4O4DA

Crystal structure of an inositol hexakisphosphate kinase ehip6ka in complexed with atp and ins(1,4,5)p3
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
240
structure length
240
Chain Sequence
PDGQYLLKPCLSHRERDFYLHIKDDKEWTGTGIIPKFYGVELHEFGFGELEFIRMENLMYKYKRPFVLDLKIGTQTWDPETASSKMKKRLVVDSTSTTTSLGVRFSGMERNIGEEKPILYSRYLCTHEVNTRDSLKEYIKLFFNDGKKYRKELVPYFISQLDKMIEVMKKREYKMFSSSVLFVYDSTTTLEDKKYNCKMIDFAHNWILSEEECTVEDGFLFGLNNLKSILEDIENEFKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol hexakisphosphate kinase
publication title IP6K structure and the molecular determinants of catalytic specificity in an inositol phosphate kinase family.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Transferase
total genus 77
structure length 240
sequence length 240
ec nomenclature ec 2.7.4.21: Inositol-hexakisphosphate kinase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03770 IPK Inositol polyphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.50 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase); domain 1 4o4dA00
1W2DA 4O4EA 1W2FA 1W2CA 2AQXA 4FRFA 2IF8A 1TZDA 4O4BB 4O4DA 4O4FA 2IEWA 4O4CA 2A98A
chains in the Genus database with same CATH superfamily
5EFQA 1BL7A 3V5QA 1H4LA 4W9WA 2W1GA 3VS4A 3NGAA 5K3YA 2ITXA 4GYGA 5KMLA 4NUSA 5I3OA 2VTRA 5J9ZA 3EQHA 3PE1A 3F7ZA 3MH0A 5AUYA 4AS0A 3OXTA 3WE4A 2BIKB 4WG4A 4EH9A 2YCRA 2YACA 5DMZA 3UIMA 4D5KA 4ZY4A 3FQSA 4JLCA 3C0HA 4BCJA 4UYAA 3GC9A 2X0OA 2RFDA 4DH7A 5BUIA 2CPKE 4J98A 4TYGA 3I79A 5E8XA 3DXNA 4QQJA 1FVVA 3LFNA 2F7EE 1UNGA 5ACBC 3OROA 2REIA 1PKDA 3PP0A 3MB7A 3KVXA 1JSTA 1NVQA 5DRBA 4O38A 5E8SA 1EH4A 4GL9A 4DTKA 3R9NA 4QQCA 5TO8A 4MYGA 5EDPA 2BRGA 4OTRA 2R5TA 4H3BA 3R7VA 2C5XA 3HGKA 5B7VA 2GS7A 5DNRA 2R3JA 1BKXA 3F66A 4DLJA 4KKEA 1P4OA 5TKDA 3QTWA 4YBKA 4C4JA 4HGSA 4MVFA 5KHWA 3BEGA 3BHVA 3BHYA 3PIYA 4FL2A 4EKLA 3P5KA 3WBLA 2QOFA 5M4IA 4FVQA 3IW6A 2ACXA 4UB7A 1KOBA 5ETAA 2ETKA 1PXOA 3HEGA 2X8EA 4FZ6A 3PSCA 3QRTA 4O4EA 4BCIA 2R3MA 2BAQA 4RA5A 3LXNA 3PY3A 3QTZA 4Z9LA 5E8WA 4NWMA 2J0MB 2R0UA 3DJ6A 2HXQA 3BU6A 3PVBA 3FBVA 4OBPA 3FLZA 4EC8A 4RMZA 5HHWA 3HNGA 5I3RA 3ZTXA 4DGGA 4EONA 2W1DA 4IAIA 2IZUA 4EJNA 4L3LA 4QMYA 3LFEA 3I7CA 2R7IA 3P08A 4FKTA 2OKRA 4HPUE 3ZFYA 4GT4A 2GHMA 3PFQA 4E20A 3D7TA 3MA3A 2NRYA 4QP7A 3R7UA 4AZWA 3AC8A 4JIKA 3WI6A 2HWPA 4FTUA 4QD6A 3M11A 4C58A 2X7FA 5JZNA 5BVDA 5AM6A 3DTCA 3EN7A 4IAFA 1H26A 2CJMA 2ZDUA 4CTBA 3DA6A 4XG7A 2XKEA 2Z2WA 5KNJA 3TKIA 5IPJA 2V7AA 3JPVA 4HW7A 3PPJA 4FTLA 2WNTA 2OXXA 3F5GA 3IG7A 2XK8A 2G2HA 3QLGA 5CQUA 4Y73A 4XHKB 4N70A 2IVTA 3DB8A 4LV5A 3B8QA 5AP7A 3FDNA 4GU9A 5HBEA 4MWIA 3ZUTA 5GJFA 3E88A 1M7NA 2XH5A 5ANJA 2GS6A 2WHBA 4NM0A 4DLIA 4OLIA 1ZYDA 3GU5A 1JBPE 3L8SA 3NDMA 3MB6A 3SA0A 3HVCA 4D2TA 3QC4A 4BI2A 3RCJA 3O17A 2R3RA 3QQFA 3DNDA 4FSZA 4AZVA 5HO8A 4E8AA 4JXFA 4CFUA 3LFSA 2X9FA 5BUJA 3AGMA 3PSDA 2XF0A 3DCVA 3DBQA 3HP5A 3MH3A 2OZOA 3FWQA 4RIXB 3GB2A 4I0SA 3V5TA 3VQHA 3EQIA 4EH5A 4AN2A 4OAVB 3WYYA 1SYKA 2C6LA 4BWXA 5HO7A 5DT0A 4P2KA 5TR6A 2CGVA 1R78A 3D4QA 3QUEA 3ZUVA 3AMAA 3FMKA 3NIZA 2Z7QA 4FOBA 1JVPP 4UXQA 4D9TA 1M2QA 1STCE 2G1TA 4EOLA 5EYKA 4BDAA 1CKJA 4O0XA 5KUPA 1G3NA 4D2SA 5CAVA 2ZMCA 5KMJA 4EBWA 1XH8A 1PHKA 4EH7A 2FH9A 5HE2A 4W4YA 4A7CA 3L8PA 4RX5A 2JEDA 3RI1A 5DT4A 3AC4A 1J1BA 4OT6A 5BVOA 3ET7A 3A99A 2KULA 3F5XA 4EOIA 3KU2A 5IF1A 4ZLYA 3NUXA 3LPBA 4JBPA 4FK3A 3VUTA 1W8CA 5DR6A 3F5PA 4XX9A 3PXFA 1GIHA 2OO8X 2YM5A 4D28A 5B2LA 4PPBA 4MXZA 5FRIA 3A4PA 3HV5A 2UW8A 2X0QA 3QU0A 1MQBA 5HVKA 5IEYA 5ANEA 5JFXA 4YC6A 4YLKA 2C4GA 5IH6A 4BDGA 2W05A 1E9HA 3ENHA 2B9HA 3FKOA 1JWHA 4PPCA 4E4XA 4IC8A 4CT1A 4FTJA 2UW5A 2GHLA 3FL4A 2JAVA 2FB8A 2QQ7A 2ETMA 3IDCA 3R9OA 4E3CA 2VTSA 4QMMA 4D0XA 1TQMA 2YCQA 1S9JA 4FNWA 1M2RA 5HE3A 1KSWA 2GQGA 3ORTA 2WQEA 2Y0AA 5C03A 3RBWA 3VUIA 4UZHA 4A07A 4XH6A 1PXPA 4WRSA 3DJ7A 4TWNA 2Z7LA 2W9ZB 4C59A 3FYKX 3Q60A 5GJDA 5AP0A 1OKYA 3QQGA 1ZZ2A 2VWIA 2QOBA 2QODA 3PJ2A 3QCQA 4IAAA 4C3PA 2E2BA 3VBYA 2VN9A 4BTMA 1YWRA 4FYOA 5HIEA 3MVMA 4O0TA 1W83A 1QL6A 4NH1A 4RIWB 4APCA 3V5JA 2QKWB 2RGPA 1GZKA 5HCYA 4IAZA 5A46A 4L45A 4BC6A 2R64A 3KCFA 5J1WA 3F2NA 4Q5EA 2O2UA 3BGZA 3G6GA 3IK3A 4J99A 4Z7GA 2A27A 3WOWA 3JVRA 3RWQA 1ERKA 2X7GA 4BDFA 4O1OA 4Q5HA 5TE0A 3WZUA 2Q0NA 1OITA 5E7RA 3PPKA 3SW7A 4WUAA 1FOTA 4NM3A 4AFJA 3CD8A 5EM7A 4EBVA 5BVFA 1WBTA 5FXRA 3AOXA 5HBHA 2VTHA 3QTIA 5FEEA 4Q2AA 4GG7A 3I0OA 4IW0A 3OC1A 3NS9A 1Q8UA 3A61A 3QQLA 3VHEA 1W84A 3NNWA 3HRBA 4RIXA 1JNKA 1OL6A 1DAWA 4W8EA 4OAUC 4BI1A 3D5XA 1WBVA 4FKSA 4TWCA 3S95A 3QCYA 3U9NA 1DM2A 2O65A 4JVGA 4BDHA 2EXEA 2IEWA 3O0GA 3FZRA 3HA6A 1DI8A 2XK7A 5HTCA 3ZFMA 3CLYA 4KABA 5HCZA 5FXSA 5AV0A 2V0DA 1Q8YA 4I94A 2BHEA 4M97A 1XH7A 3G0EA 3H9RA 4X0MA 3R00A 4FG9A 4RWKA 3P4KA 5CZIA 4AZSA 4F7JA 4L6QA 2CGUA 3FLQA 4R3RA 4DFYA 4DFZE 5E1EA 3ZLXA 3ZO4A 5T3QA 2BZHB 1YWNA 3CTJA 5IA1A 4BTKA 4X2FA 3UMWA 3HLLA 4GMYA 2DQ7X 2WGJA 3IONA 3U4UA 1OIUA 4QTBA 5I9WA 4ACGA 1KOAA 2G01A 2WTDA 3DGKA 3FSKA 4TYIA 2JDSA 4O91A 5DG5A 2XIZA 1YQJA 4AAAA 3ZBFA 1H28A 3NNUA 4HZSA 4IANA 1U46A 4PUZA 1KWPA 2BFYA 3BPRA 4TNBA 2VTIA 3Q2MA 4U3ZA 4NTTA 3VUHA 2BMCA 1H00A 2W99B 3GC0A 1H25A 4IM0A 4NZWB 4RJ5A 4S32A 4B9DA 2X6DA 3FC2A 5JFWA 5L4QA 2OSCA 3KXHA 5C8KA 4E26A 4BYIA 4O0YA 3WZJA 2CHLA 4FODA 4J97A 1P4FA 5E8UA 4O2PA 5AADA 4L44A 4BCNA 3C4WA 5CY3A 2YA9A 4HYSA 3VS1A 1PXJA 4CKRA 2PVNA 3N51A 4H36A 4DEEA 4XG9A 2C1AA 1HOWA 1A06A 2RFEA 5EHOA 5KO1A 3ZEWA 3D5WA 3PXZA 4QP9A 1OIRA 3SW4A 1CDKA 3GP0A 4EHZA 1SZMA 5CU3A 1KV2A 3BYVA 2RL5A 4U44A 3R8VA 4ARKA 1PMUA 3M1SA 1GNGA 4I5PA 4ANOA 1JAMA 3HV3A 3UDBA 2ZV8A 2PSQA 2WMVA 2UVXA 3PIZA 2XK6A 5DEWA 1YXXA 3W2CA 3OBGA 1JQHA 2VX0A 2W17A 3E8DA 2C6EA 2ZV7A 4FT9A 4RIWA 3TKHA 5EM6A 4B8LA 4BTFA 4BCHA 2FVDA 1YKRA 3OW4A 5DH3A 5DOSA 4D2RA 5AP4A 4G2FA 5CEMA 1MRUA 2I0YA 5CENA 3ZSHA 4C57A 4O4FA 1KE6A 2BALA 4MK0A 2XZSA 3H3CA 3LFFA 4HNFA 4LL0A 3RZFA 3VUGA 1AGWA 1VEBA 3DKCA 3R7IA 3UOHA 4AUAA 3MYGA 3COMA 3ZU7A 4C3RA 3DKOA 2C68A 1H24A 3KN6A 4ZSAA 5BUEA 3V5PA 1OKZA 4FSWA 3L9NA 3R8MA 3UODA 4L8MA 2YZAA 2R3NA 4FNZA 5JH6A 5A6OA 4MWHA 2BAJA 5A3XA 1KV1A 3UQGA 5IDNA 2GPHA 5KCVA 3BLHA 2RSVA 3KVWA 2R3FA 2OICA 4BZOA 4CMUA 3IO7A 2BZIB 4ENXA 3TEIA 4UWCA 4CZTA 4EC9A 3QHRA 4XP2A 5DLSA 3HMIA 4CZUA 3QXOA 1XBBA 3PRFA 4JL9A 2AC3A 1XQZA 4K9YA 4PDSA 5AUVA 3Q6UA 1UU8A 2XYNA 5J1VA 1XBCA 5AAEA 4HCTA 4UMUA 4EK8A 3G0FA 3ORIA 5K0XA 2F2CB 4U7ZA 4PTEA 2O5KA 4RJ6A 4FV9A 4GK4A 2RG5A 5LMAA 4MTAA 3TTIA 4XP0A 4UWYA 3FI4A 4MXOA 3MS9A 3HECA 2WIPA 3KK8A 3QTRA 5JGBA 5H8EA 5HCXA 3OTUA 4RX9A 2IW8A 2W4JA 3Q4UA 3FHIA 2YIXA 4V04A 1WVWA 3FJQE 1NY3A 2WTCA 4I23A 3NW7A 1O9UA 3P78A 4QO9A 4IVDA 4R5SA 3EZRA 5JQ8A 5TF9A 4BZDA 3WE8A 4YR8A 3A7GA 4GSBA 2BFXA 2FA2A 2XCKA 3PZHA 4WT6A 4W4VA 4W8DA 2C69A 3BU3A 3CC6A 3UP7A 2PZRA 2R3PA 3QQUA 3R8ZA 1OVEA 3FQEA 3VVHA 4CKIA 4DFNA 2XBAA 3RGFA 3NUSA 4ANQA 4FX3A 2WTKC 3QKMA 2IZSA 4MBLA 4QRCA 3RPRA 2OXYA 4MXCA 5HX6A 4IMYA 4AA0A 4XBUA 5H3QA 4UN0C 2WMTA 4O4CA 3MH2A 4QTDA 5LJJA 3UNZA 2E9UA 1P14A 2UW6A 4JRVA 4K33A 4GUBA 2GS2A 3ETAA 4FT0A 2YHVA 3P1AA 4QNAA 4FIJA 5D9HA 2BTSA 2X2MA 1RE8A 1H0VA 2VZ6A 3TCPA 4JRNA 4FRFA 1PF8A 2R3IA 5JSMA 3TT0A 3CGFA 4DHFA 4W4WA 3MFSA 5FDPA 3OP5A 2QOHA 4FKOA 3THBA 4RVLA 3PYYA 1ZZLA 3FMJA 1VYZA 4FMQA 3MY5A 3PXQA 5FM3A 5I9UA 1BMKA 3BZ3A 5HORA 2O8YA 2J90A 3H0YA 2Z8CA 3Q3BA 3NCZA 5J79A 3TIZA 3FXWA 4YJSA 5BYYA 3VQUA 3V04A 4EHEA 4GYIA 4OUCA 1ZYCA 3MPAA 3FE3A 2QOCA 4FSNA 1H1QA 4FKGA 4YJOA 3WF6A 4AT5A 5KKRB 4KIPA 2B7AA 2OK1A 5CZHA 4L7FA 3W16A 3QRIA 2WQBA 3NWWA 4WO5A 2RFSA 3E64A 4BGQA 5AUUA 1V0OA 3E8NA 5F94A 4TN6A 5HI2A 4EOQA 3RVGA 2J7TA 3D9VA 5CNNA 4CQEA 1XHAA 4OTDA 3EYHA 3BHTA 4J95A 4ZSJA 3KF4A 5F4NA 4FTQA 3MWUA 1WFCA 4AW0A 3POOA 5I9ZA 3F7WA 5AMNA 3DAJA 4PRJA 4FV4A 3SV0A 3CJGA 1CSNA 2XNOA 4LUDA 1JOWB 4RBLA 4XEYA 2CMWA 4CYJA 3PXKA 5FP6A 4O6EA 5AUWA 2ITOA 3DJ5A 4DFLA 3MA6A 4WD5A 4USEA 4EOPA 2XS0A 5C26A 3K3JA 2ITVA 4QMOA 4ZJJA 4FKRA 4I5CA 2VGOA 2VWZA 5AP2A 2UZNA 4EK6A 5AP3A 4PDOA 2GNJA 4LRKA 4USFA 3P7AA 2ZB0A 4WA9A 4MXAA 4IZ5A 2YIYA 4L52A 3C4CA 4RIYB 4MH7A 2I1MA 3AC3A 5F95A 3QRJA 3EQGA 3PXRA 4N4SA 3WIKA 1KE5A 5F20A 3BYUA 2NPQA 3JUHA 2OI4X 2YM8A 4NW6A 5KX8A 5BQ0A 2CCIA 3HKOA 4IX5A 1M17A 2WQOA 4USDA 4TYHB 4F08A 4GRBA 3IGGA 3P7CA 3ACKA 4IC7A 4NCTA 5FP5A 2IW9A 5HBJA 4AG8A 2BZJA 1M2PA 3FMNA 3QQHA 4YJRA 2WB8A 3PJ8A 4NK9A 2R3KA 2R9SA 3CS9A 4EHGA 4G3DA 4CRSA 4F9BA 2P33A 3WIGA 4MBIA 4QMVA 4C3FA 1ZYSA 3FUPA 2VTJA 4JIAA 2PZYA 4EWQA 4P4CA 2JFLA 4ITIA 3BBTB 3O71A 2ERZE 3RAWA 4Q9ZA 4D2VA 4QYEA 4EQUA 4S33A 4F70A 4RX7A 3OEZA 4RVMA 3DZOA 3VBTA 5GZ9A 4QMNA 1XH9A 1IEPA 1GZOA 3D2KA 3D7ZA 3FZSA 4TKSA 5DR9A 4ZAUA 3BV3A 3CKXA 4JDJA 2EB3A 3LM5A 3QRKA 2XM9A 4HZRA 4IVBA 4DEBA 3FLSA 4EK3A 5JRSA 3RALA 3OEFX 4X6QC 5IA0A 3QTXA 4QPSA 4U5JA 3ROYA 4Y83A 5IEXA 3MSSA 2B1PA 5I9YA 2JDTA 4BL1A 3MIYA 1JLUE 3ORLA 2JBOA 4I20A 4YZDA 4I93A 2XIKA 5HIBA 4CMTA 5I0BA 3OWPA 3JVSA 3R02A 4CFNA 4ZLZA 2XB7A 3LCDA 4NKAA 4TWPA 5GZ8A 5E92A 3FY2A 1F0QA 3FZTA 4IJ9A 2W5AA 4ALUA 2A4LA 4ALWA 3F88A 3VW8A 4FK6A 3NCGA 3DKGA 4KBKA 4RGJA 4UY9A 3ITZA 5DFPA 5BVEA 2PVKA 3OWKA 3R2YA 3LE6A 2CKEA 1V0BA 1YDSE 4YBJA 2YDIA 1TZDA 3NYOA 5CEPA 3UPXA 3WF7A 3IECA 3NUPA 2VO7A 3E87A 4C36A 5LCKA 2NRUA 2F7ZE 2QHMA 3E7OA 5LVPA 1ZRZA 4Z16A 2RF9A 4NM5A 2B53A 4RJ3A 4V05A 5H8BA 3VHKA 2X81A 1ZMVA 1IASA 5DBXA 4RX8A 4F09A 4BTJA 4YMJA 2VTQA 4DH3A 3FV8A 4WNOA 2J9MA 1B38A 3I81A 4A9RA 3U4WA 4RFMA 2YITA 4RIYA 3FI2A 5J7HA 3FYJX 3RK9A 4L68A 3LJ1A 2UW7A 1LEWA 2P55A 4JBOA 3BE2A 4QPMA 4N6YA 2BRNA 3MJ1A 2B4SB 2HW7A 4PMTA 5CEQA 3R1YA 2QC6A 3H9OA 3SXSA 3UP2A 4C4FA 5C01A 1LP4A 1ZOHA 4F7NA 3I7BA 4AFEA 1WBWA 2WTVA 3HV6A 5AA9A 1YRPA 2ERKA 3LCOA 4IWDA 5CI6A 3AG9A 3QX2A 4BFMA 3QD0A 4MF0A 2ITTA 3BKBA 5HO6A 2R3QA 4RVKA 3U9CA 3OVVA 3G51A 1OUYA 1PXNA 2I6LA 4NJ3A 2IJMA 4QMQA 2R3HA 4XG2A 3DK7A 3PP1A 2X1NA 3LM0A 5FXQA 4J8MA 3QGWA 4O0RA 2QU5A 3JY0A 3AT4A 4IBMA 3EKNA 2PE2A 2BROA 3A7HA 2QR8A 2ITNA 3ORKA 4NU1A 5HU3A 3MVLA 4HVHA 3MFRA 5KMOA 1V1KA 5CVHA 3Q9YA 2Y8OA 2YISA 1M14A 4PMSA 5CAPA 5BMSA 3RHKA 1WVYA 4AXAA 4G3FA 2XIRA 3BV2A 2OF4A 4QPAA 5LMKA 5AAGA 4GVJA 1GIIA 2OFUA 3KMUA 4QMZA 5E91A 3SVVA 4QTAA 5EI8A 2QO9A 4M67A 4NEUA 3R83A 3TZ8A 5B0XA 4H39A 4DINA 3DDPA 4A4OA 2PZPA 3KXZA 5D1JA 2A98A 1PYEA 1QCFA 2P2HA 1Q3WA 1Y91A 3D0EA 2HYYA 4ZTQA 3ZRMA 4X2GA 5JRQA 1Z57A 3SC1A 4G3EA 5LVOA 4ZZNA 3LFCA 4EEVA 2CCHA 4JAJA 3VNTA 1H8FA 3S2PA 4F9WA 1JPAA 5HZNA 3E3BX 2WMWA 4ZSLA 2A1AB 4I0RA 4WBOA 4U97A 3ZRKA 3OCGA 4YZNA 4GCJA 1XR1A 5EG3A 3ZXTA 4FEQA 3L9LA 5DGZA 4IADA 2O63A 4RWLA 3ZC5A 4EQCA 3D15A 2QKRA 3RWPA 4DAWA 2IZRA 4ZTSA 3VS3A 4A4XA 1OGUA 4R5YA 3QTQA 5IMXA 3R7OA 2BR1A 4FV7A 4EH6A 1GAGA 3GBZA 3ZXZA 4F1OA 4C33A 3UPZA 2KTYA 4RRVA 3CCNA 3KULB 3QZIA 4XS2A 5EM5A 5CSHA 4LRMA 5M44A 3UTOA 1RDQE 4ZY5A 3PVGA 3PA5A 4IAKA 4X3FC 4XJ0A 3BHUA 3CTHA 2WFYA 4FV3A 2W7XA 4GK3A 2PVRA 3Q04A 4UYNA 3R04A 3O50A 3PG3A 2VU3A 3KA0A 3QTSA 3RPYA 3A8XA 2XKDA 4FICA 4TZRA 3UC3A 4YZ9A 3KCKA 4RQVA 3QALE 2JD5A 4LM5A 4BZNA 2OZAB 3DNEA 1AD5A 5CALA 5AX3A 1YHVA 1FVTA 3IGOA 4G17A 4PPAA 4YJVA 3EYGA 3KEXA 3MW1A 5EH0A 3P23A 4CT2A 2FSTX 4YC3A 3GFEA 2XNMA 3OBJA 3RAIA 3VULA 5CU4A 5AWMA 5IEVA 4QYGA 4U40A 4XV1A 3OUNB 2HZIA 2W96B 3EZVA 2YDJA 4U43A 2Y6MA 3F2AA 3A2CA 4RJ8A 2ZVAA 3A4OX 2B55A 1WBSA 4LV8A 3TTJA 3BU5A 4CTCA 4W4XA 2C6DA 2J50A 2WTIA 3G2FA 3LCTA 3FHRA 1OL7A 4FIEA 5CT7A 3RJCA 1Z5MA 3NW5A 1UU7A 4ASZA 4TYJA 5IUGA 3FLYA 2R3LA 4LMNA 3TXOA 5FTQA 4FKWA 1OPLA 2W06A 2OJIA 1WBNA 3LHJA 4ERWA 3T3VA 3I4BA 4RG0A 3VUMA 3W10A 3UJGA 4I4FA 1W7HA 5BX0A 4KKGA 3UYTA 1SM2A 4FTNA 5L2IA 3RPOA 2E9PA 1Z9XA 3WZDA 2B9FA 5BMMA 4TTHB 2RFNA 3UC4A 2GTMA 3IQ7A 3ZBXA 4JQ7A 2YIQA 4OTFA 3VW6A 3CE3A 4Y5HA 3GQIA 3PJ3A 4F9YA 2B52A 2A2AA 3D5VA 3A7JA 4O1PA 5A9UA 4QP6A 3RMFA 4IIRA 3FI3A 1APME 4D4VA 3SXFA 1UA2A 5FDXA 3TNWA 3VS0A 3P9JA 3LXKA 5EW9A 2HXLA 3HA8A 1J91A 5D11A 5AAFA 4I3ZA 2JITA 2E9OA 2YEXA 3I5NA 4JQEA 1OM1A 4G5PA 1K2PA 4DGOA 3JYAA 1DI9A 4LGGA 3PA3A 4XP3A 4C38A 5IG1A 4DEIA 2WXVA 5HICA 1H1RA 2PVMA 3CKWA 4H3QA 3RPSA 1OB3A 1MRYA 4R1VA 3MN3A 3NUUA 5AUZA 3U6HA 4QYFA 4O4BB 4BCOA 2PUUA 4U6RA 5JFVA 3KY2A 4NFNA 4QT1A 2VTTA 5HGIA 3KMMA 4B6LA 5C1QB 4GIIA 4ZTNA 1BUHA 4B7TA 3OT3A 4E6CA 4E5AX 1X8BA 3DDQA 3SOCA 3ZM4A 4E1ZA 3IOPA 4IJPA 4KBAA 3KULA 5EHLA 3AXWA 3SD0A 4II5A 4JDHA 4JOAA 4TY1A 4K77A 4QYYA 5FEDA 1V0PA 5CVFA 5LOHA 2CN8A 5KZ0A 4IVAA 3WZKA 5L8JA 1H1SA 3I6UA 3LJ2A 2EUFB 5J7BA 2W1CA 3O8UA 4F63A 2OG8A 4FOCA 1LEZA 2WOTA 5DI1A 3DT1A 4XYFA 4FUXA 4BDBA 3VS6A 4XV3A 3GUBA 4FSTA 3QCXA 1Q61A 3DY7A 3R8UA 1OECA 2FSMX 3PZEA 4D1XA 4QMPA 2CN5A 5LVMA 1XH5A 2JBPA 4OTGA 5D10A 3VBVA 1FPUA 3FLNC 5CTPA 4F99A 4K8AA 2OZAA 3UNKA 2J0LA 5BVNA 2ZYBA 5M57A 2C3IB 4R7IA 4U9AA 4I41A 5AP1A 4G6NA 5HG7A 4WNPA 5A6NA 4IACA 4IWQA 5EYCA 4HYIA 2WPAA 4F4PA 1SNUA 3AC1A 4G1WA 3RAKA 1CKPA 4YO6A 2QONA 3C0IA 4BIDA 5D7AA 5JK3A 3DK6A 3LXPA 3NUYA 4KIQA 5KHXA 4AX8A 3CXWA 4FIIA 1K3AA 2HY81 4HPTE 5HNBA 3GGFA 4CCUA 4PTGA 4PTCA 3D14A 4CLIA 2ZM3A 5A4CA 4GFMA 1J3HA 3Q9ZA 5L6PA 2GHGA 2XEZA 3KQ7A 5GJGA 3UG2A 5L3AA 3NRMA 1LUFA 1B6CB 4HYHA 4IWPA 5TT7A 3EFJA 2GMXA 3O2MA 2EWAA 2XBJA 2JKMA 3BQRA 3UIXA 4IZYA 4J53A 4UXLA 4YGAA 5AP5A 4ZTLA 4YP8A 3OMVA 5DHJA 3GOPA 3V01A 1Q62A 1XH6A 4F7LA 2O0UA 3IDPA 3FC1X 2F9GA 3LFQA 4HGLA 3G9LX 3OWJA 1TQIA 3DQXA 3KK9A 2ITQA 3DBFA 3PJ1A 4MNEB 4UMRA 4KRDA 3ZFXA 2PK9A 5CF6A 2BRMA 3F9NA 1Q99A 3IW5A 3KRWA 2BKZA 4G6LA 5J5SA 1PW2A 2J5EA 1GZNA 4PY1A 5T6KA 4FTKA 4DC2A 4WIHA 3BLRA 4L67A 2GCDA 1OMWA 3AD6A 4FG7A 4NIFB 3C1XA 1UWHA 1Y8GA 3FMLA 5EM8A 3BRBA 5FM2A 2JIUA 4I22A 4FKJA 2WU7A 3E62A 3FXXA 3CEKA 3GFWA 4CFVA 1VYWA 3AD4A 4U3YA 4TT7A 4QMWA 5HG9A 2C3LA 5EHYA 4BCPA 2EXCX 3BWFA 2XVDA 2JGZA 4QTEA 3QKKA 2R3GA 3Q32A 4C35A 2B9JA 2ZV9A 4ACDA 3DAKA 3EQCA 2WMQA 4BWKA 3KXMA 3A8WA 3VS5A 5IA2A 5M4UA 5D41A 3VF8A 4CZYB 4YHFA 4LRJA 4X2JA 4AGWA 2XP2A 4IM3A 2X7OA 4FTCA 5A14A 3ODZX 4I5HA 3RPVA 4ALVA 4EOJA 3VRZA 3G33A 3ROCA 2WMUA 2ITZA 5IUIA 1Q8TA 3CP9A 3FKNA 2R4BA 2V62A 2UZVA 3DQWA 2LAVA 3LW0A 2R2PA 3FL5A 5CT0A 5K4JA 1H1PA 3NR9A 4FKIA 3SAYA 5CLPA 4XG8A 5CU0A 4YU2A 4XG3A 4K18A 3TUDA 4BCMA 5I9XA 4ZSGA 2XA4A 3QD2B 4ZTRA 2FGIA 4R6VA 3C7QA 3NYNA 2VNYA 3O51A 5L8LA 4GVAA 4CVAA 2QOLA 1XWSA 4FKVA 4K11A 1GIJA 4PF4A 4K6ZA 5HU9A 5EI6A 1L3RE 5HKMA 1IA8A 3RAHA 1YHSA 2NO3A 4LL5A 2YERA 4YURA 4ANNA 1PMEA 4UEUA 4WKQA 4I6HA 5DWRA 4ZK5A 3BEAA 3PY0A 2P4IA 4FZ7A 3W2OA 5DIAA 5JKGA 4DFXE 4KSPA 5HD4A 2C47A 3DLZA 4WOVA 3LLTA 3UOLA 5K5NA 5CQWA 4IVCA 5AJQA 2O3PA 4QMSA 2HAKA 2ONLC 4OGRA 2AQXA 3OW3A 3R63A 4OTWA 2AUHA 2HWOA 3G9NA 1R0PA 2GNIA 1MRVA 4LI5A 3OOGA 3TWJA 2C3JA 2H6DA 3E93A 4R7HA 4YTHA 1Y6AA 5AX9A 3WF9A 5ICPA 3L9PA 3DU8A 2XJ0A 4FI1A 5EW3A 3EN6A 1ZARA 3FZ1A 2YCFA 4O21A 3SOAA 4C4EA 4FV1A 4JR7A 1WBOA 5ETIA 1OUKA 2CLQA 2PZ5A 3LJ0A 4QP1A 2QU6A 3LFDA 4A06A 1OZ1A 3COKA 2ZOQA 5CSWA 4B99A 4NTSA 1M7QA 2EB2A 1S9IA 3ZEPA 3HV4A 3NUNA 5FBOA 5DRDA 5BNJA 3VS7A 4MNEA 2OIQA 3R6XA 2BRBA 2UZUE 1Q5KA 4CD0A 3AT2A 4KNBA 3WYXA 1SVGA 4J96A 4X3JA 5KMNA 2RIOA 2WMAA 4U41A 4X2NA 1O6LA 5HIDA 3LFBA 4X21A 3FZOA 4FT7A 4NIFA 5JQ5A 3QA0A 2HK5A 3VS2A 2ITYA 5AIKA 3R1NA 2HZ0A 4I1ZA 4QP4A 1CM8A 3Q9XA 5FWKK 4XCUA 3GU6A 2QR7A 3UYSA 4WUNA 3F3VA 4NCTC 1YOJA 4O0WA 3ZLYA 2HELA 2WEIA 4GIHA 3HUCA 3PIXA 4GJ2A 2WTKB 2WOUA 3Q53A 2VWWA 2VAGA 2JLDA 1R3CA 4XG6A 5HVYA 3VUKA 4D4YA 4YTCA 3R30A 4E7WA 4CRLA 2BRHA 2OU7A 3PTGA 5HX8A 3TV6A 3W18A 1O6YA 2FSLX 3ANRA 3TZ7A 4YZCA 4PQNA 1PXKA 3ZUUA 2XEYA 2F57A 4M84A 2QOQA 4FNXA 4NW5A 3H9FA 4JI9A 3ZZEA 2GU8A 4CNHA 3CPBA 1FQ1B 4FC0A 4UX9A 2WMRA 2ZDTA 4OTIA 3OCBA 3TIYA 4DITA 1PJKA 2O64A 4HVDA 4CFMA 3BELA 1XJDA 2X2LA 3VUDA 4XMOA 5CEKA 4EH8A 3PG1A 4DH5A 5AR5A 3RINA 5JGAA 1Y8YA 2GDOA 4J8NA 1UVRA 2C6TA 4PWNA 3U87A 2XUUA 3D5UA 4QNYA 2BVAA 3NYXA 3DFCB 4G6OA 4K2RA 4R3PA 2OH4A 4KKHA 3OTVA 3BWJA 3B2TA 2BHHA 2VNWA 4M12A 1SNXA 3V8SA 3E5AA 3ZSGA 2Z7RA 4LYNA 3RZBA 3FKLA 2DUVA 4U81A 4E4MA 2G15A 4ZEGA 4F0IA 3EWHA 3BHHA 3KXXA 4M69B 2QOOA 5EW8A 3RHXA 3IOKA 2R7BA 4X7QA 2J2IB 4FSYA 4APPA 2GSFA 5KKRC 2XIXA 4FT5A 4XUFA 5BYZA 3UE4A 5KBRA 4BF2A 2BDFA 4J7BA 4OR5A 3LMGA 3EKKA 4MF1A 5JEBA 4RZVA 4ITHA 4D1ZA 4E6DA 4FT3A 4PDPA 1WAKA 3CQUA 4MCVA 3CR0A 4GV1A 3O96A 4XG4A 4ANMA 3V5WA 5HEZA 2EXMA 3MH1A 3O8TA 3KXNA 4PL4A 3MGYA 1BI7A 3ZOSA 2IZTA 3HDMA 3W33A 4KSQA 4FTOA 3HP2A 5HD7A 4WNMA 2X2KA 2BPMA 4F1MA 4ACHA 4YHJA 1GJOA 4A9YA 3WF8A 2ITUA 3BCEA 4FA2A 3OCSA 4V0GB 4E5WA 3VRYA 2UVYA 3K3IA 3FLWA 1W2DA 5IA5A 2JAMA 3TN8A 2BILB 2I0EA 3ANQA 4ZTHA 5FTOA 3U8WA 4KAOA 3LXLA 4MX9A 3F61A 4YPSA 3FXZA 3AC5A 2V5QA 2AYPA 3KN5A 3NW6A 5T68A 3W2PA 1PYXA 5ITAA 5H9BA 3PPZA 2VX3A 4LFIA 3GEQA 2QOKA 2ZJWA 3DKFA 4GT3A 5AV3A 4D1SA 3ERKA 3FY0A 4IE9A 4KA3A 4XV9A 1UNHA 3VF9A 4DGMA 4F9CA 5A4EA 5LWNA 2VWYA 1IR3A 5DVRA 2QHNA 2DYLA 3PE2A 4KBCA 4BHZA 1HCLA 2J51A 3PXYA 2QD9A 1UU9A 1ZYJA 2C0TA 2OGVA 3QZFA 3C0GA 3GXLA 3CY3A 2X8DA 4F6SA 1RW8A 2ZM4A 1VR2A 3HUBA 4BI0A 1NVRA 3F82A 4DEDA 2Y4IB 3K2LA 4IAYA 4RQKA 3PWYA 3ZMMA 4KINA 3CIKA 3EQBA 4U80A 3EMGA 4FZAB 3SQQA 3GC8A 4AA5A 2QOIA 4RWIA 5CAUA 4PNIA 2PTKA 5KBQA 4BDJA 4IFGA 2XKFA 5HQ0A 4E6AA 5M51A 3O8PA 5HESA 2FUMA 5IUHA 3UQCA 2UUEA 3TNPC 3MDYA 3I0QA 3I6WA 3EQFA 3UOKA 3ZDIA 4ZZMA 4GEOA 3ZH8A 1U5RA 4GS6A 4ANBA 4AWIA 1OIQA 4ZTMA 3OS3A 2JC6A 3JS2A 4O4DA 2HOGA 3VIDA 4BWPA 5LMKC 1FVRA 2YIWA 1KE7A 1K9AA 2BIYA 3IW4A 5DT3A 4BIBA 3ACJA 3AT3A 4BCKA 2GNLA 3K5UA 2XNPA 4D9UA 4F65A 1OKVA 2VGPA 2X0PA 1PY5A 5J87A 4H1JA 4S2ZA 4K1BA 4AT3A 4MBJA 2PWLA 3UGCA 5JGDA 1Q4LA 2QLUA 3COHA 1U5QA 2ITWA 4ZOGA 3TKUA 2VV9A 3QD3A 5HLPA 2BZKB 3FAAA 2H96A 1YDRE 4M69A 4ONAA 4MQ2A 4EOSA 4RC2A 3MFTA 1FGKA 3BLQA 4LGDA 2F2UA 5AM7A 1JKTA 2B54A 4KS7A 3T3UA 4BDIA 4BGGA 4XV2A 3KB7A 4FSUA 5EYDA 4U8ZA 4MXXA 5J5TA 2XK9A 3OXZA 3NNXA 1CKIA 3NYVA 4GUEA 4ID7A 3KF7A 4IQ6A 4R8QA 4UV0A 5LARA 3TJCA 4AGCA 1OPJA 4YUQA 1PXMA 4MHAA 4O0UA 4RSSA 2GNFA 5JMSA 3ZS5A 2QO2A 4A9UA 4C2VA 5D7VA 4L01A 4CYIA 4DEGA 3EFLA 4JBQA 4FTIA 2XRUA 5EK7A 1JSVA 1TKIA 4ZIMA 4TXCA 4O6LA 4OTPA 4XOYA 3FMEA 4BCGA 4BDEA 2VO0A 4F0GA 3OXIA 2VTOA 3AC2A 2GNGA 3KXGA 4U79A 4BN1A 5IDPA 5EOLA 4IZAA 1OKWA 4A4LA 3UOJA 2C0OA 4FZDB 4O0VA 5AUXA 4V0GA 4TYHA 3AD5A 3C4ZA 2RKUA 4S30A 4UBAA 4MNFA 1QPCA 3QUDA 4HCVA 3BX5A 2C5VA 3OHTA 4QMXA 4WSQA 3V51A 4AZTA 4C62A 4RJ7A 3PY1A 2YIRA 4PL5A 2W5HA 2IN6A 4MD8E 2YN8A 2BTRA 3PJCA 1I44A 4FTAA 5ANOA 2C1BA 3MTFA 2BAKA 3W32A 5FG8A 1RQQA 3GU7A 3A7IA 3QQJA 4G16A 2WMXA 4RWJA 4FSRA 3FMHA 4D58A 4QMTA 1U54B 3T9TA 1P5EA 4G9CA 3QZHA 3F6XA 4ZXTA 4GU6A 4I21A 3U51A 3ALNA 4LOPA 5AR2A 4AE6A 4DGLC 3EB0A 1KE9A 4L9IA 3PVWA 2C6MA 4I6BA 4KRCA 5ANDA 3T8OA 2XJ2A 4IX3A 5AA8A 5IMEA 2PE0A 1YWVA 4LUEA 3F5UA 3GC7A 5AV1A 5HVJA 3OFMA 1O6KA 4ACCA 5J95A 3NLBA 4IH8A 3FPMA 2SRCA 1IG1A 1MUOA 3OT8A 4Y95A 3K54A 5AR7A 5G1XA 3C4EA 5CSXA 1PXIA 3LIJA 2WO6A 4AOJA 2PL0A 1YHWA 5H2UA 2LGCA 3V5LA 4YTIA 3EOCA 4IEBA 5JT2A 1F5QA 4BKYA 5K4IA 4XRJA 2WIHA 3OF0A 4LGHA 4M13A 3ORZA 3EL8A 5BVWA 3W2QA 4AN9A 5ANGA 4L42A 4Q9SA 4BBEA 3RNIA 5A4TA 3BBWA 5LWMA 4CCBA 3UNJA 4IHPA 4CXAA 3RM6A 4P90A 2GFSA 5BVKA 1QPEA 3ZLWA 2B9IA 5C9CA 3G90X 3IW7A 4YNOA 3UO5A 5LMBA 3H0ZA 1Q3DA 3BYOA 4AW5A 2CLXA 3RNYA 2AC5A 1B39A 3KL8A 2XRWA 4NM7A 1WCCA 5A4LA 3Q4TA 2PMLX 3UG1A 2H8HA 1JKKA 3R28A 4YJNA 3S1HA 3D94A 3TJDA 5L6WL 3MIAA 4C4HA 4XBRA 3IW8A 4BBFA 5CF4A 1FMKA 4L43A 1Q41A 4S31A 1JSUA 5CASA 5F9EA 3BE9A 1H1WA 3DV3A 4QP3A 4HOKA 1TQPA 2UW3A 2V7OA 4BBMA 5LVNA 1PXLA 1YI6A 1GY3A 3W55A 2IW6A 3DBCA 1XKKA 3QRUA 4G5JA 4Y72A 1OL2A 5FGKA 4G34A 4Z55A 1F3MC 4ASEA 5ACKA 4ZP5A 4AT4A 3O23A 3KRRA 3TZMA 4EZ5A 2JKKA 3R22A 4C61A 2UZWE 2WD1A 3HL7A 3Q9WA 1YI4A 4X3FB 3JY9A 3V6SA 4BRXA 2ETRA 1BX6A 4EYJA 4Y5QA 4Z3VA 5M56A 3P86A 5A4QA 5E1SA 2VD5A 1DAYA 3F3UA 4FKQA 3QCSA 2PZIA 5ANIA 5E8ZA 3U6IA 3UZTA 1NXKA 4EQMA 5EDQA 4JX3A 4Y8DA 2F7XE 3R7EA 5CF5A 3MTLA 3ORPA 3W2RA 4IX6A 1WMKA 3D2IA 3ZONA 3R73A 4BB4A 1OL5A 3C50A 3NX8A 3OG7A 2P2IA 3TNHA 1YXSA 2WU6A 1UNLA 2VTNA 2XKCA 4WSYA 5JN2A 2OJJA 2UVZA 4AN3A 4ZS0A 2W4KA 2A19B 1U54A 1W0XC 3DTWA 4JG7A 4AZFA 5KE0A 2HENA 4V01A 3W2SA 3LVPA 3W8LA 2E9VA 4KD1A 1W2CA 2PVHA 3IS5A 2YJRA 3OZ6A 4P7EA 4M0ZA 2WMBA 1OPKA 3ZO2A 3C13A 2HW6A 5CXHA 4N0SA 5K0KA 2JKQA 2QI8A 2UZLA 2XIYA 4IM2A 4L3JA 5GZAA 4F1TA 5M4CA 2JKOA 1QMZA 4DH1A 5GHVA 2BUJA 4ANSA 2UZDA 2EU9A 4BKJA 4FL3A 2XCHA 2PMNX 4QOXA 4UALA 4I6FA 4L3PA 5KMIA 4OBOA 1LR4A 2ESMA 4YJPA 4BDKA 3LQ5A 1OIYA 3MPMA 2WKMA 4QP2A 3VN9A 5CAQA 4FUYA 2GTNA 2VX1A 2E9NA 2W5BA 4FKLA 4BCFA 4CFWA 2WMSA 2G9XA 1ZAOA 2X4ZA 2YAKA 2ZB1A 3E92A 3K5VA 4EI4A 2P3GX 3C9WA 1URCA 3GENA 4DG2E 4FTRA 4J52A 5EKNA 3IKAA 3OCTA 2Y4PA 5IA4A 2C6IA 3LFAA 3Q96A 3TI1A 3B8RA 3JXWA 4YJTA 3HMNA 3TL8A 2I40A 1T45A 2IVVA 3KGAA 3TNIA 1SVEA 4Y46A 4ZLOA 3DBDA 2CDZA 3OOMA 4PP7A 5CU6A 4D4SA 5L2SA 5IA3A 4FTMA 5JFSA 4OW8A 4LMUA 5FEQA 4NJDA 2OJFE 1H01A 1YDTE 2J0IA 3HZTA 3RTPA 4AGUA 2OIBA 3QWJA 1GZ8A 1ZMUA 1ATPE 2UZBA 3C4FA 3QLFA 1FMOE 5IU2A 4U45A 4UMPA 1ZOEA 3R2BA 3R8PA 2X9EA 1E1VA 3EN9A 3EIDA 3L1SA 4FR4A 3NIEA 3MVJA 4FV5A 4LOOA 5CVGA 5CEIA 4ERKA 2VWVA 4YZMA 5I9VA 3R1SA 4HJOA 2OH0E 3GQLA 4RFZA 5GNKA 2IO6A 4EOMA 3TUBA 4G3CA 3VO3A 3TUCA 5ETFA 3V8WA 4S34A 3MJ2A 1FINA 2WELA 2WEVA 3LZBA 4NKSA 3MV5A 4EORA 4AP7A 4WHZA 4X3FA 3R9HA 2YFXA 2CGWA 4PP9A 4JDIA 4OBQA 5CNOA 4WRGA 4E4LA 1H08A 1P2AA 4CFFA 3Q6WA 4CKJA 2JIIA 2VUWA 2PMOX 3UZPA 3WF5A 4C4IA 4E4NA 5FQDC 4EH4A 3DAEA 4M14A 4I6QA 1IRKA 5ANKA 3BGPA 4I0TA 4IWOA 1FGIA 2UW9A 3OWLA 1QPDA 4B8MA 4D5HA 2XNNA 4I24A 3SXRA 3PLSA 4HNIA 4WG3A 1ZY4A 3E7VA 4JG8A 1BLXA 4M3QA 4EYMA 2OFVA 2FSOX 3NSZA 4M66A 4BHNA 5L2QA 5HLWA 3CD3A 4PV0A 5LXMA 5FBNC 1ZWSA 4PMPA 3GCUA 3R21A 5F1ZA 3KRXA 3G6HA 4Z7HA 5L8KA 2X0GA 3ORMA 5CWZA 4I92A 3GCVA 2QVSE 3QYZA 1ZXEA 3RCDA 5AV2A 4BVUA 3NAYA 2XYUA 3MFUA 5J9LA 3DZQA 3UO4A 1UV5A 2IF8A 4DH8A 3HV7A 3COIA 5HE1A 1YXTA 2VWBA 4C2WA 3QF9A 5CI7A 4C34A 5HNGA 4HVGA 4TRLA 1QPJA 2VO6A 3PWDA 2ZM1A 4CFXA 4RLKA 1PKGA 2WZJA 3DK3A 3R7GA 3GNIB 4J1RA 4YZBA 3S3IA 3TNQB 2FYSA 3EQDA 3CGOA 4B4LA 3HYHA 3HMMA 4YC8A 2OF2A 3VJOA 3SX9A 4AW2A 3ZCLA 3DB6A 3GCPA 3Q4ZA 4H1MA 4IX4A 2OXDA 2EVAA 3Q5ZA 5J8IA 1VJYA 4EHVA 5A54A 4A9TA 3MI9A 4KS8A 3W1FA 4E73A 4RJ4A 2ZV2A 5LVLA 4FL1A 3ZRLA 4H3PA 3OUKA 4C0TA 3QXPA 2YJSA 4YJUA 4CQGA 4TWOA 3ZO1A 1GOLA 3BYSA 3ZDUA 4LOQA 2PHKA 2XJ1A 3BIZA 3HMPA 4I4EA 1Q8WA 4EK5A 3F3ZA 4GK2A 4JNWA 5EOBA 1E1XA 2RG6A 4C4GA 4FKUA 3EHAA 4HGTA 2VTPA 3EL7A 4BDDA 3NEWA 1WBPA 3LAUA 2C5YA 4JT3A 4MD9E 2JDOA 2CSNA 5HE0A 3VAPA 4EL9A 4F6WA 4C7TA 4FSMA 5DEYA 1Y57A 4BKZA 2Y9QA 3L8VA 4IB0A 4XLVA 4KB8A 4R1YA 4OTQA 2W1FA 2C0IA 2G2IA 1W2FA 4O22A 2QURA 4FNYA 2Y6OA 4C37A 4E5BA 2VTLA 4GW8A 2YDKA 2WAJA 3AMYA 3RP9A 4U0IA 2DWBA 5K5XA 2OW3A 2VRXA 3HRCA 1ZYLA 5IZFA 3Q5IA 4CSVA 3Q52A 4FGBA 2ZMDA 4M8TA 3OD6X 3F69A 3ENMA 2FO0A 2A0CX 4FIHA 5CSPA 3RK7A 1YI3A 2YM7A 3TACA 4EOOA 2W0JA 3HDNA 3B2WA 4FVRA 3ULZA 5TOZA 4F64A 3T9IA 2QO7A 3G5DA 1BL6A 4RPVA 3ODYX 4MXYA 4YNEA 2WQMA 5L2TA 5AR4A 5J9YA 2W1IA 5E8TA 4F7SA 5AEPA 2J0KA 3WILA 4EOKA 3EH9A 4AE9A 2IVUA 3FMDA 4JBVA 5M55A 3EQPA 2C6KA 3TG1A 2V22A 4EH2A 3V6RA 4RZWA 3QC9A 4O96A 2C5NA 5C8MA 3VBWA 4HYUA 3CQWA 3TV7A 1YOLA 4EUTA 2PE1A 2X4FA 2X39A 2Y7JA 4WNKA 3QYWA 4FV2A 2VWUA 2YABA 4L53A 4UWBA 4JAIA 3LQ8A 3QBNA 3MY0A 3S0OA 5CF8A 5M53A 4DG3E 4BYJA 1W82A 4IZ7A 2OIDA 3EN4A 2JFMA 4RC4A 2QNJA 3A60A 4IB5A 4JDKA 4OT5A 5HNIX 2G2FA 4FV6A 3BQCA 3VBXA 2I0HA 3QHWA 4B0GA 1CTPE 3ORXA 3SRVB 1LPUA 3ALOA 3HMOA 4QTCA 3GVUA 5KZIA 2YWPA 2GNHA 3E8CA 4HVSA 4JQ8A 4YO4A 3FZPA 3UQFA 2UW4A 4RFYA 3W8QA 1A9UA 2PMIA 5CU2A 2OWBA 5DE2A 1NA7A 4QYHA 2PY3A 4RVTA 5HOAA 5E8YA 2YM4A 3L8XA 3VBQA 4BDCA 3V8TA 4DEHA 4FF8A 1W98A 1UWJA 4RIOA 5EI2A 3UVQA 1ZMWA 1ZLTA 4EKKA 3R9DA 3HRFA 4IDVA 3DBEA 2ZAZA 3DS6A 4ZJIA 4UMQA 4KWPA 4RC3A 3FPQA 4E6QA 4ASXA 3R01A 3A7FA 4IDTA 4YTFA 4JX7A 3ZZWA 2VTMA 3E8EA 2CGXA 2W1ZA 2HY0A 2VTAA 1SMHA 2XMYA 3PSBA 4PL3A 4AOTA 5IISA 1VZOA 2XK3A 2W9FB 2QLQA 4NT4A 4EZ7A 1Q24A 3ZLSA 4YLJA 4DCEA 3QL8A 4O2ZA 3QGYA 4EUUA 2HZ4A 4C02A 2PVYA 5I5ZA 1AQ1A 2VWXA 2XNBA 2YLEA 3QD4A 4YPDA 3RK5A 3VC4A 4UZDA 3ZSIA 4HVIA 3HX4A 4MQ1A 4RLLA 1CMKE 5G6VA 3ZYAA 3AQVA 3QA8A 2H9VA 3L9MA 4UMTA 1HCKA 4AZEA 5AUTA 4GT5A 4FZFB 4GH2A 4IB3A 1XO2B 2HCKA 3BI6A 5E90A 1I09A 5AR8A 4TPTA 4F6UA 2OJ9A 3LOKA 4L00A 1MQ4A 4IXPA 5DPVA 3EJ1A 3SKCA 1XH4A 1BYGA 4QMLA 4D2WA 3O7LB 4L7SA 4GFGA 5EKOA 4QQ5A 5HTIA 3IPHA 1TVOA 2IWIA 2R0IA 4DEAA 4YJQA 4FYNA 3E63A 4M0YA 5C27A 4AOIA 1YXUA 5AR3A 5I4NA 3PVUA 4G31A 4H58A 4MAOA 3OY3A 2WTJA 4FV0A 3FQHA 5AIRA 4GJ3A 3I5ZA 3KC3A 3R0TA 4HGEA 1YVJA 2WTWA 3NNVA 3R8LA 2UZEA 1H27A 4DGNA 5EYMA 3MBLA 1JKLA 4FSQA 3UVRA 4FKPA 4X6RA 4QQTA 2OJGA 2H34A 5DA3A 3V3VA 2YM6A 3BYMA 5CSVA 3E3PA 2WQNA 4O27B 3S4QA 4ANLA 3CQEA 5KMMA 1UKIA 3AGLA 3ORNA 4WG5A 3RM7A 3KFAA 3QFVA 4G3GA 4PX6A 1SVHA 1ZOGA 5CYIA 4CEGA 4X2KA 2YLFA 3P0MA 2Q0BA 4FBXA 2ONLA 4P5ZA 3MY1A 1ZY5A 3FSFA 3R1QA 2X6EA 4R3CA 3QQKA 4ASDA 2JDVA 4K0YA 4PNKA 3ULIA 3WARA 4EWHA 2XM8A 4U42A 4BICA 3CJFA 4C8BA 1R39A 2J0JA 4FV8A 1M52A 2QG5A 4D4RA 2DS1A 1YOMA 3F3TA 4IB1A 2P0CA 3KRJA 4FIFA 5B2MA 3SRVA 3M42A 2V55A 3N9XA 4JG6A 2GFCA 1RJBA 4ACMA 4XNEA 1YW2A 4TYEA 5HG8A 4ZSEA 3EN5A 4BGHA 5IH4A 2VO3A 4M15A 4QMUA 3CBLA 4FG8A 4O0SA 3EFWA 4RT7A 2Z7SA 4TNDA 4BIEA 3QTUA 3UIBA 4YSMA 3I60A 5CAOA 2UZTA 3O7LD 3PA4A 3ELJA 4CMOA 3S00A 4LQMA 4DYMA 5IKWA 3I1AA 4AQCA 2C30A 2PVFA 3UBDA 3FMMA 1JKSA 5HTBA 4RA4A 4DG0E 4Y85A 2PVJA 4GG5A 4KIKB 3GU4A 5H8GA 4MKCA 3ZHPC 3CPCA 1UU3A 4YLLA 3C4XA 2YM3A 4OTHA 4ZY6A 1H07A 2UW0A 3H10A 3PRIA 3D83A 4IFCA 4EH3A 4XRLA 3SHEA 4AGDA 4YHTA 3GU8A 5M4FA 4N6ZA 2HZNA 5E8VA 3DOGA 4L46A 2BDJA 2BCJA 1OI9A 5AP6A 3MVHA 4M7IA 5HLNA 3DFAA 2F4JA 4JR3A 2JIVA 4TL0A 3NZ0A 3M2WA 4D2PA 5IH5A 4BCQA 2J5FA 2UZOA 3II5A 4KIOA 3F3WA 3R7YA 3WZEA 4F9AA 5CEOA 2QCSA 2PVLA 3QZGA 5B2KA 5AV4A 3UMXA 4D0WA 3GOKA 4AW1A 3NAXA 2Y4IC 3GCQA 3UO6A 5HG5A 1U59A 2W1HA 2JDRA 5D12A 5DN3A 5ETCA 1H0WA 5FD2A 2C6OA 4AA4A 1REKA 3LCKA 4FIGA 2BDWA 1Y6BA 4TW9A 4AACA 4MEDA 2W4OA 4XOZA 1WVXA 3REPA 3DLSA 3POZA 5KMKA 2XK4A 4PMMA 1YXVA 4FVPA 4QP8A 1BI8A 4J71A 4ENYA 4MD7E 3MPTA 3GCSA 1G5SA 4I5MA 2ITPA 3R71A 3SLSA 4FTTA 1OL1A 3A62A 2X8IA 3KRLA 2R3OA 4XLIA 3VJNA 5L2WA 4NSTA 5DR2A 2XNGA 1R0EA 3QX4A 2YAAA 3CTQA 5LCJA 3U6JA 2W1EA 1XBAA 3VWAA 4ITJA 2OBJA 3UIUA 4P5QA 1Q97A 2NP8A 4GFOA 3P79A 5FLFA 3QUPA 3DPKA 2J6MA 3D7TB 4HCUA 4YSJA 4G9RA 3QWKA 3IDBA 1DS5A 4JJRA 3EFKA 4D55A 3PUPA 4DN5A 5L6OA 5JZJA 2F49A 4NFMA 3LCSA 3EQRA 4JS8A 1REJA 2UV2A 4F0FA 1NVSA 3Q4CA 3GI3A 3C5UA 4AU8A 3NPCA 5EDRA 3SDJA 1PMNA 3H4JA 1J1CA 4CLJA 4ZJVA 5CANA 3C51A 4E93A 5C8NA 3QAME 4WBBB 4CV8A 3BGQA 3CY2A 4CV9A 1U4DA 3H30A 4W9XA 2IVSA 3GT8A 5LQFA 3OY1A 5K9IA 2XNEA 3TV4A 4AF3A 3ZC6A 3UVPA 2I0VA 2J4ZA 4A9SA 5BPYA 1URWA 5CS6A 3P7BA 2C3KA 1PMVA 5CXZA 3AMBA 4DBNA 1T46A 3KKVA 4EZ3A 3QKLA 2YCSA 2C5OA 4KIKA 4M68A 3KMWA 3TZ9A 1UKHA 4LG4A 1R1WA 1WZYA 3ZO3A 1MP8A 4EK4A 4ZZOA 1KE8A 1Q8ZA 2Z60A 3RKBA 2HIWA 5CX9A
chains in the Genus database with same CATH topology
1W2DA 4O4EA 1W2FA 1W2CA 2AQXA 4FRFA 2IF8A 2X0QA 1TZDA 4O4BB 4O4DA 2X0PA 2X0OA 4O4FA 2IEWA 4O4CA 2A98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2D A;  4O4E A;  1W2F A;  1W2C A;  2AQX A;  4FRF A;  2IF8 A;  1TZD A;  4O4B B;  4O4D A;  4O4F A;  2IEW A;  4O4C A;  2A98 A; 
#chains in the Genus database with same CATH topology
 5EFQ A;  1BL7 A;  3V5Q A;  1H4L A;  4W9W A;  2W1G A;  3VS4 A;  3NGA A;  5K3Y A;  2ITX A;  4GYG A;  5KML A;  4NUS A;  5I3O A;  2VTR A;  5J9Z A;  3EQH A;  3PE1 A;  3F7Z A;  3MH0 A;  5AUY A;  4AS0 A;  3OXT A;  3WE4 A;  2BIK B;  4WG4 A;  4EH9 A;  2YCR A;  2YAC A;  5DMZ A;  3UIM A;  4D5K A;  4ZY4 A;  3FQS A;  4JLC A;  3C0H A;  4BCJ A;  4UYA A;  3GC9 A;  2X0O A;  2RFD A;  4DH7 A;  5BUI A;  2CPK E;  4J98 A;  4TYG A;  3I79 A;  5E8X A;  3DXN A;  4QQJ A;  1FVV A;  3LFN A;  2F7E E;  1UNG A;  5ACB C;  3ORO A;  2REI A;  1PKD A;  3PP0 A;  3MB7 A;  3KVX A;  1JST A;  1NVQ A;  5DRB A;  4O38 A;  5E8S A;  1EH4 A;  4GL9 A;  4DTK A;  3R9N A;  4QQC A;  5TO8 A;  4MYG A;  5EDP A;  2BRG A;  4OTR A;  2R5T A;  4H3B A;  3R7V A;  2C5X A;  3HGK A;  5B7V A;  2GS7 A;  5DNR A;  2R3J A;  1BKX A;  3F66 A;  4DLJ A;  4KKE A;  1P4O A;  5TKD A;  3QTW A;  4YBK A;  4C4J A;  4HGS A;  4MVF A;  5KHW A;  3BEG A;  3BHV A;  3BHY A;  3PIY A;  4FL2 A;  4EKL A;  3P5K A;  3WBL A;  2QOF A;  5M4I A;  4FVQ A;  3IW6 A;  2ACX A;  4UB7 A;  1KOB A;  5ETA A;  2ETK A;  1PXO A;  3HEG A;  2X8E A;  4FZ6 A;  3PSC A;  3QRT A;  4O4E A;  4BCI A;  2R3M A;  2BAQ A;  4RA5 A;  3LXN A;  3PY3 A;  3QTZ A;  4Z9L A;  5E8W A;  4NWM A;  2J0M B;  2R0U A;  3DJ6 A;  2HXQ A;  3BU6 A;  3PVB A;  3FBV A;  4OBP A;  3FLZ A;  4EC8 A;  4RMZ A;  5HHW A;  3HNG A;  5I3R A;  3ZTX A;  4DGG A;  4EON A;  2W1D A;  4IAI A;  2IZU A;  4EJN A;  4L3L A;  4QMY A;  3LFE A;  3I7C A;  2R7I A;  3P08 A;  4FKT A;  2OKR A;  4HPU E;  3ZFY A;  4GT4 A;  2GHM A;  3PFQ A;  4E20 A;  3D7T A;  3MA3 A;  2NRY A;  4QP7 A;  3R7U A;  4AZW A;  3AC8 A;  4JIK A;  3WI6 A;  2HWP A;  4FTU A;  4QD6 A;  3M11 A;  4C58 A;  2X7F A;  5JZN A;  5BVD A;  5AM6 A;  3DTC A;  3EN7 A;  4IAF A;  1H26 A;  2CJM A;  2ZDU A;  4CTB A;  3DA6 A;  4XG7 A;  2XKE A;  2Z2W A;  5KNJ A;  3TKI A;  5IPJ A;  2V7A A;  3JPV A;  4HW7 A;  3PPJ A;  4FTL A;  2WNT A;  2OXX A;  3F5G A;  3IG7 A;  2XK8 A;  2G2H A;  3QLG A;  5CQU A;  4Y73 A;  4XHK B;  4N70 A;  2IVT A;  3DB8 A;  4LV5 A;  3B8Q A;  5AP7 A;  3FDN A;  4GU9 A;  5HBE A;  4MWI A;  3ZUT A;  5GJF A;  3E88 A;  1M7N A;  2XH5 A;  5ANJ A;  2GS6 A;  2WHB A;  4NM0 A;  4DLI A;  4OLI A;  1ZYD A;  3GU5 A;  1JBP E;  3L8S A;  3NDM A;  3MB6 A;  3SA0 A;  3HVC A;  4D2T A;  3QC4 A;  4BI2 A;  3RCJ A;  3O17 A;  2R3R A;  3QQF A;  3DND A;  4FSZ A;  4AZV A;  5HO8 A;  4E8A A;  4JXF A;  4CFU A;  3LFS A;  2X9F A;  5BUJ A;  3AGM A;  3PSD A;  2XF0 A;  3DCV A;  3DBQ A;  3HP5 A;  3MH3 A;  2OZO A;  3FWQ A;  4RIX B;  3GB2 A;  4I0S A;  3V5T A;  3VQH A;  3EQI A;  4EH5 A;  4AN2 A;  4OAV B;  3WYY A;  1SYK A;  2C6L A;  4BWX A;  5HO7 A;  5DT0 A;  4P2K A;  5TR6 A;  2CGV A;  1R78 A;  3D4Q A;  3QUE A;  3ZUV A;  3AMA A;  3FMK A;  3NIZ A;  2Z7Q A;  4FOB A;  1JVP P;  4UXQ A;  4D9T A;  1M2Q A;  1STC E;  2G1T A;  4EOL A;  5EYK A;  4BDA A;  1CKJ A;  4O0X A;  5KUP A;  1G3N A;  4D2S A;  5CAV A;  2ZMC A;  5KMJ A;  4EBW A;  1XH8 A;  1PHK A;  4EH7 A;  2FH9 A;  5HE2 A;  4W4Y A;  4A7C A;  3L8P A;  4RX5 A;  2JED A;  3RI1 A;  5DT4 A;  3AC4 A;  1J1B A;  4OT6 A;  5BVO A;  3ET7 A;  3A99 A;  2KUL A;  3F5X A;  4EOI A;  3KU2 A;  5IF1 A;  4ZLY A;  3NUX A;  3LPB A;  4JBP A;  4FK3 A;  3VUT A;  1W8C A;  5DR6 A;  3F5P A;  4XX9 A;  3PXF A;  1GIH A;  2OO8 X;  2YM5 A;  4D28 A;  5B2L A;  4PPB A;  4MXZ A;  5FRI A;  3A4P A;  3HV5 A;  2UW8 A;  2X0Q A;  3QU0 A;  1MQB A;  5HVK A;  5IEY A;  5ANE A;  5JFX A;  4YC6 A;  4YLK A;  2C4G A;  5IH6 A;  4BDG A;  2W05 A;  1E9H A;  3ENH A;  2B9H A;  3FKO A;  1JWH A;  4PPC A;  4E4X A;  4IC8 A;  4CT1 A;  4FTJ A;  2UW5 A;  2GHL A;  3FL4 A;  2JAV A;  2FB8 A;  2QQ7 A;  2ETM A;  3IDC A;  3R9O A;  4E3C A;  2VTS A;  4QMM A;  4D0X A;  1TQM A;  2YCQ A;  1S9J A;  4FNW A;  1M2R A;  5HE3 A;  1KSW A;  2GQG A;  3ORT A;  2WQE A;  2Y0A A;  5C03 A;  3RBW A;  3VUI A;  4UZH A;  4A07 A;  4XH6 A;  1PXP A;  4WRS A;  3DJ7 A;  4TWN A;  2Z7L A;  2W9Z B;  4C59 A;  3FYK X;  3Q60 A;  5GJD A;  5AP0 A;  1OKY A;  3QQG A;  1ZZ2 A;  2VWI A;  2QOB A;  2QOD A;  3PJ2 A;  3QCQ A;  4IAA A;  4C3P A;  2E2B A;  3VBY A;  2VN9 A;  4BTM A;  1YWR A;  4FYO A;  5HIE A;  3MVM A;  4O0T A;  1W83 A;  1QL6 A;  4NH1 A;  4RIW B;  4APC A;  3V5J A;  2QKW B;  2RGP A;  1GZK A;  5HCY A;  4IAZ A;  5A46 A;  4L45 A;  4BC6 A;  2R64 A;  3KCF A;  5J1W A;  3F2N A;  4Q5E A;  2O2U A;  3BGZ A;  3G6G A;  3IK3 A;  4J99 A;  4Z7G A;  2A27 A;  3WOW A;  3JVR A;  3RWQ A;  1ERK A;  2X7G A;  4BDF A;  4O1O A;  4Q5H A;  5TE0 A;  3WZU A;  2Q0N A;  1OIT A;  5E7R A;  3PPK A;  3SW7 A;  4WUA A;  1FOT A;  4NM3 A;  4AFJ A;  3CD8 A;  5EM7 A;  4EBV A;  5BVF A;  1WBT A;  5FXR A;  3AOX A;  5HBH A;  2VTH A;  3QTI A;  5FEE A;  4Q2A A;  4GG7 A;  3I0O A;  4IW0 A;  3OC1 A;  3NS9 A;  1Q8U A;  3A61 A;  3QQL A;  3VHE A;  1W84 A;  3NNW A;  3HRB A;  4RIX A;  1JNK A;  1OL6 A;  1DAW A;  4W8E A;  4OAU C;  4BI1 A;  3D5X A;  1WBV A;  4FKS A;  4TWC A;  3S95 A;  3QCY A;  3U9N A;  1DM2 A;  2O65 A;  4JVG A;  4BDH A;  2EXE A;  2IEW A;  3O0G A;  3FZR A;  3HA6 A;  1DI8 A;  2XK7 A;  5HTC A;  3ZFM A;  3CLY A;  4KAB A;  5HCZ A;  5FXS A;  5AV0 A;  2V0D A;  1Q8Y A;  4I94 A;  2BHE A;  4M97 A;  1XH7 A;  3G0E A;  3H9R A;  4X0M A;  3R00 A;  4FG9 A;  4RWK A;  3P4K A;  5CZI A;  4AZS A;  4F7J A;  4L6Q A;  2CGU A;  3FLQ A;  4R3R A;  4DFY A;  4DFZ E;  5E1E A;  3ZLX A;  3ZO4 A;  5T3Q A;  2BZH B;  1YWN A;  3CTJ A;  5IA1 A;  4BTK A;  4X2F A;  3UMW A;  3HLL A;  4GMY A;  2DQ7 X;  2WGJ A;  3ION A;  3U4U A;  1OIU A;  4QTB A;  5I9W A;  4ACG A;  1KOA A;  2G01 A;  2WTD A;  3DGK A;  3FSK A;  4TYI A;  2JDS A;  4O91 A;  5DG5 A;  2XIZ A;  1YQJ A;  4AAA A;  3ZBF A;  1H28 A;  3NNU A;  4HZS A;  4IAN A;  1U46 A;  4PUZ A;  1KWP A;  2BFY A;  3BPR A;  4TNB A;  2VTI A;  3Q2M A;  4U3Z A;  4NTT A;  3VUH A;  2BMC A;  1H00 A;  2W99 B;  3GC0 A;  1H25 A;  4IM0 A;  4NZW B;  4RJ5 A;  4S32 A;  4B9D A;  2X6D A;  3FC2 A;  5JFW A;  5L4Q A;  2OSC A;  3KXH A;  5C8K A;  4E26 A;  4BYI A;  4O0Y A;  3WZJ A;  2CHL A;  4FOD A;  4J97 A;  1P4F A;  5E8U A;  4O2P A;  5AAD A;  4L44 A;  4BCN A;  3C4W A;  5CY3 A;  2YA9 A;  4HYS A;  3VS1 A;  1PXJ A;  4CKR A;  2PVN A;  3N51 A;  4H36 A;  4DEE A;  4XG9 A;  2C1A A;  1HOW A;  1A06 A;  2RFE A;  5EHO A;  5KO1 A;  3ZEW A;  3D5W A;  3PXZ A;  4QP9 A;  1OIR A;  3SW4 A;  1CDK A;  3GP0 A;  4EHZ A;  1SZM A;  5CU3 A;  1KV2 A;  3BYV A;  2RL5 A;  4U44 A;  3R8V A;  4ARK A;  1PMU A;  3M1S A;  1GNG A;  4I5P A;  4ANO A;  1JAM A;  3HV3 A;  3UDB A;  2ZV8 A;  2PSQ A;  2WMV A;  2UVX A;  3PIZ A;  2XK6 A;  5DEW A;  1YXX A;  3W2C A;  3OBG A;  1JQH A;  2VX0 A;  2W17 A;  3E8D A;  2C6E A;  2ZV7 A;  4FT9 A;  4RIW A;  3TKH A;  5EM6 A;  4B8L A;  4BTF A;  4BCH A;  2FVD A;  1YKR A;  3OW4 A;  5DH3 A;  5DOS A;  4D2R A;  5AP4 A;  4G2F A;  5CEM A;  1MRU A;  2I0Y A;  5CEN A;  3ZSH A;  4C57 A;  4O4F A;  1KE6 A;  2BAL A;  4MK0 A;  2XZS A;  3H3C A;  3LFF A;  4HNF A;  4LL0 A;  3RZF A;  3VUG A;  1AGW A;  1VEB A;  3DKC A;  3R7I A;  3UOH A;  4AUA A;  3MYG A;  3COM A;  3ZU7 A;  4C3R A;  3DKO A;  2C68 A;  1H24 A;  3KN6 A;  4ZSA A;  5BUE A;  3V5P A;  1OKZ A;  4FSW A;  3L9N A;  3R8M A;  3UOD A;  4L8M A;  2YZA A;  2R3N A;  4FNZ A;  5JH6 A;  5A6O A;  4MWH A;  2BAJ A;  5A3X A;  1KV1 A;  3UQG A;  5IDN A;  2GPH A;  5KCV A;  3BLH A;  2RSV A;  3KVW A;  2R3F A;  2OIC A;  4BZO A;  4CMU A;  3IO7 A;  2BZI B;  4ENX A;  3TEI A;  4UWC A;  4CZT A;  4EC9 A;  3QHR A;  4XP2 A;  5DLS A;  3HMI A;  4CZU A;  3QXO A;  1XBB A;  3PRF A;  4JL9 A;  2AC3 A;  1XQZ A;  4K9Y A;  4PDS A;  5AUV A;  3Q6U A;  1UU8 A;  2XYN A;  5J1V A;  1XBC A;  5AAE A;  4HCT A;  4UMU A;  4EK8 A;  3G0F A;  3ORI A;  5K0X A;  2F2C B;  4U7Z A;  4PTE A;  2O5K A;  4RJ6 A;  4FV9 A;  4GK4 A;  2RG5 A;  5LMA A;  4MTA A;  3TTI A;  4XP0 A;  4UWY A;  3FI4 A;  4MXO A;  3MS9 A;  3HEC A;  2WIP A;  3KK8 A;  3QTR A;  5JGB A;  5H8E A;  5HCX A;  3OTU A;  4RX9 A;  2IW8 A;  2W4J A;  3Q4U A;  3FHI A;  2YIX A;  4V04 A;  1WVW A;  3FJQ E;  1NY3 A;  2WTC A;  4I23 A;  3NW7 A;  1O9U A;  3P78 A;  4QO9 A;  4IVD A;  4R5S A;  3EZR A;  5JQ8 A;  5TF9 A;  4BZD A;  3WE8 A;  4YR8 A;  3A7G A;  4GSB A;  2BFX A;  2FA2 A;  2XCK A;  3PZH A;  4WT6 A;  4W4V A;  4W8D A;  2C69 A;  3BU3 A;  3CC6 A;  3UP7 A;  2PZR A;  2R3P A;  3QQU A;  3R8Z A;  1OVE A;  3FQE A;  3VVH A;  4CKI A;  4DFN A;  2XBA A;  3RGF A;  3NUS A;  4ANQ A;  4FX3 A;  2WTK C;  3QKM A;  2IZS A;  4MBL A;  4QRC A;  3RPR A;  2OXY A;  4MXC A;  5HX6 A;  4IMY A;  4AA0 A;  4XBU A;  5H3Q A;  4UN0 C;  2WMT A;  4O4C A;  3MH2 A;  4QTD A;  5LJJ A;  3UNZ A;  2E9U A;  1P14 A;  2UW6 A;  4JRV A;  4K33 A;  4GUB A;  2GS2 A;  3ETA A;  4FT0 A;  2YHV A;  3P1A A;  4QNA A;  4FIJ A;  5D9H A;  2BTS A;  2X2M A;  1RE8 A;  1H0V A;  2VZ6 A;  3TCP A;  4JRN A;  4FRF A;  1PF8 A;  2R3I A;  5JSM A;  3TT0 A;  3CGF A;  4DHF A;  4W4W A;  3MFS A;  5FDP A;  3OP5 A;  2QOH A;  4FKO A;  3THB A;  4RVL A;  3PYY A;  1ZZL A;  3FMJ A;  1VYZ A;  4FMQ A;  3MY5 A;  3PXQ A;  5FM3 A;  5I9U A;  1BMK A;  3BZ3 A;  5HOR A;  2O8Y A;  2J90 A;  3H0Y A;  2Z8C A;  3Q3B A;  3NCZ A;  5J79 A;  3TIZ A;  3FXW A;  4YJS A;  5BYY A;  3VQU A;  3V04 A;  4EHE A;  4GYI A;  4OUC A;  1ZYC A;  3MPA A;  3FE3 A;  2QOC A;  4FSN A;  1H1Q A;  4FKG A;  4YJO A;  3WF6 A;  4AT5 A;  5KKR B;  4KIP A;  2B7A A;  2OK1 A;  5CZH A;  4L7F A;  3W16 A;  3QRI A;  2WQB A;  3NWW A;  4WO5 A;  2RFS A;  3E64 A;  4BGQ A;  5AUU A;  1V0O A;  3E8N A;  5F94 A;  4TN6 A;  5HI2 A;  4EOQ A;  3RVG A;  2J7T A;  3D9V A;  5CNN A;  4CQE A;  1XHA A;  4OTD A;  3EYH A;  3BHT A;  4J95 A;  4ZSJ A;  3KF4 A;  5F4N A;  4FTQ A;  3MWU A;  1WFC A;  4AW0 A;  3POO A;  5I9Z A;  3F7W A;  5AMN A;  3DAJ A;  4PRJ A;  4FV4 A;  3SV0 A;  3CJG A;  1CSN A;  2XNO A;  4LUD A;  1JOW B;  4RBL A;  4XEY A;  2CMW A;  4CYJ A;  3PXK A;  5FP6 A;  4O6E A;  5AUW A;  2ITO A;  3DJ5 A;  4DFL A;  3MA6 A;  4WD5 A;  4USE A;  4EOP A;  2XS0 A;  5C26 A;  3K3J A;  2ITV A;  4QMO A;  4ZJJ A;  4FKR A;  4I5C A;  2VGO A;  2VWZ A;  5AP2 A;  2UZN A;  4EK6 A;  5AP3 A;  4PDO A;  2GNJ A;  4LRK A;  4USF A;  3P7A A;  2ZB0 A;  4WA9 A;  4MXA A;  4IZ5 A;  2YIY A;  4L52 A;  3C4C A;  4RIY B;  4MH7 A;  2I1M A;  3AC3 A;  5F95 A;  3QRJ A;  3EQG A;  3PXR A;  4N4S A;  3WIK A;  1KE5 A;  5F20 A;  3BYU A;  2NPQ A;  3JUH A;  2OI4 X;  2YM8 A;  4NW6 A;  5KX8 A;  5BQ0 A;  2CCI A;  3HKO A;  4IX5 A;  1M17 A;  2WQO A;  4USD A;  4TYH B;  4F08 A;  4GRB A;  3IGG A;  3P7C A;  3ACK A;  4IC7 A;  4NCT A;  5FP5 A;  2IW9 A;  5HBJ A;  4AG8 A;  2BZJ A;  1M2P A;  3FMN A;  3QQH A;  4YJR A;  2WB8 A;  3PJ8 A;  4NK9 A;  2R3K A;  2R9S A;  3CS9 A;  4EHG A;  4G3D A;  4CRS A;  4F9B A;  2P33 A;  3WIG A;  4MBI A;  4QMV A;  4C3F A;  1ZYS A;  3FUP A;  2VTJ A;  4JIA A;  2PZY A;  4EWQ A;  4P4C A;  2JFL A;  4ITI A;  3BBT B;  3O71 A;  2ERZ E;  3RAW A;  4Q9Z A;  4D2V A;  4QYE A;  4EQU A;  4S33 A;  4F70 A;  4RX7 A;  3OEZ A;  4RVM A;  3DZO A;  3VBT A;  5GZ9 A;  4QMN A;  1XH9 A;  1IEP A;  1GZO A;  3D2K A;  3D7Z A;  3FZS A;  4TKS A;  5DR9 A;  4ZAU A;  3BV3 A;  3CKX A;  4JDJ A;  2EB3 A;  3LM5 A;  3QRK A;  2XM9 A;  4HZR A;  4IVB A;  4DEB A;  3FLS A;  4EK3 A;  5JRS A;  3RAL A;  3OEF X;  4X6Q C;  5IA0 A;  3QTX A;  4QPS A;  4U5J A;  3ROY A;  4Y83 A;  5IEX A;  3MSS A;  2B1P A;  5I9Y A;  2JDT A;  4BL1 A;  3MIY A;  1JLU E;  3ORL A;  2JBO A;  4I20 A;  4YZD A;  4I93 A;  2XIK A;  5HIB A;  4CMT A;  5I0B A;  3OWP A;  3JVS A;  3R02 A;  4CFN A;  4ZLZ A;  2XB7 A;  3LCD A;  4NKA A;  4TWP A;  5GZ8 A;  5E92 A;  3FY2 A;  1F0Q A;  3FZT A;  4IJ9 A;  2W5A A;  4ALU A;  2A4L A;  4ALW A;  3F88 A;  3VW8 A;  4FK6 A;  3NCG A;  3DKG A;  4KBK A;  4RGJ A;  4UY9 A;  3ITZ A;  5DFP A;  5BVE A;  2PVK A;  3OWK A;  3R2Y A;  3LE6 A;  2CKE A;  1V0B A;  1YDS E;  4YBJ A;  2YDI A;  1TZD A;  3NYO A;  5CEP A;  3UPX A;  3WF7 A;  3IEC A;  3NUP A;  2VO7 A;  3E87 A;  4C36 A;  5LCK A;  2NRU A;  2F7Z E;  2QHM A;  3E7O A;  5LVP A;  1ZRZ A;  4Z16 A;  2RF9 A;  4NM5 A;  2B53 A;  4RJ3 A;  4V05 A;  5H8B A;  3VHK A;  2X81 A;  1ZMV A;  1IAS A;  5DBX A;  4RX8 A;  4F09 A;  4BTJ A;  4YMJ A;  2VTQ A;  4DH3 A;  3FV8 A;  4WNO A;  2J9M A;  1B38 A;  3I81 A;  4A9R A;  3U4W A;  4RFM A;  2YIT A;  4RIY A;  3FI2 A;  5J7H A;  3FYJ X;  3RK9 A;  4L68 A;  3LJ1 A;  2UW7 A;  1LEW A;  2P55 A;  4JBO A;  3BE2 A;  4QPM A;  4N6Y A;  2BRN A;  3MJ1 A;  2B4S B;  2HW7 A;  4PMT A;  5CEQ A;  3R1Y A;  2QC6 A;  3H9O A;  3SXS A;  3UP2 A;  4C4F A;  5C01 A;  1LP4 A;  1ZOH A;  4F7N A;  3I7B A;  4AFE A;  1WBW A;  2WTV A;  3HV6 A;  5AA9 A;  1YRP A;  2ERK A;  3LCO A;  4IWD A;  5CI6 A;  3AG9 A;  3QX2 A;  4BFM A;  3QD0 A;  4MF0 A;  2ITT A;  3BKB A;  5HO6 A;  2R3Q A;  4RVK A;  3U9C A;  3OVV A;  3G51 A;  1OUY A;  1PXN A;  2I6L A;  4NJ3 A;  2IJM A;  4QMQ A;  2R3H A;  4XG2 A;  3DK7 A;  3PP1 A;  2X1N A;  3LM0 A;  5FXQ A;  4J8M A;  3QGW A;  4O0R A;  2QU5 A;  3JY0 A;  3AT4 A;  4IBM A;  3EKN A;  2PE2 A;  2BRO A;  3A7H A;  2QR8 A;  2ITN A;  3ORK A;  4NU1 A;  5HU3 A;  3MVL A;  4HVH A;  3MFR A;  5KMO A;  1V1K A;  5CVH A;  3Q9Y A;  2Y8O A;  2YIS A;  1M14 A;  4PMS A;  5CAP A;  5BMS A;  3RHK A;  1WVY A;  4AXA A;  4G3F A;  2XIR A;  3BV2 A;  2OF4 A;  4QPA A;  5LMK A;  5AAG A;  4GVJ A;  1GII A;  2OFU A;  3KMU A;  4QMZ A;  5E91 A;  3SVV A;  4QTA A;  5EI8 A;  2QO9 A;  4M67 A;  4NEU A;  3R83 A;  3TZ8 A;  5B0X A;  4H39 A;  4DIN A;  3DDP A;  4A4O A;  2PZP A;  3KXZ A;  5D1J A;  2A98 A;  1PYE A;  1QCF A;  2P2H A;  1Q3W A;  1Y91 A;  3D0E A;  2HYY A;  4ZTQ A;  3ZRM A;  4X2G A;  5JRQ A;  1Z57 A;  3SC1 A;  4G3E A;  5LVO A;  4ZZN A;  3LFC A;  4EEV A;  2CCH A;  4JAJ A;  3VNT A;  1H8F A;  3S2P A;  4F9W A;  1JPA A;  5HZN A;  3E3B X;  2WMW A;  4ZSL A;  2A1A B;  4I0R A;  4WBO A;  4U97 A;  3ZRK A;  3OCG A;  4YZN A;  4GCJ A;  1XR1 A;  5EG3 A;  3ZXT A;  4FEQ A;  3L9L A;  5DGZ A;  4IAD A;  2O63 A;  4RWL A;  3ZC5 A;  4EQC A;  3D15 A;  2QKR A;  3RWP A;  4DAW A;  2IZR A;  4ZTS A;  3VS3 A;  4A4X A;  1OGU A;  4R5Y A;  3QTQ A;  5IMX A;  3R7O A;  2BR1 A;  4FV7 A;  4EH6 A;  1GAG A;  3GBZ A;  3ZXZ A;  4F1O A;  4C33 A;  3UPZ A;  2KTY A;  4RRV A;  3CCN A;  3KUL B;  3QZI A;  4XS2 A;  5EM5 A;  5CSH A;  4LRM A;  5M44 A;  3UTO A;  1RDQ E;  4ZY5 A;  3PVG A;  3PA5 A;  4IAK A;  4X3F C;  4XJ0 A;  3BHU A;  3CTH A;  2WFY A;  4FV3 A;  2W7X A;  4GK3 A;  2PVR A;  3Q04 A;  4UYN A;  3R04 A;  3O50 A;  3PG3 A;  2VU3 A;  3KA0 A;  3QTS A;  3RPY A;  3A8X A;  2XKD A;  4FIC A;  4TZR A;  3UC3 A;  4YZ9 A;  3KCK A;  4RQV A;  3QAL E;  2JD5 A;  4LM5 A;  4BZN A;  2OZA B;  3DNE A;  1AD5 A;  5CAL A;  5AX3 A;  1YHV A;  1FVT A;  3IGO A;  4G17 A;  4PPA A;  4YJV A;  3EYG A;  3KEX A;  3MW1 A;  5EH0 A;  3P23 A;  4CT2 A;  2FST X;  4YC3 A;  3GFE A;  2XNM A;  3OBJ A;  3RAI A;  3VUL A;  5CU4 A;  5AWM A;  5IEV A;  4QYG A;  4U40 A;  4XV1 A;  3OUN B;  2HZI A;  2W96 B;  3EZV A;  2YDJ A;  4U43 A;  2Y6M A;  3F2A A;  3A2C A;  4RJ8 A;  2ZVA A;  3A4O X;  2B55 A;  1WBS A;  4LV8 A;  3TTJ A;  3BU5 A;  4CTC A;  4W4X A;  2C6D A;  2J50 A;  2WTI A;  3G2F A;  3LCT A;  3FHR A;  1OL7 A;  4FIE A;  5CT7 A;  3RJC A;  1Z5M A;  3NW5 A;  1UU7 A;  4ASZ A;  4TYJ A;  5IUG A;  3FLY A;  2R3L A;  4LMN A;  3TXO A;  5FTQ A;  4FKW A;  1OPL A;  2W06 A;  2OJI A;  1WBN A;  3LHJ A;  4ERW A;  3T3V A;  3I4B A;  4RG0 A;  3VUM A;  3W10 A;  3UJG A;  4I4F A;  1W7H A;  5BX0 A;  4KKG A;  3UYT A;  1SM2 A;  4FTN A;  5L2I A;  3RPO A;  2E9P A;  1Z9X A;  3WZD A;  2B9F A;  5BMM A;  4TTH B;  2RFN A;  3UC4 A;  2GTM A;  3IQ7 A;  3ZBX A;  4JQ7 A;  2YIQ A;  4OTF A;  3VW6 A;  3CE3 A;  4Y5H A;  3GQI A;  3PJ3 A;  4F9Y A;  2B52 A;  2A2A A;  3D5V A;  3A7J A;  4O1P A;  5A9U A;  4QP6 A;  3RMF A;  4IIR A;  3FI3 A;  1APM E;  4D4V A;  3SXF A;  1UA2 A;  5FDX A;  3TNW A;  3VS0 A;  3P9J A;  3LXK A;  5EW9 A;  2HXL A;  3HA8 A;  1J91 A;  5D11 A;  5AAF A;  4I3Z A;  2JIT A;  2E9O A;  2YEX A;  3I5N A;  4JQE A;  1OM1 A;  4G5P A;  1K2P A;  4DGO A;  3JYA A;  1DI9 A;  4LGG A;  3PA3 A;  4XP3 A;  4C38 A;  5IG1 A;  4DEI A;  2WXV A;  5HIC A;  1H1R A;  2PVM A;  3CKW A;  4H3Q A;  3RPS A;  1OB3 A;  1MRY A;  4R1V A;  3MN3 A;  3NUU A;  5AUZ A;  3U6H A;  4QYF A;  4O4B B;  4BCO A;  2PUU A;  4U6R A;  5JFV A;  3KY2 A;  4NFN A;  4QT1 A;  2VTT A;  5HGI A;  3KMM A;  4B6L A;  5C1Q B;  4GII A;  4ZTN A;  1BUH A;  4B7T A;  3OT3 A;  4E6C A;  4E5A X;  1X8B A;  3DDQ A;  3SOC A;  3ZM4 A;  4E1Z A;  3IOP A;  4IJP A;  4KBA A;  3KUL A;  5EHL A;  3AXW A;  3SD0 A;  4II5 A;  4JDH A;  4JOA A;  4TY1 A;  4K77 A;  4QYY A;  5FED A;  1V0P A;  5CVF A;  5LOH A;  2CN8 A;  5KZ0 A;  4IVA A;  3WZK A;  5L8J A;  1H1S A;  3I6U A;  3LJ2 A;  2EUF B;  5J7B A;  2W1C A;  3O8U A;  4F63 A;  2OG8 A;  4FOC A;  1LEZ A;  2WOT A;  5DI1 A;  3DT1 A;  4XYF A;  4FUX A;  4BDB A;  3VS6 A;  4XV3 A;  3GUB A;  4FST A;  3QCX A;  1Q61 A;  3DY7 A;  3R8U A;  1OEC A;  2FSM X;  3PZE A;  4D1X A;  4QMP A;  2CN5 A;  5LVM A;  1XH5 A;  2JBP A;  4OTG A;  5D10 A;  3VBV A;  1FPU A;  3FLN C;  5CTP A;  4F99 A;  4K8A A;  2OZA A;  3UNK A;  2J0L A;  5BVN A;  2ZYB A;  5M57 A;  2C3I B;  4R7I A;  4U9A A;  4I41 A;  5AP1 A;  4G6N A;  5HG7 A;  4WNP A;  5A6N A;  4IAC A;  4IWQ A;  5EYC A;  4HYI A;  2WPA A;  4F4P A;  1SNU A;  3AC1 A;  4G1W A;  3RAK A;  1CKP A;  4YO6 A;  2QON A;  3C0I A;  4BID A;  5D7A A;  5JK3 A;  3DK6 A;  3LXP A;  3NUY A;  4KIQ A;  5KHX A;  4AX8 A;  3CXW A;  4FII A;  1K3A A;  2HY8 1;  4HPT E;  5HNB A;  3GGF A;  4CCU A;  4PTG A;  4PTC A;  3D14 A;  4CLI A;  2ZM3 A;  5A4C A;  4GFM A;  1J3H A;  3Q9Z A;  5L6P A;  2GHG A;  2XEZ A;  3KQ7 A;  5GJG A;  3UG2 A;  5L3A A;  3NRM A;  1LUF A;  1B6C B;  4HYH A;  4IWP A;  5TT7 A;  3EFJ A;  2GMX A;  3O2M A;  2EWA A;  2XBJ A;  2JKM A;  3BQR A;  3UIX A;  4IZY A;  4J53 A;  4UXL A;  4YGA A;  5AP5 A;  4ZTL A;  4YP8 A;  3OMV A;  5DHJ A;  3GOP A;  3V01 A;  1Q62 A;  1XH6 A;  4F7L A;  2O0U A;  3IDP A;  3FC1 X;  2F9G A;  3LFQ A;  4HGL A;  3G9L X;  3OWJ A;  1TQI A;  3DQX A;  3KK9 A;  2ITQ A;  3DBF A;  3PJ1 A;  4MNE B;  4UMR A;  4KRD A;  3ZFX A;  2PK9 A;  5CF6 A;  2BRM A;  3F9N A;  1Q99 A;  3IW5 A;  3KRW A;  2BKZ A;  4G6L A;  5J5S A;  1PW2 A;  2J5E A;  1GZN A;  4PY1 A;  5T6K A;  4FTK A;  4DC2 A;  4WIH A;  3BLR A;  4L67 A;  2GCD A;  1OMW A;  3AD6 A;  4FG7 A;  4NIF B;  3C1X A;  1UWH A;  1Y8G A;  3FML A;  5EM8 A;  3BRB A;  5FM2 A;  2JIU A;  4I22 A;  4FKJ A;  2WU7 A;  3E62 A;  3FXX A;  3CEK A;  3GFW A;  4CFV A;  1VYW A;  3AD4 A;  4U3Y A;  4TT7 A;  4QMW A;  5HG9 A;  2C3L A;  5EHY A;  4BCP A;  2EXC X;  3BWF A;  2XVD A;  2JGZ A;  4QTE A;  3QKK A;  2R3G A;  3Q32 A;  4C35 A;  2B9J A;  2ZV9 A;  4ACD A;  3DAK A;  3EQC A;  2WMQ A;  4BWK A;  3KXM A;  3A8W A;  3VS5 A;  5IA2 A;  5M4U A;  5D41 A;  3VF8 A;  4CZY B;  4YHF A;  4LRJ A;  4X2J A;  4AGW A;  2XP2 A;  4IM3 A;  2X7O A;  4FTC A;  5A14 A;  3ODZ X;  4I5H A;  3RPV A;  4ALV A;  4EOJ A;  3VRZ A;  3G33 A;  3ROC A;  2WMU A;  2ITZ A;  5IUI A;  1Q8T A;  3CP9 A;  3FKN A;  2R4B A;  2V62 A;  2UZV A;  3DQW A;  2LAV A;  3LW0 A;  2R2P A;  3FL5 A;  5CT0 A;  5K4J A;  1H1P A;  3NR9 A;  4FKI A;  3SAY A;  5CLP A;  4XG8 A;  5CU0 A;  4YU2 A;  4XG3 A;  4K18 A;  3TUD A;  4BCM A;  5I9X A;  4ZSG A;  2XA4 A;  3QD2 B;  4ZTR A;  2FGI A;  4R6V A;  3C7Q A;  3NYN A;  2VNY A;  3O51 A;  5L8L A;  4GVA A;  4CVA A;  2QOL A;  1XWS A;  4FKV A;  4K11 A;  1GIJ A;  4PF4 A;  4K6Z A;  5HU9 A;  5EI6 A;  1L3R E;  5HKM A;  1IA8 A;  3RAH A;  1YHS A;  2NO3 A;  4LL5 A;  2YER A;  4YUR A;  4ANN A;  1PME A;  4UEU A;  4WKQ A;  4I6H A;  5DWR A;  4ZK5 A;  3BEA A;  3PY0 A;  2P4I A;  4FZ7 A;  3W2O A;  5DIA A;  5JKG A;  4DFX E;  4KSP A;  5HD4 A;  2C47 A;  3DLZ A;  4WOV A;  3LLT A;  3UOL A;  5K5N A;  5CQW A;  4IVC A;  5AJQ A;  2O3P A;  4QMS A;  2HAK A;  2ONL C;  4OGR A;  2AQX A;  3OW3 A;  3R63 A;  4OTW A;  2AUH A;  2HWO A;  3G9N A;  1R0P A;  2GNI A;  1MRV A;  4LI5 A;  3OOG A;  3TWJ A;  2C3J A;  2H6D A;  3E93 A;  4R7H A;  4YTH A;  1Y6A A;  5AX9 A;  3WF9 A;  5ICP A;  3L9P A;  3DU8 A;  2XJ0 A;  4FI1 A;  5EW3 A;  3EN6 A;  1ZAR A;  3FZ1 A;  2YCF A;  4O21 A;  3SOA A;  4C4E A;  4FV1 A;  4JR7 A;  1WBO A;  5ETI A;  1OUK A;  2CLQ A;  2PZ5 A;  3LJ0 A;  4QP1 A;  2QU6 A;  3LFD A;  4A06 A;  1OZ1 A;  3COK A;  2ZOQ A;  5CSW A;  4B99 A;  4NTS A;  1M7Q A;  2EB2 A;  1S9I A;  3ZEP A;  3HV4 A;  3NUN A;  5FBO A;  5DRD A;  5BNJ A;  3VS7 A;  4MNE A;  2OIQ A;  3R6X A;  2BRB A;  2UZU E;  1Q5K A;  4CD0 A;  3AT2 A;  4KNB A;  3WYX A;  1SVG A;  4J96 A;  4X3J A;  5KMN A;  2RIO A;  2WMA A;  4U41 A;  4X2N A;  1O6L A;  5HID A;  3LFB A;  4X21 A;  3FZO A;  4FT7 A;  4NIF A;  5JQ5 A;  3QA0 A;  2HK5 A;  3VS2 A;  2ITY A;  5AIK A;  3R1N A;  2HZ0 A;  4I1Z A;  4QP4 A;  1CM8 A;  3Q9X A;  5FWK K;  4XCU A;  3GU6 A;  2QR7 A;  3UYS A;  4WUN A;  3F3V A;  4NCT C;  1YOJ A;  4O0W A;  3ZLY A;  2HEL A;  2WEI A;  4GIH A;  3HUC A;  3PIX A;  4GJ2 A;  2WTK B;  2WOU A;  3Q53 A;  2VWW A;  2VAG A;  2JLD A;  1R3C A;  4XG6 A;  5HVY A;  3VUK A;  4D4Y A;  4YTC A;  3R30 A;  4E7W A;  4CRL A;  2BRH A;  2OU7 A;  3PTG A;  5HX8 A;  3TV6 A;  3W18 A;  1O6Y A;  2FSL X;  3ANR A;  3TZ7 A;  4YZC A;  4PQN A;  1PXK A;  3ZUU A;  2XEY A;  2F57 A;  4M84 A;  2QOQ A;  4FNX A;  4NW5 A;  3H9F A;  4JI9 A;  3ZZE A;  2GU8 A;  4CNH A;  3CPB A;  1FQ1 B;  4FC0 A;  4UX9 A;  2WMR A;  2ZDT A;  4OTI A;  3OCB A;  3TIY A;  4DIT A;  1PJK A;  2O64 A;  4HVD A;  4CFM A;  3BEL A;  1XJD A;  2X2L A;  3VUD A;  4XMO A;  5CEK A;  4EH8 A;  3PG1 A;  4DH5 A;  5AR5 A;  3RIN A;  5JGA A;  1Y8Y A;  2GDO A;  4J8N A;  1UVR A;  2C6T A;  4PWN A;  3U87 A;  2XUU A;  3D5U A;  4QNY A;  2BVA A;  3NYX A;  3DFC B;  4G6O A;  4K2R A;  4R3P A;  2OH4 A;  4KKH A;  3OTV A;  3BWJ A;  3B2T A;  2BHH A;  2VNW A;  4M12 A;  1SNX A;  3V8S A;  3E5A A;  3ZSG A;  2Z7R A;  4LYN A;  3RZB A;  3FKL A;  2DUV A;  4U81 A;  4E4M A;  2G15 A;  4ZEG A;  4F0I A;  3EWH A;  3BHH A;  3KXX A;  4M69 B;  2QOO A;  5EW8 A;  3RHX A;  3IOK A;  2R7B A;  4X7Q A;  2J2I B;  4FSY A;  4APP A;  2GSF A;  5KKR C;  2XIX A;  4FT5 A;  4XUF A;  5BYZ A;  3UE4 A;  5KBR A;  4BF2 A;  2BDF A;  4J7B A;  4OR5 A;  3LMG A;  3EKK A;  4MF1 A;  5JEB A;  4RZV A;  4ITH A;  4D1Z A;  4E6D A;  4FT3 A;  4PDP A;  1WAK A;  3CQU A;  4MCV A;  3CR0 A;  4GV1 A;  3O96 A;  4XG4 A;  4ANM A;  3V5W A;  5HEZ A;  2EXM A;  3MH1 A;  3O8T A;  3KXN A;  4PL4 A;  3MGY A;  1BI7 A;  3ZOS A;  2IZT A;  3HDM A;  3W33 A;  4KSQ A;  4FTO A;  3HP2 A;  5HD7 A;  4WNM A;  2X2K A;  2BPM A;  4F1M A;  4ACH A;  4YHJ A;  1GJO A;  4A9Y A;  3WF8 A;  2ITU A;  3BCE A;  4FA2 A;  3OCS A;  4V0G B;  4E5W A;  3VRY A;  2UVY A;  3K3I A;  3FLW A;  1W2D A;  5IA5 A;  2JAM A;  3TN8 A;  2BIL B;  2I0E A;  3ANQ A;  4ZTH A;  5FTO A;  3U8W A;  4KAO A;  3LXL A;  4MX9 A;  3F61 A;  4YPS A;  3FXZ A;  3AC5 A;  2V5Q A;  2AYP A;  3KN5 A;  3NW6 A;  5T68 A;  3W2P A;  1PYX A;  5ITA A;  5H9B A;  3PPZ A;  2VX3 A;  4LFI A;  3GEQ A;  2QOK A;  2ZJW A;  3DKF A;  4GT3 A;  5AV3 A;  4D1S A;  3ERK A;  3FY0 A;  4IE9 A;  4KA3 A;  4XV9 A;  1UNH A;  3VF9 A;  4DGM A;  4F9C A;  5A4E A;  5LWN A;  2VWY A;  1IR3 A;  5DVR A;  2QHN A;  2DYL A;  3PE2 A;  4KBC A;  4BHZ A;  1HCL A;  2J51 A;  3PXY A;  2QD9 A;  1UU9 A;  1ZYJ A;  2C0T A;  2OGV A;  3QZF A;  3C0G A;  3GXL A;  3CY3 A;  2X8D A;  4F6S A;  1RW8 A;  2ZM4 A;  1VR2 A;  3HUB A;  4BI0 A;  1NVR A;  3F82 A;  4DED A;  2Y4I B;  3K2L A;  4IAY A;  4RQK A;  3PWY A;  3ZMM A;  4KIN A;  3CIK A;  3EQB A;  4U80 A;  3EMG A;  4FZA B;  3SQQ A;  3GC8 A;  4AA5 A;  2QOI A;  4RWI A;  5CAU A;  4PNI A;  2PTK A;  5KBQ A;  4BDJ A;  4IFG A;  2XKF A;  5HQ0 A;  4E6A A;  5M51 A;  3O8P A;  5HES A;  2FUM A;  5IUH A;  3UQC A;  2UUE A;  3TNP C;  3MDY A;  3I0Q A;  3I6W A;  3EQF A;  3UOK A;  3ZDI A;  4ZZM A;  4GEO A;  3ZH8 A;  1U5R A;  4GS6 A;  4ANB A;  4AWI A;  1OIQ A;  4ZTM A;  3OS3 A;  2JC6 A;  3JS2 A;  4O4D A;  2HOG A;  3VID A;  4BWP A;  5LMK C;  1FVR A;  2YIW A;  1KE7 A;  1K9A A;  2BIY A;  3IW4 A;  5DT3 A;  4BIB A;  3ACJ A;  3AT3 A;  4BCK A;  2GNL A;  3K5U A;  2XNP A;  4D9U A;  4F65 A;  1OKV A;  2VGP A;  2X0P A;  1PY5 A;  5J87 A;  4H1J A;  4S2Z A;  4K1B A;  4AT3 A;  4MBJ A;  2PWL A;  3UGC A;  5JGD A;  1Q4L A;  2QLU A;  3COH A;  1U5Q A;  2ITW A;  4ZOG A;  3TKU A;  2VV9 A;  3QD3 A;  5HLP A;  2BZK B;  3FAA A;  2H96 A;  1YDR E;  4M69 A;  4ONA A;  4MQ2 A;  4EOS A;  4RC2 A;  3MFT A;  1FGK A;  3BLQ A;  4LGD A;  2F2U A;  5AM7 A;  1JKT A;  2B54 A;  4KS7 A;  3T3U A;  4BDI A;  4BGG A;  4XV2 A;  3KB7 A;  4FSU A;  5EYD A;  4U8Z A;  4MXX A;  5J5T A;  2XK9 A;  3OXZ A;  3NNX A;  1CKI A;  3NYV A;  4GUE A;  4ID7 A;  3KF7 A;  4IQ6 A;  4R8Q A;  4UV0 A;  5LAR A;  3TJC A;  4AGC A;  1OPJ A;  4YUQ A;  1PXM A;  4MHA A;  4O0U A;  4RSS A;  2GNF A;  5JMS A;  3ZS5 A;  2QO2 A;  4A9U A;  4C2V A;  5D7V A;  4L01 A;  4CYI A;  4DEG A;  3EFL A;  4JBQ A;  4FTI A;  2XRU A;  5EK7 A;  1JSV A;  1TKI A;  4ZIM A;  4TXC A;  4O6L A;  4OTP A;  4XOY A;  3FME A;  4BCG A;  4BDE A;  2VO0 A;  4F0G A;  3OXI A;  2VTO A;  3AC2 A;  2GNG A;  3KXG A;  4U79 A;  4BN1 A;  5IDP A;  5EOL A;  4IZA A;  1OKW A;  4A4L A;  3UOJ A;  2C0O A;  4FZD B;  4O0V A;  5AUX A;  4V0G A;  4TYH A;  3AD5 A;  3C4Z A;  2RKU A;  4S30 A;  4UBA A;  4MNF A;  1QPC A;  3QUD A;  4HCV A;  3BX5 A;  2C5V A;  3OHT A;  4QMX A;  4WSQ A;  3V51 A;  4AZT A;  4C62 A;  4RJ7 A;  3PY1 A;  2YIR A;  4PL5 A;  2W5H A;  2IN6 A;  4MD8 E;  2YN8 A;  2BTR A;  3PJC A;  1I44 A;  4FTA A;  5ANO A;  2C1B A;  3MTF A;  2BAK A;  3W32 A;  5FG8 A;  1RQQ A;  3GU7 A;  3A7I A;  3QQJ A;  4G16 A;  2WMX A;  4RWJ A;  4FSR A;  3FMH A;  4D58 A;  4QMT A;  1U54 B;  3T9T A;  1P5E A;  4G9C A;  3QZH A;  3F6X A;  4ZXT A;  4GU6 A;  4I21 A;  3U51 A;  3ALN A;  4LOP A;  5AR2 A;  4AE6 A;  4DGL C;  3EB0 A;  1KE9 A;  4L9I A;  3PVW A;  2C6M A;  4I6B A;  4KRC A;  5AND A;  3T8O A;  2XJ2 A;  4IX3 A;  5AA8 A;  5IME A;  2PE0 A;  1YWV A;  4LUE A;  3F5U A;  3GC7 A;  5AV1 A;  5HVJ A;  3OFM A;  1O6K A;  4ACC A;  5J95 A;  3NLB A;  4IH8 A;  3FPM A;  2SRC A;  1IG1 A;  1MUO A;  3OT8 A;  4Y95 A;  3K54 A;  5AR7 A;  5G1X A;  3C4E A;  5CSX A;  1PXI A;  3LIJ A;  2WO6 A;  4AOJ A;  2PL0 A;  1YHW A;  5H2U A;  2LGC A;  3V5L A;  4YTI A;  3EOC A;  4IEB A;  5JT2 A;  1F5Q A;  4BKY A;  5K4I A;  4XRJ A;  2WIH A;  3OF0 A;  4LGH A;  4M13 A;  3ORZ A;  3EL8 A;  5BVW A;  3W2Q A;  4AN9 A;  5ANG A;  4L42 A;  4Q9S A;  4BBE A;  3RNI A;  5A4T A;  3BBW A;  5LWM A;  4CCB A;  3UNJ A;  4IHP A;  4CXA A;  3RM6 A;  4P90 A;  2GFS A;  5BVK A;  1QPE A;  3ZLW A;  2B9I A;  5C9C A;  3G90 X;  3IW7 A;  4YNO A;  3UO5 A;  5LMB A;  3H0Z A;  1Q3D A;  3BYO A;  4AW5 A;  2CLX A;  3RNY A;  2AC5 A;  1B39 A;  3KL8 A;  2XRW A;  4NM7 A;  1WCC A;  5A4L A;  3Q4T A;  2PML X;  3UG1 A;  2H8H A;  1JKK A;  3R28 A;  4YJN A;  3S1H A;  3D94 A;  3TJD A;  5L6W L;  3MIA A;  4C4H A;  4XBR A;  3IW8 A;  4BBF A;  5CF4 A;  1FMK A;  4L43 A;  1Q41 A;  4S31 A;  1JSU A;  5CAS A;  5F9E A;  3BE9 A;  1H1W A;  3DV3 A;  4QP3 A;  4HOK A;  1TQP A;  2UW3 A;  2V7O A;  4BBM A;  5LVN A;  1PXL A;  1YI6 A;  1GY3 A;  3W55 A;  2IW6 A;  3DBC A;  1XKK A;  3QRU A;  4G5J A;  4Y72 A;  1OL2 A;  5FGK A;  4G34 A;  4Z55 A;  1F3M C;  4ASE A;  5ACK A;  4ZP5 A;  4AT4 A;  3O23 A;  3KRR A;  3TZM A;  4EZ5 A;  2JKK A;  3R22 A;  4C61 A;  2UZW E;  2WD1 A;  3HL7 A;  3Q9W A;  1YI4 A;  4X3F B;  3JY9 A;  3V6S A;  4BRX A;  2ETR A;  1BX6 A;  4EYJ A;  4Y5Q A;  4Z3V A;  5M56 A;  3P86 A;  5A4Q A;  5E1S A;  2VD5 A;  1DAY A;  3F3U A;  4FKQ A;  3QCS A;  2PZI A;  5ANI A;  5E8Z A;  3U6I A;  3UZT A;  1NXK A;  4EQM A;  5EDQ A;  4JX3 A;  4Y8D A;  2F7X E;  3R7E A;  5CF5 A;  3MTL A;  3ORP A;  3W2R A;  4IX6 A;  1WMK A;  3D2I A;  3ZON A;  3R73 A;  4BB4 A;  1OL5 A;  3C50 A;  3NX8 A;  3OG7 A;  2P2I A;  3TNH A;  1YXS A;  2WU6 A;  1UNL A;  2VTN A;  2XKC A;  4WSY A;  5JN2 A;  2OJJ A;  2UVZ A;  4AN3 A;  4ZS0 A;  2W4K A;  2A19 B;  1U54 A;  1W0X C;  3DTW A;  4JG7 A;  4AZF A;  5KE0 A;  2HEN A;  4V01 A;  3W2S A;  3LVP A;  3W8L A;  2E9V A;  4KD1 A;  1W2C A;  2PVH A;  3IS5 A;  2YJR A;  3OZ6 A;  4P7E A;  4M0Z A;  2WMB A;  1OPK A;  3ZO2 A;  3C13 A;  2HW6 A;  5CXH A;  4N0S A;  5K0K A;  2JKQ A;  2QI8 A;  2UZL A;  2XIY A;  4IM2 A;  4L3J A;  5GZA A;  4F1T A;  5M4C A;  2JKO A;  1QMZ A;  4DH1 A;  5GHV A;  2BUJ A;  4ANS A;  2UZD A;  2EU9 A;  4BKJ A;  4FL3 A;  2XCH A;  2PMN X;  4QOX A;  4UAL A;  4I6F A;  4L3P A;  5KMI A;  4OBO A;  1LR4 A;  2ESM A;  4YJP A;  4BDK A;  3LQ5 A;  1OIY A;  3MPM A;  2WKM A;  4QP2 A;  3VN9 A;  5CAQ A;  4FUY A;  2GTN A;  2VX1 A;  2E9N A;  2W5B A;  4FKL A;  4BCF A;  4CFW A;  2WMS A;  2G9X A;  1ZAO A;  2X4Z A;  2YAK A;  2ZB1 A;  3E92 A;  3K5V A;  4EI4 A;  2P3G X;  3C9W A;  1URC A;  3GEN A;  4DG2 E;  4FTR A;  4J52 A;  5EKN A;  3IKA A;  3OCT A;  2Y4P A;  5IA4 A;  2C6I A;  3LFA A;  3Q96 A;  3TI1 A;  3B8R A;  3JXW A;  4YJT A;  3HMN A;  3TL8 A;  2I40 A;  1T45 A;  2IVV A;  3KGA A;  3TNI A;  1SVE A;  4Y46 A;  4ZLO A;  3DBD A;  2CDZ A;  3OOM A;  4PP7 A;  5CU6 A;  4D4S A;  5L2S A;  5IA3 A;  4FTM A;  5JFS A;  4OW8 A;  4LMU A;  5FEQ A;  4NJD A;  2OJF E;  1H01 A;  1YDT E;  2J0I A;  3HZT A;  3RTP A;  4AGU A;  2OIB A;  3QWJ A;  1GZ8 A;  1ZMU A;  1ATP E;  2UZB A;  3C4F A;  3QLF A;  1FMO E;  5IU2 A;  4U45 A;  4UMP A;  1ZOE A;  3R2B A;  3R8P A;  2X9E A;  1E1V A;  3EN9 A;  3EID A;  3L1S A;  4FR4 A;  3NIE A;  3MVJ A;  4FV5 A;  4LOO A;  5CVG A;  5CEI A;  4ERK A;  2VWV A;  4YZM A;  5I9V A;  3R1S A;  4HJO A;  2OH0 E;  3GQL A;  4RFZ A;  5GNK A;  2IO6 A;  4EOM A;  3TUB A;  4G3C A;  3VO3 A;  3TUC A;  5ETF A;  3V8W A;  4S34 A;  3MJ2 A;  1FIN A;  2WEL A;  2WEV A;  3LZB A;  4NKS A;  3MV5 A;  4EOR A;  4AP7 A;  4WHZ A;  4X3F A;  3R9H A;  2YFX A;  2CGW A;  4PP9 A;  4JDI A;  4OBQ A;  5CNO A;  4WRG A;  4E4L A;  1H08 A;  1P2A A;  4CFF A;  3Q6W A;  4CKJ A;  2JII A;  2VUW A;  2PMO X;  3UZP A;  3WF5 A;  4C4I A;  4E4N A;  5FQD C;  4EH4 A;  3DAE A;  4M14 A;  4I6Q A;  1IRK A;  5ANK A;  3BGP A;  4I0T A;  4IWO A;  1FGI A;  2UW9 A;  3OWL A;  1QPD A;  4B8M A;  4D5H A;  2XNN A;  4I24 A;  3SXR A;  3PLS A;  4HNI A;  4WG3 A;  1ZY4 A;  3E7V A;  4JG8 A;  1BLX A;  4M3Q A;  4EYM A;  2OFV A;  2FSO X;  3NSZ A;  4M66 A;  4BHN A;  5L2Q A;  5HLW A;  3CD3 A;  4PV0 A;  5LXM A;  5FBN C;  1ZWS A;  4PMP A;  3GCU A;  3R21 A;  5F1Z A;  3KRX A;  3G6H A;  4Z7H A;  5L8K A;  2X0G A;  3ORM A;  5CWZ A;  4I92 A;  3GCV A;  2QVS E;  3QYZ A;  1ZXE A;  3RCD A;  5AV2 A;  4BVU A;  3NAY A;  2XYU A;  3MFU A;  5J9L A;  3DZQ A;  3UO4 A;  1UV5 A;  2IF8 A;  4DH8 A;  3HV7 A;  3COI A;  5HE1 A;  1YXT A;  2VWB A;  4C2W A;  3QF9 A;  5CI7 A;  4C34 A;  5HNG A;  4HVG A;  4TRL A;  1QPJ A;  2VO6 A;  3PWD A;  2ZM1 A;  4CFX A;  4RLK A;  1PKG A;  2WZJ A;  3DK3 A;  3R7G A;  3GNI B;  4J1R A;  4YZB A;  3S3I A;  3TNQ B;  2FYS A;  3EQD A;  3CGO A;  4B4L A;  3HYH A;  3HMM A;  4YC8 A;  2OF2 A;  3VJO A;  3SX9 A;  4AW2 A;  3ZCL A;  3DB6 A;  3GCP A;  3Q4Z A;  4H1M A;  4IX4 A;  2OXD A;  2EVA A;  3Q5Z A;  5J8I A;  1VJY A;  4EHV A;  5A54 A;  4A9T A;  3MI9 A;  4KS8 A;  3W1F A;  4E73 A;  4RJ4 A;  2ZV2 A;  5LVL A;  4FL1 A;  3ZRL A;  4H3P A;  3OUK A;  4C0T A;  3QXP A;  2YJS A;  4YJU A;  4CQG A;  4TWO A;  3ZO1 A;  1GOL A;  3BYS A;  3ZDU A;  4LOQ A;  2PHK A;  2XJ1 A;  3BIZ A;  3HMP A;  4I4E A;  1Q8W A;  4EK5 A;  3F3Z A;  4GK2 A;  4JNW A;  5EOB A;  1E1X A;  2RG6 A;  4C4G A;  4FKU A;  3EHA A;  4HGT A;  2VTP A;  3EL7 A;  4BDD A;  3NEW A;  1WBP A;  3LAU A;  2C5Y A;  4JT3 A;  4MD9 E;  2JDO A;  2CSN A;  5HE0 A;  3VAP A;  4EL9 A;  4F6W A;  4C7T A;  4FSM A;  5DEY A;  1Y57 A;  4BKZ A;  2Y9Q A;  3L8V A;  4IB0 A;  4XLV A;  4KB8 A;  4R1Y A;  4OTQ A;  2W1F A;  2C0I A;  2G2I A;  1W2F A;  4O22 A;  2QUR A;  4FNY A;  2Y6O A;  4C37 A;  4E5B A;  2VTL A;  4GW8 A;  2YDK A;  2WAJ A;  3AMY A;  3RP9 A;  4U0I A;  2DWB A;  5K5X A;  2OW3 A;  2VRX A;  3HRC A;  1ZYL A;  5IZF A;  3Q5I A;  4CSV A;  3Q52 A;  4FGB A;  2ZMD A;  4M8T A;  3OD6 X;  3F69 A;  3ENM A;  2FO0 A;  2A0C X;  4FIH A;  5CSP A;  3RK7 A;  1YI3 A;  2YM7 A;  3TAC A;  4EOO A;  2W0J A;  3HDN A;  3B2W A;  4FVR A;  3ULZ A;  5TOZ A;  4F64 A;  3T9I A;  2QO7 A;  3G5D A;  1BL6 A;  4RPV A;  3ODY X;  4MXY A;  4YNE A;  2WQM A;  5L2T A;  5AR4 A;  5J9Y A;  2W1I A;  5E8T A;  4F7S A;  5AEP A;  2J0K A;  3WIL A;  4EOK A;  3EH9 A;  4AE9 A;  2IVU A;  3FMD A;  4JBV A;  5M55 A;  3EQP A;  2C6K A;  3TG1 A;  2V22 A;  4EH2 A;  3V6R A;  4RZW A;  3QC9 A;  4O96 A;  2C5N A;  5C8M A;  3VBW A;  4HYU A;  3CQW A;  3TV7 A;  1YOL A;  4EUT A;  2PE1 A;  2X4F A;  2X39 A;  2Y7J A;  4WNK A;  3QYW A;  4FV2 A;  2VWU A;  2YAB A;  4L53 A;  4UWB A;  4JAI A;  3LQ8 A;  3QBN A;  3MY0 A;  3S0O A;  5CF8 A;  5M53 A;  4DG3 E;  4BYJ A;  1W82 A;  4IZ7 A;  2OID A;  3EN4 A;  2JFM A;  4RC4 A;  2QNJ A;  3A60 A;  4IB5 A;  4JDK A;  4OT5 A;  5HNI X;  2G2F A;  4FV6 A;  3BQC A;  3VBX A;  2I0H A;  3QHW A;  4B0G A;  1CTP E;  3ORX A;  3SRV B;  1LPU A;  3ALO A;  3HMO A;  4QTC A;  3GVU A;  5KZI A;  2YWP A;  2GNH A;  3E8C A;  4HVS A;  4JQ8 A;  4YO4 A;  3FZP A;  3UQF A;  2UW4 A;  4RFY A;  3W8Q A;  1A9U A;  2PMI A;  5CU2 A;  2OWB A;  5DE2 A;  1NA7 A;  4QYH A;  2PY3 A;  4RVT A;  5HOA A;  5E8Y A;  2YM4 A;  3L8X A;  3VBQ A;  4BDC A;  3V8T A;  4DEH A;  4FF8 A;  1W98 A;  1UWJ A;  4RIO A;  5EI2 A;  3UVQ A;  1ZMW A;  1ZLT A;  4EKK A;  3R9D A;  3HRF A;  4IDV A;  3DBE A;  2ZAZ A;  3DS6 A;  4ZJI A;  4UMQ A;  4KWP A;  4RC3 A;  3FPQ A;  4E6Q A;  4ASX A;  3R01 A;  3A7F A;  4IDT A;  4YTF A;  4JX7 A;  3ZZW A;  2VTM A;  3E8E A;  2CGX A;  2W1Z A;  2HY0 A;  2VTA A;  1SMH A;  2XMY A;  3PSB A;  4PL3 A;  4AOT A;  5IIS A;  1VZO A;  2XK3 A;  2W9F B;  2QLQ A;  4NT4 A;  4EZ7 A;  1Q24 A;  3ZLS A;  4YLJ A;  4DCE A;  3QL8 A;  4O2Z A;  3QGY A;  4EUU A;  2HZ4 A;  4C02 A;  2PVY A;  5I5Z A;  1AQ1 A;  2VWX A;  2XNB A;  2YLE A;  3QD4 A;  4YPD A;  3RK5 A;  3VC4 A;  4UZD A;  3ZSI A;  4HVI A;  3HX4 A;  4MQ1 A;  4RLL A;  1CMK E;  5G6V A;  3ZYA A;  3AQV A;  3QA8 A;  2H9V A;  3L9M A;  4UMT A;  1HCK A;  4AZE A;  5AUT A;  4GT5 A;  4FZF B;  4GH2 A;  4IB3 A;  1XO2 B;  2HCK A;  3BI6 A;  5E90 A;  1I09 A;  5AR8 A;  4TPT A;  4F6U A;  2OJ9 A;  3LOK A;  4L00 A;  1MQ4 A;  4IXP A;  5DPV A;  3EJ1 A;  3SKC A;  1XH4 A;  1BYG A;  4QML A;  4D2W A;  3O7L B;  4L7S A;  4GFG A;  5EKO A;  4QQ5 A;  5HTI A;  3IPH A;  1TVO A;  2IWI A;  2R0I A;  4DEA A;  4YJQ A;  4FYN A;  3E63 A;  4M0Y A;  5C27 A;  4AOI A;  1YXU A;  5AR3 A;  5I4N A;  3PVU A;  4G31 A;  4H58 A;  4MAO A;  3OY3 A;  2WTJ A;  4FV0 A;  3FQH A;  5AIR A;  4GJ3 A;  3I5Z A;  3KC3 A;  3R0T A;  4HGE A;  1YVJ A;  2WTW A;  3NNV A;  3R8L A;  2UZE A;  1H27 A;  4DGN A;  5EYM A;  3MBL A;  1JKL A;  4FSQ A;  3UVR A;  4FKP A;  4X6R A;  4QQT A;  2OJG A;  2H34 A;  5DA3 A;  3V3V A;  2YM6 A;  3BYM A;  5CSV A;  3E3P A;  2WQN A;  4O27 B;  3S4Q A;  4ANL A;  3CQE A;  5KMM A;  1UKI A;  3AGL A;  3ORN A;  4WG5 A;  3RM7 A;  3KFA A;  3QFV A;  4G3G A;  4PX6 A;  1SVH A;  1ZOG A;  5CYI A;  4CEG A;  4X2K A;  2YLF A;  3P0M A;  2Q0B A;  4FBX A;  2ONL A;  4P5Z A;  3MY1 A;  1ZY5 A;  3FSF A;  3R1Q A;  2X6E A;  4R3C A;  3QQK A;  4ASD A;  2JDV A;  4K0Y A;  4PNK A;  3ULI A;  3WAR A;  4EWH A;  2XM8 A;  4U42 A;  4BIC A;  3CJF A;  4C8B A;  1R39 A;  2J0J A;  4FV8 A;  1M52 A;  2QG5 A;  4D4R A;  2DS1 A;  1YOM A;  3F3T A;  4IB1 A;  2P0C A;  3KRJ A;  4FIF A;  5B2M A;  3SRV A;  3M42 A;  2V55 A;  3N9X A;  4JG6 A;  2GFC A;  1RJB A;  4ACM A;  4XNE A;  1YW2 A;  4TYE A;  5HG8 A;  4ZSE A;  3EN5 A;  4BGH A;  5IH4 A;  2VO3 A;  4M15 A;  4QMU A;  3CBL A;  4FG8 A;  4O0S A;  3EFW A;  4RT7 A;  2Z7S A;  4TND A;  4BIE A;  3QTU A;  3UIB A;  4YSM A;  3I60 A;  5CAO A;  2UZT A;  3O7L D;  3PA4 A;  3ELJ A;  4CMO A;  3S00 A;  4LQM A;  4DYM A;  5IKW A;  3I1A A;  4AQC A;  2C30 A;  2PVF A;  3UBD A;  3FMM A;  1JKS A;  5HTB A;  4RA4 A;  4DG0 E;  4Y85 A;  2PVJ A;  4GG5 A;  4KIK B;  3GU4 A;  5H8G A;  4MKC A;  3ZHP C;  3CPC A;  1UU3 A;  4YLL A;  3C4X A;  2YM3 A;  4OTH A;  4ZY6 A;  1H07 A;  2UW0 A;  3H10 A;  3PRI A;  3D83 A;  4IFC A;  4EH3 A;  4XRL A;  3SHE A;  4AGD A;  4YHT A;  3GU8 A;  5M4F A;  4N6Z A;  2HZN A;  5E8V A;  3DOG A;  4L46 A;  2BDJ A;  2BCJ A;  1OI9 A;  5AP6 A;  3MVH A;  4M7I A;  5HLN A;  3DFA A;  2F4J A;  4JR3 A;  2JIV A;  4TL0 A;  3NZ0 A;  3M2W A;  4D2P A;  5IH5 A;  4BCQ A;  2J5F A;  2UZO A;  3II5 A;  4KIO A;  3F3W A;  3R7Y A;  3WZE A;  4F9A A;  5CEO A;  2QCS A;  2PVL A;  3QZG A;  5B2K A;  5AV4 A;  3UMX A;  4D0W A;  3GOK A;  4AW1 A;  3NAX A;  2Y4I C;  3GCQ A;  3UO6 A;  5HG5 A;  1U59 A;  2W1H A;  2JDR A;  5D12 A;  5DN3 A;  5ETC A;  1H0W A;  5FD2 A;  2C6O A;  4AA4 A;  1REK A;  3LCK A;  4FIG A;  2BDW A;  1Y6B A;  4TW9 A;  4AAC A;  4MED A;  2W4O A;  4XOZ A;  1WVX A;  3REP A;  3DLS A;  3POZ A;  5KMK A;  2XK4 A;  4PMM A;  1YXV A;  4FVP A;  4QP8 A;  1BI8 A;  4J71 A;  4ENY A;  4MD7 E;  3MPT A;  3GCS A;  1G5S A;  4I5M A;  2ITP A;  3R71 A;  3SLS A;  4FTT A;  1OL1 A;  3A62 A;  2X8I A;  3KRL A;  2R3O A;  4XLI A;  3VJN A;  5L2W A;  4NST A;  5DR2 A;  2XNG A;  1R0E A;  3QX4 A;  2YAA A;  3CTQ A;  5LCJ A;  3U6J A;  2W1E A;  1XBA A;  3VWA A;  4ITJ A;  2OBJ A;  3UIU A;  4P5Q A;  1Q97 A;  2NP8 A;  4GFO A;  3P79 A;  5FLF A;  3QUP A;  3DPK A;  2J6M A;  3D7T B;  4HCU A;  4YSJ A;  4G9R A;  3QWK A;  3IDB A;  1DS5 A;  4JJR A;  3EFK A;  4D55 A;  3PUP A;  4DN5 A;  5L6O A;  5JZJ A;  2F49 A;  4NFM A;  3LCS A;  3EQR A;  4JS8 A;  1REJ A;  2UV2 A;  4F0F A;  1NVS A;  3Q4C A;  3GI3 A;  3C5U A;  4AU8 A;  3NPC A;  5EDR A;  3SDJ A;  1PMN A;  3H4J A;  1J1C A;  4CLJ A;  4ZJV A;  5CAN A;  3C51 A;  4E93 A;  5C8N A;  3QAM E;  4WBB B;  4CV8 A;  3BGQ A;  3CY2 A;  4CV9 A;  1U4D A;  3H30 A;  4W9X A;  2IVS A;  3GT8 A;  5LQF A;  3OY1 A;  5K9I A;  2XNE A;  3TV4 A;  4AF3 A;  3ZC6 A;  3UVP A;  2I0V A;  2J4Z A;  4A9S A;  5BPY A;  1URW A;  5CS6 A;  3P7B A;  2C3K A;  1PMV A;  5CXZ A;  3AMB A;  4DBN A;  1T46 A;  3KKV A;  4EZ3 A;  3QKL A;  2YCS A;  2C5O A;  4KIK A;  4M68 A;  3KMW A;  3TZ9 A;  1UKH A;  4LG4 A;  1R1W A;  1WZY A;  3ZO3 A;  1MP8 A;  4EK4 A;  4ZZO A;  1KE8 A;  1Q8Z A;  2Z60 A;  3RKB A;  2HIW A;  5CX9 A; 
#chains in the Genus database with same CATH homology
 1W2D A;  4O4E A;  1W2F A;  1W2C A;  2AQX A;  4FRF A;  2IF8 A;  2X0Q A;  1TZD A;  4O4B B;  4O4D A;  2X0P A;  2X0O A;  4O4F A;  2IEW A;  4O4C A;  2A98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...