA 5C26A 3DV3A 4QOXA 4ZMFA 4QYHA 1OECA 5E8SA 5BYYA 4GCJA 2IZSA 3K2LA 4OBQA 3FL5A 5ANIA 4KBCA 5CAVA 3CD8A 1BL6A 3G51A 4O7ZA 3A62A 4KIPA 4A4LA 3DK6A 2YA9A 4DEEA 4O7VA 2J7TA 3K5VA 3R9OA 3UODA 3FC2A 3RAHA 1ERKA 2OH0E 3NYXA 3C0GA 4U5JA 4OTIA 3GUBA 5AMNA 4UWYA 5HNGA 3PPJA 1PXMA 1Y8YA 3PSDA 4YNOA 4ZTMA 3FI8A 4JNWA 4JQEA 4AXDA 1WVXA 4O0RA 3HA8A 4RGJA 3WARA 4EOPA 4RJ4A 5EYMA 2R3MA 5CVHA 3VW6A 3WF9A 3L8XA 1H1RA 3FL4A 5HORA 3KN5A 5K5XA 1XH7A 2I0VA 4HCUA 4I1ZA 4J99A 4U43A 3WZDA 3DQXA 1MRYA 2VV9A 4A9SA 4BIDA 2OI4X 2BR1A 4Z7GA 4ZAUA 1OZ1A 3UQCA 4BGHA 4UZDA 2WD1A 2XK7A 5D9HA 5C01A 2AUHA 4QRCA 2JIUA 3MH3A 4QYGA 2JDRA 2OFVA 2ITUA 4YLKA 1OL2A 3PP0A 4IWDA 4AQKA 4GMYA 5TR6A 3R6XA 3ZU7A 1Q62A 4FKSA 4R7HA 5AUWA 1U54B 5AUXA 5HG8A 4GK3A 3ZRLA 4AN3A 3AG9A 3DS6A 5AUTA 2I7QA 3VRYA 4AOTA 4FYOA 4D0XA 3NLBA 4HNFA 3VQUA 3HMMA 3OOMA 4M84A 2PSQA 4PMSA 4ERKA 4E26A 4O0VA 4V0GA 3ZH8A 5LVOA 4O0UA 3ENHA 5E8TA 5FEEA 3B2WA 2W1GA 4V01A 2BHHA 4Y95A 2VX3A 3MYGA 5IA4A 4FKIA 2X7GA 2PVHA 2UW6A 3FZSA 4FSWA 4F6UA 3BWJA 4X2NA 1PYEA 3BL7A 2FA2A 4X7QA 5J7HA 2G01A 3ZFMA 2QODA 3OWLA 3F5GA 4JT3A 1UU3A 3QGWA 4J52A 3OXIA 4NEUA 2WTCA 4RFYA 4WNPA 2C1BA 4F78A 2GTMA 4F0FA 5D10A 2LGCA 3QQFA 5BVOA 4FT5A 1DI9A 2R3QA 4KRCA 4MXOA 4LYNA 4DYMA 4L44A 3QHWA 3BQRA 4FK3A 3FI4A 1H01A 3EN9A 4NU1A 3W8QA 1MQ4A 2E9NA 4FV3A 3VNTA 3AQVA 4RWLA 2R3HA 2YEXA 5KBRA 4Z7HA 4TWPA 4L7SA 4M69B 3EFLA 5AP7A 3PPZA 4ZXTA 4DFXE 2A2AA 2ITVA 3E8CA 5AM7A 4EH8A 5DI1A 4CFNA 2VO0A 3PRIA 3FMJA 3M2WA 3QF9A 3U8WA 1B39A 2Z8CA 1TFFA 3SOCA 2PPQA 2YLEA 4NFMA 4QYEA 2B54A 2ZDUA 4FTLA 5EW3A 3W10A 4QP8A 3GFWA 2X81A 2YIRA 3F3ZA 3GCPA 5DT0A 3KXHA 3PJ3A 4YTFA 1L8TA 2XNNA 4IZAA 4IWQA 4DGOA 3DKCA 5JGAA 4FV8A 5K4JA 1YWVA 5HE3A 4RC3A 4P5QA 2H6DA 2WFYA 2C6KA 4WSQA 1OPJA 1VYZA 5I0BA 4JMQA 3FMMA 4EL9A 3G5DA 4QMNA 5CSWA 3LXNA 1XWSA 3ZLSA 1HCKA 4J96A 2WTKB 5CEQA 4AFJA 2PVFA 4RWKA 5FXQA 5ITAA 3FEGA 2XAMA 4JDHA 5J9ZA 3RZBA 5AP2A 2VWWA 4ACMA 1JAMA 4HVDA 4EORA 1Q8YA 1B38A 3HUCA 5J79A 3NUUA 3AKLA 2VTNA 1OIUA 2JFLA 2QR8A 4PDOA 2W1CA 4BDHA 5EI6A 3S3IA 3VBQA 3MFUA 4ZSEA 2QOOA 3HV3A 4GIHA 4CMTA 1OL1A 2UVYA 1W0XC 2C4GA 3SA0A 3CKXA 3I7CA 3R22A 4BI1A 5CU0A 2H96A 3NNVA 2X39A 3IECA 3L1SA 3NAXA 4RLKA 1FMKA 3OW4A 4ANOA 4D58A 4G1WA 2QVSE 4ZSJA 3EZVA 4K6ZA 1K2PA 2BZIB 3UIMA 4UWCA 4ZEGA 2CKPA 4H36A 1CKPA 3HAMA 4BHNA 4K11A 4PPBA 3THBA 4YJVA 4HVHA 2WMWA 2VTOA 3BYUA 3FZTA 4E4LA 3HMOA 1R1WA 4KIQA 3TKUA 3H4JA 3GCSA 3I60A 3GGFA 2HXQA 2YISA 4FTUA 4BCOA 3OD6X 2Y8OA 1YI6A 5B0XA 4PDYA 4WIHA 2X0PA 5HD4A 4FZ6A 4O4CA 2XIYA 3N4TA 2GHGA 3PJCA 3UO6A 2VN9A 2GHLA 3VW8A 4EWHA 4EH6A 3RBWA 2QOQA 3C4CA 1JKTA 3NRMA 2WGJA 4O1OA 5I9VA 3AKJA 3TNIA 4AXEA 2OG8A 3LFSA 3TV6A 4MWIA 4G3DA 3U9NA 4M13A 3HLLA 3VAPA 3H9FA 4YTIA 1GIIA 4HYIA 4OTFA 5HTCA 3RINA 4KAOA 3E93A 2VGOA 4GU6A 2Y4PA 5JT2A 3HRBA 2C5OA 4C4HA 3FQEA 4J1RA 4CRSA 2FUMA 5CAPA 3AMYA 3R9HA 4KRDA 4BYIA 2Q0BA 4EUUA 4QMVA 4KD1A 4I0RA 4GEOA 5F9EA 1UU8A 4O0SA 4I6QA 1OGUA 3VUDA 2UW8A 3KXZA 4RFMA 3W8LA 2WMTA 4HPUE 4MWHA 5DEWA 2OXYA 3F82A 4EH9A 2ZAZA 3QQHA 4J7BA 3ZUVA 2BZHB 4AZWA 2PUIA 2YWVA 3HVCA 4DG0E 4S33A 1GIHA 1ZY4A 4LFIA 2GHMA 2GQGA 4FE2A 2PVMA 2O2UA 3DDPA 4I4EA 2NNWB 3TG1A 3IO7A 3QRIA 2IEWA 3OEZA 5KZ0A 4EOLA 4YC8A 2JIIA 3ULIA 4NT4A 4UALA 5KO1A 5BVFA 5KNJA 2C5VA 1ZY5A 2NRYA 3DBEA 5FP5A 1W8CA 2VTLA 4DTKA 4N6YA 4DGNA 3KQ7A 4D0WA 3AKKA 2R7IA 5CY3A 4F7SA 3KXGA 2W1EA 2YDIA 4YZCA 3DPKA 4RVMA 2WQEA 2F7EE 4EZ3A 3ZOSA 5AIRA 2W1FA 3D7TB 3JY0A 2HWOA 5I9ZA 4DE4A 1XH8A 4F1MA 3GP0A 5CANA 5HKMA 3LXLA 5EM5A 5JSMA 4C36A 5HLNA 5C03A 5IQCA 5L2QA 5K3YA 5DEYA 4NIFB 4FEUA 2C6LA 3W33A 4IVDA 3BIZA 4J71A 5HG9A 5CNOA 3R71A 5KMMA 2IF8A 3ZZWA 3K3IA 4OLIA 5J1VA 3HAVA 4XH6A 1SM2A 3UOLA 2BALA 4ASEA 5KMNA 1J1CA 3UDSA 3FLSA 4CCBA 2P0CA 2NP8A 4PV0A 4GKIA 2XK8A 3G33A 3GCQA 3ETAA 5A9UA 4BCKA 4YHFA 5M55A 2HOGA 3HRCA 3D0EA 3IGGA 4XP2A 3I7BA 3CSVA 4K33A 4L43A 5BV3A 2XK9A 3LLTA 2VTAA 1JKKA 5M4UA 5KKRB 4KBAA 3TN8A 1PXNA 1KOAA 3H3CA 1G3NA 3CIKA 4F6WA 2W06A 3QYZA 3OWJA 4JOAA 2JKKA 3UNKA 3PG3A 4X0MA 5F1ZA 1FGIA 4U42A 4J8NA 3D14A 4DG2E 2OBJA 5AAEA 3BBWA 4FKRA 5EI8A 5AV1A 3HUBA 3Q9YA 4FTIA 4GL9A 5AUVA 5KX8A 2XYUA 4DCEA 4HVGA 3V5JA 5DR9A 3W55A 2CPKE 3II5A 4UN0C 2CNUA 3ZCLA 1OVEA 4LV5A 2XEZA 4MNEA 4BDEA 3N51A 3GB2A 3F2RA 1MRVA 1Z9XA 4FV5A 4IAIA 2C5NA 1DS5A 1FVRA 3CKWA 2P2IA 3HNGA 4KA3A 3VHKA 1H1PA 3U6JA 3ZO3A 4F9BA 4E5WA 4FL3A 4C4IA 3NUAA 4CV9A 2GFSA 1YI4A 2XANA 2VWZA 3UC3A 3QC4A 3MH1A 4U9AA 4UXLA 1REKA 4DAWA 4RSSA 4XRLA 3ZYAA 4OT6A 3RWQA 1L3RE 2BIYA 2HZ4A 3C50A 3WE8A 2GS7A 4QMQA 4LV7A 2FSMX 5CTPA 3TNPC 1OITA 2FSOX 2VX0A 1H24A 2XNEA 3ANQA 5EW9A 4JIKA 2X4ZA 5E7RA 2UZBA 3FZRA 3QQUA 5T6KA 4Q9ZA 5A6NA 1A06A 3RNYA 3JXWA 4J8MA 5JFSA 3ATTA 3R8LA 3TDWA 4JG8A 3OS3A 5FWKK 2HZ0A 2VO3A 3VS3A 5JEBA 4FZ7A 3DBQA 4OTQA 3EFJA 3OWKA 4FSYA 4I6FA 3UOKA 4MXYA 4D5HA 3SAYA 4K18A 4QTBA 3POOA 3QTIA 3VUIA 1VLRA 2REIA 2V62A 4UEUA 4MEDA 2UW5A 4EQUA 4N0SA 4MUQA 3R0TA 2PMIA 5DHJA 3JY9A 4BDFA 4ANLA 2R3GA 4CFUA 1ZYCA 2B1PA 2WTKC 4RIYB 4CT1A 3CY3A 4G9CA 3LLAA 5GZ9A 3RPVA 2WMVA 2IVVA 4W9WA 5F4NA 5IKWA 4XLVA 5J5SA 2FYSA 2RGPA 2PUPA 1DAYA 3MVMA 4YGAA 3DB6A 1IASA 4BIBA 4MNFA 4O7WA 2XS0A 5IMXA 1Q61A 3NUNA 3O17A 3PIZA 3ZM4A 2R0UA 2W9FB 3QTSA 2HYYA 2C0IA 5E1SA 3CBLA 2Y6MA 3C13A 4Y5HA 2X6EA 1ZLTA 2EUFB 4QP4A 1F5QA 4B8LA 2QONA 4NM5A 5KHWA 3QXOA 2VTJA 3Q5ZA 4R7IA 2VO7A 2CCHA 4KKHA 5DN3A 2QD9A 4FTKA 4K8AA 2UZOA 5DH3A 3BHHA 2PZIA 3ZXZA 2OLCA 1HCLA 4JAJA 4I23A 3C9WA 3MTLA 5FQDC 1U4DA 1V0PA 5M08A 4RVKA 4ZJVA 2J5EA 3MJ1A 3E3BX 3HP2A 4QO9A 5GJFA 5CYIA 3LHJA 4HW7A 3SXFA 3PE2A 2BTSA 1JNKA 3WYXA 4PP9A 3HV5A 4U41A 3EL7A 3FMLA 3FMDA 1XHAA 4EJNA 5L2WA 1SZMA 4O38A 5CI6A 5IDPA 5IEVA 3VONA 4ZTLA 1WVYA 4AAAA 1H00A 2C5YA 5CWZA 3RALA 4K9YA 4FUYA 4R5YA 2E9PA 3NFFB 2PZRA 5ANDA 4C35A 4TN6A 4R3CA 4ARKA 2PUUA 4PF4A 4ANSA 1Y6AA 4AGWA 5LWMA 4D9UA 2CDZA 4G3CA 4F09A 3NVMB 4H1JA 3PFQA 3V51A 2J90A 4CZUA 4J97A 4FGRA 4O86A 4Y85A 5D41A 2X6DA 3LPBA 2X2KA 3FYJX 4FV9A 4GUEA 3QKMA 4H3BA 4MXXA 4XUFA 5CZHA 4HCTA 4EOIA 5FTOA 4AA0A 5IQFA 1LR4A 3IDBA 2UZUE 4OTDA 2VTMA 3GOPA 2ITXA 2XRUA 3HYHA 4A4OA 4L7FA 3HZTA 5DRDA 4GT5A 1W2FA 2VAGA 3OEFX 2WTJA 1O6LA 2YAAA 3GVUA 4L45A 4MBLA 4OTHA 3VUTA 1NXKA 1FPUA 3P5KA 5LVPA 2W4OA 1W98A 3GU4A 1G8SA 2RFSA 4I20A 4O7SA 4EK5A 2CSNA 3SDJA 2F4JA 4FV0A 4QDVA 3WZJA 3H30A 4UMTA 2B9FA 4FKGA 3IOPA 4F7JA 4EOKA 1UKIA 3MB7A 4OT5A 2QI8A 5HLWA 4OBOA 4TYHA 3KY2A 4BDKA 1OKYA 1H0VA 1KV2A 3F7WA 3QFVA 4I3ZA 5CSHA 4IAKA 5J5TA 3LKMA 4ZY4A 4FTQA 2CN5A 1ZWSA 2OO8X 2XYNA 4HGEA 4TWOA 2BTRA 3ZBXA 2YHVA 2QO9A 2OKRA 4HYHA 2QO7A 3ORLA 5DLSA 3S2PA 4MD9E 3W32A 3IK3A 4FJVA 4KABA 3EL8A 1NVQA 3R8VA 3LFBA 2BRBA 4KIKA 4EC9A 5HHWA 1REJA 3LCTA 3JR1A 4S32A 4MD8E 4RC2A 3RPRA 4IIRA 4P5ZA 5H2UA 4GG5A 5A4TA 3UO5A 3N9XA 5L6OA 4Y46A 4F9YA 3DBDA 4IBMA 1Y57A 3KK8A 5B7VA 4F7LA 1AD5A 2JBPA 3RCJA 3FXXA 4YPSA 5FDXA 4AZFA 4WD5A 3Q32A 3F3UA 4YZDA 3FE3A 5ETFA 3NW6A 3MFSA 4QTAA 3KXNA 3F66A 2ONLC 4FKTA 3ZC5A 5CXHA 2OW3A 5KKRC 4F1OA 4MBIA 3C4EA 1XR1A 3HL7A 2CN8A 3NX8A 2VNYA 2Y9QA 4QQCA 3AGMA 4FUXA 3ODYX 3R7YA 1M17A 5DT3A 3ZFYA 1PY5A 2VNWA 4QTEA 1YXVA 3HMIA 3TWJA 4IX4A 4WNMA 3LJ1A 4EKKA 5BVNA 3IPHA 4QDEA 3NVKI 3KRLA 4DH3A 4AQCA 4QP7A 4XHKB 3ROCA 4NH1A 1P2AA 2PU8A 1K3AA 3LQ3A 3DNEA 3RM7A 3QCYA 4HYSA 5J1WA 2NPQA 2G9XA 5LWNA 2OGVA 4Z55A 1G8JA 3WOWA 3ZDIA 2BDJA 5JFXA 3AD4A 4ZS4A 1YI3A 5HIEA 4I5PA 4IX5A 1PXIA 3EWHA 4JVGA 4WHZA 2PY3A 4EK4A 3ZS5A 3ZLYA 3FQSA 2PUNA 3MSSA 3MFRA 2QG7A 5IQAA 2BFYA 4E73A 4JRNA 3FHRA 4H3QA 3FKLA 4EBWA 4EK8A 2YCSA 3HX4A 3NIZA 4L9IA 3UZPA 3W2RA 2W96B 3W0OA 2OZAB 4R3RA 3G90X 1WFCA 1FQ1B 4R3PA 4R78A 2C6TA 1JVPP 3C4ZA 5AV2A 3BLAA 4EK3A 4Z3VA 4EONA 3IW5A 2R0IA 4FNYA 4FIIA 3GNIB 4FTCA 5AUZA 5LVMA 2QNJA 4B8MA 2R3IA 3LQ5A 4P90A 4KNBA 3SG8A 2C1AA 4YNEA 4I93A 4EWQA 4RJ8A 2A1AB 3O2MA 4D1ZA 4HYUA 5J95A 4RIOA 1UV5A 4NM7A 1FVTA 5AWMA 2OH4A 2IW8A 2QOIA 3F61A 1RJBA 3HV6A 1Q8UA 3O51A 4QPAA 3TXOA 1PMVA 5HO7A 3PFYA 4BC6A 3DBFA 3PVWA 1XH6A 2CGXA 4E8AA 4ACDA 3A61A 2JBOA 4JDKA 3F7ZA 3TI1A 1Y8GA 3IG7A 4AOIA 4ENXA 3E8DA 5JZNA 3Q9XA 5M06A 2RFNA 3COIA 3SW4A 2WMXA 3E3PA 3GCVA 4O2ZA 2XEYA 5CLPA 4DG3E 5CEKA 5HI2A 4YJSA 4GRBA 1QPDA 4O6EA 4IAFA 4D28A 4XYFA 4YO6A 4S31A 4BYJA 4P7EA 5E8WA 1LPUA 2HW6A 3L9NA 3QCXA 4GVJA 4B4LA 3NNWA 4M12A 4ACHA 4CGAA 2XK6A 3QBNA 4ZTSA 3TT0A 3ZTXA 4JX3A 3TNWA 3DNDA 1U5QA 4LV8A 4JR3A 4RVLA 3DJ7A 3GC0A 4RA4A 4GUBA 5CAUA 5IISA 3ORMA 4BWKA 5J87A 3DAJA 2BAKA 5LQFA 4G17A 1TVOA 3PZHA 2FB8A 2J5FA 1IR3A 4JX7A 3PY3A 2OZAA 2Y0AA 3UTOA 3VF9A 5J7BA 2Z7SA 3DKFA 3GBZA 2KULA 3OHTA 4FG8A 3D7ZA 3COMA 3VJOA 5IF1A 1JKSA 3UVQA 4D5KA 1A48A 3HMNA 5EQEA 2IVTA 5AV4A 2E9VA 2R3JA 3QKLA 4TL0A 3P5JC 1IA8A 2HZIA 3KRJA 4H3PA 4LUEA 1XJDA 5DE2A 5FBOA 4FOBA 4XV9A 5BVDA 2UZEA 4DT8A 3QZFA 4X2KA 5DFPA 3DQWA 4MBJA 4CT2A 1UVRA 4LI5A 1PF8A 3QA0A 4FIGA 4FKWA 4JLCA 2RFDA 5EFQA 3HMPA 5G6VA 2XKEA 4R1VA 2YM4A 1YDRE 2YJRA 3UYTA 3DKGA 3MN3A