4O4DA

Crystal structure of an inositol hexakisphosphate kinase ehip6ka in complexed with atp and ins(1,4,5)p3
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
240
structure length
240
Chain Sequence
PDGQYLLKPCLSHRERDFYLHIKDDKEWTGTGIIPKFYGVELHEFGFGELEFIRMENLMYKYKRPFVLDLKIGTQTWDPETASSKMKKRLVVDSTSTTTSLGVRFSGMERNIGEEKPILYSRYLCTHEVNTRDSLKEYIKLFFNDGKKYRKELVPYFISQLDKMIEVMKKREYKMFSSSVLFVYDSTTTLEDKKYNCKMIDFAHNWILSEEECTVEDGFLFGLNNLKSILEDIENEFKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title IP6K structure and the molecular determinants of catalytic specificity in an inositol phosphate kinase family.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Transferase
molecule keywords Inositol hexakisphosphate kinase
total genus 77
structure length 240
sequence length 240
ec nomenclature ec 2.7.4.21: Inositol-hexakisphosphate kinase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03770 IPK Inositol polyphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.50 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase); domain 1 4o4dA00
1W2CA 1TZDA 2A98A 4FRFA 4O4CA 4O4FA 2IF8A 4O4DA 2AQXA 4O4BB 4O4EA 1W2DA 2IEWA 1W2FA
chains in the Genus database with same CATH superfamily
5AAEA 4FV0A 3KRXA 2IVTA 2XVDA 2ZB1A 2A27A 5HX8A 2PVRA 1U46A 1B39A 2DYLA 3GC9A 4ZLZA 2LGCA 3IK3A 2W4OA 4ANSA 3QWJA 4IIRA 5E91A 2UW7A 3BU5A 4E3CA 1JSVA 4YO4A 2X9EA 3NWWA 3PJCA 4CCBA 4D4YA 3ZFMA 5K0XA 3LFDA 4K2RA 3QRJA 3FMEA 3MTLA 1ZWSA 3P86A 4HPUE 3PIYA 2HZNA 5AR8A 5I9XA 4JDIA 3KL8A 2WHBA 3DBEA 2JD5A 1URWA 1JWHA 4FVPA 4GK3A 4I3ZA 4IACA 3QRUA 5E90A 1MRVA 3BBTB 4G1WA 3QZIA 4AWIA 4NM3A 3AD5A 5CEIA 5IMEA 4EOQA 4IWPA 4KIPA 3ZSHA 4DLIA 2PVLA 3PJ3A 4E4LA 3UGCA 4YZCA 3DY7A 5L2IA 4DH8A 4PQNA 1ZOEA 5A4CA 3DPKA 4ZJVA 1V0BA 3ULZA 4F6WA 4RZVA 1R3CA 4RSSA 5TO8A 1Y8GA 5H3QA 5M4CA 4BDDA 4D0XA 4EZ5A 2OF4A 3ALNA 4BIEA 4EH4A 3ZZWA 5LVNA 4TTHB 5DOSA 4DTKA 3VJNA 3QKLA 4L3PA 4A9SA 3V04A 3I0OA 4UYNA 5AJQA 3MWUA 5AUWA 2WZJA 4N6YA 3HMNA 2XUUA 3GCVA 5L2TA 3EIDA 4MHAA 5JMSA 4GV1A 3PFQA 1RE8A 4OW8A 4G9CA 3DK6A 4IFGA 4UMQA 4ENXA 5M56A 3NX8A 3SXFA 2PMLX 4G5PA 5KKRC 2J4ZA 2J5FA 1UU3A 1MUOA 4YZBA 4QYYA 3ROYA 3A2CA 1YXVA 4YJQA 4FUYA 1W2FA 4OTQA 2R0IA 3W2OA 4YNOA 2ITUA 3GCSA 2F49A 3RHXA 5J7BA 3QX2A 4N0SA 3FLWA 4BDEA 1H1RA 3COIA 3MH1A 3PSBA 1SVEA 3BRBA 2XIZA 5LVOA 5T68A 2GNLA 2WMUA 4HGSA 4ASXA 4D1XA 2WMRA 4HJOA 4NFMA 2X8EA 3I6WA 4BRXA 4F1MA 2YM4A 4QTDA 3FLNC 2YIWA 5HIDA 3GFEA 3UZPA 4KRDA 3QQHA 5GZ9A 2CLXA 2VTOA 4TKSA 5C1QB 2C6TA 2GHLA 1BMKA 2PSQA 3KCKA 2ERZE 4L7FA 1H07A 1W0XC 3I7CA 5L6OA 5FDXA 3DBDA 4XX9A 2H96A 2VX3A 4XRJA 5TF9A 5A9UA 1NVRA 3UVQA 3W2RA 2HZIA 3LLTA 3BU6A 5B7VA 4CKRA 1E9HA 2PE0A 4F7NA 4ZZOA 4MAOA 3P08A 1VYZA 5J9YA 1OKZA 1WMKA 4CLJA 3AGLA 3HEGA 2X7OA 2JKMA 4F99A 3VBQA 4YJPA 2YACA 4YZMA 2YDJA 1M7QA 3E88A 5CZIA 3V5LA 3CY2A 3GQLA 1OIUA 3DJ5A 3QZGA 3V5WA 4U6RA 3ZLWA 3RVGA 4TWCA 2W4JA 4AFEA 3RKBA 1OL2A 3E93A 3HGKA 4GG5A 4ID7A 4AW5A 4BCFA 3A7IA 3DT1A 2H9VA 4C3FA 2R0UA 1H1WA 3HUBA 4C34A 5B0XA 4GJ2A 4A9TA 3W16A 4FSNA 2W7XA 4EHEA 2Y4IB 4BCQA 4PNKA 4QNAA 1K2PA 4FTIA 4MYGA 4UYAA 3O50A 3R04A 4FT3A 1XBCA 2VGPA 4NH1A 3RCDA 3G2FA 1M14A 1S9IA 4C4HA 2JGZA 3OEZA 1JPAA 4EOMA 4PNIA 2WTIA 1P2AA 4KA3A 5HLWA 5A6NA 5DT0A 4BVUA 4ASEA 5CT0A 5IUGA 2A0CX 2OKRA 5IA3A 5LOHA 1QPDA 2IO6A 4E5WA 2GTMA 2UW9A 3EKNA 1UKIA 3NCGA 1WBVA 3EFLA 1PMEA 4ZZMA 4EORA 4ZY5A 3OCGA 3ZFXA 1K3AA 3FMNA 4YBJA 2OICA 5AP0A 5ETAA 4B8LA 4BWXA 4IB5A 4E5BA 3RWPA 2PK9A 4FKVA 5AV2A 3GC7A 4TYGA 2J5EA 4XP2A 1WCCA 4XOYA 4EI4A 5EH0A 2R3KA 2UUEA 2QNJA 5L2QA 4DGGA 4IQ6A 3SV0A 4X0MA 2JIIA 5HORA 4G3EA 1ZYLA 4OT6A 3DKCA 3MA6A 3AQVA 4ANNA 4DG0E 3NAYA 2WPAA 5KHXA 5GHVA 1BX6A 3LAUA 5TR6A 5CSPA 5AR5A 1H8FA 3V01A 2HXQA 3DKGA 3W1FA 2Y8OA 4BKJA 3CY3A 4YJRA 3QZHA 4MTAA 4Y5QA 3CD3A 3UODA 2UZVA 3LQ8A 3Q4CA 4BDBA 3LQ5A 3W8QA 5CU0A 2A98A 3DQWA 3F88A 2X9FA 3UE4A 4FSUA 4L3JA 3KRLA 2QOBA 2X0GA 4J95A 4YU2A 2EB2A 3M2WA 4JS8A 2HW7A 5AIRA 4FA2A 1K9AA 2G1TA 3OOGA 4X21A 3Q6UA 4K8AA 5J95A 3LXNA 1UNLA 3E63A 3ZH8A 3WZKA 5CAPA 4ANOA 2VTPA 5CF5A 3ERKA 4QQ5A 2GNFA 2X6EA 4I94A 3MVHA 4RLKA 5HE0A 4F7JA 3QA0A 2V7OA 5HCYA 3OOMA 3OW3A 4QQCA 3FMDA 4E4NA 5CALA 5EOBA 4IX3A 3QD4A 4QOXA 3JUHA 4X3FA 2PE2A 2OJFE 3OBJA 4NUSA 5EYMA 5DH3A 4E6QA 5IH5A 3QHRA 3VUTA 4D4SA 4DFNA 5C26A 1PMUA 4FZ6A 4NTSA 4ACHA 3BE9A 2XNPA 4BZDA 3C4XA 5J5TA 3OWJA 2YISA 3QFVA 3CKXA 2XZSA 4FIIA 2WNTA 4CFMA 4XLIA 1RQQA 3KXXA 2CGXA 3O2MA 4M14A 1FMKA 1URCA 3UDBA 3C4EA 4WUNA 4WNKA 3MY5A 3KMMA 3PG3A 3MVLA 4O4CA 2WQMA 5CF6A 1Q4LA 2C68A 2E9PA 4F4PA 3POOA 4APPA 4YC8A 2BIKB 2GQGA 4Y95A 5EW9A 1BKXA 2WIHA 3MPAA 4Y73A 3GEQA 3BIZA 4W4WA 2GNIA 4TY1A 3TKIA 3ZDUA 5C8MA 3LM5A 3OT3A 2UW8A 5HHWA 4KS8A 3D5UA 4LMNA 2RG6A 3R0TA 1HOWA 4F9BA 5IPJA 4MXZA 2BAKA 4IB0A 2BIYA 1YOJA 4EZ7A 2GCDA 3ETAA 3S2PA 4X7QA 5CSWA 2LAVA 4EK6A 1EH4A 3BYMA 3DZOA 4JL9A 4C8BA 4F9CA 5GJDA 4RX5A 4X2KA 4GS6A 5AP7A 5DE2A 2RFDA 5KMOA 1H4LA 5LVLA 3VS7A 3FV8A 3SXSA 5CSHA 2FSMX 2J0KA 3GENA 4M8TA 3VS6A 4H39A 5M51A 2OIBA 3BYSA 4GK4A 1YXTA 4AXAA 5CEKA 2WEVA 3PYYA 5HVKA 4I20A 2J0IA 1G3NA 1UU9A 3VS4A 4WBOA 4I6HA 2PVKA 4MQ1A 3FHRA 2XEZA 2C6EA 4IM2A 3BCEA 2CJMA 4UWBA 4I24A 1YI3A 3DDQA 5HBJA 2NP8A 5D11A 3E64A 3E8CA 4ZTLA 3LJ1A 4JLCA 4ZOGA 3C4WA 4MXYA 1FVRA 2RSVA 4XBRA 3WZDA 1ZY4A 5CXHA 4FV5A 4O4BB 4K9YA 3DNDA 4DGLC 4G3GA 4F09A 3P78A 3R21A 4ZXTA 3R7UA 4D2PA 4FKIA 4XRLA 4FOBA 3HMPA 3CPCA 3LOKA 3TKUA 3S95A 3BELA 2I6LA 5EKOA 1FPUA 2HCKA 5AR4A 5AUXA 2B7AA 4MNEA 4AT5A 3AD6A 4DH3A 2VO6A 3MS9A 2FH9A 5AV3A 4MNEB 5JGBA 1JKLA 5CS6A 1Q41A 4CYIA 4PPBA 4IE9A 2UZEA 3O8UA 4KBKA 4EJNA 3OEFX 4FKRA 3UIBA 5LQFA 2OH0E 3PXFA 4BKYA 3PVWA 4QP1A 2C5NA 1L3RE 3EQFA 4P7EA 2A19B 4WD5A 2PZYA 3TZ9A 5KBRA 4LFIA 3ORNA 2BZHB 2PZIA 3BHVA 4HW7A 5FEQA 3IDCA 5IA4A 4TYEA 2PTKA 4JOAA 4M15A 4U79A 4XMOA 1UA2A 4FZAB 5DT4A 3FLZA 5LJJA 5JH6A 4IJPA 4AGDA 3B8QA 2C47A 1NVSA 4UWCA 4YLKA 2C0IA 3LJ0A 3W2QA 2ZDTA 3UNJA 3IKAA 5JZJA 1CKIA 3D7TA 3S4QA 3SRVB 5IDPA 4Y85A 5H8EA 2XK6A 2QCSA 1AGWA 3OY3A 3QWKA 3RTPA 4XG8A 3FZRA 2FSTX 3D5VA 5DVRA 4OBQA 1GIJA 2W96B 4HVSA 4M66A 5A4EA 1H25A 4L45A 4JRNA 4ANQA 1W2DA 3UVRA 5HO7A 5LMKA 4YGAA 4FBXA 4RLLA 2ITOA 3ORXA 3GBZA 4O1PA 4QP8A 3E62A 2YIXA 5CVGA 5D7AA 1HCKA 2ZB0A 2ZV7A 2XF0A 1YDSE 3FKOA 2YLEA 1E1VA 4ENYA 4OTRA 2PMNX 2EUFB 1RJBA 3HV6A 5DA3A 4DYMA 3DFCB 1NA7A 3GCUA 1AQ1A 4ITHA 3B8RA 4ZSEA 2ZV8A 2OK1A 5DIAA 1O6KA 2J50A 2B52A 2R3HA 3CR0A 5IH4A 3FZSA 3KEXA 3PRFA 3SD0A 4LRMA 2YM3A 2O64A 1KE6A 4CV8A 2XNMA 4UBAA 1SM2A 2X81A 5IU2A 1H27A 3VUGA 5ANEA 1S9JA 3ZRLA 3PRIA 3FLYA 5FWKK 1OECA 3A60A 3EFJA 1R1WA 5HKMA 5FG8A 2QHMA 4HCUA 1GNGA 5CI7A 2YM8A 5HU9A 4O0RA 4DHFA 2C3KA 3NW6A 4RIOA 2PY3A 4XG7A 4MEDA 4ASDA 2JFLA 5ANGA 2BHEA 3T9IA 4C02A 3UZTA 3A61A 4FSRA 4OAVB 2VAGA 3UPXA 4FT5A 2O63A 3HA6A 3VUHA 4HZRA 4NZWB 2XIYA 3K3JA 5HCXA 4BKZA 1QMZA 2BFXA 2GDOA 3HYHA 2HOGA 2Z60A 4RIYA 5ACBC 3ZO1A 3L8VA 2X0OA 4BCGA 2VTHA 3MTFA 4H3PA 2BUJA 2XS0A 4QP2A 5D10A 5I9UA 5IUIA 5LARA 4K18A 4CFWA 3R8ZA 1WBWA 5ETIA 4C0TA 4R6VA 3VQUA 1ZMVA 3FL4A 4GW8A 5F4NA 4OTGA 4RX8A 3E7OA 1XBBA 4I5MA 4U44A 3RAKA 1U59A 3QALE 4FL1A 5FQDC 4BBMA 3KN5A 3ORKA 2YDKA 2YAKA 3Q9XA 4BDIA 1CDKA 4JR7A 3FI4A 3F5GA 3AC3A 2PZPA 3DDPA 3NPCA 4UZDA 4LYNA 2XK4A 5LWNA 4FT0A 2QOFA 2J0MB 5CENA 2IVSA 4BTKA 4FX3A 1JQHA 3RPRA 1I09A 4FTTA 1UU7A 4U8ZA 2QU6A 3MW1A 4I1ZA 4JG8A 3F3WA 4JX3A 4P4CA 3LCTA 4DFXE 2EXEA 2PL0A 1UU8A 5CSVA 4D4VA 4WKQA 1CKJA 4ASZA 4BZOA 4FKTA 4ANMA 3OFMA 3BWFA 1TQMA 1WVXA 2WOTA 5JFVA 4RJ5A 2ESMA 2WO6A 2V5QA 4OTFA 2WU7A 5CF8A 1ZAOA 5CVFA 5JZNA 3DU8A 4BYJA 3LFNA 1QPJA 2UZNA 4QMLA 4YZNA 4NT4A 4F0IA 4PRJA 1OKVA 3EWHA 3LFBA 3NYVA 3R6XA 3PY0A 5FBOA 1Z5MA 4TNDA 4D9TA 2AC3A 2E9VA 4JX7A 4GVJA 4D28A 2CGVA 3KRWA 3MJ2A 3T9TA 3UVPA 4AW2A 2WOUA 2RL5A 4KIQA 4ZTQA 4O2PA 5JRQA 4TXCA 2E9UA 3MB6A 4IAFA 2ZMCA 1OIQA 5AX3A 3FZOA 4KKHA 3Q4TA 2Z7SA 3GU5A 4UMRA 4FODA 2GS6A 3BE2A 4D2RA 3CCNA 5AP2A 3DCVA 4IJ9A 3R7IA 3ZTXA 4F6SA 3CTJA 3UNKA 3OY1A 3EYGA 4CMUA 5FP6A 3W2SA 1OVEA 3IW7A 2Q0BA 3C7QA 2B9HA 5AR2A 3GU7A 3KULB 4OTDA 3VNTA 1XH8A 4V04A 5CWZA 4NM7A 3THBA 3ZLYA 3FJQE 4BGQA 4C4FA 1V0PA 3KY2A 4FTOA 2UZWE 3D5WA 4ZZNA 2HELA 4I4FA 3BEGA 5AUZA 3B2WA 3U4UA 3MB7A 3GUBA 5AMNA 2OWBA 3R1NA 3R63A 5IKWA 3QTXA 4N70A 3DKOA 3GB2A 4Y46A 2JC6A 2WU6A 5BVOA 2B1PA 1NY3A 2V7AA 2BRMA 4XG6A 4Q5HA 4ZJIA 3NZ0A 4GG7A 3UQFA 5IG1A 4NM0A 3R9HA 2VTLA 2OJ9A 4JQ8A 2I0EA 2RG5A 3P23A 4P5QA 3PA4A 3IO7A 4W8EA 3T3VA 4GT5A 3TCPA 1YI4A 1X8BA 4CT1A 4BC6A 2XK8A 3RCJA 4M68A 2JKOA 2B53A 3MI9A 2ZM1A 2YERA 1XWSA 4G3FA 3ZXZA 4BCKA 4CEGA 1UWHA 3HRFA 3QRKA 4BIDA 4EH5A 3QQLA 3FUPA 3QKKA 1MP8A 2A1AB 3GNIB 3KFAA 2H6DA 2WMQA 2VWXA 4FMQA 2IWIA 4CSVA 2E2BA 4Q9ZA 1KE7A 2BDFA 5I3OA 3CC6A 3KXMA 3WF8A 1TKIA 1U5RA 2W05A 5JFXA 2WTWA 4L9IA 3RZFA 3WOWA 4F9AA 2HY0A 4BGHA 4O4FA 4G34A 4JT3A 4RG0A 5K3YA 4D2TA 4ANBA 2FB8A 4BYIA 5EW8A 1OIRA 2YEXA 1Q8YA 2QU5A 2X7GA 3BU3A 2YIQA 3PPJA 3R8VA 4CNHA 1GZOA 5FRIA 4DEAA 5B2MA 4UX9A 3NUXA 3MFTA 5DGZA 4CQGA 1T45A 1H00A 3GOPA 3IDBA 5CNOA 3VHKA 2OXXA 3HZTA 4ACMA 3DOGA 1WBOA 4AX8A 5CAVA 2EB3A 4DFYA 1BL6A 3OBGA 3QQJA 2B9JA 4UY9A 4L68A 4W4YA 2R3QA 3PXRA 4PL3A 3AOXA 4HYHA 4JBVA 4G31A 3GC0A 3MJ1A 4AW0A 3A8XA 4C33A 2ETRA 1A9UA 3KK9A 4J71A 4DITA 3FQEA 5H8GA 3TG1A 5KZIA 3LPBA 4O0XA 5K0KA 5DR2A 2IN6A 3R73A 1YXUA 2ZYBA 4CD0A 3JXWA 3KK8A 4I93A 3ZC6A 4O2ZA 3S00A 4IHPA 3BHHA 3UOJA 2CCIA 3GCQA 4NW6A 1ZZ2A 4IX4A 3PA3A 3QBNA 5AP5A 3Q4UA 4QP4A 5J1WA 4H3QA 4L3LA 3ZO2A 3U9NA 4AZSA 4XNEA 5EI6A 3BEAA 2WTCA 3Q52A 4R1VA 4C3PA 3K2LA 5EM6A 2OJJA 2XYUA 3EL8A 3NNWA 3OZ6A 4ZSGA 2R3IA 4GFGA 2XCKA 3HMMA 4RX7A 4TWNA 4S33A 3GVUA 4U80A 5A54A 2HXLA 3D2KA 4BTFA 3R8UA 3VIDA 2JDTA 2Y6OA 4GH2A 4USFA 4DN5A 3PPKA 3OXZA 4YTCA 3UP7A 3M42A 4U3YA 2CSNA 2I0HA 3RHKA 3ZEWA 2BZJA 3OROA 3RALA 4QP7A 2ETMA 5IA5A 3I6UA 4RWJA 4ACGA 3P7CA 1ZYDA 2HWOA 4IM0A 5EHOA 2VTIA 3MIYA 3OUNB 2ONLA 2GNGA 4C3RA 1O6LA 5E1EA 3CJFA 5M53A 3IDPA 4ZY6A 5HEZA 3ZSIA 3C4CA 4DG3E 4FKGA 3RBWA 3U87A 2Z7LA 3AGMA 3COHA 3L9LA 2JDSA 3TV6A 4WHZA 3F66A 2P55A 3DLZA 3OVVA 3TXOA 4MX9A 4TPTA 3VUKA 5ANOA 3DV3A 4CMOA 1OM1A 1WAKA 2Z7QA 5ANDA 2HIWA 4LMUA 2DS1A 4EQCA 3EN4A 3TNQB 3P7BA 3Q5IA 4O4DA 3T8OA 3LVPA 2NRUA 2VWZA 2XKEA 4EL9A 4M12A 4F64A 1JKKA 4U40A 3BX5A 1IEPA 3UG1A 3F61A 3AC1A 3EQDA 2X4FA 3GOKA 4L43A 3QRTA 5FXSA 4D58A 4EK5A 1OZ1A 3ZU7A 3W2CA 4YUQA 3QCSA 5HCZA 2YZAA 4C57A 4AGUA 4E6AA 3PIXA 1MQ4A 2FSOX 5HG9A 3ZEPA 5GNKA 3TUCA 2VX1A 3ENMA 3CXWA 3JS2A 4N6ZA 4OR5A 4OBPA 5I4NA 2QO7A 1H01A 1XH4A 1ZRZA 4LUEA 3DAKA 3TNPC 3VWAA 5K5XA 3QD3A 2XK7A 4GYGA 4J96A 4KIKA 4CT2A 5C01A 2W5BA 3TEIA 4AFJA 4F9WA 4EH2A 1AD5A 4RC4A 5BX0A 1P4FA 3PVBA 2VTJA 5AAGA 5HE3A 4A9YA 4B9DA 4U3ZA 3U6HA 4DGMA 2WMBA 2X4ZA 1IR3A 4GU9A 3MSSA 3BGQA 3NIZA 4G3DA 2VNWA 4MXCA 2AQXA 3N51A 5DRBA 5BYZA 3CS9A 1XHAA 2JDVA 2YITA 3D94A 4RJ3A 4I22A 4AS0A 4B4LA 4ZSAA 4LOPA 4TT7A 3UQCA 1Q8ZA 3R02A 3SKCA 3DTWA 3WF5A 4QMNA 5KMNA 2CGWA 3H3CA 4ZJJA 2UW4A 2B55A 3WILA 2B54A 2WELA 3VUDA 3O23A 2C1AA 3TL8A 4I6FA 5D12A 4BHZA 3G9NA 4QMSA 4O0TA 2QO9A 5HQ0A 4AZFA 4KWPA 5I0BA 2WTKC 2XNEA 4AF3A 1Q8WA 5IH6A 2QLQA 3GP0A 4QYEA 4M67A 4UN0C 4J97A 1BYGA 2RFNA 4LGDA 4M7IA 4ZAUA 3QQGA 4QP6A 5FTOA 2C6IA 5ICPA 2W9ZB 1DAWA 5GZ8A 1JVPP 5EW3A 4AA4A 4BDFA 3ORMA 4JNWA 4AZVA 4EH6A 3BGZA 2J6MA 3F5UA 1M17A 3MY0A 5J5SA 3ORTA 4RWLA 4YHJA 3NUPA 3WARA 4MBLA 4C4GA 3MN3A 4XYFA 5B2LA 3AC4A 2BROA 2JKKA 4ZEGA 4QTBA 2F2CB 4YJVA 1TZDA 4L00A 4BI0A 4DGNA 4QMWA 3BQRA 4C36A 4IH8A 2UW5A 4A9RA 3Q04A 2BRGA 4YZDA 2WMTA 5JN2A 2C0OA 2IZTA 3DB8A 2C30A 2RFEA 5CF4A 1PXNA 3OCSA 3FZ1A 4TWPA 4BF2A 1OGUA 5HNGA 4LOOA 3KQ7A 5CEMA 3R7EA 3PVUA 5BUIA 1ZOGA 2OI4X 4U42A 3V5JA 2P4IA 4HCTA 4W9XA 4AUAA 4HNIA 1IASA 3MFSA 2C6MA 2CLQA 1BUHA 3ACKA 4AN3A 5CAOA 1M7NA 3V8TA 3D15A 3Q2MA 1PJKA 4AGCA 4PP9A 5H8BA 3OTVA 4R1YA 2OFVA 4YZ9A 3OD6X 4U9AA 4D9UA 4HYSA 4I0RA 2OG8A 4QTCA 1ERKA 5KMIA 1KE9A 2VWIA 2VWVA 1PHKA 2CGUA 2C69A 4D2SA 3UBDA 2R7BA 1OUKA 2JIUA 3BZ3A 1R39A 2W1ZA 3UYTA 4CCUA 1JBPE 1H26A 1XO2B 3DNEA 2HW6A 3RPSA 1H1SA 3NGAA 5CQUA 3IW4A 4IB3A 3BV2A 3QZFA 4NK9A 3SX9A 4TRLA 2ZOQA 3F9NA 3SA0A 4PL5A 2O65A 4H36A 5E7RA 3V8WA 2QOIA 3MH2A 4O1OA 5FEDA 4IWOA 4MK0A 1RW8A 3NUNA 4L44A 4Z9LA 3DB6A 2UW6A 1W7HA 2ZDUA 4IVDA 4F1OA 5HU3A 4FR4A 3MPTA 4WNPA 3ZFYA 3TACA 2WFYA 4P5ZA 5HE2A 4FTRA 2GNJA 3HDMA 2PZ5A 2QC6A 1H28A 1R0PA 3W33A 3PSDA 3KKVA 5HG5A 4ANLA 2C5YA 3IQ7A 4KKEA 3C5UA 4MBIA 4NWMA 4UEUA 3ZO4A 3D83A 4YTIA 4ERWA 4K77A 2QHNA 4FZ7A 3V6SA 1LEZA 4L67A 1BLXA 3F6XA 2Y4PA 4FZDB 1J1CA 1KOAA 1IG1A 2SRCA 3F69A 3FZPA 2BFYA 1FQ1B 4AA5A 3PUPA 4FUXA 4GIHA 3NYOA 5DLSA 4FV9A 3ZS5A 3BWJA 3O8PA 4CFNA 5HICA 4RVTA 4C62A 3RAWA 5CEPA 5GJGA 2UZDA 2YLFA 3C4ZA 3KU2A 4FV6A 4O0VA 5K9IA 3UO4A 2CPKE 4EOPA 3PWDA 4USEA 3WF7A 4RIWB 2EU9A 2J0JA 4YP8A 3CE3A 3R1QA 3GU6A 1W84A 5E8SA 1Q5KA 4FG7A 2QI8A 4EBVA 2ZAZA 1MRYA 4RC3A 5L3AA 5D1JA 2CMWA 3WF6A 3AMAA 1Q97A 3FC1X 5CEOA 4FTJA 3R7VA 3LFSA 1I44A 4JRVA 4FC0A 3TWJA 2F7XE 5C03A 3RNYA 3FPQA 4F9YA 4MBJA 5IA2A 1XKKA 3EQCA 2QOQA 4U45A 3QQKA 4AA0A 4EYJA 5JSMA 4IB1A 5IZFA 4I4EA 3SXRA 1W82A 4NEUA 5JT2A 3IS5A 2G15A 4BCHA 1YHSA 5A6OA 4AN2A 4FSZA 4HVIA 2WQEA 4NCTC 2QR7A 4XHKB 3HLLA 3R28A 3S3IA 2X2KA 2W5HA 1YWVA 4ACCA 2XM9A 4FK6A 3K3IA 3FQSA 4RJ4A 3IGGA 5ETCA 3G6GA 4A9UA 1Q99A 1YVJA 2WMVA 3DTCA 4XEYA 5HESA 1F3MC 3OTUA 3QTIA 2HENA 3VAPA 3RPOA 3SLSA 2IW6A 3A7FA 3KN6A 4IAYA 1W98A 4RJ8A 4EH9A 5F95A 4H3BA 5HBHA 5BVWA 2YA9A 4FKWA 5BVNA 4J1RA 4CKIA 2OIQA 1GIIA 4J8NA 3KXNA 2W1GA 3BLHA 4O0WA 3VBXA 3ODYX 4AOIA 1M52A 5EOLA 4BZNA 3QC9A 4F08A 2IJMA 3AC5A 3NNXA 4IWDA 4LGHA 4OT5A 3W32A 5T3QA 5BYYA 4WRGA 3KCFA 3A4PA 4PUZA 4HGTA 3CQWA 4FYOA 4O38A 5HI2A 3JY9A 4FTKA 3U6IA 5JRSA 2C3LA 4FIHA 2C5XA 2VTNA 5IA0A 2CCHA 3EQPA 1OMWA 2C6OA 4NIFA 2WTKB 4BCNA 1PXIA 4FKQA 2J7TA 4II5A 5CNNA 4MH7A 3R7OA 2YIYA 3DBQA 3KF7A 4YJNA 2ETKA 4WO5A 3RK7A 3EZRA 5C8KA 2YJSA 2VGOA 4R5SA 4WNMA 2P3GX 4KIOA 3UQGA 3T3UA 4I6QA 3ACJA 3ORIA 4Q2AA 4WIHA 2C6LA 4JBOA 4M69B 1TQPA 5DEYA 3V5QA 5JKGA 4AAAA 5L2WA 4UMTA 3UP2A 5LVPA 3P79A 4OUCA 1REJA 2XYNA 3OUKA 1B38A 5M57A 5DNRA 5FTQA 4X2JA 3FXZA 3ZO3A 4C35A 4YURA 3WIKA 3QU0A 4I41A 4F63A 1DS5A 1RDQE 2PVYA 2ZM4A 2C5OA 5HVYA 5JGAA 3WF9A 1GZKA 2R3PA 3PJ8A 4FOCA 2C3IB 4M0ZA 4QO9A 4Z55A 2WMWA 4BDHA 3SOAA 3EQRA 1CM8A 1XH9A 4OAUC 3E8EA 1ZZLA 3I81A 2WKMA 3IECA 2O3PA 1ZLTA 2P0CA 3OWKA 4WG5A 3Q60A 5FLFA 1LR4A 2Z2WA 2J9MA 3NYXA 4RC2A 3GXLA 1OITA 3OCBA 4ERKA 4TYJA 3FLQA 4Y83A 4ZTHA 4EWHA 1XH5A 4UWYA 1M2RA 5K5NA 4QMOA 3W55A 4EK4A 2XJ2A 3CP9A 3C13A 2W9FB 2BCJA 3ORPA 4IVBA 5IUHA 3CTHA 4KBCA 3KF4A 2BALA 3NYNA 5KZ0A 3TTJA 3VHEA 4BGGA 4EC8A 5JEBA 4FIGA 3L9MA 3F5XA 5ETFA 1JKSA 4N4SA 5IF1A 4OBOA 5DMZA 4XG9A 4L46A 1Y6AA 4AU8A 2IZRA 5EDPA 4OTIA 1PXJA 4UXLA 1W2CA 3S1HA 1XH6A 2G2FA 4KSPA 3QYZA 3SC1A 2XCHA 4MD8E 3FY0A 3HP5A 4FV8A 3I1AA 4CTCA 4KS7A 3PE1A 4UXQA 1YXSA 4MD9E 4XLVA 3E8NA 4USDA 3UYSA 4IWQA 4IVCA 4O0YA 2YIRA 4FIFA 3OXIA 3QTZA 4RMZA 3MV5A 1ZYJA 2ITTA 3G0EA 2QOOA 4FTUA 5L6WL 3W18A 3LZBA 3O7LD 3PTGA 4ZLYA 3FBVA 5HD7A 2AC5A 4C58A 3FI3A 4LV8A 2HYYA 2REIA 3LCKA 5AM6A 2W1EA 3RM6A 3TTIA 4AW1A 4QQJA 4CZUA 1GAGA 4O91A 2F7EE 3QGYA 4TW9A 5ANJA 5IEXA 4YO6A 2O0UA 5KMLA 3LXPA 4UV0A 5IMXA 3IONA 3FSFA 3ULIA 3NIEA 4O27B 4HVDA 3FSKA 3QCYA 2WB8A 3VC4A 3I79A 3O0GA 4BBEA 3G51A 3DQXA 4L01A 2QURA 1A06A 4I5PA 4O6EA 5JK3A 2ZV9A 4O96A 5E8XA 3ZOSA 2QKRA 1JAMA 3V5PA 4R7IA 1F0QA 4DFLA 5LMAA 4B6LA 4DG2E 3QQUA 4D2VA 4EOIA 3LXLA 4FV4A 4U7ZA 3TNWA 4IDVA 4GFMA 4AACA 5BNJA 4IAAA 3L1SA 5KO1A 5L8LA 5FD2A 2ERKA 3ZZEA 3BHYA 5I9YA 4I5CA 2EWAA 3Q32A 4M13A 1KE5A 2I1MA 3NAXA 4FKUA 4HGLA 4XH6A 4XV2A 4ZTMA 3VS5A 3IW8A 2VTSA 2OZAB 4M69A 4FTCA 3ZUTA 4C37A 3Q9YA 4EONA 3KRRA 4JBPA 4BHNA 4X6RA 5T6KA 5FDPA 2UZOA 4OTPA 4S30A 2W1FA 3V6RA 4L7SA 1PYXA 3ZYAA 2ZM3A 3O7LB 5EYDA 3I7BA 3QAME 2VU3A 4EHZA 4EYMA 3C50A 4MXXA 3VULA 4C4IA 1OIYA 5FXRA 1OL6A 4ACDA 4NIFB 4TWOA 2XJ0A 3QCXA 4LRKA 3GGFA 3BHTA 3I60A 3RJCA 4ARKA 3EJ1A 1M2QA 5FM3A 5LMBA 1WVWA 1KV1A 3PP1A 4QP9A 3TIZA 2IF8A 4D5HA 4U5JA 1LP4A 4QRCA 5I9WA 2R2PA 5CQWA 5AR7A 2OF2A 3PJ2A 1FOTA 3EOCA 5E8YA 1JOWB 4UZHA 3NLBA 2FSLX 5D41A 2DUVA 1YWNA 2V22A 1FVTA 3ZUVA 4ALUA 1OL1A 4F0GA 3C0GA 2V62A 3C1XA 3I5NA 4M84A 3TIYA 3G90X 1YOLA 1WBPA 1Q24A 4M97A 4IVAA 4I21A 1PKGA 5AUYA 1WFCA 3C0HA 5IEVA 4MNFA 4X2FA 3BBWA 3II5A 2QD9A 3EZVA 3MYGA 4RJ6A 3E92A 4BCPA 4F7SA 2YFXA 5L6PA 3F5PA 4FKPA 2JBOA 4JIAA 5EM5A 3P5KA 1CKPA 2VTMA 5DT3A 4Q5EA 1PF8A 2YAAA 1YXXA 2R3OA 2CN8A 3N9XA 1OUYA 5FP5A 3OWPA 5HG8A 2WD1A 4G9RA 4ZTNA 4J99A 1J91A 4RFMA 4EH8A 4AE6A 5HTIA 4EOJA 2W17A 4S31A 2X1NA 3P0MA 5J9ZA 2X2LA 3WIGA 2R3MA 4FTQA 4CV9A 2X0PA 4YLJA 3WI6A 1B6CB 5BUEA 2BMCA 4C61A 2RGPA 4NM5A 3TKHA 3UC4A 3FC2A 3ENHA 5G6VA 2UV2A 4DINA 3O96A 2PUUA 3QUPA 4PPAA 3QC4A 2R3GA 2OXDA 5CI6A 4IFCA 1Q8TA 3FMHA 2H34A 3W8LA 4FL2A 4B8MA 4C59A 5CTPA 3OMVA 3QX4A 4XG3A 1HCLA 3PY1A 4WUAA 5DPVA 2IW9A 1VR2A 5K4IA 1E1XA 2FVDA 4XCUA 2FA2A 4DEDA 3R83A 5A46A 1PY5A 2GSFA 2W0JA 3KVWA 2VNYA 2XIXA 4QMZA 4CFUA 4XS2A 3PLSA 3KVXA 3VW8A 4NSTA 3DXNA 3MGYA 4FL3A 4JDKA 4GT4A 3UC3A 4C7TA 3F82A 1PXOA 2R5TA 4PDOA 3U51A 5EYCA 4BI1A 2YCQA 2J0LA 3QD0A 4FRFA 5BMMA 5LVMA 1CSNA 3KC3A 3NUSA 2UW3A 1MRUA 1SVGA 2GHGA 3HECA 3HMOA 4GYIA 3CGOA 3R00A 4BTJA 5AP1A 2XNGA 4EZ3A 3KRJA 4AOTA 2BZKB 2PE1A 2RF9A 2VTTA 1SZMA 2BKZA 4CYJA 3H10A 4QPMA 4R7HA 4BCIA 3F3VA 4HVGA 1OL7A 3OHTA 1JNKA 2YCRA 3QXOA 3FXWA 3HNGA 4QMMA 5GZAA 4S2ZA 5EDQA 2XK3A 5EKNA 2QO2A 4ALWA 2FUMA 4FSQA 4G6NA 4KD1A 1O6YA 3ORZA 4YR8A 2Y6MA 3EYHA 5D9HA 3VF8A 2YCSA 4PV0A 4BCOA 2IVUA 1BI7A 3HRCA 3F7ZA 1U5QA 4KAOA 3CD8A 4WOVA 4GMYA 5M55A 3F3UA 2VWBA 4FG8A 4O21A 5L8JA 2R3JA 1WVYA 3QGWA 4BCJA 4MVFA 2WXVA 3R2YA 3BQCA 4O0SA 3LW0A 4WT6A 1O9UA 2OO8X 3H9OA 3P1AA 1DAYA 3TZ7A 1ZMUA 4RWKA 3SQQA 4U97A 4E5AX 2C6KA 4IZ7A 2WEIA 5LCJA 4BI2A 1VZOA 4MXAA 1OI9A 1Q3WA 5M4UA 4CTBA 3P7AA 3FLSA 2YJRA 4P2KA 4DEIA 4S34A 3UJGA 2QG5A 5DBXA 4JAIA 4F70A 4NFNA 5EM8A 3QTSA 4HOKA 4UB7A 3BV3A 1YDTE 3R1SA 4YJOA 2WQNA 3FPMA 1WBSA 2BZIB 3G33A 3PXQA 4TYHB 4A4LA 5BMSA 3M1SA 2UZUE 2ZJWA 3EQBA 2WQOA 1NVQA 3Q3BA 4OGRA 4R3CA 5E8UA 3ZM4A 5KNJA 2FGIA 5C8NA 3QUDA 4J8MA 3FE3A 5HO8A 4ALVA 1XQZA 5ACKA 1KV2A 4RFYA 3R9NA 3RM7A 3VF9A 3DLSA 3W10A 4AZEA 3EQIA 1QCFA 3VJOA 4BFMA 3HUCA 1FVVA 3MBLA 2IZUA 3QRIA 5A3XA 3AD4A 2R9SA 3LFFA 2GTNA 2E9OA 2YABA 5HNBA 2ZVAA 2PVFA 4MXOA 2W1DA 3E3PA 4IC8A 3R8MA 3ROCA 1TVOA 5I9ZA 3VRYA 3EFKA 5L4QA 1UVRA 2R4BA 5J8IA 3RK5A 3EHAA 2JKQA 3Q53A 2WQBA 2F2UA 3L8XA 4EH7A 3CJGA 4G2FA 4FTLA 4U0IA 1YWRA 2PZRA 2VWWA 2YM7A 3BI6A 4L6QA 2ZMDA 1XH7A 3FQHA 3D2IA 4YSJA 5KMKA 1H08A 2FYSA 2QONA 3FI2A 4RA5A 3U9CA 3V5TA 4AOJA 1P4OA 2BRBA 2W1CA 2ITXA 5IISA 2GS7A 3QTQA 5KE0A 4QMQA 5HVJA 5A14A 4J7BA 4F6UA 5I3RA 3B2TA 2GMXA 4XV1A 2O5KA 3OWLA 3HV3A 3D0EA 2XK9A 4A4OA 4BDKA 3A7JA 1V0OA 3EB0A 3DGKA 1OPLA 4WG4A 5A4TA 3OF0A 2BAJA 4YNEA 2CKEA 3U8WA 3HV4A 3IOKA 2P2HA 5EHLA 2XIKA 1MQBA 5F1ZA 3G0FA 3TJCA 4DLJA 3NW5A 3ODZX 1UNGA 5LWMA 3RINA 5FM2A 4WSYA 4Y8DA 2AYPA 2C4GA 3ELJA 4O4EA 3DBFA 2DQ7X 4FYNA 2XNNA 4X3FB 3NSZA 3VBVA 5JFSA 1TQIA 3F7WA 3PE2A 5J7HA 3IG7A 3D4QA 3MVMA 1JSUA 3AG9A 4EQMA 4QYFA 3L9NA 4GT3A 2A2AA 2WIPA 2YM6A 3G9LX 4O6LA 3JPVA 5M4FA 1V1KA 4PTGA 3QLFA 5CANA 3FAAA 2XNOA 4D55A 4K6ZA 1ZYCA 4KKGA 2XKFA 4I92A 5HG7A 2IW8A 4KINA 2XBAA 4HYUA 4JQ7A 4R3PA 5CU2A 2PVNA 3D14A 4ZTSA 5AIKA 5FEEA 3LFQA 3VVHA 4IC7A 4PPCA 1P14A 2WMXA 4RT7A 5AP3A 5E8WA 2RFSA 3OW4A 3VUIA 3QUEA 3IW6A 4F65A 4PMPA 3ZRKA 3H30A 4IDTA 4FV3A 4IEBA 3U4WA 3EN9A 3D7TB 3F3TA 1GY3A 4LG4A 5F20A 3SRVA 3ZC5A 4DEBA 4E6DA 3DBCA 4RWIA 3SDJA 4FICA 4EBWA 4APCA 2XA4A 5HTBA 5IEYA 4QMVA 5EI8A 2X7FA 3ZCLA 3LXKA 3GU4A 3KMUA 2XEYA 4GSBA 5CAQA 1OB3A 3KGAA 3LFEA 3PSCA 4W9WA 3DKFA 1Q62A 4DAWA 5HE1A 2NO3A 4CFXA 4I0SA 3WE8A 4NKSA 2I0YA 3C0IA 4QMYA 4XV3A 2XKCA 5BUJA 4HGEA 5LMKC 1PYEA 4XG4A 3KXHA 4ZIMA 3SVVA 4WSQA 5TT7A 3EQGA 2XBJA 5HD4A 2OFUA 4YC3A 2JEDA 4O0UA 4DEHA 2B9FA 2QKWB 4BTMA 3DK3A 3MFRA 4FIJA 4FKLA 3NW7A 3NUYA 3WZJA 4B7TA 5HX6A 4QMPA 5KHWA 3TV7A 4EH3A 3EFWA 1G5SA 2XKDA 4E73A 2UVXA 4QQTA 3HL7A 3E87A 4AZWA 3R71A 5HLNA 3D9VA 4R8QA 3TI1A 4R3RA 1PMVA 3WBLA 4X3JA 5L8KA 3V51A 3DAJA 3MFUA 1U4DA 3TV4A 3PZHA 4BDAA 4LUDA 1KOBA 4EUUA 1FINA 4P90A 2BDJA 2XMYA 4QNYA 3R1YA 3EH9A 4BDGA 5KMMA 4KBAA 4BB4A 2XIRA 3U6JA 1JLUE 3BGPA 3C51A 4GEOA 2JFMA 4MCVA 3LE6A 3CBLA 4XOZA 4YLLA 3WZUA 3D5XA 4UALA 3F2AA 4BBFA 5KMJA 3PXZA 4ZY4A 3S0OA 3O8TA 1Y8YA 2R3LA 5E92A 1REKA 4PL4A 4PTEA 4Y5HA 5EI2A 3FMJA 2OGVA 3VUMA 4PF4A 1PXKA 3CTQA 4C38A 2QOKA 4LL0A 5CU6A 3VBYA 1SYKA 3UOHA 1Y6BA 4JDJA 4BN1A 4IX5A 4MD7E 4BWPA 4FV1A 2VTAA 3ZONA 4RFZA 2W1IA 4YJSA 1PKDA 4JG6A 4EKKA 4V01A 3DZQA 4IAZA 2PVJA 5E8VA 2WMAA 3AMYA 3K5VA 5G1XA 4WNOA 5DEWA 3UIMA 4ONAA 4IMYA 3TNHA 3RAIA 3IOPA 3HV5A 3PVGA 1ZY5A 3GT8A 1YQJA 3R22A 3E7VA 2YCFA 1JKTA 3CPBA 4PDPA 4PX6A 4RBLA 4NTTA 1M2PA 4BL1A 2XM8A 4RQKA 4GUEA 4ZSJA 2F57A 2R3RA 2XJ1A 3EN5A 2ONLC 5CAUA 3G6HA 2WMSA 4DC2A 2ITZA 2RKUA 2F9GA 4XP3A 2IZSA 3RP9A 5EK7A 1QPEA 3IGOA 4GCJA 5DN3A 4FV2A 4IAIA 5K4JA 3HDNA 4E4XA 1KSWA 5TOZA 1Q61A 4FSWA 5ANKA 4RIYB 5EHYA 3FMKA 3LM0A 4UMUA 3BYUA 3FL5A 5CU4A 2QVSE 3UIXA 5HNIX 3QD2B 4JJRA 3HX4A 3SOCA 4HCVA 4W4VA 3QA8A 2JAVA 1Z9XA 2WAJA 4EHVA 3IW5A 2CN5A 3ANQA 4CFFA 4E93A 2VD5A 3A7GA 4GU6A 2ITNA 2UZLA 3PP0A 5JQ5A 3D7ZA 3ALOA 5FXQA 5EM7A 1H0WA 1T46A 3FZTA 3AXWA 4DEGA 5CX9A 3M11A 2YM5A 4IADA 2X8IA 3FY2A 4TZRA 5H2UA 1SNXA 5ITAA 2GU8A 3UNZA 4C2WA 1SMHA 2VTRA 5I9VA 1SNUA 3UO6A 2Y0AA 3Q9ZA 3HKOA 4GK2A 1PW2A 2VUWA 3PPZA 4XUFA 1ZARA 4FZFB 1JSTA 4G16A 3HVCA 5F94A 3CEKA 4FSYA 2BILB 4LI5A 4X2GA 3ZRMA 4JDHA 4E8AA 3P9JA 4D1SA 2NPQA 3A4OX 3ZBFA 4G5JA 1WBTA 3WE4A 3ET7A 4B0GA 4ZP5A 2BDWA 1F5QA 2Q0NA 3GU8A 3IPHA 3BLRA 4QMTA 3R01A 2PMIA 5KX8A 4RZWA 5LXMA 1DM2A 3PJ1A 4EOKA 2J90A 4MKCA 4PMSA 4LGGA 3RPVA 4JQEA 3QXPA 2EXCX 4MQ2A 3KXZA 4AT3A 3UIUA 4WRSA 1SVHA 4EQUA 1DI8A 3UOKA 3FMMA 2KULA 4DGOA 4LOQA 5CZHA 2XP2A 1R78A 5I5ZA 4L52A 4AE9A 4DH7A 4IW0A 2ACXA 1FGKA 4EOLA 4WBBB 2BR1A 3ANRA 4QD6A 2HY81 4X3FC 4TYIA 1VJYA 4G6OA 3TZ8A 5BPYA 1YW2A 2OJGA 3A8WA 4IZAA 4D5KA 5AA9A 3KMWA 4F0FA 4GVAA 1ZOHA 4FNYA 3FKLA 3LCSA 4FIEA 1Q8UA 2PVHA 4YHFA 5HGIA 4UMPA 2B4SB 3H9RA 5HBEA 1OL5A 3QYWA 4L42A 5E8TA 3VS1A 3TUDA 5BVDA 2QOHA 1GOLA 4IXPA 4FT9A 2ITVA 3KULA 3UG2A 4FTAA 2ZV2A 1APME 3G5DA 1ZYSA 4K0YA 4U43A 3QTRA 3UMXA 5EYKA 2X39A 2GNHA 5ANIA 3MA3A 2EXMA 5CU3A 2WGJA 3I0QA 4IM3A 2C0TA 4FSTA 4G3CA 4GFOA 4QPSA 4HNFA 4CZYB 4KABA 2H8HA 1H24A 1UKHA 4YPDA 2BPMA 3CIKA 4NJDA 3K54A 3LMGA 4BIBA 3COMA 2DWBA 2QR8A 1Y57A 2PMOX 2J2IB 4JXFA 3LCOA 4DBNA 5CXZA 3I5ZA 3H4JA 4EHGA 4EEVA 2XRWA 2GFCA 2WTDA 3EL7A 3OXTA 4FNXA 4MWIA 4V0GB 4XJ0A 3RI1A 3FYJX 3HMIA 2PHKA 3HA8A 2JLDA 4YTHA 2ITYA 1OKWA 2VZ6A 5EFQA 2X6DA 3VO3A 1IA8A 2QOLA 3GCPA 4PMTA 2YHVA 2R64A 2UZTA 3MIAA 4QYGA 3VW6A 4BICA 4JVGA 3CKWA 1W8CA 3QQFA 3LCDA 2QLUA 4DH5A 2PWLA 3NNVA 5D7VA 1H1QA 4D1ZA 2OZAA 1UNHA 2C5VA 4FSMA 4U41A 4DFZE 1FMOE 2V0DA 3W2PA 4KNBA 4DCEA 3QTWA 4A07A 3PG1A 4YHTA 3E8DA 3QKMA 4GIIA 5BQ0A 4NKAA 2VN9A 3LJ2A 3TT0A 3ZDIA 5DHJA 2V55A 4I6BA 2YN8A 3POZA 4Z3VA 2VWYA 4D4RA 1Y91A 4TYHA 2YDIA 2BRHA 5CEQA 3AC2A 3H0YA 3C4FA 4MF0A 4TNBA 2G01A 3PA5A 3SW7A 3AC8A 3O17A 1ATPE 3NS9A 4H1JA 4RIXA 3NUUA 4NU1A 2W06A 1STCE 1NXKA 5CLPA 3LHJA 2ITQA 2JITA 5AV0A 5HIEA 3UTOA 3Q5ZA 3E5AA 4I23A 4J52A 5EG3A 4F7LA 1XBAA 2Y9QA 4AP7A 3MH3A 4FGBA 4XV9A 2ITPA 2Z8CA 2J51A 3I4BA 2E9NA 3K5UA 4KIKB 4S32A 3V8SA 3DA6A 4NW5A 4ITJA 4WA9A 5AAFA 1GJOA 5DFPA 2BTSA 3ORLA 3R7GA 2G2HA 4LQMA 4FK3A 4MWHA 2OW3A 4FKSA 4FVRA 4QT1A 3EQHA 3UOLA 5KUPA 4E6CA 3WYYA 3BLQA 4K11A 3VRZA 5AEPA 3CQEA 5CVHA 3ZBXA 2GS2A 2VO3A 4LL5A 3E3BX 2XH5A 3MDYA 4K1BA 4C4JA 4M0YA 4E1ZA 2AUHA 3A62A 4RX9A 1LPUA 2UVZA 3Q4ZA 2OSCA 3CQUA 3NDMA 4LRJA 4W8DA 4YC6A 3CLYA 4H1MA 5AR3A 2BRNA 5TE0A 4MF1A 3R9OA 5CYIA 3FWQA 3NNUA 5AP6A 5HLPA 5CASA 1YRPA 3H9FA 3NR9A 3QL8A 2VO7A 4PMMA 3BYOA 3F3ZA 1J3HA 2W1HA 3F2NA 1R0EA 4RRVA 3UO5A 4EK3A 4V05A 4AGWA 5A4QA 3FDNA 5JQ8A 4CXAA 3A99A 5AM7A 2JIVA 4BDJA 4CLIA 4OTHA 1Q3DA 4FNZA 4RPVA 5J87A 4ZLOA 3JYAA 4JG7A 4Q9SA 2WTVA 3TN8A 3PXKA 1VYWA 3DK7A 2JAMA 3VS0A 4ZK5A 3R9DA 4Z7HA 3VS3A 3V3VA 4Z7GA 4J53A 3FYKX 2QOCA 3NCZA 3SHEA 4D2WA 3LFCA 2O2UA 2UZBA 5DG5A 3O71A 4BCMA 2HWPA 4Z16A 4R5YA 3ZLSA 1YI6A 2C1BA 4YJUA 4CQEA 1J1BA 4JBQA 5AWMA 5CT7A 5BVEA 5AUTA 5E8ZA 2HK5A 4PWNA 1BL7A 3PIZA 4CMTA 3MVJA 2FO0A 2OXYA 3ZHPC 4RGJA 4RVMA 4BWKA 4EC9A 2VTQA 2VV9A 3PY3A 2I0VA 2ITWA 3R2BA 5J9LA 1KWPA 2IEWA 1ZXEA 1ZMWA 3QHWA 4FF8A 5AP4A 3R7YA 3WZEA 3Q6WA 3TUBA 4G17A 4CRSA 3AT2A 2OIDA 3GC8A 4PY1A 1LEWA 4A06A 1IRKA 4CVAA 3CGFA 4EOSA 2BVAA 5M4IA 1W83A 2GFSA 4OTWA 3BHUA 1Z57A 3JVRA 4QPAA 5J79A 2PVMA 4IX6A 3UMWA 3ZXTA 5AADA 5KKRB 4O22A 5AV4A 1CMKE 4D0WA 4G6LA 3AMBA 4HZSA 2NRYA 4FNWA 1WBNA 2CDZA 3DJ7A 5AUUA 4I0TA 2G9XA 3RMFA 3JY0A 3QTUA 5DR6A 4E7WA 3VBWA 3QCQA 3RNIA 4YSMA 3OCTA 1YDRE 2HZ4A 3EMGA 1PXMA 1H1PA 4H58A 4I5HA 4JI9A 4QMXA 4QP3A 5AA8A 4JIKA 5L2SA 1UV5A 3AT3A 3L8SA 3R8PA 3Q96A 2RIOA 1U54A 3DS6A 3OP5A 5DI1A 4FKJA 5E1SA 5B2KA 5KCVA 4GJ3A 4QMUA 4CFVA 4K33A 2G2IA 4JAJA 2F7ZE 4QTAA 2CHLA 4PDSA 4C4EA 4ZSLA 5FGKA 2Y7JA 3RAHA 3FXXA 4HPTE 3MH0A 1GZNA 1VEBA 2GPHA 3OS3A 2HAKA 4FI1A 3ZLXA 4FV7A 5HTCA 2X8DA 2GHMA 3KXGA 1WZYA 2I40A 3JVSA 2R3NA 3QLGA 4IZ5A 4NJ3A 4TN6A 3RGFA 2VX0A 4FT7A 3TNIA 4C2VA 4IZYA 1P5EA 5GJFA 5HZNA 2QQ7A 5JGDA 2Z7RA 3RZBA 3VQHA 1CTPE 4CKJA 5A4LA 1DI9A 3TZMA 4HVHA 2W4KA 2HZ0A 1YHWA 3NRMA 4AQCA 2O8YA 3PWYA 4CZTA 2WTJA 3ITZA 4GUBA 3PXYA 4KB8A 4YBKA 5LCKA 3ZMMA 1QPCA 3LFAA 4RVLA 4FKOA 3SW4A 4HYIA 3PZEA 3RK9A 3L8PA 3KB7A 4KSQA 5AUVA 3COKA 4AT4A 4FVQA 3GQIA 4WG3A 2OU7A 5IA1A 4U81A 2IVVA 4GL9A 2X2MA 3R8LA 4LV5A 1OPJA 1XR1A 4IBMA 4E4MA 4EUTA 4ZTRA 3BKBA 4RIXB 2Y4IC 4L53A 3OT8A 2OJIA 5F9EA 4BDCA 3Q9WA 4CRLA 2KTYA 1H0VA 2BAQA 3FKNA 4ITIA 1GZ8A 2X0QA 4NCTA 4B99A 5J1VA 3DFAA 1LUFA 3FMLA 3H0ZA 4RIWA 4XG2A 4AZTA 5TKDA 4RQVA 3WYXA 4FG9A 5KBQA 4IANA 3NEWA 2W5AA 2OH4A 3SAYA 3OC1A 5IDNA 1XJDA 4QTEA 4M3QA 3VBTA 3GFWA 4RVKA 3VN9A 2C3JA 2JDRA 4EOOA 4XBUA 2OZOA 3DJ6A 2R7IA 5HOAA 4A4XA 1PXLA 4GRBA 3KA0A 3RPYA 4FEQA 3VS2A 4DH1A 3O51A 5AV1A 4LM5A 4RJ7A 4DEEA 4A7CA 2C6DA 5BVFA 1PXPA 1KE8A 3AT4A 2R3FA 4RA4A 2VRXA 4Y72A 3HP2A 4TL0A 4YTFA 3OG7A 1OPKA 2YWPA 4JR3A 4YPSA 1BI8A 2JBPA 4IAKA 4L8MA 4QYHA 4V0GA 5CY3A 3BPRA 1GIHA 2OBJA 4XP0A 5BVKA 2A4LA 5CSXA 1U54B 3HV7A 1QL6A 4YMJA 4EK8A 1YKRA 3R30A 2BHHA 5HO6A 4X6QC 3FHIA 4W4XA 5HIBA 5FBNC 2VO0A 3L9PA 3ZUUA 3UPZA 2VWUA 4EWQA 2QODA 2XRUA 4F1TA 4E20A 3A7HA 1FGIA 3EN6A 4YJTA 2BTRA 4FTMA 2W99B 3GI3A 3MPMA 4ZS0A 4KRCA 3P4KA 3RWQA 3BYVA 5DWRA 2P2IA 3DAEA 4AN9A 3EN7A 2P33A 4OLIA 3REPA 3EKKA 4J98A 2F4JA 5M44A 2XNBA 3LIJA 4E26A 4EKLA 1YHVA 2JDOA 3TJDA 5DRDA 1PMNA 2UVYA 5DR9A 1OKYA 5EDRA 4PTCA 4AG8A 4FTNA 2EVAA 1YOMA 3HRBA 3QF9A 5C9CA 5JFWA 3C9WA 2B9IA 4X2NA 2XB7A 5AX9A 2UW0A 5H9BA 5C27A 4PP7A 1UWJA 3MY1A 3ZSGA
chains in the Genus database with same CATH topology
1W2CA 1TZDA 2A98A 2X0QA 2X0PA 4FRFA 2IF8A 4O4CA 4O4FA 4O4DA 2AQXA 4O4BB 4O4EA 1W2DA 2IEWA 1W2FA 2X0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2C A;  1TZD A;  2A98 A;  4FRF A;  4O4C A;  4O4F A;  2IF8 A;  4O4D A;  2AQX A;  4O4B B;  4O4E A;  1W2D A;  2IEW A;  1W2F A; 
#chains in the Genus database with same CATH topology
 5AAE A;  4FV0 A;  3KRX A;  2IVT A;  2XVD A;  2ZB1 A;  2A27 A;  5HX8 A;  2PVR A;  1U46 A;  1B39 A;  2DYL A;  3GC9 A;  4ZLZ A;  2LGC A;  3IK3 A;  2W4O A;  4ANS A;  3QWJ A;  4IIR A;  5E91 A;  2UW7 A;  3BU5 A;  4E3C A;  1JSV A;  4YO4 A;  2X9E A;  3NWW A;  3PJC A;  4CCB A;  4D4Y A;  3ZFM A;  5K0X A;  3LFD A;  4K2R A;  3QRJ A;  3FME A;  3MTL A;  1ZWS A;  3P86 A;  4HPU E;  3PIY A;  2HZN A;  5AR8 A;  5I9X A;  4JDI A;  3KL8 A;  2WHB A;  3DBE A;  2JD5 A;  1URW A;  1JWH A;  4FVP A;  4GK3 A;  4I3Z A;  4IAC A;  3QRU A;  5E90 A;  1MRV A;  3BBT B;  4G1W A;  3QZI A;  4AWI A;  4NM3 A;  3AD5 A;  5CEI A;  5IME A;  4EOQ A;  4IWP A;  4KIP A;  3ZSH A;  4DLI A;  2PVL A;  3PJ3 A;  4E4L A;  3UGC A;  4YZC A;  3DY7 A;  5L2I A;  4DH8 A;  4PQN A;  1ZOE A;  5A4C A;  3DPK A;  4ZJV A;  1V0B A;  3ULZ A;  4F6W A;  4RZV A;  1R3C A;  4RSS A;  5TO8 A;  1Y8G A;  5H3Q A;  5M4C A;  4BDD A;  4D0X A;  4EZ5 A;  2OF4 A;  3ALN A;  4BIE A;  4EH4 A;  3ZZW A;  5LVN A;  4TTH B;  5DOS A;  4DTK A;  3VJN A;  3QKL A;  4L3P A;  4A9S A;  3V04 A;  3I0O A;  4UYN A;  5AJQ A;  3MWU A;  5AUW A;  2WZJ A;  4N6Y A;  3HMN A;  2XUU A;  3GCV A;  5L2T A;  3EID A;  4MHA A;  5JMS A;  4GV1 A;  3PFQ A;  1RE8 A;  4OW8 A;  4G9C A;  3DK6 A;  4IFG A;  4UMQ A;  4ENX A;  5M56 A;  3NX8 A;  3SXF A;  2PML X;  4G5P A;  5KKR C;  2J4Z A;  2J5F A;  1UU3 A;  1MUO A;  4YZB A;  4QYY A;  3ROY A;  3A2C A;  1YXV A;  4YJQ A;  4FUY A;  1W2F A;  4OTQ A;  2R0I A;  3W2O A;  4YNO A;  2ITU A;  3GCS A;  2F49 A;  3RHX A;  5J7B A;  3QX2 A;  4N0S A;  3FLW A;  4BDE A;  1H1R A;  3COI A;  3MH1 A;  3PSB A;  1SVE A;  3BRB A;  2XIZ A;  5LVO A;  5T68 A;  2GNL A;  2WMU A;  4HGS A;  4ASX A;  4D1X A;  2WMR A;  4HJO A;  4NFM A;  2X8E A;  3I6W A;  4BRX A;  4F1M A;  2YM4 A;  4QTD A;  3FLN C;  2YIW A;  5HID A;  3GFE A;  3UZP A;  4KRD A;  3QQH A;  5GZ9 A;  2CLX A;  2VTO A;  4TKS A;  5C1Q B;  2C6T A;  2GHL A;  1BMK A;  2PSQ A;  3KCK A;  2ERZ E;  4L7F A;  1H07 A;  1W0X C;  3I7C A;  5L6O A;  5FDX A;  3DBD A;  4XX9 A;  2H96 A;  2VX3 A;  4XRJ A;  5TF9 A;  5A9U A;  1NVR A;  3UVQ A;  3W2R A;  2HZI A;  3LLT A;  3BU6 A;  5B7V A;  4CKR A;  1E9H A;  2PE0 A;  4F7N A;  4ZZO A;  4MAO A;  3P08 A;  1VYZ A;  5J9Y A;  1OKZ A;  1WMK A;  4CLJ A;  3AGL A;  3HEG A;  2X7O A;  2JKM A;  4F99 A;  3VBQ A;  4YJP A;  2YAC A;  4YZM A;  2YDJ A;  1M7Q A;  3E88 A;  5CZI A;  3V5L A;  3CY2 A;  3GQL A;  1OIU A;  3DJ5 A;  3QZG A;  3V5W A;  4U6R A;  3ZLW A;  3RVG A;  4TWC A;  2W4J A;  4AFE A;  3RKB A;  1OL2 A;  3E93 A;  3HGK A;  4GG5 A;  4ID7 A;  4AW5 A;  4BCF A;  3A7I A;  3DT1 A;  2H9V A;  4C3F A;  2R0U A;  1H1W A;  3HUB A;  4C34 A;  5B0X A;  4GJ2 A;  4A9T A;  3W16 A;  4FSN A;  2W7X A;  4EHE A;  2Y4I B;  4BCQ A;  4PNK A;  4QNA A;  1K2P A;  4FTI A;  4MYG A;  4UYA A;  3O50 A;  3R04 A;  4FT3 A;  1XBC A;  2VGP A;  4NH1 A;  3RCD A;  3G2F A;  1M14 A;  1S9I A;  4C4H A;  2JGZ A;  3OEZ A;  1JPA A;  4EOM A;  4PNI A;  2WTI A;  1P2A A;  4KA3 A;  5HLW A;  5A6N A;  5DT0 A;  4BVU A;  4ASE A;  5CT0 A;  5IUG A;  2A0C X;  2OKR A;  5IA3 A;  5LOH A;  1QPD A;  2IO6 A;  4E5W A;  2GTM A;  2UW9 A;  3EKN A;  1UKI A;  3NCG A;  1WBV A;  3EFL A;  1PME A;  4ZZM A;  4EOR A;  4ZY5 A;  3OCG A;  3ZFX A;  1K3A A;  3FMN A;  4YBJ A;  2OIC A;  5AP0 A;  5ETA A;  4B8L A;  4BWX A;  4IB5 A;  4E5B A;  3RWP A;  2PK9 A;  4FKV A;  5AV2 A;  3GC7 A;  4TYG A;  2J5E A;  4XP2 A;  1WCC A;  4XOY A;  4EI4 A;  5EH0 A;  2R3K A;  2UUE A;  2QNJ A;  5L2Q A;  4DGG A;  4IQ6 A;  3SV0 A;  4X0M A;  2JII A;  5HOR A;  4G3E A;  1ZYL A;  4OT6 A;  3DKC A;  3MA6 A;  3AQV A;  4ANN A;  4DG0 E;  3NAY A;  2WPA A;  5KHX A;  5GHV A;  1BX6 A;  3LAU A;  5TR6 A;  5CSP A;  5AR5 A;  1H8F A;  3V01 A;  2HXQ A;  3DKG A;  3W1F A;  2Y8O A;  4BKJ A;  3CY3 A;  4YJR A;  3QZH A;  4MTA A;  4Y5Q A;  3CD3 A;  3UOD A;  2UZV A;  3LQ8 A;  3Q4C A;  4BDB A;  3LQ5 A;  3W8Q A;  5CU0 A;  2A98 A;  3DQW A;  3F88 A;  2X9F A;  3UE4 A;  4FSU A;  4L3J A;  3KRL A;  2QOB A;  2X0G A;  4J95 A;  4YU2 A;  2EB2 A;  3M2W A;  4JS8 A;  2HW7 A;  5AIR A;  4FA2 A;  1K9A A;  2G1T A;  3OOG A;  4X21 A;  3Q6U A;  4K8A A;  5J95 A;  3LXN A;  1UNL A;  3E63 A;  3ZH8 A;  3WZK A;  5CAP A;  4ANO A;  2VTP A;  5CF5 A;  3ERK A;  4QQ5 A;  2GNF A;  2X6E A;  4I94 A;  3MVH A;  4RLK A;  5HE0 A;  4F7J A;  3QA0 A;  2V7O A;  5HCY A;  3OOM A;  3OW3 A;  4QQC A;  3FMD A;  4E4N A;  5CAL A;  5EOB A;  4IX3 A;  3QD4 A;  4QOX A;  3JUH A;  4X3F A;  2PE2 A;  2OJF E;  3OBJ A;  4NUS A;  5EYM A;  5DH3 A;  4E6Q A;  5IH5 A;  3QHR A;  3VUT A;  4D4S A;  4DFN A;  5C26 A;  1PMU A;  4FZ6 A;  4NTS A;  4ACH A;  3BE9 A;  2XNP A;  4BZD A;  3C4X A;  5J5T A;  3OWJ A;  2YIS A;  3QFV A;  3CKX A;  2XZS A;  4FII A;  2WNT A;  4CFM A;  4XLI A;  1RQQ A;  3KXX A;  2CGX A;  3O2M A;  4M14 A;  1FMK A;  1URC A;  3UDB A;  3C4E A;  4WUN A;  4WNK A;  3MY5 A;  3KMM A;  3PG3 A;  3MVL A;  4O4C A;  2WQM A;  5CF6 A;  1Q4L A;  2C68 A;  2E9P A;  4F4P A;  3POO A;  4APP A;  4YC8 A;  2BIK B;  2GQG A;  4Y95 A;  5EW9 A;  1BKX A;  2WIH A;  3MPA A;  4Y73 A;  3GEQ A;  3BIZ A;  4W4W A;  2GNI A;  4TY1 A;  3TKI A;  3ZDU A;  5C8M A;  3LM5 A;  3OT3 A;  2UW8 A;  5HHW A;  4KS8 A;  3D5U A;  4LMN A;  2RG6 A;  3R0T A;  1HOW A;  4F9B A;  5IPJ A;  4MXZ A;  2BAK A;  4IB0 A;  2BIY A;  1YOJ A;  4EZ7 A;  2GCD A;  3ETA A;  3S2P A;  4X7Q A;  5CSW A;  2LAV A;  4EK6 A;  1EH4 A;  3BYM A;  3DZO A;  4JL9 A;  4C8B A;  4F9C A;  5GJD A;  4RX5 A;  4X2K A;  4GS6 A;  5AP7 A;  5DE2 A;  2RFD A;  5KMO A;  1H4L A;  5LVL A;  3VS7 A;  3FV8 A;  3SXS A;  5CSH A;  2FSM X;  2J0K A;  3GEN A;  4M8T A;  3VS6 A;  4H39 A;  5M51 A;  2OIB A;  3BYS A;  4GK4 A;  1YXT A;  4AXA A;  5CEK A;  2WEV A;  3PYY A;  5HVK A;  4I20 A;  2J0I A;  1G3N A;  1UU9 A;  3VS4 A;  4WBO A;  4I6H A;  2PVK A;  4MQ1 A;  3FHR A;  2XEZ A;  2C6E A;  4IM2 A;  3BCE A;  2CJM A;  4UWB A;  4I24 A;  1YI3 A;  3DDQ A;  5HBJ A;  2NP8 A;  5D11 A;  3E64 A;  3E8C A;  4ZTL A;  3LJ1 A;  4JLC A;  4ZOG A;  3C4W A;  4MXY A;  1FVR A;  2RSV A;  4XBR A;  3WZD A;  1ZY4 A;  5CXH A;  4FV5 A;  4O4B B;  4K9Y A;  3DND A;  4DGL C;  4G3G A;  4F09 A;  3P78 A;  3R21 A;  4ZXT A;  3R7U A;  4D2P A;  4FKI A;  4XRL A;  4FOB A;  3HMP A;  3CPC A;  3LOK A;  3TKU A;  3S95 A;  3BEL A;  2I6L A;  5EKO A;  1FPU A;  2HCK A;  5AR4 A;  5AUX A;  2B7A A;  4MNE A;  4AT5 A;  3AD6 A;  4DH3 A;  2VO6 A;  3MS9 A;  2FH9 A;  5AV3 A;  4MNE B;  5JGB A;  1JKL A;  5CS6 A;  1Q41 A;  4CYI A;  4PPB A;  4IE9 A;  2UZE A;  3O8U A;  4KBK A;  4EJN A;  3OEF X;  4FKR A;  3UIB A;  5LQF A;  2OH0 E;  3PXF A;  4BKY A;  3PVW A;  4QP1 A;  2C5N A;  1L3R E;  3EQF A;  4P7E A;  2A19 B;  4WD5 A;  2PZY A;  3TZ9 A;  5KBR A;  4LFI A;  3ORN A;  2BZH B;  2PZI A;  3BHV A;  4HW7 A;  5FEQ A;  3IDC A;  5IA4 A;  4TYE A;  2PTK A;  4JOA A;  4M15 A;  4U79 A;  4XMO A;  1UA2 A;  4FZA B;  5DT4 A;  3FLZ A;  5LJJ A;  5JH6 A;  4IJP A;  4AGD A;  3B8Q A;  2C47 A;  1NVS A;  4UWC A;  4YLK A;  2C0I A;  3LJ0 A;  3W2Q A;  2ZDT A;  3UNJ A;  3IKA A;  5JZJ A;  1CKI A;  3D7T A;  3S4Q A;  3SRV B;  5IDP A;  4Y85 A;  5H8E A;  2XK6 A;  2QCS A;  1AGW A;  3OY3 A;  3QWK A;  3RTP A;  4XG8 A;  3FZR A;  2FST X;  3D5V A;  5DVR A;  4OBQ A;  1GIJ A;  2W96 B;  4HVS A;  4M66 A;  5A4E A;  1H25 A;  4L45 A;  4JRN A;  4ANQ A;  1W2D A;  3UVR A;  5HO7 A;  5LMK A;  4YGA A;  4FBX A;  4RLL A;  2ITO A;  3ORX A;  3GBZ A;  4O1P A;  4QP8 A;  3E62 A;  2YIX A;  5CVG A;  5D7A A;  1HCK A;  2ZB0 A;  2ZV7 A;  2XF0 A;  1YDS E;  3FKO A;  2YLE A;  1E1V A;  4ENY A;  4OTR A;  2PMN X;  2EUF B;  1RJB A;  3HV6 A;  5DA3 A;  4DYM A;  3DFC B;  1NA7 A;  3GCU A;  1AQ1 A;  4ITH A;  3B8R A;  4ZSE A;  2ZV8 A;  2OK1 A;  5DIA A;  1O6K A;  2J50 A;  2B52 A;  2R3H A;  3CR0 A;  5IH4 A;  3FZS A;  3KEX A;  3PRF A;  3SD0 A;  4LRM A;  2YM3 A;  2O64 A;  1KE6 A;  4CV8 A;  2XNM A;  4UBA A;  1SM2 A;  2X81 A;  5IU2 A;  1H27 A;  3VUG A;  5ANE A;  1S9J A;  3ZRL A;  3PRI A;  3FLY A;  5FWK K;  1OEC A;  3A60 A;  3EFJ A;  1R1W A;  5HKM A;  5FG8 A;  2QHM A;  4HCU A;  1GNG A;  5CI7 A;  2YM8 A;  5HU9 A;  4O0R A;  4DHF A;  2C3K A;  3NW6 A;  4RIO A;  2PY3 A;  4XG7 A;  4MED A;  4ASD A;  2JFL A;  5ANG A;  2BHE A;  3T9I A;  4C02 A;  3UZT A;  3A61 A;  4FSR A;  4OAV B;  2VAG A;  3UPX A;  4FT5 A;  2O63 A;  3HA6 A;  3VUH A;  4HZR A;  4NZW B;  2XIY A;  3K3J A;  5HCX A;  4BKZ A;  1QMZ A;  2BFX A;  2GDO A;  3HYH A;  2HOG A;  2Z60 A;  4RIY A;  5ACB C;  3ZO1 A;  3L8V A;  2X0O A;  4BCG A;  2VTH A;  3MTF A;  4H3P A;  2BUJ A;  2XS0 A;  4QP2 A;  5D10 A;  5I9U A;  5IUI A;  5LAR A;  4K18 A;  4CFW A;  3R8Z A;  1WBW A;  5ETI A;  4C0T A;  4R6V A;  3VQU A;  1ZMV A;  3FL4 A;  4GW8 A;  5F4N A;  4OTG A;  4RX8 A;  3E7O A;  1XBB A;  4I5M A;  4U44 A;  3RAK A;  1U59 A;  3QAL E;  4FL1 A;  5FQD C;  4BBM A;  3KN5 A;  3ORK A;  2YDK A;  2YAK A;  3Q9X A;  4BDI A;  1CDK A;  4JR7 A;  3FI4 A;  3F5G A;  3AC3 A;  2PZP A;  3DDP A;  3NPC A;  4UZD A;  4LYN A;  2XK4 A;  5LWN A;  4FT0 A;  2QOF A;  2J0M B;  5CEN A;  2IVS A;  4BTK A;  4FX3 A;  1JQH A;  3RPR A;  1I09 A;  4FTT A;  1UU7 A;  4U8Z A;  2QU6 A;  3MW1 A;  4I1Z A;  4JG8 A;  3F3W A;  4JX3 A;  4P4C A;  3LCT A;  4DFX E;  2EXE A;  2PL0 A;  1UU8 A;  5CSV A;  4D4V A;  4WKQ A;  1CKJ A;  4ASZ A;  4BZO A;  4FKT A;  4ANM A;  3OFM A;  3BWF A;  1TQM A;  1WVX A;  2WOT A;  5JFV A;  4RJ5 A;  2ESM A;  2WO6 A;  2V5Q A;  4OTF A;  2WU7 A;  5CF8 A;  1ZAO A;  5CVF A;  5JZN A;  3DU8 A;  4BYJ A;  3LFN A;  1QPJ A;  2UZN A;  4QML A;  4YZN A;  4NT4 A;  4F0I A;  4PRJ A;  1OKV A;  3EWH A;  3LFB A;  3NYV A;  3R6X A;  3PY0 A;  5FBO A;  1Z5M A;  4TND A;  4D9T A;  2AC3 A;  2E9V A;  4JX7 A;  4GVJ A;  4D28 A;  2CGV A;  3KRW A;  3MJ2 A;  3T9T A;  3UVP A;  4AW2 A;  2WOU A;  2RL5 A;  4KIQ A;  4ZTQ A;  4O2P A;  5JRQ A;  4TXC A;  2E9U A;  3MB6 A;  4IAF A;  2ZMC A;  1OIQ A;  5AX3 A;  3FZO A;  4KKH A;  3Q4T A;  2Z7S A;  3GU5 A;  4UMR A;  4FOD A;  2GS6 A;  3BE2 A;  4D2R A;  3CCN A;  5AP2 A;  3DCV A;  4IJ9 A;  3R7I A;  3ZTX A;  4F6S A;  3CTJ A;  3UNK A;  3OY1 A;  3EYG A;  4CMU A;  5FP6 A;  3W2S A;  1OVE A;  3IW7 A;  2Q0B A;  3C7Q A;  2B9H A;  5AR2 A;  3GU7 A;  3KUL B;  4OTD A;  3VNT A;  1XH8 A;  4V04 A;  5CWZ A;  4NM7 A;  3THB A;  3ZLY A;  3FJQ E;  4BGQ A;  4C4F A;  1V0P A;  3KY2 A;  4FTO A;  2UZW E;  3D5W A;  4ZZN A;  2HEL A;  4I4F A;  3BEG A;  5AUZ A;  3B2W A;  3U4U A;  3MB7 A;  3GUB A;  5AMN A;  2OWB A;  3R1N A;  3R63 A;  5IKW A;  3QTX A;  4N70 A;  3DKO A;  3GB2 A;  4Y46 A;  2JC6 A;  2WU6 A;  5BVO A;  2B1P A;  1NY3 A;  2V7A A;  2BRM A;  4XG6 A;  4Q5H A;  4ZJI A;  3NZ0 A;  4GG7 A;  3UQF A;  5IG1 A;  4NM0 A;  3R9H A;  2VTL A;  2OJ9 A;  4JQ8 A;  2I0E A;  2RG5 A;  3P23 A;  4P5Q A;  3PA4 A;  3IO7 A;  4W8E A;  3T3V A;  4GT5 A;  3TCP A;  1YI4 A;  1X8B A;  4CT1 A;  4BC6 A;  2XK8 A;  3RCJ A;  4M68 A;  2JKO A;  2B53 A;  3MI9 A;  2ZM1 A;  2YER A;  1XWS A;  4G3F A;  3ZXZ A;  4BCK A;  4CEG A;  1UWH A;  3HRF A;  3QRK A;  4BID A;  4EH5 A;  3QQL A;  3FUP A;  3QKK A;  1MP8 A;  2A1A B;  3GNI B;  3KFA A;  2H6D A;  2WMQ A;  2VWX A;  4FMQ A;  2IWI A;  4CSV A;  2E2B A;  4Q9Z A;  1KE7 A;  2BDF A;  5I3O A;  3CC6 A;  3KXM A;  3WF8 A;  1TKI A;  1U5R A;  2W05 A;  5JFX A;  2WTW A;  4L9I A;  3RZF A;  3WOW A;  4F9A A;  2HY0 A;  4BGH A;  4O4F A;  4G34 A;  4JT3 A;  4RG0 A;  5K3Y A;  4D2T A;  4ANB A;  2FB8 A;  4BYI A;  5EW8 A;  1OIR A;  2YEX A;  1Q8Y A;  2QU5 A;  2X7G A;  3BU3 A;  2YIQ A;  3PPJ A;  3R8V A;  4CNH A;  1GZO A;  5FRI A;  4DEA A;  5B2M A;  4UX9 A;  3NUX A;  3MFT A;  5DGZ A;  4CQG A;  1T45 A;  1H00 A;  3GOP A;  3IDB A;  5CNO A;  3VHK A;  2OXX A;  3HZT A;  4ACM A;  3DOG A;  1WBO A;  4AX8 A;  5CAV A;  2EB3 A;  4DFY A;  1BL6 A;  3OBG A;  3QQJ A;  2B9J A;  4UY9 A;  4L68 A;  4W4Y A;  2R3Q A;  3PXR A;  4PL3 A;  3AOX A;  4HYH A;  4JBV A;  4G31 A;  3GC0 A;  3MJ1 A;  4AW0 A;  3A8X A;  4C33 A;  2ETR A;  1A9U A;  3KK9 A;  4J71 A;  4DIT A;  3FQE A;  5H8G A;  3TG1 A;  5KZI A;  3LPB A;  4O0X A;  5K0K A;  5DR2 A;  2IN6 A;  3R73 A;  1YXU A;  2ZYB A;  4CD0 A;  3JXW A;  3KK8 A;  4I93 A;  3ZC6 A;  4O2Z A;  3S00 A;  4IHP A;  3BHH A;  3UOJ A;  2CCI A;  3GCQ A;  4NW6 A;  1ZZ2 A;  4IX4 A;  3PA3 A;  3QBN A;  5AP5 A;  3Q4U A;  4QP4 A;  5J1W A;  4H3Q A;  4L3L A;  3ZO2 A;  3U9N A;  4AZS A;  4XNE A;  5EI6 A;  3BEA A;  2WTC A;  3Q52 A;  4R1V A;  4C3P A;  3K2L A;  5EM6 A;  2OJJ A;  2XYU A;  3EL8 A;  3NNW A;  3OZ6 A;  4ZSG A;  2R3I A;  4GFG A;  2XCK A;  3HMM A;  4RX7 A;  4TWN A;  4S33 A;  3GVU A;  4U80 A;  5A54 A;  2HXL A;  3D2K A;  4BTF A;  3R8U A;  3VID A;  2JDT A;  2Y6O A;  4GH2 A;  4USF A;  4DN5 A;  3PPK A;  3OXZ A;  4YTC A;  3UP7 A;  3M42 A;  4U3Y A;  2CSN A;  2I0H A;  3RHK A;  3ZEW A;  2BZJ A;  3ORO A;  3RAL A;  4QP7 A;  2ETM A;  5IA5 A;  3I6U A;  4RWJ A;  4ACG A;  3P7C A;  1ZYD A;  2HWO A;  4IM0 A;  5EHO A;  2VTI A;  3MIY A;  3OUN B;  2ONL A;  2GNG A;  4C3R A;  1O6L A;  5E1E A;  3CJF A;  5M53 A;  3IDP A;  4ZY6 A;  5HEZ A;  3ZSI A;  3C4C A;  4DG3 E;  4FKG A;  3RBW A;  3U87 A;  2Z7L A;  3AGM A;  3COH A;  3L9L A;  2JDS A;  3TV6 A;  4WHZ A;  3F66 A;  2P55 A;  3DLZ A;  3OVV A;  3TXO A;  4MX9 A;  4TPT A;  3VUK A;  5ANO A;  3DV3 A;  4CMO A;  1OM1 A;  1WAK A;  2Z7Q A;  5AND A;  2HIW A;  4LMU A;  2DS1 A;  4EQC A;  3EN4 A;  3TNQ B;  3P7B A;  3Q5I A;  4O4D A;  3T8O A;  3LVP A;  2NRU A;  2VWZ A;  2XKE A;  4EL9 A;  4M12 A;  4F64 A;  1JKK A;  4U40 A;  3BX5 A;  1IEP A;  3UG1 A;  3F61 A;  3AC1 A;  3EQD A;  2X4F A;  3GOK A;  4L43 A;  3QRT A;  5FXS A;  4D58 A;  4EK5 A;  1OZ1 A;  3ZU7 A;  3W2C A;  4YUQ A;  3QCS A;  5HCZ A;  2YZA A;  4C57 A;  4AGU A;  4E6A A;  3PIX A;  1MQ4 A;  2FSO X;  5HG9 A;  3ZEP A;  5GNK A;  3TUC A;  2VX1 A;  3ENM A;  3CXW A;  3JS2 A;  4N6Z A;  4OR5 A;  4OBP A;  5I4N A;  2QO7 A;  1H01 A;  1XH4 A;  1ZRZ A;  4LUE A;  3DAK A;  3TNP C;  3VWA A;  5K5X A;  3QD3 A;  2XK7 A;  4GYG A;  4J96 A;  4KIK A;  4CT2 A;  5C01 A;  2W5B A;  3TEI A;  4AFJ A;  4F9W A;  4EH2 A;  1AD5 A;  4RC4 A;  5BX0 A;  1P4F A;  3PVB A;  2VTJ A;  5AAG A;  5HE3 A;  4A9Y A;  4B9D A;  4U3Z A;  3U6H A;  4DGM A;  2WMB A;  2X4Z A;  1IR3 A;  4GU9 A;  3MSS A;  3BGQ A;  3NIZ A;  4G3D A;  2VNW A;  4MXC A;  2AQX A;  3N51 A;  5DRB A;  5BYZ A;  3CS9 A;  1XHA A;  2JDV A;  2YIT A;  3D94 A;  4RJ3 A;  4I22 A;  4AS0 A;  4B4L A;  4ZSA A;  4LOP A;  4TT7 A;  3UQC A;  1Q8Z A;  3R02 A;  3SKC A;  3DTW A;  3WF5 A;  4QMN A;  5KMN A;  2CGW A;  3H3C A;  4ZJJ A;  2UW4 A;  2B55 A;  3WIL A;  2B54 A;  2WEL A;  3VUD A;  3O23 A;  2C1A A;  3TL8 A;  4I6F A;  5D12 A;  4BHZ A;  3G9N A;  4QMS A;  4O0T A;  2QO9 A;  5HQ0 A;  4AZF A;  4KWP A;  5I0B A;  2WTK C;  2XNE A;  4AF3 A;  1Q8W A;  5IH6 A;  2QLQ A;  3GP0 A;  4QYE A;  4M67 A;  4UN0 C;  4J97 A;  1BYG A;  2RFN A;  4LGD A;  4M7I A;  4ZAU A;  3QQG A;  4QP6 A;  5FTO A;  2C6I A;  5ICP A;  2W9Z B;  1DAW A;  5GZ8 A;  1JVP P;  5EW3 A;  4AA4 A;  4BDF A;  3ORM A;  4JNW A;  4AZV A;  4EH6 A;  3BGZ A;  2J6M A;  3F5U A;  1M17 A;  3MY0 A;  5J5S A;  3ORT A;  4RWL A;  4YHJ A;  3NUP A;  3WAR A;  4MBL A;  4C4G A;  3MN3 A;  4XYF A;  5B2L A;  3AC4 A;  2BRO A;  2JKK A;  4ZEG A;  4QTB A;  2F2C B;  4YJV A;  1TZD A;  4L00 A;  4BI0 A;  4DGN A;  4QMW A;  3BQR A;  4C36 A;  4IH8 A;  2UW5 A;  4A9R A;  3Q04 A;  2BRG A;  4YZD A;  2WMT A;  5JN2 A;  2C0O A;  2IZT A;  3DB8 A;  2C30 A;  2RFE A;  5CF4 A;  1PXN A;  3OCS A;  3FZ1 A;  4TWP A;  4BF2 A;  1OGU A;  5HNG A;  4LOO A;  3KQ7 A;  5CEM A;  3R7E A;  3PVU A;  5BUI A;  1ZOG A;  2OI4 X;  4U42 A;  3V5J A;  2P4I A;  4HCT A;  4W9X A;  4AUA A;  4HNI A;  1IAS A;  3MFS A;  2C6M A;  2CLQ A;  1BUH A;  3ACK A;  4AN3 A;  5CAO A;  1M7N A;  3V8T A;  3D15 A;  3Q2M A;  1PJK A;  4AGC A;  4PP9 A;  5H8B A;  3OTV A;  4R1Y A;  2OFV A;  4YZ9 A;  3OD6 X;  4U9A A;  4D9U A;  4HYS A;  4I0R A;  2OG8 A;  4QTC A;  1ERK A;  5KMI A;  1KE9 A;  2VWI A;  2VWV A;  1PHK A;  2CGU A;  2C69 A;  4D2S A;  3UBD A;  2R7B A;  1OUK A;  2JIU A;  3BZ3 A;  1R39 A;  2W1Z A;  3UYT A;  4CCU A;  1JBP E;  1H26 A;  1XO2 B;  3DNE A;  2HW6 A;  3RPS A;  1H1S A;  3NGA A;  5CQU A;  3IW4 A;  4IB3 A;  3BV2 A;  3QZF A;  4NK9 A;  3SX9 A;  4TRL A;  2ZOQ A;  3F9N A;  3SA0 A;  4PL5 A;  2O65 A;  4H36 A;  5E7R A;  3V8W A;  2QOI A;  3MH2 A;  4O1O A;  5FED A;  4IWO A;  4MK0 A;  1RW8 A;  3NUN A;  4L44 A;  4Z9L A;  3DB6 A;  2UW6 A;  1W7H A;  2ZDU A;  4IVD A;  4F1O A;  5HU3 A;  4FR4 A;  3MPT A;  4WNP A;  3ZFY A;  3TAC A;  2WFY A;  4P5Z A;  5HE2 A;  4FTR A;  2GNJ A;  3HDM A;  2PZ5 A;  2QC6 A;  1H28 A;  1R0P A;  3W33 A;  3PSD A;  3KKV A;  5HG5 A;  4ANL A;  2C5Y A;  3IQ7 A;  4KKE A;  3C5U A;  4MBI A;  4NWM A;  4UEU A;  3ZO4 A;  3D83 A;  4YTI A;  4ERW A;  4K77 A;  2QHN A;  4FZ7 A;  3V6S A;  1LEZ A;  4L67 A;  1BLX A;  3F6X A;  2Y4P A;  4FZD B;  1J1C A;  1KOA A;  1IG1 A;  2SRC A;  3F69 A;  3FZP A;  2BFY A;  1FQ1 B;  4AA5 A;  3PUP A;  4FUX A;  4GIH A;  3NYO A;  5DLS A;  4FV9 A;  3ZS5 A;  3BWJ A;  3O8P A;  4CFN A;  5HIC A;  4RVT A;  4C62 A;  3RAW A;  5CEP A;  5GJG A;  2UZD A;  2YLF A;  3C4Z A;  3KU2 A;  4FV6 A;  4O0V A;  5K9I A;  3UO4 A;  2CPK E;  4EOP A;  3PWD A;  4USE A;  3WF7 A;  4RIW B;  2EU9 A;  2J0J A;  4YP8 A;  3CE3 A;  3R1Q A;  3GU6 A;  1W84 A;  5E8S A;  1Q5K A;  4FG7 A;  2QI8 A;  4EBV A;  2ZAZ A;  1MRY A;  4RC3 A;  5L3A A;  5D1J A;  2CMW A;  3WF6 A;  3AMA A;  1Q97 A;  3FC1 X;  5CEO A;  4FTJ A;  3R7V A;  3LFS A;  1I44 A;  4JRV A;  4FC0 A;  3TWJ A;  2F7X E;  5C03 A;  3RNY A;  3FPQ A;  4F9Y A;  4MBJ A;  5IA2 A;  1XKK A;  3EQC A;  2QOQ A;  4U45 A;  3QQK A;  4AA0 A;  4EYJ A;  5JSM A;  4IB1 A;  5IZF A;  4I4E A;  3SXR A;  1W82 A;  4NEU A;  5JT2 A;  3IS5 A;  2G15 A;  4BCH A;  1YHS A;  5A6O A;  4AN2 A;  4FSZ A;  4HVI A;  2WQE A;  4NCT C;  2QR7 A;  4XHK B;  3HLL A;  3R28 A;  3S3I A;  2X2K A;  2W5H A;  1YWV A;  4ACC A;  2XM9 A;  4FK6 A;  3K3I A;  3FQS A;  4RJ4 A;  3IGG A;  5ETC A;  3G6G A;  4A9U A;  1Q99 A;  1YVJ A;  2WMV A;  3DTC A;  4XEY A;  5HES A;  1F3M C;  3OTU A;  3QTI A;  2HEN A;  3VAP A;  3RPO A;  3SLS A;  2IW6 A;  3A7F A;  3KN6 A;  4IAY A;  1W98 A;  4RJ8 A;  4EH9 A;  5F95 A;  4H3B A;  5HBH A;  5BVW A;  2YA9 A;  4FKW A;  5BVN A;  4J1R A;  4CKI A;  2OIQ A;  1GII A;  4J8N A;  3KXN A;  2W1G A;  3BLH A;  4O0W A;  3VBX A;  3ODY X;  4AOI A;  1M52 A;  5EOL A;  4BZN A;  3QC9 A;  4F08 A;  2IJM A;  3AC5 A;  3NNX A;  4IWD A;  4LGH A;  4OT5 A;  3W32 A;  5T3Q A;  5BYY A;  4WRG A;  3KCF A;  3A4P A;  4PUZ A;  4HGT A;  3CQW A;  4FYO A;  4O38 A;  5HI2 A;  3JY9 A;  4FTK A;  3U6I A;  5JRS A;  2C3L A;  4FIH A;  2C5X A;  2VTN A;  5IA0 A;  2CCH A;  3EQP A;  1OMW A;  2C6O A;  4NIF A;  2WTK B;  4BCN A;  1PXI A;  4FKQ A;  2J7T A;  4II5 A;  5CNN A;  4MH7 A;  3R7O A;  2YIY A;  3DBQ A;  3KF7 A;  4YJN A;  2ETK A;  4WO5 A;  3RK7 A;  3EZR A;  5C8K A;  2YJS A;  2VGO A;  4R5S A;  4WNM A;  2P3G X;  4KIO A;  3UQG A;  3T3U A;  4I6Q A;  3ACJ A;  3ORI A;  4Q2A A;  4WIH A;  2C6L A;  4JBO A;  4M69 B;  1TQP A;  5DEY A;  3V5Q A;  5JKG A;  4AAA A;  5L2W A;  4UMT A;  3UP2 A;  5LVP A;  3P79 A;  4OUC A;  1REJ A;  2XYN A;  3OUK A;  1B38 A;  5M57 A;  5DNR A;  5FTQ A;  4X2J A;  3FXZ A;  3ZO3 A;  4C35 A;  4YUR A;  3WIK A;  3QU0 A;  4I41 A;  4F63 A;  1DS5 A;  1RDQ E;  2PVY A;  2ZM4 A;  2C5O A;  5HVY A;  5JGA A;  3WF9 A;  1GZK A;  2R3P A;  3PJ8 A;  4FOC A;  2C3I B;  4M0Z A;  4QO9 A;  4Z55 A;  2WMW A;  4BDH A;  3SOA A;  3EQR A;  1CM8 A;  1XH9 A;  4OAU C;  3E8E A;  1ZZL A;  3I81 A;  2WKM A;  3IEC A;  2O3P A;  1ZLT A;  2P0C A;  3OWK A;  4WG5 A;  3Q60 A;  5FLF A;  1LR4 A;  2Z2W A;  2J9M A;  3NYX A;  4RC2 A;  3GXL A;  1OIT A;  3OCB A;  4ERK A;  4TYJ A;  3FLQ A;  4Y83 A;  4ZTH A;  4EWH A;  1XH5 A;  4UWY A;  1M2R A;  5K5N A;  4QMO A;  3W55 A;  4EK4 A;  2XJ2 A;  3CP9 A;  3C13 A;  2W9F B;  2BCJ A;  3ORP A;  4IVB A;  5IUH A;  3CTH A;  4KBC A;  3KF4 A;  2BAL A;  3NYN A;  5KZ0 A;  3TTJ A;  3VHE A;  4BGG A;  4EC8 A;  5JEB A;  4FIG A;  3L9M A;  3F5X A;  5ETF A;  1JKS A;  4N4S A;  5IF1 A;  4OBO A;  5DMZ A;  4XG9 A;  4L46 A;  1Y6A A;  4AU8 A;  2IZR A;  5EDP A;  4OTI A;  1PXJ A;  4UXL A;  1W2C A;  3S1H A;  1XH6 A;  2G2F A;  4KSP A;  3QYZ A;  3SC1 A;  2XCH A;  4MD8 E;  3FY0 A;  3HP5 A;  4FV8 A;  3I1A A;  4CTC A;  4KS7 A;  3PE1 A;  4UXQ A;  1YXS A;  4MD9 E;  4XLV A;  3E8N A;  4USD A;  3UYS A;  4IWQ A;  4IVC A;  4O0Y A;  2YIR A;  4FIF A;  3OXI A;  3QTZ A;  4RMZ A;  3MV5 A;  1ZYJ A;  2ITT A;  3G0E A;  2QOO A;  4FTU A;  5L6W L;  3W18 A;  3LZB A;  3O7L D;  3PTG A;  4ZLY A;  3FBV A;  5HD7 A;  2AC5 A;  4C58 A;  3FI3 A;  4LV8 A;  2HYY A;  2REI A;  3LCK A;  5AM6 A;  2W1E A;  3RM6 A;  3TTI A;  4AW1 A;  4QQJ A;  4CZU A;  1GAG A;  4O91 A;  2F7E E;  3QGY A;  4TW9 A;  5ANJ A;  5IEX A;  4YO6 A;  2O0U A;  5KML A;  3LXP A;  4UV0 A;  5IMX A;  3ION A;  3FSF A;  3ULI A;  3NIE A;  4O27 B;  4HVD A;  3FSK A;  3QCY A;  2WB8 A;  3VC4 A;  3I79 A;  3O0G A;  4BBE A;  3G51 A;  3DQX A;  4L01 A;  2QUR A;  1A06 A;  4I5P A;  4O6E A;  5JK3 A;  2ZV9 A;  4O96 A;  5E8X A;  3ZOS A;  2QKR A;  1JAM A;  3V5P A;  4R7I A;  1F0Q A;  4DFL A;  5LMA A;  4B6L A;  4DG2 E;  3QQU A;  4D2V A;  4EOI A;  3LXL A;  4FV4 A;  4U7Z A;  3TNW A;  4IDV A;  4GFM A;  4AAC A;  5BNJ A;  4IAA A;  3L1S A;  5KO1 A;  5L8L A;  5FD2 A;  2ERK A;  3ZZE A;  3BHY A;  5I9Y A;  4I5C A;  2EWA A;  3Q32 A;  4M13 A;  1KE5 A;  2I1M A;  3NAX A;  4FKU A;  4HGL A;  4XH6 A;  4XV2 A;  4ZTM A;  3VS5 A;  3IW8 A;  2VTS A;  2OZA B;  4M69 A;  4FTC A;  3ZUT A;  4C37 A;  3Q9Y A;  4EON A;  3KRR A;  4JBP A;  4BHN A;  4X6R A;  5T6K A;  5FDP A;  2UZO A;  4OTP A;  4S30 A;  2W1F A;  3V6R A;  4L7S A;  1PYX A;  3ZYA A;  2ZM3 A;  3O7L B;  5EYD A;  3I7B A;  3QAM E;  2VU3 A;  4EHZ A;  4EYM A;  3C50 A;  4MXX A;  3VUL A;  4C4I A;  1OIY A;  5FXR A;  1OL6 A;  4ACD A;  4NIF B;  4TWO A;  2XJ0 A;  3QCX A;  4LRK A;  3GGF A;  3BHT A;  3I60 A;  3RJC A;  4ARK A;  3EJ1 A;  1M2Q A;  5FM3 A;  5LMB A;  1WVW A;  1KV1 A;  3PP1 A;  4QP9 A;  3TIZ A;  2IF8 A;  4D5H A;  4U5J A;  1LP4 A;  4QRC A;  5I9W A;  2R2P A;  5CQW A;  5AR7 A;  2OF2 A;  3PJ2 A;  1FOT A;  3EOC A;  5E8Y A;  1JOW B;  4UZH A;  3NLB A;  2FSL X;  5D41 A;  2DUV A;  1YWN A;  2V22 A;  1FVT A;  3ZUV A;  4ALU A;  1OL1 A;  4F0G A;  3C0G A;  2V62 A;  3C1X A;  3I5N A;  4M84 A;  3TIY A;  3G90 X;  1YOL A;  1WBP A;  1Q24 A;  4M97 A;  4IVA A;  4I21 A;  1PKG A;  5AUY A;  1WFC A;  3C0H A;  5IEV A;  4MNF A;  4X2F A;  3BBW A;  3II5 A;  2QD9 A;  3EZV A;  3MYG A;  4RJ6 A;  3E92 A;  4BCP A;  4F7S A;  2YFX A;  5L6P A;  3F5P A;  4FKP A;  2JBO A;  4JIA A;  5EM5 A;  3P5K A;  1CKP A;  2VTM A;  5DT3 A;  4Q5E A;  1PF8 A;  2YAA A;  1YXX A;  2R3O A;  2CN8 A;  3N9X A;  1OUY A;  5FP5 A;  3OWP A;  5HG8 A;  2WD1 A;  4G9R A;  4ZTN A;  4J99 A;  1J91 A;  4RFM A;  4EH8 A;  4AE6 A;  5HTI A;  4EOJ A;  2W17 A;  4S31 A;  2X1N A;  3P0M A;  5J9Z A;  2X2L A;  3WIG A;  2R3M A;  4FTQ A;  4CV9 A;  2X0P A;  4YLJ A;  3WI6 A;  1B6C B;  5BUE A;  2BMC A;  4C61 A;  2RGP A;  4NM5 A;  3TKH A;  3UC4 A;  3FC2 A;  3ENH A;  5G6V A;  2UV2 A;  4DIN A;  3O96 A;  2PUU A;  3QUP A;  4PPA A;  3QC4 A;  2R3G A;  2OXD A;  5CI6 A;  4IFC A;  1Q8T A;  3FMH A;  2H34 A;  3W8L A;  4FL2 A;  4B8M A;  4C59 A;  5CTP A;  3OMV A;  3QX4 A;  4XG3 A;  1HCL A;  3PY1 A;  4WUA A;  5DPV A;  2IW9 A;  1VR2 A;  5K4I A;  1E1X A;  2FVD A;  4XCU A;  2FA2 A;  4DED A;  3R83 A;  5A46 A;  1PY5 A;  2GSF A;  2W0J A;  3KVW A;  2VNY A;  2XIX A;  4QMZ A;  4CFU A;  4XS2 A;  3PLS A;  3KVX A;  3VW8 A;  4NST A;  3DXN A;  3MGY A;  4FL3 A;  4JDK A;  4GT4 A;  3UC3 A;  4C7T A;  3F82 A;  1PXO A;  2R5T A;  4PDO A;  3U51 A;  5EYC A;  4BI1 A;  2YCQ A;  2J0L A;  3QD0 A;  4FRF A;  5BMM A;  5LVM A;  1CSN A;  3KC3 A;  3NUS A;  2UW3 A;  1MRU A;  1SVG A;  2GHG A;  3HEC A;  3HMO A;  4GYI A;  3CGO A;  3R00 A;  4BTJ A;  5AP1 A;  2XNG A;  4EZ3 A;  3KRJ A;  4AOT A;  2BZK B;  2PE1 A;  2RF9 A;  2VTT A;  1SZM A;  2BKZ A;  4CYJ A;  3H10 A;  4QPM A;  4R7H A;  4BCI A;  3F3V A;  4HVG A;  1OL7 A;  3OHT A;  1JNK A;  2YCR A;  3QXO A;  3FXW A;  3HNG A;  4QMM A;  5GZA A;  4S2Z A;  5EDQ A;  2XK3 A;  5EKN A;  2QO2 A;  4ALW A;  2FUM A;  4FSQ A;  4G6N A;  4KD1 A;  1O6Y A;  3ORZ A;  4YR8 A;  2Y6M A;  3EYH A;  5D9H A;  3VF8 A;  2YCS A;  4PV0 A;  4BCO A;  2IVU A;  1BI7 A;  3HRC A;  3F7Z A;  1U5Q A;  4KAO A;  3CD8 A;  4WOV A;  4GMY A;  5M55 A;  3F3U A;  2VWB A;  4FG8 A;  4O21 A;  5L8J A;  2R3J A;  1WVY A;  3QGW A;  4BCJ A;  4MVF A;  2WXV A;  3R2Y A;  3BQC A;  4O0S A;  3LW0 A;  4WT6 A;  1O9U A;  2OO8 X;  3H9O A;  3P1A A;  1DAY A;  3TZ7 A;  1ZMU A;  4RWK A;  3SQQ A;  4U97 A;  4E5A X;  2C6K A;  4IZ7 A;  2WEI A;  5LCJ A;  4BI2 A;  1VZO A;  4MXA A;  1OI9 A;  1Q3W A;  5M4U A;  4CTB A;  3P7A A;  3FLS A;  2YJR A;  4P2K A;  4DEI A;  4S34 A;  3UJG A;  2QG5 A;  5DBX A;  4JAI A;  4F70 A;  4NFN A;  5EM8 A;  3QTS A;  4HOK A;  4UB7 A;  3BV3 A;  1YDT E;  3R1S A;  4YJO A;  2WQN A;  3FPM A;  1WBS A;  2BZI B;  3G33 A;  3PXQ A;  4TYH B;  4A4L A;  5BMS A;  3M1S A;  2UZU E;  2ZJW A;  3EQB A;  2WQO A;  1NVQ A;  3Q3B A;  4OGR A;  4R3C A;  5E8U A;  3ZM4 A;  5KNJ A;  2FGI A;  5C8N A;  3QUD A;  4J8M A;  3FE3 A;  5HO8 A;  4ALV A;  1XQZ A;  5ACK A;  1KV2 A;  4RFY A;  3R9N A;  3RM7 A;  3VF9 A;  3DLS A;  3W10 A;  4AZE A;  3EQI A;  1QCF A;  3VJO A;  4BFM A;  3HUC A;  1FVV A;  3MBL A;  2IZU A;  3QRI A;  5A3X A;  3AD4 A;  2R9S A;  3LFF A;  2GTN A;  2E9O A;  2YAB A;  5HNB A;  2ZVA A;  2PVF A;  4MXO A;  2W1D A;  3E3P A;  4IC8 A;  3R8M A;  3ROC A;  1TVO A;  5I9Z A;  3VRY A;  3EFK A;  5L4Q A;  1UVR A;  2R4B A;  5J8I A;  3RK5 A;  3EHA A;  2JKQ A;  3Q53 A;  2WQB A;  2F2U A;  3L8X A;  4EH7 A;  3CJG A;  4G2F A;  4FTL A;  4U0I A;  1YWR A;  2PZR A;  2VWW A;  2YM7 A;  3BI6 A;  4L6Q A;  2ZMD A;  1XH7 A;  3FQH A;  3D2I A;  4YSJ A;  5KMK A;  1H08 A;  2FYS A;  2QON A;  3FI2 A;  4RA5 A;  3U9C A;  3V5T A;  4AOJ A;  1P4O A;  2BRB A;  2W1C A;  2ITX A;  5IIS A;  2GS7 A;  3QTQ A;  5KE0 A;  4QMQ A;  5HVJ A;  5A14 A;  4J7B A;  4F6U A;  5I3R A;  3B2T A;  2GMX A;  4XV1 A;  2O5K A;  3OWL A;  3HV3 A;  3D0E A;  2XK9 A;  4A4O A;  4BDK A;  3A7J A;  1V0O A;  3EB0 A;  3DGK A;  1OPL A;  4WG4 A;  5A4T A;  3OF0 A;  2BAJ A;  4YNE A;  2CKE A;  3U8W A;  3HV4 A;  3IOK A;  2P2H A;  5EHL A;  2XIK A;  1MQB A;  5F1Z A;  3G0F A;  3TJC A;  4DLJ A;  3NW5 A;  3ODZ X;  1UNG A;  5LWM A;  3RIN A;  5FM2 A;  4WSY A;  4Y8D A;  2AYP A;  2C4G A;  3ELJ A;  4O4E A;  3DBF A;  2DQ7 X;  4FYN A;  2XNN A;  4X3F B;  3NSZ A;  3VBV A;  5JFS A;  1TQI A;  3F7W A;  3PE2 A;  5J7H A;  3IG7 A;  3D4Q A;  3MVM A;  1JSU A;  3AG9 A;  4EQM A;  4QYF A;  3L9N A;  4GT3 A;  2A2A A;  2WIP A;  2YM6 A;  3G9L X;  4O6L A;  3JPV A;  5M4F A;  1V1K A;  4PTG A;  3QLF A;  5CAN A;  3FAA A;  2XNO A;  4D55 A;  4K6Z A;  1ZYC A;  4KKG A;  2XKF A;  4I92 A;  5HG7 A;  2IW8 A;  4KIN A;  2XBA A;  4HYU A;  4JQ7 A;  4R3P A;  5CU2 A;  2PVN A;  3D14 A;  4ZTS A;  5AIK A;  5FEE A;  3LFQ A;  3VVH A;  4IC7 A;  4PPC A;  1P14 A;  2WMX A;  4RT7 A;  5AP3 A;  5E8W A;  2RFS A;  3OW4 A;  3VUI A;  3QUE A;  3IW6 A;  4F65 A;  4PMP A;  3ZRK A;  3H30 A;  4IDT A;  4FV3 A;  4IEB A;  3U4W A;  3EN9 A;  3D7T B;  3F3T A;  1GY3 A;  4LG4 A;  5F20 A;  3SRV A;  3ZC5 A;  4DEB A;  4E6D A;  3DBC A;  4RWI A;  3SDJ A;  4FIC A;  4EBW A;  4APC A;  2XA4 A;  5HTB A;  5IEY A;  4QMV A;  5EI8 A;  2X7F A;  3ZCL A;  3LXK A;  3GU4 A;  3KMU A;  2XEY A;  4GSB A;  5CAQ A;  1OB3 A;  3KGA A;  3LFE A;  3PSC A;  4W9W A;  3DKF A;  1Q62 A;  4DAW A;  5HE1 A;  2NO3 A;  4CFX A;  4I0S A;  3WE8 A;  4NKS A;  2I0Y A;  3C0I A;  4QMY A;  4XV3 A;  2XKC A;  5BUJ A;  4HGE A;  5LMK C;  1PYE A;  4XG4 A;  3KXH A;  4ZIM A;  3SVV A;  4WSQ A;  5TT7 A;  3EQG A;  2XBJ A;  5HD4 A;  2OFU A;  4YC3 A;  2JED A;  4O0U A;  4DEH A;  2B9F A;  2QKW B;  4BTM A;  3DK3 A;  3MFR A;  4FIJ A;  4FKL A;  3NW7 A;  3NUY A;  3WZJ A;  4B7T A;  5HX6 A;  4QMP A;  5KHW A;  3TV7 A;  4EH3 A;  3EFW A;  1G5S A;  2XKD A;  4E73 A;  2UVX A;  4QQT A;  3HL7 A;  3E87 A;  4AZW A;  3R71 A;  5HLN A;  3D9V A;  4R8Q A;  3TI1 A;  4R3R A;  1PMV A;  3WBL A;  4X3J A;  5L8K A;  3V51 A;  3DAJ A;  3MFU A;  1U4D A;  3TV4 A;  3PZH A;  4BDA A;  4LUD A;  1KOB A;  4EUU A;  1FIN A;  4P90 A;  2BDJ A;  2XMY A;  4QNY A;  3R1Y A;  3EH9 A;  4BDG A;  5KMM A;  4KBA A;  4BB4 A;  2XIR A;  3U6J A;  1JLU E;  3BGP A;  3C51 A;  4GEO A;  2JFM A;  4MCV A;  3LE6 A;  3CBL A;  4XOZ A;  4YLL A;  3WZU A;  3D5X A;  4UAL A;  3F2A A;  4BBF A;  5KMJ A;  3PXZ A;  4ZY4 A;  3S0O A;  3O8T A;  1Y8Y A;  2R3L A;  5E92 A;  1REK A;  4PL4 A;  4PTE A;  4Y5H A;  5EI2 A;  3FMJ A;  2OGV A;  3VUM A;  4PF4 A;  1PXK A;  3CTQ A;  4C38 A;  2QOK A;  4LL0 A;  5CU6 A;  3VBY A;  1SYK A;  3UOH A;  1Y6B A;  4JDJ A;  4BN1 A;  4IX5 A;  4MD7 E;  4BWP A;  4FV1 A;  2VTA A;  3ZON A;  4RFZ A;  2W1I A;  4YJS A;  1PKD A;  4JG6 A;  4EKK A;  4V01 A;  3DZQ A;  4IAZ A;  2PVJ A;  5E8V A;  2WMA A;  3AMY A;  3K5V A;  5G1X A;  4WNO A;  5DEW A;  3UIM A;  4ONA A;  4IMY A;  3TNH A;  3RAI A;  3IOP A;  3HV5 A;  3PVG A;  1ZY5 A;  3GT8 A;  1YQJ A;  3R22 A;  3E7V A;  2YCF A;  1JKT A;  3CPB A;  4PDP A;  4PX6 A;  4RBL A;  4NTT A;  1M2P A;  4BL1 A;  2XM8 A;  4RQK A;  4GUE A;  4ZSJ A;  2F57 A;  2R3R A;  2XJ1 A;  3EN5 A;  2ONL C;  5CAU A;  3G6H A;  2WMS A;  4DC2 A;  2ITZ A;  2RKU A;  2F9G A;  4XP3 A;  2IZS A;  3RP9 A;  5EK7 A;  1QPE A;  3IGO A;  4GCJ A;  5DN3 A;  4FV2 A;  4IAI A;  5K4J A;  3HDN A;  4E4X A;  1KSW A;  5TOZ A;  1Q61 A;  4FSW A;  5ANK A;  4RIY B;  5EHY A;  3FMK A;  3LM0 A;  4UMU A;  3BYU A;  3FL5 A;  5CU4 A;  2QVS E;  3UIX A;  5HNI X;  3QD2 B;  4JJR A;  3HX4 A;  3SOC A;  4HCV A;  4W4V A;  3QA8 A;  2JAV A;  1Z9X A;  2WAJ A;  4EHV A;  3IW5 A;  2CN5 A;  3ANQ A;  4CFF A;  4E93 A;  2VD5 A;  3A7G A;  4GU6 A;  2ITN A;  2UZL A;  3PP0 A;  5JQ5 A;  3D7Z A;  3ALO A;  5FXQ A;  5EM7 A;  1H0W A;  1T46 A;  3FZT A;  3AXW A;  4DEG A;  5CX9 A;  3M11 A;  2YM5 A;  4IAD A;  2X8I A;  3FY2 A;  4TZR A;  5H2U A;  1SNX A;  5ITA A;  2GU8 A;  3UNZ A;  4C2W A;  1SMH A;  2VTR A;  5I9V A;  1SNU A;  3UO6 A;  2Y0A A;  3Q9Z A;  3HKO A;  4GK2 A;  1PW2 A;  2VUW A;  3PPZ A;  4XUF A;  1ZAR A;  4FZF B;  1JST A;  4G16 A;  3HVC A;  5F94 A;  3CEK A;  4FSY A;  2BIL B;  4LI5 A;  4X2G A;  3ZRM A;  4JDH A;  4E8A A;  3P9J A;  4D1S A;  2NPQ A;  3A4O X;  3ZBF A;  4G5J A;  1WBT A;  3WE4 A;  3ET7 A;  4B0G A;  4ZP5 A;  2BDW A;  1F5Q A;  2Q0N A;  3GU8 A;  3IPH A;  3BLR A;  4QMT A;  3R01 A;  2PMI A;  5KX8 A;  4RZW A;  5LXM A;  1DM2 A;  3PJ1 A;  4EOK A;  2J90 A;  4MKC A;  4PMS A;  4LGG A;  3RPV A;  4JQE A;  3QXP A;  2EXC X;  4MQ2 A;  3KXZ A;  4AT3 A;  3UIU A;  4WRS A;  1SVH A;  4EQU A;  1DI8 A;  3UOK A;  3FMM A;  2KUL A;  4DGO A;  4LOQ A;  5CZH A;  2XP2 A;  1R78 A;  5I5Z A;  4L52 A;  4AE9 A;  4DH7 A;  4IW0 A;  2ACX A;  1FGK A;  4EOL A;  4WBB B;  2BR1 A;  3ANR A;  4QD6 A;  2HY8 1;  4X3F C;  4TYI A;  1VJY A;  4G6O A;  3TZ8 A;  5BPY A;  1YW2 A;  2OJG A;  3A8W A;  4IZA A;  4D5K A;  5AA9 A;  3KMW A;  4F0F A;  4GVA A;  1ZOH A;  4FNY A;  3FKL A;  3LCS A;  4FIE A;  1Q8U A;  2PVH A;  4YHF A;  5HGI A;  4UMP A;  2B4S B;  3H9R A;  5HBE A;  1OL5 A;  3QYW A;  4L42 A;  5E8T A;  3VS1 A;  3TUD A;  5BVD A;  2QOH A;  1GOL A;  4IXP A;  4FT9 A;  2ITV A;  3KUL A;  3UG2 A;  4FTA A;  2ZV2 A;  1APM E;  3G5D A;  1ZYS A;  4K0Y A;  4U43 A;  3QTR A;  3UMX A;  5EYK A;  2X39 A;  2GNH A;  5ANI A;  3MA3 A;  2EXM A;  5CU3 A;  2WGJ A;  3I0Q A;  4IM3 A;  2C0T A;  4FST A;  4G3C A;  4GFO A;  4QPS A;  4HNF A;  4CZY B;  4KAB A;  2H8H A;  1H24 A;  1UKH A;  4YPD A;  2BPM A;  3CIK A;  4NJD A;  3K54 A;  3LMG A;  4BIB A;  3COM A;  2DWB A;  2QR8 A;  1Y57 A;  2PMO X;  2J2I B;  4JXF A;  3LCO A;  4DBN A;  5CXZ A;  3I5Z A;  3H4J A;  4EHG A;  4EEV A;  2XRW A;  2GFC A;  2WTD A;  3EL7 A;  3OXT A;  4FNX A;  4MWI A;  4V0G B;  4XJ0 A;  3RI1 A;  3FYJ X;  3HMI A;  2PHK A;  3HA8 A;  2JLD A;  4YTH A;  2ITY A;  1OKW A;  2VZ6 A;  5EFQ A;  2X6D A;  3VO3 A;  1IA8 A;  2QOL A;  3GCP A;  4PMT A;  2YHV A;  2R64 A;  2UZT A;  3MIA A;  4QYG A;  3VW6 A;  4BIC A;  4JVG A;  3CKW A;  1W8C A;  3QQF A;  3LCD A;  2QLU A;  4DH5 A;  2PWL A;  3NNV A;  5D7V A;  1H1Q A;  4D1Z A;  2OZA A;  1UNH A;  2C5V A;  4FSM A;  4U41 A;  4DFZ E;  1FMO E;  2V0D A;  3W2P A;  4KNB A;  4DCE A;  3QTW A;  4A07 A;  3PG1 A;  4YHT A;  3E8D A;  3QKM A;  4GII A;  5BQ0 A;  4NKA A;  2VN9 A;  3LJ2 A;  3TT0 A;  3ZDI A;  5DHJ A;  2V55 A;  4I6B A;  2YN8 A;  3POZ A;  4Z3V A;  2VWY A;  4D4R A;  1Y91 A;  4TYH A;  2YDI A;  2BRH A;  5CEQ A;  3AC2 A;  3H0Y A;  3C4F A;  4MF0 A;  4TNB A;  2G01 A;  3PA5 A;  3SW7 A;  3AC8 A;  3O17 A;  1ATP E;  3NS9 A;  4H1J A;  4RIX A;  3NUU A;  4NU1 A;  2W06 A;  1STC E;  1NXK A;  5CLP A;  3LHJ A;  2ITQ A;  2JIT A;  5AV0 A;  5HIE A;  3UTO A;  3Q5Z A;  3E5A A;  4I23 A;  4J52 A;  5EG3 A;  4F7L A;  1XBA A;  2Y9Q A;  4AP7 A;  3MH3 A;  4FGB A;  4XV9 A;  2ITP A;  2Z8C A;  2J51 A;  3I4B A;  2E9N A;  3K5U A;  4KIK B;  4S32 A;  3V8S A;  3DA6 A;  4NW5 A;  4ITJ A;  4WA9 A;  5AAF A;  1GJO A;  5DFP A;  2BTS A;  3ORL A;  3R7G A;  2G2H A;  4LQM A;  4FK3 A;  4MWH A;  2OW3 A;  4FKS A;  4FVR A;  4QT1 A;  3EQH A;  3UOL A;  5KUP A;  4E6C A;  3WYY A;  3BLQ A;  4K11 A;  3VRZ A;  5AEP A;  3CQE A;  5CVH A;  3ZBX A;  2GS2 A;  2VO3 A;  4LL5 A;  3E3B X;  2XH5 A;  3MDY A;  4K1B A;  4C4J A;  4M0Y A;  4E1Z A;  2AUH A;  3A62 A;  4RX9 A;  1LPU A;  2UVZ A;  3Q4Z A;  2OSC A;  3CQU A;  3NDM A;  4LRJ A;  4W8D A;  4YC6 A;  3CLY A;  4H1M A;  5AR3 A;  2BRN A;  5TE0 A;  4MF1 A;  3R9O A;  5CYI A;  3FWQ A;  3NNU A;  5AP6 A;  5HLP A;  5CAS A;  1YRP A;  3H9F A;  3NR9 A;  3QL8 A;  2VO7 A;  4PMM A;  3BYO A;  3F3Z A;  1J3H A;  2W1H A;  3F2N A;  1R0E A;  4RRV A;  3UO5 A;  4EK3 A;  4V05 A;  4AGW A;  5A4Q A;  3FDN A;  5JQ8 A;  4CXA A;  3A99 A;  5AM7 A;  2JIV A;  4BDJ A;  4CLI A;  4OTH A;  1Q3D A;  4FNZ A;  4RPV A;  5J87 A;  4ZLO A;  3JYA A;  4JG7 A;  4Q9S A;  2WTV A;  3TN8 A;  3PXK A;  1VYW A;  3DK7 A;  2JAM A;  3VS0 A;  4ZK5 A;  3R9D A;  4Z7H A;  3VS3 A;  3V3V A;  4Z7G A;  4J53 A;  3FYK X;  2QOC A;  3NCZ A;  3SHE A;  4D2W A;  3LFC A;  2O2U A;  2UZB A;  5DG5 A;  3O71 A;  4BCM A;  2HWP A;  4Z16 A;  4R5Y A;  3ZLS A;  1YI6 A;  2C1B A;  4YJU A;  4CQE A;  1J1B A;  4JBQ A;  5AWM A;  5CT7 A;  5BVE A;  5AUT A;  5E8Z A;  2HK5 A;  4PWN A;  1BL7 A;  3PIZ A;  4CMT A;  3MVJ A;  2FO0 A;  2OXY A;  3ZHP C;  4RGJ A;  4RVM A;  4BWK A;  4EC9 A;  2VTQ A;  2VV9 A;  3PY3 A;  2I0V A;  2ITW A;  3R2B A;  5J9L A;  1KWP A;  2IEW A;  1ZXE A;  1ZMW A;  3QHW A;  4FF8 A;  5AP4 A;  3R7Y A;  3WZE A;  3Q6W A;  3TUB A;  4G17 A;  4CRS A;  3AT2 A;  2OID A;  3GC8 A;  4PY1 A;  1LEW A;  4A06 A;  1IRK A;  4CVA A;  3CGF A;  4EOS A;  2BVA A;  5M4I A;  1W83 A;  2GFS A;  4OTW A;  3BHU A;  1Z57 A;  3JVR A;  4QPA A;  5J79 A;  2PVM A;  4IX6 A;  3UMW A;  3ZXT A;  5AAD A;  5KKR B;  4O22 A;  5AV4 A;  1CMK E;  4D0W A;  4G6L A;  3AMB A;  4HZS A;  2NRY A;  4FNW A;  1WBN A;  2CDZ A;  3DJ7 A;  5AUU A;  4I0T A;  2G9X A;  3RMF A;  3JY0 A;  3QTU A;  5DR6 A;  4E7W A;  3VBW A;  3QCQ A;  3RNI A;  4YSM A;  3OCT A;  1YDR E;  2HZ4 A;  3EMG A;  1PXM A;  1H1P A;  4H58 A;  4I5H A;  4JI9 A;  4QMX A;  4QP3 A;  5AA8 A;  4JIK A;  5L2S A;  1UV5 A;  3AT3 A;  3L8S A;  3R8P A;  3Q96 A;  2RIO A;  1U54 A;  3DS6 A;  3OP5 A;  5DI1 A;  4FKJ A;  5E1S A;  5B2K A;  5KCV A;  4GJ3 A;  4QMU A;  4CFV A;  4K33 A;  2G2I A;  4JAJ A;  2F7Z E;  4QTA A;  2CHL A;  4PDS A;  4C4E A;  4ZSL A;  5FGK A;  2Y7J A;  3RAH A;  3FXX A;  4HPT E;  3MH0 A;  1GZN A;  1VEB A;  2GPH A;  3OS3 A;  2HAK A;  4FI1 A;  3ZLX A;  4FV7 A;  5HTC A;  2X8D A;  2GHM A;  3KXG A;  1WZY A;  2I40 A;  3JVS A;  2R3N A;  3QLG A;  4IZ5 A;  4NJ3 A;  4TN6 A;  3RGF A;  2VX0 A;  4FT7 A;  3TNI A;  4C2V A;  4IZY A;  1P5E A;  5GJF A;  5HZN A;  2QQ7 A;  5JGD A;  2Z7R A;  3RZB A;  3VQH A;  1CTP E;  4CKJ A;  5A4L A;  1DI9 A;  3TZM A;  4HVH A;  2W4K A;  2HZ0 A;  1YHW A;  3NRM A;  4AQC A;  2O8Y A;  3PWY A;  4CZT A;  2WTJ A;  3ITZ A;  4GUB A;  3PXY A;  4KB8 A;  4YBK A;  5LCK A;  3ZMM A;  1QPC A;  3LFA A;  4RVL A;  4FKO A;  3SW4 A;  4HYI A;  3PZE A;  3RK9 A;  3L8P A;  3KB7 A;  4KSQ A;  5AUV A;  3COK A;  4AT4 A;  4FVQ A;  3GQI A;  4WG3 A;  2OU7 A;  5IA1 A;  4U81 A;  2IVV A;  4GL9 A;  2X2M A;  3R8L A;  4LV5 A;  1OPJ A;  1XR1 A;  4IBM A;  4E4M A;  4EUT A;  4ZTR A;  3BKB A;  4RIX B;  2Y4I C;  4L53 A;  3OT8 A;  2OJI A;  5F9E A;  4BDC A;  3Q9W A;  4CRL A;  2KTY A;  1H0V A;  2BAQ A;  3FKN A;  4ITI A;  1GZ8 A;  2X0Q A;  4NCT A;  4B99 A;  5J1V A;  3DFA A;  1LUF A;  3FML A;  3H0Z A;  4RIW A;  4XG2 A;  4AZT A;  5TKD A;  4RQV A;  3WYX A;  4FG9 A;  5KBQ A;  4IAN A;  3NEW A;  2W5A A;  2OH4 A;  3SAY A;  3OC1 A;  5IDN A;  1XJD A;  4QTE A;  4M3Q A;  3VBT A;  3GFW A;  4RVK A;  3VN9 A;  2C3J A;  2JDR A;  4EOO A;  4XBU A;  2OZO A;  3DJ6 A;  2R7I A;  5HOA A;  4A4X A;  1PXL A;  4GRB A;  3KA0 A;  3RPY A;  4FEQ A;  3VS2 A;  4DH1 A;  3O51 A;  5AV1 A;  4LM5 A;  4RJ7 A;  4DEE A;  4A7C A;  2C6D A;  5BVF A;  1PXP A;  1KE8 A;  3AT4 A;  2R3F A;  4RA4 A;  2VRX A;  4Y72 A;  3HP2 A;  4TL0 A;  4YTF A;  3OG7 A;  1OPK A;  2YWP A;  4JR3 A;  4YPS A;  1BI8 A;  2JBP A;  4IAK A;  4L8M A;  4QYH A;  4V0G A;  5CY3 A;  3BPR A;  1GIH A;  2OBJ A;  4XP0 A;  5BVK A;  2A4L A;  5CSX A;  1U54 B;  3HV7 A;  1QL6 A;  4YMJ A;  4EK8 A;  1YKR A;  3R30 A;  2BHH A;  5HO6 A;  4X6Q C;  3FHI A;  4W4X A;  5HIB A;  5FBN C;  2VO0 A;  3L9P A;  3ZUU A;  3UPZ A;  2VWU A;  4EWQ A;  2QOD A;  2XRU A;  4F1T A;  4E20 A;  3A7H A;  1FGI A;  3EN6 A;  4YJT A;  2BTR A;  4FTM A;  2W99 B;  3GI3 A;  3MPM A;  4ZS0 A;  4KRC A;  3P4K A;  3RWQ A;  3BYV A;  5DWR A;  2P2I A;  3DAE A;  4AN9 A;  3EN7 A;  2P33 A;  4OLI A;  3REP A;  3EKK A;  4J98 A;  2F4J A;  5M44 A;  2XNB A;  3LIJ A;  4E26 A;  4EKL A;  1YHV A;  2JDO A;  3TJD A;  5DRD A;  1PMN A;  2UVY A;  5DR9 A;  1OKY A;  5EDR A;  4PTC A;  4AG8 A;  4FTN A;  2EVA A;  1YOM A;  3HRB A;  3QF9 A;  5C9C A;  5JFW A;  3C9W A;  2B9I A;  4X2N A;  2XB7 A;  5AX9 A;  2UW0 A;  5H9B A;  5C27 A;  4PP7 A;  1UWJ A;  3MY1 A;  3ZSG A; 
#chains in the Genus database with same CATH homology
 1W2C A;  1TZD A;  2A98 A;  2X0Q A;  2X0P A;  4FRF A;  2IF8 A;  4O4C A;  4O4F A;  4O4D A;  2AQX A;  4O4B B;  4O4E A;  1W2D A;  2IEW A;  1W2F A;  2X0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...