4O4DA

Crystal structure of an inositol hexakisphosphate kinase ehip6ka in complexed with atp and ins(1,4,5)p3
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
240
structure length
240
Chain Sequence
PDGQYLLKPCLSHRERDFYLHIKDDKEWTGTGIIPKFYGVELHEFGFGELEFIRMENLMYKYKRPFVLDLKIGTQTWDPETASSKMKKRLVVDSTSTTTSLGVRFSGMERNIGEEKPILYSRYLCTHEVNTRDSLKEYIKLFFNDGKKYRKELVPYFISQLDKMIEVMKKREYKMFSSSVLFVYDSTTTLEDKKYNCKMIDFAHNWILSEEECTVEDGFLFGLNNLKSILEDIENEFKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Inositol hexakisphosphate kinase
publication title IP6K structure and the molecular determinants of catalytic specificity in an inositol phosphate kinase family.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 77
structure length 240
sequence length 240
ec nomenclature ec 2.7.4.21: Inositol-hexakisphosphate kinase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03770 IPK Inositol polyphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.50 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase); domain 1 4o4dA00
2A98A 2AQXA 1W2DA 4O4DA 4FRFA 4O4BB 1W2CA 1W2FA 4O4FA 2IEWA 4O4CA 1TZDA 2IF8A 4O4EA
chains in the Genus database with same CATH superfamily
3UYSA 4HVGA 3C13A 5AR4A 4C3FA 5KBQA 4GJ3A 3DKFA 4R3RA 4U79A 5GJDA 4PPBA 3KMWA 4E4LA 3NGAA 3HYHA 5BVDA 2A19B 2XKEA 4O22A 4XV3A 3EZRA 2GS2A 2JLDA 1ZYDA 1K9AA 2YJRA 3U9NA 1XBBA 4IX6A 2X0OA 1W0XC 1XHAA 3Q3BA 3R21A 5CENA 5ANEA 3HUCA 3RCJA 4JQ8A 5E8UA 1CKPA 3E8NA 4M69A 3EQHA 3ZO2A 4ACHA 3CC6A 3ZBXA 2PMOX 2BAQA 3SXFA 5FQDC 4IBMA 3HECA 5HO6A 4GEOA 1TVOA 1M7NA 2I40A 3VQUA 2VO3A 4FSWA 1XWSA 4M0ZA 4BYJA 5A9UA 2ZM1A 3H9FA 4IXPA 4IC8A 5BUEA 2X8DA 1GZNA 2DS1A 3AXWA 3KMMA 3V5WA 1URWA 5DFPA 4FF8A 3CR0A 4JBOA 5EW9A 1FVTA 1H24A 2GFSA 3Q60A 3SAYA 3W2CA 4E6AA 2DYLA 4JVGA 1J1BA 3RZFA 4FZAB 4GL9A 4AN9A 3I7BA 2OKRA 4E20A 3O2MA 5G6VA 4F9YA 2QR7A 2P0CA 4MEDA 5A4EA 3QQFA 3FYJX 3MDYA 5HTBA 3ZMMA 3A7GA 4D1SA 3R8PA 3PSCA 1OGUA 4YP8A 4IW0A 3LCKA 3COKA 4RA4A 1QPJA 4KAOA 5IA1A 4EOKA 4EUTA 3IOKA 1JLUE 2CGUA 3R30A 4NH1A 1JQHA 3BYUA 3LE6A 4X6RA 3E63A 3C0HA 2IEWA 3M2WA 1P4FA 4EH8A 2PE2A 1KE7A 2VWBA 4EBVA 1IR3A 3RP9A 5AV4A 5HCZA 3OC1A 3ZLWA 3KVWA 3R9NA 3NIEA 3PG3A 3U8WA 5HBJA 2C0IA 3UJGA 2HXQA 1GIJA 2JD5A 4EH5A 3ZC5A 2WMVA 3NUNA 3OBJA 3GCQA 4TN6A 1ZXEA 3HV7A 3OWPA 3EQGA 3R9OA 1SVGA 3SV0A 5HX8A 3ANRA 2OJIA 3C4CA 5HIBA 4RGJA 1W84A 4X2NA 1WVWA 4BCKA 4IWQA 4NUSA 4GYIA 2Q0BA 4XEYA 3BLRA 2YM4A 1UU8A 1LUFA 4BGGA 1YDTE 2F4JA 4PP9A 3QFVA 4QP9A 5DEWA 3QQHA 1W98A 2XNOA 2PL0A 4FL1A 1WAKA 5EW3A 2V22A 4QTCA 4FIEA 2XCHA 4AZTA 2UVXA 2WXVA 4QPSA 4Z7GA 1PW2A 3A8XA 3ZM4A 2GHGA 1OKZA 2XEZA 2GMXA 3F7ZA 3Q32A 4PL5A 2ZM3A 2WFYA 1GIIA 3A7IA 1WMKA 3QTUA 4KBKA 3VW6A 3W1FA 5KO1A 2BDWA 2OGVA 3V8TA 4ZSLA 3F2NA 3ZRMA 1ZYCA 4DG2E 5ANJA 4PPCA 4CQEA 3GB2A 3FMDA 1UKHA 1IRKA 2KULA 4NZWB 3MB7A 3M42A 4OBOA 4IVDA 5D41A 5DGZA 1J1CA 2J4ZA 2ITWA 2OF2A 4CZYB 4ZZNA 5T3QA 5CU0A 4PTCA 4WSQA 4PNIA 1M2PA 4HZRA 4MXOA 3VS6A 2QOFA 2Y4IB 3BGPA 3P7CA 3QGYA 3ZDIA 3RPRA 4QYFA 2UW6A 4TY1A 3U4UA 3KEXA 4GIIA 4WNOA 4AGUA 3WF5A 4BDKA 4FX3A 4HGLA 4J53A 5DT0A 4YJRA 3LXLA 4RA5A 4AF3A 4ASEA 2J50A 3BBWA 2V5QA 5AEPA 3LM5A 1P4OA 4UX9A 5HLNA 2QODA 3TZ8A 3AC1A 3T9IA 1REKA 3TG1A 5IA5A 3UDBA 3E62A 2OJFE 4CT2A 5KBRA 3LZBA 4X21A 3BKBA 5AP3A 2BTSA 4BICA 4LRMA 4AT4A 4IDTA 2J0LA 5IISA 3CXWA 4EZ3A 2VWYA 3UP7A 3ZFXA 3QZHA 2YM6A 4FSQA 2WHBA 2FSOX 4I94A 4BRXA 2WMAA 5A4TA 4USEA 4QMLA 5E7RA 5C27A 3FYKX 2GNGA 4I1ZA 3LCOA 4PL4A 3TIYA 4F09A 4NM7A 2VTLA 1SVHA 4ZP5A 2OSCA 2XBJA 5CAVA 3CTHA 4GG5A 4O21A 4ERWA 2JIUA 4FICA 4G3EA 5J5SA 1ERKA 2C6EA 4GMYA 4RX5A 2OZAA 3QWJA 3ORLA 4M68A 3G6GA 2QURA 4DH3A 2ZDUA 4BCGA 3OWLA 2WTCA 3Q6UA 5GZ9A 5IA0A 5L3AA 4A4LA 3LJ1A 3G0FA 5ETIA 2NRUA 4BTKA 4ZXTA 5DH3A 1YI4A 4KIQA 4KNBA 4UXQA 2XK9A 4GH2A 5IEYA 1OMWA 3MA6A 2OI4X 5E92A 5FBOA 4IIRA 5HVKA 5G1XA 1LEWA 4FZDB 2JBPA 3RBWA 4WIHA 4C4FA 4FV0A 2B7AA 2BRMA 2G15A 3MVJA 3S4QA 5BUJA 3HV6A 2W1GA 4AGWA 3QRIA 2WPAA 5L2IA 4WO5A 3HV4A 5AR8A 3K5UA 2FA2A 4YNEA 5DNRA 3R9DA 2B1PA 5I9UA 5LOHA 1XH8A 4DG3E 1LP4A 4I20A 1WBPA 4YNOA 2WTKC 4BCIA 2YM7A 4USDA 2OJGA 3UTOA 3BHVA 1UU7A 4Q9ZA 4JNWA 5LVOA 4FIFA 3G90X 4O0VA 3ZLXA 3DLSA 4CYJA 3BLHA 3B8RA 2Y7JA 1U59A 4EJNA 3RJCA 1JKSA 1M2QA 1ZAOA 2QKRA 4K8AA 3S95A 4P7EA 4M15A 3VBVA 3Q9YA 4AE6A 4K11A 4KS7A 3LCTA 3TJCA 5J1WA 3DQXA 4GCJA 5J87A 5AV2A 4ZSGA 4AWIA 4GJ2A 1PXJA 3KN6A 4IZ7A 3OEFX 4TWPA 3JPVA 4C02A 3OP5A 3VBTA 4KKHA 2WOTA 1Y6AA 4NKSA 2R3PA 2OG8A 2XCKA 3PY1A 3II5A 3ZHPC 5LMKA 5EYDA 4BBMA 1OUYA 2W9ZB 3KC3A 2PVLA 3OD6X 1H1SA 1YHVA 2VTHA 4QTDA 4DEIA 4O2ZA 3FDNA 3OROA 4IAZA 4RJ8A 4YTCA 3CD8A 1W8CA 2W1EA 4RX7A 4Y5QA 5CSXA 3FQSA 4TNDA 3QX4A 4IAFA 3ORKA 3TEIA 1RQQA 3DNEA 4F1MA 5J8IA 5CVGA 5B2KA 3F3UA 4FTCA 2YHVA 4IAYA 5JFXA 3VVHA 2OXXA 4XMOA 1H1RA 2XMYA 4FV2A 4MYGA 4X3FB 4C0TA 5FXSA 1YRPA 4I5HA 3SRVB 3A7JA 3DK3A 4F65A 5IUIA 4R7HA 3I60A 4NFNA 4C4IA 4KBCA 3QTIA 4EEVA 4UWYA 4RJ6A 2UW4A 3PA5A 1H4LA 4QP4A 3IONA 3R8ZA 4EQCA 2C5YA 1PXPA 3HMOA 3AGMA 3CQEA 3EN5A 3PVBA 5JH6A 4APCA 4O27B 5AA9A 4QMNA 4W9XA 2J0JA 4QO9A 5B7VA 3W32A 4EH4A 1OIQA 5AP0A 4FKQA 1VEBA 3V6SA 5F20A 5LVLA 3ZO1A 2Y4PA 5AX3A 3CTQA 1X8BA 2VWWA 4OT5A 4D1ZA 1S9IA 4FBXA 3U9CA 4FL3A 4O1PA 5F9EA 4CT1A 4QMPA 4V0GB 3ENHA 1E9HA 4MXZA 4YJOA 3EFKA 4JJRA 3VS0A 2PZPA 2PMNX 4J71A 2VTNA 2J0KA 2RSVA 4RIXB 1OM1A 4P90A 4WRGA 4AN2A 4EK4A 3SRVA 2R3HA 3CQUA 2YJSA 4I6BA 4IFGA 3PIZA 1CKIA 3W33A 4EOLA 1UU9A 4QP6A 1BX6A 2RFSA 3R8UA 4MBJA 3ALNA 3KN5A 2PZYA 2PTKA 4YJPA 2JAVA 5DOSA 3UOJA 4QTAA 3QQKA 5FDXA 5FTQA 4FG8A 1PXNA 5KMJA 5DRBA 2X0PA 3GU8A 4FUYA 4TKSA 1AD5A 3HRCA 4HW7A 4XNEA 1ZWSA 4X2JA 1Z57A 3DFAA 4EYJA 3QA0A 1TQMA 4XOYA 4L43A 3F3VA 3FZ1A 4FTOA 5B0XA 2YCQA 4ZTQA 3FY0A 5CY3A 4B8LA 1DI9A 5KZ0A 5JEBA 4V0GA 1HOWA 2ZYBA 4CSVA 4DBNA 3A60A 4FT0A 1NA7A 4I6QA 4K2RA 2XNNA 4FTMA 3R7IA 4OLIA 4U6RA 4HOKA 3EQIA 5EOLA 4RIXA 4AZVA 2WB8A 2Z8CA 5CQWA 4B6LA 1H25A 4ZS0A 3EYGA 4FZ7A 4DN5A 4L67A 2WU7A 2FB8A 3RZBA 3QXPA 4FIIA 1H1WA 3PXYA 1ZYSA 5EYMA 2JDSA 1H28A 1GZ8A 2WTJA 4YLJA 3OBGA 5M55A 3VUIA 4ZSAA 3FV8A 4G31A 4CMOA 3RGFA 4ZK5A 4H39A 1BI7A 4FKWA 3C4WA 4CZUA 5LQFA 2C0OA 3COMA 1U4DA 4FSTA 4AFJA 5I9WA 5E1EA 3DZOA 4LV8A 5EI2A 3QRUA 3PSDA 3FI4A 2WQOA 3SQQA 3RWQA 3WE4A 4AACA 4TYGA 5T6KA 5CTPA 1BKXA 3FLWA 1P14A 2ZV7A 3G0EA 4EQMA 3EN6A 1SMHA 4ZSEA 5ETFA 4DEGA 4CXAA 4C37A 4EH9A 5AX9A 3NZ0A 4GSBA 4A9UA 3F5UA 1QMZA 4NEUA 2SRCA 1IA8A 2FH9A 5M4UA 5AR5A 2NPQA 1RDQE 4LGHA 1SNUA 4QMMA 3FQEA 2H96A 4EOPA 3VQHA 4K6ZA 3F5GA 4YC6A 5HG8A 5D12A 3MW1A 3ORIA 4NWMA 1Q8TA 5KX8A 1YXUA 4BDEA 1OIYA 3W8QA 4O4BB 3OFMA 4XV1A 3TNQB 4BCNA 3UZTA 4BDIA 4Q5EA 3NYXA 3RMFA 5IMEA 5HE2A 4O0SA 1ATPE 4G5JA 5A14A 2I6LA 5AM6A 1OL1A 4KKGA 2PUUA 3PJ2A 4CKRA 2OICA 3NRMA 3HDNA 2XH5A 4RC2A 3IDPA 3KRJA 4ACGA 3GCSA 3MY5A 4BBFA 1O6YA 3D7ZA 3ORMA 1PMEA 5E8ZA 1YWRA 3NNVA 4M7IA 3VBXA 3ZFMA 3M11A 4DGNA 5CVHA 5H8EA 2YACA 3EN9A 2ITUA 3I0OA 3C5UA 4O6EA 4AOTA 1HCKA 5LCKA 3LXNA 5F4NA 5E8YA 2A27A 1O6KA 1Y8YA 3PXQA 4M8TA 4CVAA 4E8AA 1PYEA 4AUAA 2FO0A 4Y72A 5JT2A 3C9WA 2WIPA 2R7BA 3HMMA 3E5AA 2EXMA 3ZO3A 2EWAA 3EFWA 2C5XA 1B6CB 5KNJA 4FNYA 1Q5KA 3OEZA 2YDIA 4JL9A 3DNDA 3GCVA 3KRLA 3P9JA 4XUFA 3Q04A 4F08A 5EYKA 3EYHA 2VWIA 2YM3A 4AGDA 3F7WA 3C4XA 4U45A 5K4JA 2I1MA 5L2SA 4OAVB 1Q97A 3BE2A 2BIKB 1OL6A 2BAKA 4JRNA 2X1NA 2AUHA 2BAJA 4EK3A 2VTJA 1R1WA 4AZFA 3RVGA 4ZAUA 4JT3A 5CT7A 4GT4A 3NYNA 3BHTA 1WVXA 3R7YA 4L68A 4BFMA 4OTFA 3VN9A 3L8PA 5AMNA 2F2UA 3O71A 2HELA 2GTMA 2E9PA 5D7AA 4DAWA 3ZRKA 4WUNA 3UIXA 2GSFA 1QPEA 4AW1A 5CEKA 3R7UA 2J2IB 5I3OA 4JDJA 3CGFA 3HMPA 4FV6A 4G2FA 5A46A 4L3JA 3FLZA 5H9BA 5LXMA 3VS5A 4FTLA 1J91A 5CI7A 3ULIA 4UWCA 2X7GA 3D83A 3EHAA 2YCRA 3QF9A 2NRYA 2BFYA 3RNYA 4FVRA 2JIIA 5K9IA 5I3RA 5CANA 3I5NA 4IAAA 1IEPA 2F57A 5I4NA 2Y8OA 4ZLOA 3S1HA 4Z3VA 1PMVA 1H1QA 1YXVA 2UUEA 2BROA 3EZVA 3O51A 4G5PA 4E4XA 3I5ZA 4BZOA 5A54A 2P2IA 3EQCA 3ZOSA 4F9AA 3QC4A 4IX4A 3KRXA 4MBLA 4OTGA 2YAAA 4P5ZA 3Q6WA 5HI2A 4G9RA 5ETAA 5HZNA 1OKYA 3CBLA 3V3VA 3FZTA 3GEQA 3KXGA 4H36A 1SZMA 4TXCA 3RHKA 3V5TA 3Q5ZA 3OMVA 4XV2A 3QTSA 4FV7A 4UZHA 3P4KA 4I4FA 3ODYX 3P86A 4O4DA 2CGVA 4ENYA 4WT6A 4IX3A 4OTRA 4V05A 3UODA 3VIDA 2VZ6A 4WBOA 2J0IA 4FTAA 5BYZA 4C3RA 1V0BA 3HP2A 3LFCA 4B99A 3RINA 4E5WA 4AX8A 3FJQE 2C3JA 4BTJA 5EG3A 2WQMA 5CASA 5JKGA 2H8HA 1EH4A 3BCEA 4OTIA 4E1ZA 3UBDA 3ZUUA 4PMSA 4BIDA 2GU8A 5J7HA 4B9DA 3E93A 2UZNA 5JQ5A 3MFUA 3KVXA 4IE9A 4FT9A 1CSNA 4X3FC 1FGKA 4D4VA 4KINA 5F94A 3OT3A 2FSMX 5E8SA 4GU9A 4AQCA 4ZLZA 4QQCA 3A99A 3KB7A 1B39A 2B55A 5E90A 3RAWA 4PY1A 3TL8A 4YURA 5IEXA 2XYUA 2VTIA 5KCVA 1YDSE 2DWBA 3F66A 3FZPA 2G2FA 4NM5A 2WMSA 4D28A 3KXXA 5HVYA 3OWKA 1Q3DA 1JKTA 1FMKA 2E9UA 2XNMA 4DH1A 5A4LA 4R7IA 1PXLA 1UV5A 3AT4A 3PUPA 4JG6A 4FKRA 4S2ZA 4H1MA 4L42A 3UGCA 1KOAA 1FGIA 3ZDUA 1FVRA 4L00A 4RWLA 5DE2A 4U3YA 3U6IA 2PZRA 4C35A 4C36A 4RC3A 1GZOA 2X9FA 4DLIA 4MQ1A 2BR1A 3C4EA 3GU4A 4PQNA 5HIDA 3CD3A 4M13A 3LXKA 3UNZA 4XLIA 5BQ0A 2VV9A 2IO6A 3VO3A 1OPLA 2WU6A 2GCDA 3P78A 4XX9A 3TV7A 5J9ZA 2OJJA 1XH9A 1DS5A 1PY5A 1ZYJA 3ZBFA 4G3CA 5L2QA 3HA6A 5I9YA 1OI9A 4ZOGA 3FUPA 2BRNA 4BDBA 1A06A 5DVRA 3RK7A 4H3BA 3VS4A 5HO8A 3TUDA 4CFWA 3DAKA 3C0GA 3U87A 4FI1A 1ZMVA 2E9OA 3HMNA 4BZDA 3U6HA 3FMMA 1WZYA 4OGRA 4X2KA 4CFUA 2BCJA 3C1XA 3E3BX 4IB5A 3VULA 3PIXA 5HLPA 5LMAA 1BMKA 3H9RA 2UVYA 2VWVA 2HZIA 2B9JA 2WQBA 3DU8A 2R64A 4N4SA 4BCJA 3O7LD 4JBQA 2UVZA 4UMQA 2C6LA 1H00A 4IMYA 2HZ4A 4FTNA 5AP5A 4OR5A 3PG1A 4QP1A 2QQ7A 3BU5A 4QRCA 4FSMA 2CGXA 4O4CA 5ETCA 2V7AA 2Z2WA 3BV2A 4PTEA 4EHGA 3FMNA 4FV8A 4Y8DA 4A06A 3FZRA 3V8WA 1ZOHA 4MQ2A 1MRVA 2YM5A 5M4CA 4JDKA 4BGHA 1IASA 3FL4A 3HL7A 3DTCA 5IPJA 1OIUA 2ZVAA 4ITJA 4FTRA 3TT0A 3OCSA 5HE0A 3TUBA 1MUOA 3DJ6A 3FMLA 4D5KA 5EK7A 2XM9A 3K54A 4ACDA 4ITIA 1CKJA 3HP5A 5FP5A 3SOAA 3ZRLA 1W2DA 3BI6A 1JVPP 3NUSA 4O38A 5DHJA 4I93A 5C03A 3HKOA 1TQPA 2VNWA 3B2WA 3PE2A 2O0UA 2R3MA 4QQ5A 4D2PA 4JIAA 5LVNA 3DOGA 3O23A 4IVBA 4NJ3A 2W5HA 4JG8A 1Q8UA 3VAPA 5H8BA 3UNKA 3IOPA 4BN1A 2EXEA 2XKFA 3ET7A 2C5OA 3O8UA 3PP1A 3R28A 4PL3A 4O0UA 3OTVA 2VWZA 4WG3A 3OVVA 3UC3A 5BVNA 3TNIA 4YLKA 3UOHA 3L9MA 2O65A 3SVVA 3MA3A 4XG3A 2OH0E 3CPBA 4F6UA 3DTWA 4AE9A 1UNLA 3V04A 2UW5A 2UZOA 4C34A 5E8TA 2BZKB 1I44A 4IZ5A 4IZAA 3R9HA 4XCUA 3UIUA 1OZ1A 3DAEA 4YJUA 2JDVA 2JKOA 3EN7A 4J97A 4KA3A 2XIKA 2C5NA 4ANOA 5JGAA 3MSSA 1G3NA 1UNHA 5AADA 3BU3A 3MVLA 2YLFA 3JY0A 4QYYA 3C0IA 3SW4A 3A61A 4O6LA 4AS0A 4ZLYA 3HRFA 2PSQA 5KHXA 5M4FA 2ZDTA 3HDMA 4XS2A 4CFFA 1YVJA 4DG0E 3CP9A 3GQLA 4YTIA 3MTLA 4OT6A 2HK5A 4I21A 2YCSA 2IVSA 4I0RA 3Q52A 4JAJA 2W06A 3IW4A 4U41A 4X0MA 4R3PA 2G2IA 3RAIA 3R2YA 5HORA 3QCQA 2CSNA 5HU3A 3EWHA 3DJ7A 5L8LA 5I5ZA 4WNPA 2REIA 5BVOA 3QL8A 2VTQA 4E6QA 4ITHA 2XS0A 3QALE 5AV0A 4UYAA 3GU5A 5J7BA 2W9FB 1LPUA 4J8NA 1M2RA 1U5RA 2AC5A 5DN3A 4YJTA 3BX5A 4B7TA 5FXRA 2W1HA 2YCFA 5HBEA 3BEGA 5HEZA 4QYEA 1UKIA 3QD2B 3ZUTA 4MWHA 2XF0A 1NVRA 4QNYA 4PWNA 3LVPA 3E8DA 3A7HA 4GFGA 5AP2A 5D1JA 3PRIA 4I22A 1ZZLA 5ACBC 5GJGA 4D58A 1YQJA 3DXNA 3OCBA 2B9HA 3DA6A 3DFCB 4JLCA 5CX9A 2E9NA 5IUHA 5HD4A 1MQBA 1XH5A 2X8IA 2RKUA 4FYOA 1W7HA 5KMMA 4FIGA 3ZTXA 4TL0A 2JFLA 4XG6A 4U80A 3MGYA 3TKUA 2YA9A 2YABA 3EKKA 1T46A 3QHWA 4MXCA 3VHKA 1JSVA 2UW8A 3W2QA 4IZYA 2XNPA 4GVJA 2CKEA 4UXLA 2OH4A 4WNMA 4QMYA 4O96A 4YSMA 5EFQA 5FEDA 1PJKA 4F6WA 1OL7A 3LJ2A 3UIBA 4I24A 3KRWA 2OJ9A 2VTSA 3NNUA 4Y46A 1VJYA 2BZJA 2YM8A 5AUXA 4RC4A 4JRVA 1CMKE 4FG7A 5E91A 2XK7A 2PVKA 3P23A 1WBSA 3Q4ZA 5CI6A 4FK3A 5FTOA 5JK3A 1R78A 5M56A 3OTUA 2YDJA 3ZUVA 2PVJA 4BL1A 3DB8A 4FK6A 5EDRA 4DYMA 2ZV9A 3MH1A 2X7FA 3I1AA 3DBDA 3KXMA 3OWJA 3WF6A 3DS6A 3BYOA 1JNKA 3BHYA 2XIXA 2XK3A 3KA0A 4FV5A 3V6RA 3LCSA 3W55A 3D4QA 3RKBA 3AQVA 3BLQA 4LG4A 4DGLC 5BYYA 2P3GX 2JFMA 2WMBA 5K0XA 2YIXA 2IVUA 2UZTA 3UO5A 2G1TA 1DI8A 5CWZA 4RX9A 4X7QA 1YI3A 4E3CA 5C26A 4X2GA 4XHKB 4BI0A 3RM7A 4YHFA 4RPVA 2IW6A 4XH6A 3NUXA 3GC9A 4IWDA 3BYSA 1BLXA 1H08A 2Z60A 2R4BA 1PKGA 4G3GA 2EXCX 3G6HA 3UQGA 2PZIA 2UV2A 4JQ7A 2Z7LA 5IH5A 1MRUA 1OKWA 4FKOA 5DPVA 1H1PA 2PVHA 3CTJA 4YMJA 4WG4A 4KWPA 2I0EA 3PVUA 5HNIX 4HYSA 3U51A 3WZDA 3POOA 2X9EA 3QQLA 3DB6A 5CZHA 4ANQA 4XRJA 4BB4A 4CFVA 4ZY5A 4MK0A 5A6OA 3DY7A 1OVEA 5BPYA 2JKKA 4YZDA 3QX2A 4ACMA 1YDRE 2BZHB 4G16A 4MBIA 1JSUA 2QVSE 4BCPA 2QO7A 5CF6A 1JOWB 2OIDA 3EJ1A 1W2FA 4XV9A 4YJVA 3LLTA 3T3UA 3OUKA 5L6OA 5BVWA 3NWWA 4PRJA 5FDPA 5EDQA 3VRYA 3LAUA 3K5VA 2OWBA 3PXZA 4NKAA 4CRLA 2BRBA 3BZ3A 4YHJA 3ZSGA 1R0EA 4S32A 2CLXA 3AMYA 3R71A 5DR9A 4Q5HA 2XK6A 4IQ6A 2W96B 3ZO4A 4C4GA 4EHEA 4IWOA 2ZOQA 2W4JA 5C8KA 4I5PA 4V04A 3EL7A 4Q2AA 3EQFA 1UWJA 3MH2A 5FBNC 3AD5A 5A3XA 4HVDA 3VS3A 2WELA 2IZUA 2UW0A 3L9LA 5J9LA 2XUUA 5D9HA 3M1SA 4UMUA 3QZGA 4HCTA 4XG7A 2YN8A 2R3LA 4FTKA 4NCTC 4ZIMA 3TCPA 3FY2A 2VD5A 2QNJA 1APME 4RIYB 4B0GA 4E93A 5JRQA 3F82A 4F99A 2ESMA 5GHVA 5I9VA 4E7WA 3HUBA 4YZMA 3TZ9A 2BHEA 1F3MC 4CFNA 2JIVA 3CKXA 4D2WA 3WZKA 2F2CB 2XNEA 4YGAA 3VUGA 3WIGA 5JFSA 2C69A 3AC2A 3PPZA 4D2RA 3VJOA 3R2BA 4ZJIA 4BKYA 3CPCA 2ETRA 3BBTB 3BWFA 4BCQA 3MI9A 2G01A 5L4QA 2OBJA 3RK5A 3QD0A 3KF4A 4FA2A 1GZKA 3NYVA 2FSTX 3SX9A 4UN0C 5LCJA 3UQFA 2WMQA 5J9YA 1RE8A 2JAMA 5C1QB 5IG1A 2G9XA 4G3FA 1XH7A 3IO7A 3QYWA 4NU1A 2UZEA 3OHTA 3Q4UA 4AA5A 5EM8A 5LWMA 4YZBA 4XG9A 1QCFA 2EB3A 4RFZA 5E1SA 1UA2A 5CQUA 3UVQA 3CJFA 3R8LA 4YBJA 4OTPA 5TT7A 4RIYA 4NSTA 5CEPA 3VUMA 1Y57A 1XR1A 5CSVA 3QTWA 3PXKA 4DH8A 4F7JA 5CXZA 2BTRA 3R1QA 4QOXA 2PVNA 3PY3A 5JSMA 4BI1A 4L53A 5M44A 3QBNA 3GXLA 3PZEA 4D5HA 4N70A 4C38A 2OXYA 2HXLA 3A4PA 3FSFA 3KULB 3PJ3A 4QP7A 2LAVA 3UQCA 2UW3A 3OY1A 2XRUA 5AAFA 2GNJA 2VO6A 2PVYA 2W99B 3Q9WA 4PMTA 5DLSA 2XZSA 3NUYA 5AUVA 4ZY6A 1JAMA 5CALA 2F9GA 1W83A 3IW7A 3PE1A 2YIRA 1Q3WA 2H6DA 3MVHA 3QQGA 3UOLA 2C1AA 2XM8A 4L9IA 2J5EA 4M84A 3O8PA 4C2WA 4JX7A 3GU6A 4UYNA 3IK3A 4XRLA 5L2WA 3ORNA 3REPA 3PTGA 3R8VA 2WMTA 2WMXA 4X3FA 3TI1A 4BDJA 1PMNA 3QZIA 3KL8A 2J90A 2ERKA 3KXZA 1YOLA 4TYJA 1SNXA 4BIEA 2Z7SA 3SC1A 1XKKA 2XJ2A 5H8GA 4DCEA 5EI8A 4KSQA 3MJ2A 3EL8A 5K3YA 2UW9A 5IKWA 3G9LX 3GFEA 3U4WA 3R1SA 1XBCA 3EQPA 4U97A 4I5CA 3V01A 4FL2A 3V8SA 3MPTA 5M53A 3WE8A 4LGGA 3GOPA 4PV0A 3KULA 4Y95A 2IW8A 4AP7A 4D0WA 3S00A 4GRBA 1KE9A 5TF9A 2XKCA 2QC6A 4MD9E 4G1WA 2GNHA 3SA0A 2VO0A 4GT3A 2CJMA 2Z7QA 3AD6A 4FSUA 4QMWA 4QYHA 2PE0A 2C6IA 3UE4A 1TKIA 1WBWA 1Z5MA 2HZNA 3AC5A 2O64A 3FAAA 2ZMDA 2JDOA 3OZ6A 1K2PA 4FV3A 3U6JA 4DEAA 4WUAA 2IVTA 3L8XA 5A4CA 4IVAA 5HTIA 4EC9A 4GS6A 2VX0A 4EUUA 5EI6A 2ZM4A 4FRFA 1MP8A 4FVPA 4I41A 2XNGA 3CGOA 5TE0A 2OIQA 4HCUA 3R01A 4I6HA 4NW6A 3D5UA 4XYFA 3W2OA 4M67A 2XIZA 4QMUA 4O2PA 5JZJA 2HWPA 3E8CA 4UWBA 4CZTA 4U5JA 2R3OA 2QU5A 3L1SA 1YXTA 4U8ZA 3RM6A 4FEQA 2C6OA 3FMEA 3UMXA 1O9UA 3R00A 5CAPA 4M97A 5CAUA 5CXHA 4O4EA 5K0KA 3S2PA 5I0BA 3PXRA 2HZ0A 4DGGA 2B4SB 1JBPE 2HW7A 1BL6A 3COHA 4GVAA 3EOCA 3QQJA 5CNOA 1BL7A 4N6YA 3T8OA 3S0OA 3KK9A 1Q8WA 3FLQA 3R1YA 2YWPA 2CN8A 3EFLA 4UMTA 4EK8A 4ANNA 3O0GA 4RJ5A 5EW8A 5GNKA 3VBQA 2BKZA 3ROCA 4E26A 3ZCLA 4C4EA 4EORA 1KV2A 3TUCA 4BCHA 2BILB 4XBUA 1REJA 2P55A 4FTIA 4FT3A 4YTFA 4OBQA 3PIYA 3E8EA 2XK4A 3H4JA 3LCDA 5AIKA 5BNJA 5KKRB 2ETKA 1SM2A 3DT1A 4JBPA 4YPSA 5HG7A 4QPAA 4G6OA 4D9TA 3R1NA 4BDDA 3D2KA 5E8VA 3CY3A 3NX8A 4DEHA 4P4CA 2DUVA 4YJSA 3TKHA 3VBYA 3ZU7A 4A7CA 3PY0A 2B9FA 2CCIA 3LIJA 5FD2A 4NIFB 2UZWE 3PPJA 4BHNA 1MRYA 2I0YA 4RQVA 4ZTRA 1SYKA 2OFUA 1R0PA 3CY2A 2IWIA 3ZC6A 1YKRA 3RHXA 3QKMA 4E5BA 3EB0A 1PXMA 2C6MA 4JX3A 5KHWA 3KMUA 3UZPA 4FC0A 3BWJA 3FPMA 4RJ4A 3SXSA 1HCLA 3NNXA 2IJMA 3FI3A 4QQTA 4OAUC 3EQDA 3W2SA 2WD1A 5ANGA 4IEBA 3W8LA 4CV8A 4ZTSA 4XP3A 3LFFA 4C7TA 3MH3A 3A8WA 4HNFA 4XP0A 4RLKA 4FSNA 1GIHA 4I0TA 4YPDA 4MXAA 3DDPA 4XG8A 2GFCA 2YDKA 3UVPA 2A98A 3DZQA 3BYVA 2WGJA 3R7VA 4WNKA 4FV4A 4DINA 3ALOA 4C4JA 3QKLA 5IF1A 2J9MA 2XB7A 2VUWA 3MIYA 4GFOA 2C6TA 1UWHA 4CEGA 1ZARA 4B8MA 1PXKA 5DR6A 3KXNA 1XJDA 3PSBA 3QQUA 3D7TB 3JS2A 4RVKA 2B53A 4U44A 1VR2A 3GUBA 1QL6A 4RSSA 3DKGA 2HW6A 4NIFA 4NM0A 4O1OA 2QOLA 2PMLX 4CFMA 2R3RA 3SOCA 3RI1A 2R7IA 2PWLA 2PZ5A 4EQUA 5AP6A 5EM5A 4DFLA 4PF4A 4I23A 4EONA 5HG9A 4F7NA 5HHWA 2JKQA 2ZJWA 3IKAA 2W17A 3UO6A 3FL5A 2YIQA 1NVQA 3TTJA 3ZSIA 3NCGA 5HTCA 4J98A 4YZNA 4EOIA 4C58A 3A62A 3ZEPA 2WZJA 4ANLA 5AR3A 2J5FA 3A2CA 4F1TA 2XP2A 2WTVA 3L9PA 2VGPA 4LRKA 4AZWA 1TQIA 3CJGA 1LEZA 4HPTE 2YEXA 4K0YA 3T9TA 3SHEA 2ITYA 2PMIA 3O7LB 5FRIA 4F9WA 4USFA 4U0IA 1MQ4A 5FGKA 2GS7A 3EQRA 3KFAA 3F3TA 3VNTA 3FZOA 2A2AA 4LGDA 4QMQA 5J1VA 3ROYA 4EI4A 3BHUA 4LYNA 3RCDA 3V5QA 4XJ0A 3D7TA 4LOQA 1M14A 2Z7RA 4DLJA 5DT4A 5HD7A 2WMUA 4G17A 3Q53A 5CEQA 4JG7A 2GS6A 1OL2A 4U9AA 3PFQA 4UEUA 1JKLA 2CLQA 1Q8ZA 4WBBB 3P08A 2PVRA 4FKPA 4WHZA 5EHLA 3R6XA 3NYOA 2ZV2A 3D0EA 3OOGA 5M4IA 1YOJA 3H0ZA 4S33A 4KIOA 3MY0A 5T68A 5AWMA 2C0TA 4FKJA 4YLLA 4KIKB 4IVCA 4W8EA 1J3HA 3LQ8A 4EH3A 4E6CA 5HGIA 5ANDA 2X4ZA 4A07A 4EWHA 4L46A 5L8JA 3AG9A 3GVUA 4WG5A 2QCSA 2H9VA 2GNIA 2HY81 3Q4CA 2VTRA 4RZVA 3DBQA 3RTPA 4IAIA 2PVMA 3P1AA 4LUEA 4RT7A 2BPMA 2P4IA 3AC8A 3I79A 4ASDA 4Z55A 3CS9A 4QMZA 3O8TA 4RG0A 3PXFA 2CPKE 1W2CA 2CHLA 2HY0A 4YZCA 4B4LA 4ASZA 4EK6A 5FXQA 2VWXA 3RWPA 3NSZA 4KRDA 4BTFA 4FKVA 2VU3A 2C30A 5C9CA 4DFZE 4PTGA 1XQZA 2P2HA 3FHRA 2VGOA 3OT8A 2O2UA 3H30A 3FKLA 3D15A 4GU6A 3RPSA 3OXZA 4ONAA 4BVUA 1V0PA 5CS6A 4MHAA 4FMQA 5LVMA 3HLLA 5CZIA 4FKIA 3G33A 3D5VA 4CCBA 3C4FA 4EK5A 1KE8A 1ZLTA 4G9CA 2C68A 3HV5A 3WIKA 2QO9A 4F0IA 1G5SA 3P7BA 4ENXA 3JXWA 3LFSA 4PMMA 3QHRA 3R7GA 4DEEA 4O0WA 2ACXA 2ITOA 5ANIA 1KV1A 3GP0A 3HEGA 3H0YA 3SKCA 4EOMA 3VS7A 1RJBA 4KD1A 4D2TA 2UZLA 3R63A 2XJ1A 4J8MA 4MWIA 2X2KA 3FLYA 1H0WA 2YAKA 3Q9XA 2XA4A 5IUGA 3DQWA 2VWUA 3FI2A 3WF8A 4YUQA 4W4YA 4GUEA 3D14A 3G9NA 1YWNA 2F7EE 2BMCA 4KB8A 3R83A 1ZZ2A 3LFEA 4HJOA 3TNPC 4K33A 5GZ8A 3MWUA 5DIAA 4BKZA 5HNBA 3AGLA 2RF9A 2QG5A 3GI3A 4L52A 2BVAA 3RPVA 1WVYA 1BUHA 3MFTA 4F63A 4D4RA 5HQ0A 4KS8A 3MN3A 2X0GA 4Y83A 3TJDA 3NLBA 3GU7A 5EOBA 2JC6A 3RAKA 4DH7A 2PE1A 2A0CX 2R3IA 1URCA 3MTFA 1LR4A 4ZTHA 2CN5A 5JN2A 3LMGA 3CEKA 2ITTA 2OXDA 4WRSA 3MB6A 3HA8A 4QMXA 3W10A 4JBVA 3PA3A 2C47A 2O8YA 1DAWA 3LFQA 2YIYA 4M0YA 5HOAA 4AOJA 3DAJA 1ZOGA 4L45A 1DAYA 2R3KA 5J79A 3OXTA 4A9TA 5KMLA 4RIWB 4NCTA 4BHZA 3GBZA 5KMIA 4OTWA 1F0QA 4ACCA 4OTHA 3V5JA 4IANA 3DK6A 4F70A 5HO7A 3R22A 1Q62A 4PMPA 1Z9XA 4FSRA 2PHKA 1ZOEA 4FSYA 3MYGA 4IHPA 5IDNA 5AJQA 4BGQA 4OBPA 5EYCA 5AIRA 3MVMA 4U81A 3E3PA 3NUPA 2WEVA 3ENMA 3W2RA 3ZONA 4QYGA 4LUDA 3VS2A 4F9CA 2QOBA 4LMUA 2GHMA 3V5LA 3FC2A 3GQIA 4ARKA 2RFEA 4R5SA 3F3ZA 3I6UA 5HE1A 5FEQA 3UIMA 3JVSA 2R3FA 1S9JA 4IH8A 2C3LA 2IVVA 3NIZA 4I6FA 4ALWA 2ZAZA 4BDCA 1JWHA 2PY3A 3IW6A 5BVKA 4MXXA 5K5XA 2Y6OA 4TPTA 2WQNA 1CTPE 3N51A 4RLLA 3TACA 3EH9A 4W4VA 1B38A 2QOIA 2R3QA 4CKJA 2CGWA 4FUXA 3WARA 4R6VA 1YXSA 3F9NA 3MIAA 4FTQA 4L3LA 4RIWA 3VUTA 2ITNA 1PYXA 3ZYAA 3FSKA 3GGFA 4IM0A 2YISA 5DBXA 5DR2A 3QKKA 5ANOA 4CYIA 3UMWA 5JFWA 1ZYLA 4EOJA 5DG5A 3E92A 3JY9A 1OITA 2QLUA 3P0MA 3TV6A 1KWPA 2GHLA 4JOAA 3AMBA 3EFJA 3RNIA 4RRVA 3HVCA 4BWXA 2W5BA 4EOSA 2EB2A 2PVFA 4FTJA 4HCVA 4DH5A 4A9SA 1WBNA 3PPKA 4WD5A 5F1ZA 2BRGA 4PPAA 2VTAA 4PDOA 4BYIA 4V01A 5IZFA 3QAME 1CDKA 3HGKA 1OPKA 4X6QC 3MFRA 4M12A 5AR2A 4BC6A 5KKRC 4XG2A 3ZLSA 4EWQA 5EHOA 4MVFA 4LL5A 2WEIA 3H9OA 4GK4A 2YERA 3DBEA 4FVQA 3KGAA 4QD6A 3PP0A 4MF0A 2C5VA 4RQKA 4ANBA 3D2IA 4FTTA 3BQRA 2JITA 5CSPA 3F61A 5IDPA 2G2HA 2ZB1A 3PA4A 2ZMCA 5CT0A 3WILA 3POZA 2VN9A 2JEDA 4K77A 5KMOA 4EZ7A 1U54B 2RIOA 5AAGA 3A7FA 3E64A 3D94A 1PKDA 5L6WL 2NP8A 3Q5IA 1WFCA 4ZEGA 1OECA 2HIWA 3I4BA 4LMNA 3VUKA 3TXOA 3L9NA 2C6KA 2HYYA 3NDMA 2XNBA 4XP2A 3RPOA 1PXIA 2IZRA 4UB7A 3I6WA 2V62A 5GJFA 4EHVA 4KSPA 4RVMA 1OUKA 3CLYA 3FPQA 3GT8A 4QP2A 4YO4A 4ZSJA 1KSWA 1FINA 1YI6A 5D11A 1L3RE 3JYAA 3QA8A 3F69A 3IGGA 3R73A 3AC3A 4OW8A 3RPYA 4Z9LA 4F7LA 2VAGA 3LJ0A 3QYZA 4L8MA 5AP4A 4DC2A 3LFBA 3PWYA 4G3DA 4IACA 4BZNA 5AUZA 4S34A 4FT5A 2B54A 4APPA 2A1AB 3GFWA 1U54A 3IDBA 4EKKA 4KABA 3BEAA 3B8QA 3MY1A 3MFSA 4RX8A 4K18A 4ZZOA 3R04A 1GNGA 3LPBA 3MV5A 4DEDA 3V5PA 3GCUA 2OZOA 5FG8A 5D7VA 5KE0A 2RFDA 4JAIA 4DITA 4F64A 3PYYA 2JDRA 3QUEA 1YOMA 4AZSA 2J0MB 4D1XA 2X6DA 2ONLC 5DRDA 2BHHA 2QHMA 3Q96A 5FM2A 3NAXA 4DFXE 2VRXA 2Q0NA 2E2BA 3ZZWA 4A9YA 2I0HA 2O3PA 3A4OX 2RG5A 3UC4A 3WF7A 3E88A 1E1VA 2Y6MA 3VWAA 2PK9A 4OUCA 2ERZE 3OS3A 4KIPA 2WNTA 5C8NA 3NR9A 4DEBA 4P2KA 4GYGA 2O5KA 4W4XA 4F0FA 2UZVA 3L8SA 3OW4A 4S31A 4C57A 3AC4A 4L7SA 2GQGA 3BV3A 2R5TA 4C8BA 3LHJA 3DKCA 4TZRA 2XRWA 3SLSA 2WOUA 2V7OA 1WBTA 4NJDA 3WOWA 5H3QA 3NW7A 2OZAB 2VTPA 4TRLA 4RMZA 3FZSA 3QRJA 3G2FA 4J99A 4LI5A 3UPZA 4BBEA 2WMRA 4FT7A 4RWIA 5E8WA 4ZTMA 2WIHA 5CEIA 3K3JA 1OPJA 3FBVA 5CF8A 4C33A 1TZDA 3FKOA 4FKTA 2W5AA 3KY2A 4EOQA 5CU4A 3MPAA 5KZIA 4IAKA 5BVFA 2ITPA 3D5XA 4F1OA 5EDPA 4D55A 4RWJA 3EMGA 3IW8A 4GV1A 3KCFA 4ALUA 4PNKA 5A4QA 2XIYA 2ZB0A 1GY3A 3PJCA 4FODA 2X2LA 3QU0A 4WKQA 5LWNA 4QMVA 3FLSA 2WTWA 4R5YA 3D5WA 3R02A 5HESA 3RALA 5I9ZA 4YZ9A 5KMKA 4LRJA 1AGWA 3OG7A 4QMOA 4W8DA 3CKWA 4C62A 1FMOE 2XBAA 5IH6A 4QMSA 4RWKA 4J7BA 1QPCA 3IGOA 3TIZA 1O6LA 2BRHA 2DQ7X 2VNYA 3H3CA 3H10A 5FP6A 5KMNA 2CCHA 3DPKA 4ALVA 3NAYA 2QLQA 2R3NA 5DEYA 4AT3A 4BCMA 3DGKA 2BDJA 2QOKA 3ZH8A 3ZZEA 2W05A 4A9RA 3AD4A 4AA0A 4HNIA 2QOHA 3E7VA 3DV3A 3WZEA 4FG9A 4K9YA 4MNFA 4TTHB 3G5DA 5IU2A 5EM6A 4J95A 1OB3A 2C3IB 4RFMA 4CV9A 3TTIA 1UU3A 3FWQA 3QLFA 5IH4A 3KQ7A 3ODZX 5CNNA 4A4XA 3QTRA 4LL0A 1KOBA 2ITVA 1YW2A 5HX6A 4FZFB 5J5TA 1Q41A 1STCE 3IW5A 3SDJA 4FIJA 3UP2A 4GUBA 4C61A 2C4GA 4M14A 4IB0A 2R3GA 4JR7A 3ORZA 3PWDA 2J7TA 4YBKA 2QOOA 3CQWA 3O50A 4RJ3A 2JKMA 5HVJA 4WSYA 3BELA 1IG1A 2XEYA 3KKVA 4YR8A 4H3QA 4JI9A 5EHYA 4DFYA 5KUPA 4EH7A 2W1ZA 5IMXA 5AV3A 4I3ZA 4ZTLA 3BU6A 2VX1A 4EH6A 4KBAA 4UMPA 4NT4A 4II5A 2X0QA 2F7XE 4RFYA 1M52A 3TZ7A 4FV9A 3PZHA 4MCVA 4BCFA 2W1FA 2FUMA 2IF8A 4BCOA 2OO8X 3AMAA 1FPUA 3DK7A 3ORXA 3GNIB 2VTMA 4U42A 4RJ7A 5IEVA 5M57A 2JBOA 3FXZA 2B52A 5ANKA 3PVGA 3QCYA 3K2LA 3F5XA 2WTDA 5BVEA 4O0YA 3UG1A 4AAAA 4N6ZA 4FKUA 4CTCA 3E87A 2WKMA 2C1BA 4BDFA 4YC3A 2QD9A 1OL5A 4IADA 1JSTA 2JDTA 1Y6BA 2RGPA 4GT5A 5LVPA 5JZNA 5AR7A 1VYZA 4FOBA 5CSWA 3EKNA 1H01A 1E1XA 2R9SA 4MF1A 2VTOA 4IFCA 4CQGA 4U40A 4EH2A 4NTTA 4A4OA 3LXPA 4TNBA 3I0QA 3ZS5A 3OY3A 2V0DA 4Q9SA 3W16A 1OKVA 1V1KA 5EM7A 2X2MA 3RAHA 1F5QA 3K3IA 3OCGA 3NNWA 3QTQA 3AOXA 2J51A 1NY3A 4CFXA 2WQEA 3VF9A 2OIBA 4HGEA 4OTDA 3GC7A 4KRCA 1KE6A 4O0RA 1BI8A 4R3CA 3NEWA 3CE3A 3NCZA 4TWCA 4HZSA 4CCUA 4EC8A 2FGIA 3IQ7A 3IG7A 4RBLA 1YHWA 3LFAA 5CEMA 4DTKA 4HYIA 4QP8A 3ACKA 5CU3A 2OK1A 3FLNC 3W18A 4X3JA 4YO6A 4AG8A 3PVWA 3HX4A 2ETMA 4LFIA 5BX0A 4CLJA 4HYHA 4BDHA 4LOOA 3UVRA 3P7AA 4DFNA 4QPMA 2YLEA 5IA3A 3BHHA 2I0VA 4NK9A 2F7ZE 3QUDA 5HCXA 5FWKK 1H8FA 1K3AA 1YXXA 4YC8A 4H1JA 3R7OA 3TNWA 4FNXA 5FEEA 2X39A 5CF4A 4AN3A 1T45A 4IM2A 4RVLA 4NFMA 2VX3A 5HNGA 3RK9A 3D9VA 3UG2A 2X8EA 4AZEA 3P79A 1VZOA 5BMMA 4BWPA 4E5AX 1XBAA 2GTNA 4F9BA 3LQ5A 3GC8A 4R1VA 5GZAA 3PJ8A 4LQMA 2H34A 2BUJA 3FMJA 3P5KA 4M3QA 2CDZA 4L01A 5FLFA 4EZ5A 5JRSA 4L3PA 5CEOA 4GK2A 4IDVA 4FKLA 2QOQA 3ZEWA 3ANQA 3LFDA 2X7OA 2XKDA 1OIRA 4EOOA 5EKNA 2GNFA 2YZAA 3PLSA 4LM5A 4FKGA 4BDAA 4TYIA 4JDIA 4DGMA 3F6XA 4EYMA 2V55A 4ZY4A 3VRZA 2R0UA 4O0TA 3UNJA 4DHFA 4U7ZA 4ZJJA 4MAOA 2FVDA 2E9VA 5FM3A 3UYTA 3DBCA 4E4MA 3ZLYA 5IA2A 3QUPA 3C7QA 1KE5A 2W7XA 3LOKA 4GFMA 4H3PA 4UZDA 4FV1A 3L8VA 3COIA 3KXHA 4IWPA 4I0SA 4EBWA 2BIYA 1JKKA 4Y85A 4BIBA 1FOTA 4FR4A 1DM2A 3AT3A 5AAEA 4XG4A 3SD0A 1ZY4A 4IB1A 3ZXTA 1YHSA 1XH4A 4CNHA 4IM3A 3WYXA 1H27A 2QU6A 3NW5A 4ANMA 3MBLA 2RFNA 4FNZA 4YJNA 3VJNA 4BTMA 2W0JA 4JQEA 4CTBA 5AP7A 4L7FA 4MTAA 4PUZA 4QNAA 4PP7A 3KU2A 3QXOA 3AT2A 3TWJA 3EN4A 4ID7A 4O91A 4XBRA 5LARA 1YWVA 5AUYA 3WZJA 3TN8A 4QQJA 5CYIA 4ZZMA 4R1YA 5A6NA 3ELJA 4FIHA 5HE3A 2LGCA 4XOZA 3WBLA 1WCCA 5C01A 3HMIA 2XK8A 4D4SA 2HWOA 5BUIA 4ERKA 2C6DA 4WA9A 4ANSA 1P2AA 3R8MA 3E7OA 4U43A 3PJ1A 3NS9A 4IB3A 4R8QA 3WF9A 4CKIA 3G51A 3O96A 4LV5A 2R0IA 4IJ9A 3FE3A 1P5EA 5CVFA 5TKDA 4JXFA 4D9UA 1PF8A 3QGWA 1WBVA 2EUFB 4CLIA 5AUUA 2HENA 4FSZA 2UZBA 3FMKA 3O17A 3WI6A 2VTTA 3IPHA 4E73A 5K4IA 3BGZA 4J52A 4MNEB 5CLPA 4TWNA 3BRBA 5TOZA 3Q9ZA 3ERKA 1WBOA 3FXXA 4NM3A 3ZFYA 4M66A 1Q99A 4PX6A 3UPXA 3LM0A 2UZUE 3NW6A 3W2PA 4Z16A 5CF5A 4P5QA 4AA4A 2Y4IC 4HYUA 3OXIA 4I4EA 3OOMA 4BI2A 3BQCA 4YJQA 5AUWA 1H0VA 3C4ZA 3R7EA 4C4HA 5EH0A 2Y0AA 2WTIA 4BDGA 3VHEA 2RL5A 5HBHA 1GJOA 3FXWA 4QT1A 4TWOA 4BKJA 5D10A 2P33A 3QRKA 4TYHB 3HV3A 4MD7E 3ETAA 2OW3A 4D2VA 1FVVA 1V0OA 1Y8GA 2BFXA 5J95A 3VUDA 4Z7HA 5JGDA 1CM8A 2O63A 3DLZA 4GW8A 3MS9A 3UO4A 2OU7A 1ZY5A 4HGTA 4AGCA 1GOLA 4FKSA 4MH7A 5CU2A 3I7CA 3FHIA 5CAOA 4ZTNA 5HICA 4MD8E 2IZSA 4IC7A 5HLWA 4MNEA 5DI1A 4AW5A 1PMUA 3FC1X 2R3JA 4UALA 4FNWA 2GNLA 3QD4A 5DT3A 3VF8A 5AM7A 4BF2A 5LMBA 1PXOA 1SVEA 1NXKA 4AW0A 5LJJA 1M17A 4O0XA 4MXYA 2FSLX 4S30A 5EKOA 4AXAA 2A4LA 4GK3A 5AUTA 1M7QA 5B2LA 1UNGA 4FZ6A 3FKNA 3ZSHA 3C50A 3MPMA 1I09A 4G6NA 2BALA 4HGSA 2QR8A 4IJPA 2Y9QA 3QZFA 4Y5HA 3Q2MA 2WAJA 4QMTA 2GPHA 4D0XA 1H07A 2RG6A 3I81A 2WMWA 4L6QA 4TYHA 5IA4A 4FTUA 5AP1A 2QOCA 4FOCA 3WYYA 2R2PA 3ITZA 4C3PA 3BIZA 5AV1A 3QWKA 4HVHA 2EU9A 3KCKA 2QI8A 2QO2A 1XO2B 4YHTA 5E8XA 5TO8A 2ITXA 5M51A 1QPDA 5LMKC 1W82A 3KF7A 3MH0A 1Q4LA 2ONLA 1Q61A 3GOKA 4F4PA 3QCXA 3TNHA 3ORTA 5JQ8A 3JUHA 3V51A 2AYPA 2GDOA 4Y73A 2YIWA 4QTEA 2ZV8A 2CMWA 5H2UA 2OFVA 3F5PA 3SW7A 2HAKA 3DCVA 3GC0A 3FMHA 4PDSA 4CMTA 4OTQA 3KRRA 4RZWA 5HU9A 5CSHA 3LFNA 5ICPA 4MX9A 3HRBA 4AW2A 1NVSA 3ZXZA 3F88A 4X2FA 4F7SA 2AQXA 2UW7A 4IX5A 4YU2A 2OF4A 4EKLA 2QONA 3VUHA 2C3KA 3NPCA 3F2AA 5ACKA 3DBFA 1H26A 5JMSA 4BWKA 2ITQA 4KIKA 4D2SA 5AA8A 4W4WA 4CRSA 1A9UA 3GCPA 3VW8A 2AC3A 4ZJVA 2WO6A 4D4YA 3QTZA 2B9IA 4I5MA 4N0SA 3S3IA 4E4NA 4C59A 2X81A 4QP3A 4O4FA 1GAGA 3OCTA 3KK8A 3BYMA 4NTSA 2HOGA 3THBA 2QHNA 2IZTA 3QTXA 4K1BA 1XH6A 4UY9A 3IS5A 5DWRA 3SXRA 2YITA 4EHZA 2YFXA 3Q4TA 2W1DA 3N9XA 4J1RA 5K5NA 4CMUA 1U46A 4NW5A 1Y91A 3BPRA 4U3ZA 1Q24A 1ZMUA 2XIRA 4G6LA 4GG7A 4RIOA 3R0TA 3ACJA 1ZMWA 2JGZA 4TW9A 3CIKA 1BYGA 4AOIA 5DMZA 3TZMA 3WZUA 4TT7A 3F3WA 2WTKB 5HG5A 4EL9A 2HCKA 3BGQA 4XLVA 4JIKA 4HVIA 4E6DA 4AU8A 2BDFA 2XYNA 5HIEA 3OF0A 2W1IA 5L8KA 3QRTA 4FGBA 3PRFA 4HPUE 2NO3A 4LOPA 5C8MA 5JFVA 5BMSA 4RVTA 4G34A 3HNGA 5HKMA 5I9XA 3DKOA 3MJ1A 1AQ1A 4YSJA 3VS1A 4KKEA 3QLGA 1RW8A 1Q8YA 5F95A 4WOVA 4YTHA 2XJ0A 5L6PA 1PHKA 3QCSA 4UBAA 4F0GA 3OW3A 2FYSA 2KTYA 3VC4A 3VBWA 3IDCA 2J6MA 2UZDA 3OUNB 5DA3A 3T3VA 2F49A 1UVRA 5HCYA 4F6SA 5L2TA 4L44A 4GIHA 2XVDA 5JGBA 1R3CA 4AFEA 3ULZA 1JPAA 5CU6A 3JVRA 3TKIA 2EVAA 1R39A 3IECA 2IN6A 2QKWB 5ITAA 4TYEA 2BZIB 4M69B 4UV0A 3LW0A 5B2MA 3QC9A 3DDQA 3GENA 3TV4A 3DJ5A 4JS8A 4CD0A 4C2VA 3CCNA 4MKCA 2VO7A 5TR6A 3UOKA 3NUUA 1U5QA 3FQHA 3QD3A 5CAQA 3C51A 2W4KA 4UMRA 4JDHA 4I92A 3B2TA 4ASXA 2W4OA 2X4FA 1ZRZA 3EIDA 3BE9A 2ITZA 4QTBA 4H58A 4W9WA 4DGOA 3EQBA 3HZTA 1VYWA 2X6EA 3ORPA 4JR3A 4PDPA 2IW9A 4FYNA 4AT5A 2W1CA 4HVSA 1FQ1B 4J96A
chains in the Genus database with same CATH topology
2A98A 2AQXA 2X0PA 1W2DA 4O4DA 4FRFA 4O4BB 1W2CA 2X0OA 1W2FA 4O4FA 2IEWA 4O4CA 1TZDA 2IF8A 2X0QA 4O4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A98 A;  2AQX A;  1W2D A;  4O4D A;  4FRF A;  4O4B B;  1W2C A;  1W2F A;  4O4F A;  2IEW A;  4O4C A;  1TZD A;  2IF8 A;  4O4E A; 
#chains in the Genus database with same CATH topology
 3UYS A;  4HVG A;  3C13 A;  5AR4 A;  4C3F A;  5KBQ A;  4GJ3 A;  3DKF A;  4R3R A;  4U79 A;  5GJD A;  4PPB A;  3KMW A;  4E4L A;  3NGA A;  3HYH A;  5BVD A;  2A19 B;  2XKE A;  4O22 A;  4XV3 A;  3EZR A;  2GS2 A;  2JLD A;  1ZYD A;  1K9A A;  2YJR A;  3U9N A;  1XBB A;  4IX6 A;  2X0O A;  1W0X C;  1XHA A;  3Q3B A;  3R21 A;  5CEN A;  5ANE A;  3HUC A;  3RCJ A;  4JQ8 A;  5E8U A;  1CKP A;  3E8N A;  4M69 A;  3EQH A;  3ZO2 A;  4ACH A;  3CC6 A;  3ZBX A;  2PMO X;  2BAQ A;  3SXF A;  5FQD C;  4IBM A;  3HEC A;  5HO6 A;  4GEO A;  1TVO A;  1M7N A;  2I40 A;  3VQU A;  2VO3 A;  4FSW A;  1XWS A;  4M0Z A;  4BYJ A;  5A9U A;  2ZM1 A;  3H9F A;  4IXP A;  4IC8 A;  5BUE A;  2X8D A;  1GZN A;  2DS1 A;  3AXW A;  3KMM A;  3V5W A;  1URW A;  5DFP A;  4FF8 A;  3CR0 A;  4JBO A;  5EW9 A;  1FVT A;  1H24 A;  2GFS A;  3Q60 A;  3SAY A;  3W2C A;  4E6A A;  2DYL A;  4JVG A;  1J1B A;  3RZF A;  4FZA B;  4GL9 A;  4AN9 A;  3I7B A;  2OKR A;  4E20 A;  3O2M A;  5G6V A;  4F9Y A;  2QR7 A;  2P0C A;  4MED A;  5A4E A;  3QQF A;  3FYJ X;  3MDY A;  5HTB A;  3ZMM A;  3A7G A;  4D1S A;  3R8P A;  3PSC A;  1OGU A;  4YP8 A;  4IW0 A;  3LCK A;  3COK A;  4RA4 A;  1QPJ A;  4KAO A;  5IA1 A;  4EOK A;  4EUT A;  3IOK A;  1JLU E;  2CGU A;  3R30 A;  4NH1 A;  1JQH A;  3BYU A;  3LE6 A;  4X6R A;  3E63 A;  3C0H A;  2IEW A;  3M2W A;  1P4F A;  4EH8 A;  2PE2 A;  1KE7 A;  2VWB A;  4EBV A;  1IR3 A;  3RP9 A;  5AV4 A;  5HCZ A;  3OC1 A;  3ZLW A;  3KVW A;  3R9N A;  3NIE A;  3PG3 A;  3U8W A;  5HBJ A;  2C0I A;  3UJG A;  2HXQ A;  1GIJ A;  2JD5 A;  4EH5 A;  3ZC5 A;  2WMV A;  3NUN A;  3OBJ A;  3GCQ A;  4TN6 A;  1ZXE A;  3HV7 A;  3OWP A;  3EQG A;  3R9O A;  1SVG A;  3SV0 A;  5HX8 A;  3ANR A;  2OJI A;  3C4C A;  5HIB A;  4RGJ A;  1W84 A;  4X2N A;  1WVW A;  4BCK A;  4IWQ A;  4NUS A;  4GYI A;  2Q0B A;  4XEY A;  3BLR A;  2YM4 A;  1UU8 A;  1LUF A;  4BGG A;  1YDT E;  2F4J A;  4PP9 A;  3QFV A;  4QP9 A;  5DEW A;  3QQH A;  1W98 A;  2XNO A;  2PL0 A;  4FL1 A;  1WAK A;  5EW3 A;  2V22 A;  4QTC A;  4FIE A;  2XCH A;  4AZT A;  2UVX A;  2WXV A;  4QPS A;  4Z7G A;  1PW2 A;  3A8X A;  3ZM4 A;  2GHG A;  1OKZ A;  2XEZ A;  2GMX A;  3F7Z A;  3Q32 A;  4PL5 A;  2ZM3 A;  2WFY A;  1GII A;  3A7I A;  1WMK A;  3QTU A;  4KBK A;  3VW6 A;  3W1F A;  5KO1 A;  2BDW A;  2OGV A;  3V8T A;  4ZSL A;  3F2N A;  3ZRM A;  1ZYC A;  4DG2 E;  5ANJ A;  4PPC A;  4CQE A;  3GB2 A;  3FMD A;  1UKH A;  1IRK A;  2KUL A;  4NZW B;  3MB7 A;  3M42 A;  4OBO A;  4IVD A;  5D41 A;  5DGZ A;  1J1C A;  2J4Z A;  2ITW A;  2OF2 A;  4CZY B;  4ZZN A;  5T3Q A;  5CU0 A;  4PTC A;  4WSQ A;  4PNI A;  1M2P A;  4HZR A;  4MXO A;  3VS6 A;  2QOF A;  2Y4I B;  3BGP A;  3P7C A;  3QGY A;  3ZDI A;  3RPR A;  4QYF A;  2UW6 A;  4TY1 A;  3U4U A;  3KEX A;  4GII A;  4WNO A;  4AGU A;  3WF5 A;  4BDK A;  4FX3 A;  4HGL A;  4J53 A;  5DT0 A;  4YJR A;  3LXL A;  4RA5 A;  4AF3 A;  4ASE A;  2J50 A;  3BBW A;  2V5Q A;  5AEP A;  3LM5 A;  1P4O A;  4UX9 A;  5HLN A;  2QOD A;  3TZ8 A;  3AC1 A;  3T9I A;  1REK A;  3TG1 A;  5IA5 A;  3UDB A;  3E62 A;  2OJF E;  4CT2 A;  5KBR A;  3LZB A;  4X21 A;  3BKB A;  5AP3 A;  2BTS A;  4BIC A;  4LRM A;  4AT4 A;  4IDT A;  2J0L A;  5IIS A;  3CXW A;  4EZ3 A;  2VWY A;  3UP7 A;  3ZFX A;  3QZH A;  2YM6 A;  4FSQ A;  2WHB A;  2FSO X;  4I94 A;  4BRX A;  2WMA A;  5A4T A;  4USE A;  4QML A;  5E7R A;  5C27 A;  3FYK X;  2GNG A;  4I1Z A;  3LCO A;  4PL4 A;  3TIY A;  4F09 A;  4NM7 A;  2VTL A;  1SVH A;  4ZP5 A;  2OSC A;  2XBJ A;  5CAV A;  3CTH A;  4GG5 A;  4O21 A;  4ERW A;  2JIU A;  4FIC A;  4G3E A;  5J5S A;  1ERK A;  2C6E A;  4GMY A;  4RX5 A;  2OZA A;  3QWJ A;  3ORL A;  4M68 A;  3G6G A;  2QUR A;  4DH3 A;  2ZDU A;  4BCG A;  3OWL A;  2WTC A;  3Q6U A;  5GZ9 A;  5IA0 A;  5L3A A;  4A4L A;  3LJ1 A;  3G0F A;  5ETI A;  2NRU A;  4BTK A;  4ZXT A;  5DH3 A;  1YI4 A;  4KIQ A;  4KNB A;  4UXQ A;  2XK9 A;  4GH2 A;  5IEY A;  1OMW A;  3MA6 A;  2OI4 X;  5E92 A;  5FBO A;  4IIR A;  5HVK A;  5G1X A;  1LEW A;  4FZD B;  2JBP A;  3RBW A;  4WIH A;  4C4F A;  4FV0 A;  2B7A A;  2BRM A;  2G15 A;  3MVJ A;  3S4Q A;  5BUJ A;  3HV6 A;  2W1G A;  4AGW A;  3QRI A;  2WPA A;  5L2I A;  4WO5 A;  3HV4 A;  5AR8 A;  3K5U A;  2FA2 A;  4YNE A;  5DNR A;  3R9D A;  2B1P A;  5I9U A;  5LOH A;  1XH8 A;  4DG3 E;  1LP4 A;  4I20 A;  1WBP A;  4YNO A;  2WTK C;  4BCI A;  2YM7 A;  4USD A;  2OJG A;  3UTO A;  3BHV A;  1UU7 A;  4Q9Z A;  4JNW A;  5LVO A;  4FIF A;  3G90 X;  4O0V A;  3ZLX A;  3DLS A;  4CYJ A;  3BLH A;  3B8R A;  2Y7J A;  1U59 A;  4EJN A;  3RJC A;  1JKS A;  1M2Q A;  1ZAO A;  2QKR A;  4K8A A;  3S95 A;  4P7E A;  4M15 A;  3VBV A;  3Q9Y A;  4AE6 A;  4K11 A;  4KS7 A;  3LCT A;  3TJC A;  5J1W A;  3DQX A;  4GCJ A;  5J87 A;  5AV2 A;  4ZSG A;  4AWI A;  4GJ2 A;  1PXJ A;  3KN6 A;  4IZ7 A;  3OEF X;  4TWP A;  3JPV A;  4C02 A;  3OP5 A;  3VBT A;  4KKH A;  2WOT A;  1Y6A A;  4NKS A;  2R3P A;  2OG8 A;  2XCK A;  3PY1 A;  3II5 A;  3ZHP C;  5LMK A;  5EYD A;  4BBM A;  1OUY A;  2W9Z B;  3KC3 A;  2PVL A;  3OD6 X;  1H1S A;  1YHV A;  2VTH A;  4QTD A;  4DEI A;  4O2Z A;  3FDN A;  3ORO A;  4IAZ A;  4RJ8 A;  4YTC A;  3CD8 A;  1W8C A;  2W1E A;  4RX7 A;  4Y5Q A;  5CSX A;  3FQS A;  4TND A;  3QX4 A;  4IAF A;  3ORK A;  3TEI A;  1RQQ A;  3DNE A;  4F1M A;  5J8I A;  5CVG A;  5B2K A;  3F3U A;  4FTC A;  2YHV A;  4IAY A;  5JFX A;  3VVH A;  2OXX A;  4XMO A;  1H1R A;  2XMY A;  4FV2 A;  4MYG A;  4X3F B;  4C0T A;  5FXS A;  1YRP A;  4I5H A;  3SRV B;  3A7J A;  3DK3 A;  4F65 A;  5IUI A;  4R7H A;  3I60 A;  4NFN A;  4C4I A;  4KBC A;  3QTI A;  4EEV A;  4UWY A;  4RJ6 A;  2UW4 A;  3PA5 A;  1H4L A;  4QP4 A;  3ION A;  3R8Z A;  4EQC A;  2C5Y A;  1PXP A;  3HMO A;  3AGM A;  3CQE A;  3EN5 A;  3PVB A;  5JH6 A;  4APC A;  4O27 B;  5AA9 A;  4QMN A;  4W9X A;  2J0J A;  4QO9 A;  5B7V A;  3W32 A;  4EH4 A;  1OIQ A;  5AP0 A;  4FKQ A;  1VEB A;  3V6S A;  5F20 A;  5LVL A;  3ZO1 A;  2Y4P A;  5AX3 A;  3CTQ A;  1X8B A;  2VWW A;  4OT5 A;  4D1Z A;  1S9I A;  4FBX A;  3U9C A;  4FL3 A;  4O1P A;  5F9E A;  4CT1 A;  4QMP A;  4V0G B;  3ENH A;  1E9H A;  4MXZ A;  4YJO A;  3EFK A;  4JJR A;  3VS0 A;  2PZP A;  2PMN X;  4J71 A;  2VTN A;  2J0K A;  2RSV A;  4RIX B;  1OM1 A;  4P90 A;  4WRG A;  4AN2 A;  4EK4 A;  3SRV A;  2R3H A;  3CQU A;  2YJS A;  4I6B A;  4IFG A;  3PIZ A;  1CKI A;  3W33 A;  4EOL A;  1UU9 A;  4QP6 A;  1BX6 A;  2RFS A;  3R8U A;  4MBJ A;  3ALN A;  3KN5 A;  2PZY A;  2PTK A;  4YJP A;  2JAV A;  5DOS A;  3UOJ A;  4QTA A;  3QQK A;  5FDX A;  5FTQ A;  4FG8 A;  1PXN A;  5KMJ A;  5DRB A;  2X0P A;  3GU8 A;  4FUY A;  4TKS A;  1AD5 A;  3HRC A;  4HW7 A;  4XNE A;  1ZWS A;  4X2J A;  1Z57 A;  3DFA A;  4EYJ A;  3QA0 A;  1TQM A;  4XOY A;  4L43 A;  3F3V A;  3FZ1 A;  4FTO A;  5B0X A;  2YCQ A;  4ZTQ A;  3FY0 A;  5CY3 A;  4B8L A;  1DI9 A;  5KZ0 A;  5JEB A;  4V0G A;  1HOW A;  2ZYB A;  4CSV A;  4DBN A;  3A60 A;  4FT0 A;  1NA7 A;  4I6Q A;  4K2R A;  2XNN A;  4FTM A;  3R7I A;  4OLI A;  4U6R A;  4HOK A;  3EQI A;  5EOL A;  4RIX A;  4AZV A;  2WB8 A;  2Z8C A;  5CQW A;  4B6L A;  1H25 A;  4ZS0 A;  3EYG A;  4FZ7 A;  4DN5 A;  4L67 A;  2WU7 A;  2FB8 A;  3RZB A;  3QXP A;  4FII A;  1H1W A;  3PXY A;  1ZYS A;  5EYM A;  2JDS A;  1H28 A;  1GZ8 A;  2WTJ A;  4YLJ A;  3OBG A;  5M55 A;  3VUI A;  4ZSA A;  3FV8 A;  4G31 A;  4CMO A;  3RGF A;  4ZK5 A;  4H39 A;  1BI7 A;  4FKW A;  3C4W A;  4CZU A;  5LQF A;  2C0O A;  3COM A;  1U4D A;  4FST A;  4AFJ A;  5I9W A;  5E1E A;  3DZO A;  4LV8 A;  5EI2 A;  3QRU A;  3PSD A;  3FI4 A;  2WQO A;  3SQQ A;  3RWQ A;  3WE4 A;  4AAC A;  4TYG A;  5T6K A;  5CTP A;  1BKX A;  3FLW A;  1P14 A;  2ZV7 A;  3G0E A;  4EQM A;  3EN6 A;  1SMH A;  4ZSE A;  5ETF A;  4DEG A;  4CXA A;  4C37 A;  4EH9 A;  5AX9 A;  3NZ0 A;  4GSB A;  4A9U A;  3F5U A;  1QMZ A;  4NEU A;  2SRC A;  1IA8 A;  2FH9 A;  5M4U A;  5AR5 A;  2NPQ A;  1RDQ E;  4LGH A;  1SNU A;  4QMM A;  3FQE A;  2H96 A;  4EOP A;  3VQH A;  4K6Z A;  3F5G A;  4YC6 A;  5HG8 A;  5D12 A;  3MW1 A;  3ORI A;  4NWM A;  1Q8T A;  5KX8 A;  1YXU A;  4BDE A;  1OIY A;  3W8Q A;  4O4B B;  3OFM A;  4XV1 A;  3TNQ B;  4BCN A;  3UZT A;  4BDI A;  4Q5E A;  3NYX A;  3RMF A;  5IME A;  5HE2 A;  4O0S A;  1ATP E;  4G5J A;  5A14 A;  2I6L A;  5AM6 A;  1OL1 A;  4KKG A;  2PUU A;  3PJ2 A;  4CKR A;  2OIC A;  3NRM A;  3HDN A;  2XH5 A;  4RC2 A;  3IDP A;  3KRJ A;  4ACG A;  3GCS A;  3MY5 A;  4BBF A;  1O6Y A;  3D7Z A;  3ORM A;  1PME A;  5E8Z A;  1YWR A;  3NNV A;  4M7I A;  3VBX A;  3ZFM A;  3M11 A;  4DGN A;  5CVH A;  5H8E A;  2YAC A;  3EN9 A;  2ITU A;  3I0O A;  3C5U A;  4O6E A;  4AOT A;  1HCK A;  5LCK A;  3LXN A;  5F4N A;  5E8Y A;  2A27 A;  1O6K A;  1Y8Y A;  3PXQ A;  4M8T A;  4CVA A;  4E8A A;  1PYE A;  4AUA A;  2FO0 A;  4Y72 A;  5JT2 A;  3C9W A;  2WIP A;  2R7B A;  3HMM A;  3E5A A;  2EXM A;  3ZO3 A;  2EWA A;  3EFW A;  2C5X A;  1B6C B;  5KNJ A;  4FNY A;  1Q5K A;  3OEZ A;  2YDI A;  4JL9 A;  3DND A;  3GCV A;  3KRL A;  3P9J A;  4XUF A;  3Q04 A;  4F08 A;  5EYK A;  3EYH A;  2VWI A;  2YM3 A;  4AGD A;  3F7W A;  3C4X A;  4U45 A;  5K4J A;  2I1M A;  5L2S A;  4OAV B;  1Q97 A;  3BE2 A;  2BIK B;  1OL6 A;  2BAK A;  4JRN A;  2X1N A;  2AUH A;  2BAJ A;  4EK3 A;  2VTJ A;  1R1W A;  4AZF A;  3RVG A;  4ZAU A;  4JT3 A;  5CT7 A;  4GT4 A;  3NYN A;  3BHT A;  1WVX A;  3R7Y A;  4L68 A;  4BFM A;  4OTF A;  3VN9 A;  3L8P A;  5AMN A;  2F2U A;  3O71 A;  2HEL A;  2GTM A;  2E9P A;  5D7A A;  4DAW A;  3ZRK A;  4WUN A;  3UIX A;  2GSF A;  1QPE A;  4AW1 A;  5CEK A;  3R7U A;  2J2I B;  5I3O A;  4JDJ A;  3CGF A;  3HMP A;  4FV6 A;  4G2F A;  5A46 A;  4L3J A;  3FLZ A;  5H9B A;  5LXM A;  3VS5 A;  4FTL A;  1J91 A;  5CI7 A;  3ULI A;  4UWC A;  2X7G A;  3D83 A;  3EHA A;  2YCR A;  3QF9 A;  2NRY A;  2BFY A;  3RNY A;  4FVR A;  2JII A;  5K9I A;  5I3R A;  5CAN A;  3I5N A;  4IAA A;  1IEP A;  2F57 A;  5I4N A;  2Y8O A;  4ZLO A;  3S1H A;  4Z3V A;  1PMV A;  1H1Q A;  1YXV A;  2UUE A;  2BRO A;  3EZV A;  3O51 A;  4G5P A;  4E4X A;  3I5Z A;  4BZO A;  5A54 A;  2P2I A;  3EQC A;  3ZOS A;  4F9A A;  3QC4 A;  4IX4 A;  3KRX A;  4MBL A;  4OTG A;  2YAA A;  4P5Z A;  3Q6W A;  5HI2 A;  4G9R A;  5ETA A;  5HZN A;  1OKY A;  3CBL A;  3V3V A;  3FZT A;  3GEQ A;  3KXG A;  4H36 A;  1SZM A;  4TXC A;  3RHK A;  3V5T A;  3Q5Z A;  3OMV A;  4XV2 A;  3QTS A;  4FV7 A;  4UZH A;  3P4K A;  4I4F A;  3ODY X;  3P86 A;  4O4D A;  2CGV A;  4ENY A;  4WT6 A;  4IX3 A;  4OTR A;  4V05 A;  3UOD A;  3VID A;  2VZ6 A;  4WBO A;  2J0I A;  4FTA A;  5BYZ A;  4C3R A;  1V0B A;  3HP2 A;  3LFC A;  4B99 A;  3RIN A;  4E5W A;  4AX8 A;  3FJQ E;  2C3J A;  4BTJ A;  5EG3 A;  2WQM A;  5CAS A;  5JKG A;  2H8H A;  1EH4 A;  3BCE A;  4OTI A;  4E1Z A;  3UBD A;  3ZUU A;  4PMS A;  4BID A;  2GU8 A;  5J7H A;  4B9D A;  3E93 A;  2UZN A;  5JQ5 A;  3MFU A;  3KVX A;  4IE9 A;  4FT9 A;  1CSN A;  4X3F C;  1FGK A;  4D4V A;  4KIN A;  5F94 A;  3OT3 A;  2FSM X;  5E8S A;  4GU9 A;  4AQC A;  4ZLZ A;  4QQC A;  3A99 A;  3KB7 A;  1B39 A;  2B55 A;  5E90 A;  3RAW A;  4PY1 A;  3TL8 A;  4YUR A;  5IEX A;  2XYU A;  2VTI A;  5KCV A;  1YDS E;  2DWB A;  3F66 A;  3FZP A;  2G2F A;  4NM5 A;  2WMS A;  4D28 A;  3KXX A;  5HVY A;  3OWK A;  1Q3D A;  1JKT A;  1FMK A;  2E9U A;  2XNM A;  4DH1 A;  5A4L A;  4R7I A;  1PXL A;  1UV5 A;  3AT4 A;  3PUP A;  4JG6 A;  4FKR A;  4S2Z A;  4H1M A;  4L42 A;  3UGC A;  1KOA A;  1FGI A;  3ZDU A;  1FVR A;  4L00 A;  4RWL A;  5DE2 A;  4U3Y A;  3U6I A;  2PZR A;  4C35 A;  4C36 A;  4RC3 A;  1GZO A;  2X9F A;  4DLI A;  4MQ1 A;  2BR1 A;  3C4E A;  3GU4 A;  4PQN A;  5HID A;  3CD3 A;  4M13 A;  3LXK A;  3UNZ A;  4XLI A;  5BQ0 A;  2VV9 A;  2IO6 A;  3VO3 A;  1OPL A;  2WU6 A;  2GCD A;  3P78 A;  4XX9 A;  3TV7 A;  5J9Z A;  2OJJ A;  1XH9 A;  1DS5 A;  1PY5 A;  1ZYJ A;  3ZBF A;  4G3C A;  5L2Q A;  3HA6 A;  5I9Y A;  1OI9 A;  4ZOG A;  3FUP A;  2BRN A;  4BDB A;  1A06 A;  5DVR A;  3RK7 A;  4H3B A;  3VS4 A;  5HO8 A;  3TUD A;  4CFW A;  3DAK A;  3C0G A;  3U87 A;  4FI1 A;  1ZMV A;  2E9O A;  3HMN A;  4BZD A;  3U6H A;  3FMM A;  1WZY A;  4OGR A;  4X2K A;  4CFU A;  2BCJ A;  3C1X A;  3E3B X;  4IB5 A;  3VUL A;  3PIX A;  5HLP A;  5LMA A;  1BMK A;  3H9R A;  2UVY A;  2VWV A;  2HZI A;  2B9J A;  2WQB A;  3DU8 A;  2R64 A;  4N4S A;  4BCJ A;  3O7L D;  4JBQ A;  2UVZ A;  4UMQ A;  2C6L A;  1H00 A;  4IMY A;  2HZ4 A;  4FTN A;  5AP5 A;  4OR5 A;  3PG1 A;  4QP1 A;  2QQ7 A;  3BU5 A;  4QRC A;  4FSM A;  2CGX A;  4O4C A;  5ETC A;  2V7A A;  2Z2W A;  3BV2 A;  4PTE A;  4EHG A;  3FMN A;  4FV8 A;  4Y8D A;  4A06 A;  3FZR A;  3V8W A;  1ZOH A;  4MQ2 A;  1MRV A;  2YM5 A;  5M4C A;  4JDK A;  4BGH A;  1IAS A;  3FL4 A;  3HL7 A;  3DTC A;  5IPJ A;  1OIU A;  2ZVA A;  4ITJ A;  4FTR A;  3TT0 A;  3OCS A;  5HE0 A;  3TUB A;  1MUO A;  3DJ6 A;  3FML A;  4D5K A;  5EK7 A;  2XM9 A;  3K54 A;  4ACD A;  4ITI A;  1CKJ A;  3HP5 A;  5FP5 A;  3SOA A;  3ZRL A;  1W2D A;  3BI6 A;  1JVP P;  3NUS A;  4O38 A;  5DHJ A;  4I93 A;  5C03 A;  3HKO A;  1TQP A;  2VNW A;  3B2W A;  3PE2 A;  2O0U A;  2R3M A;  4QQ5 A;  4D2P A;  4JIA A;  5LVN A;  3DOG A;  3O23 A;  4IVB A;  4NJ3 A;  2W5H A;  4JG8 A;  1Q8U A;  3VAP A;  5H8B A;  3UNK A;  3IOP A;  4BN1 A;  2EXE A;  2XKF A;  3ET7 A;  2C5O A;  3O8U A;  3PP1 A;  3R28 A;  4PL3 A;  4O0U A;  3OTV A;  2VWZ A;  4WG3 A;  3OVV A;  3UC3 A;  5BVN A;  3TNI A;  4YLK A;  3UOH A;  3L9M A;  2O65 A;  3SVV A;  3MA3 A;  4XG3 A;  2OH0 E;  3CPB A;  4F6U A;  3DTW A;  4AE9 A;  1UNL A;  3V04 A;  2UW5 A;  2UZO A;  4C34 A;  5E8T A;  2BZK B;  1I44 A;  4IZ5 A;  4IZA A;  3R9H A;  4XCU A;  3UIU A;  1OZ1 A;  3DAE A;  4YJU A;  2JDV A;  2JKO A;  3EN7 A;  4J97 A;  4KA3 A;  2XIK A;  2C5N A;  4ANO A;  5JGA A;  3MSS A;  1G3N A;  1UNH A;  5AAD A;  3BU3 A;  3MVL A;  2YLF A;  3JY0 A;  4QYY A;  3C0I A;  3SW4 A;  3A61 A;  4O6L A;  4AS0 A;  4ZLY A;  3HRF A;  2PSQ A;  5KHX A;  5M4F A;  2ZDT A;  3HDM A;  4XS2 A;  4CFF A;  1YVJ A;  4DG0 E;  3CP9 A;  3GQL A;  4YTI A;  3MTL A;  4OT6 A;  2HK5 A;  4I21 A;  2YCS A;  2IVS A;  4I0R A;  3Q52 A;  4JAJ A;  2W06 A;  3IW4 A;  4U41 A;  4X0M A;  4R3P A;  2G2I A;  3RAI A;  3R2Y A;  5HOR A;  3QCQ A;  2CSN A;  5HU3 A;  3EWH A;  3DJ7 A;  5L8L A;  5I5Z A;  4WNP A;  2REI A;  5BVO A;  3QL8 A;  2VTQ A;  4E6Q A;  4ITH A;  2XS0 A;  3QAL E;  5AV0 A;  4UYA A;  3GU5 A;  5J7B A;  2W9F B;  1LPU A;  4J8N A;  1M2R A;  1U5R A;  2AC5 A;  5DN3 A;  4YJT A;  3BX5 A;  4B7T A;  5FXR A;  2W1H A;  2YCF A;  5HBE A;  3BEG A;  5HEZ A;  4QYE A;  1UKI A;  3QD2 B;  3ZUT A;  4MWH A;  2XF0 A;  1NVR A;  4QNY A;  4PWN A;  3LVP A;  3E8D A;  3A7H A;  4GFG A;  5AP2 A;  5D1J A;  3PRI A;  4I22 A;  1ZZL A;  5ACB C;  5GJG A;  4D58 A;  1YQJ A;  3DXN A;  3OCB A;  2B9H A;  3DA6 A;  3DFC B;  4JLC A;  5CX9 A;  2E9N A;  5IUH A;  5HD4 A;  1MQB A;  1XH5 A;  2X8I A;  2RKU A;  4FYO A;  1W7H A;  5KMM A;  4FIG A;  3ZTX A;  4TL0 A;  2JFL A;  4XG6 A;  4U80 A;  3MGY A;  3TKU A;  2YA9 A;  2YAB A;  3EKK A;  1T46 A;  3QHW A;  4MXC A;  3VHK A;  1JSV A;  2UW8 A;  3W2Q A;  4IZY A;  2XNP A;  4GVJ A;  2CKE A;  4UXL A;  2OH4 A;  4WNM A;  4QMY A;  4O96 A;  4YSM A;  5EFQ A;  5FED A;  1PJK A;  4F6W A;  1OL7 A;  3LJ2 A;  3UIB A;  4I24 A;  3KRW A;  2OJ9 A;  2VTS A;  3NNU A;  4Y46 A;  1VJY A;  2BZJ A;  2YM8 A;  5AUX A;  4RC4 A;  4JRV A;  1CMK E;  4FG7 A;  5E91 A;  2XK7 A;  2PVK A;  3P23 A;  1WBS A;  3Q4Z A;  5CI6 A;  4FK3 A;  5FTO A;  5JK3 A;  1R78 A;  5M56 A;  3OTU A;  2YDJ A;  3ZUV A;  2PVJ A;  4BL1 A;  3DB8 A;  4FK6 A;  5EDR A;  4DYM A;  2ZV9 A;  3MH1 A;  2X7F A;  3I1A A;  3DBD A;  3KXM A;  3OWJ A;  3WF6 A;  3DS6 A;  3BYO A;  1JNK A;  3BHY A;  2XIX A;  2XK3 A;  3KA0 A;  4FV5 A;  3V6R A;  3LCS A;  3W55 A;  3D4Q A;  3RKB A;  3AQV A;  3BLQ A;  4LG4 A;  4DGL C;  5BYY A;  2P3G X;  2JFM A;  2WMB A;  5K0X A;  2YIX A;  2IVU A;  2UZT A;  3UO5 A;  2G1T A;  1DI8 A;  5CWZ A;  4RX9 A;  4X7Q A;  1YI3 A;  4E3C A;  5C26 A;  4X2G A;  4XHK B;  4BI0 A;  3RM7 A;  4YHF A;  4RPV A;  2IW6 A;  4XH6 A;  3NUX A;  3GC9 A;  4IWD A;  3BYS A;  1BLX A;  1H08 A;  2Z60 A;  2R4B A;  1PKG A;  4G3G A;  2EXC X;  3G6H A;  3UQG A;  2PZI A;  2UV2 A;  4JQ7 A;  2Z7L A;  5IH5 A;  1MRU A;  1OKW A;  4FKO A;  5DPV A;  1H1P A;  2PVH A;  3CTJ A;  4YMJ A;  4WG4 A;  4KWP A;  2I0E A;  3PVU A;  5HNI X;  4HYS A;  3U51 A;  3WZD A;  3POO A;  2X9E A;  3QQL A;  3DB6 A;  5CZH A;  4ANQ A;  4XRJ A;  4BB4 A;  4CFV A;  4ZY5 A;  4MK0 A;  5A6O A;  3DY7 A;  1OVE A;  5BPY A;  2JKK A;  4YZD A;  3QX2 A;  4ACM A;  1YDR E;  2BZH B;  4G16 A;  4MBI A;  1JSU A;  2QVS E;  4BCP A;  2QO7 A;  5CF6 A;  1JOW B;  2OID A;  3EJ1 A;  1W2F A;  4XV9 A;  4YJV A;  3LLT A;  3T3U A;  3OUK A;  5L6O A;  5BVW A;  3NWW A;  4PRJ A;  5FDP A;  5EDQ A;  3VRY A;  3LAU A;  3K5V A;  2OWB A;  3PXZ A;  4NKA A;  4CRL A;  2BRB A;  3BZ3 A;  4YHJ A;  3ZSG A;  1R0E A;  4S32 A;  2CLX A;  3AMY A;  3R71 A;  5DR9 A;  4Q5H A;  2XK6 A;  4IQ6 A;  2W96 B;  3ZO4 A;  4C4G A;  4EHE A;  4IWO A;  2ZOQ A;  2W4J A;  5C8K A;  4I5P A;  4V04 A;  3EL7 A;  4Q2A A;  3EQF A;  1UWJ A;  3MH2 A;  5FBN C;  3AD5 A;  5A3X A;  4HVD A;  3VS3 A;  2WEL A;  2IZU A;  2UW0 A;  3L9L A;  5J9L A;  2XUU A;  5D9H A;  3M1S A;  4UMU A;  3QZG A;  4HCT A;  4XG7 A;  2YN8 A;  2R3L A;  4FTK A;  4NCT C;  4ZIM A;  3TCP A;  3FY2 A;  2VD5 A;  2QNJ A;  1APM E;  4RIY B;  4B0G A;  4E93 A;  5JRQ A;  3F82 A;  4F99 A;  2ESM A;  5GHV A;  5I9V A;  4E7W A;  3HUB A;  4YZM A;  3TZ9 A;  2BHE A;  1F3M C;  4CFN A;  2JIV A;  3CKX A;  4D2W A;  3WZK A;  2F2C B;  2XNE A;  4YGA A;  3VUG A;  3WIG A;  5JFS A;  2C69 A;  3AC2 A;  3PPZ A;  4D2R A;  3VJO A;  3R2B A;  4ZJI A;  4BKY A;  3CPC A;  2ETR A;  3BBT B;  3BWF A;  4BCQ A;  3MI9 A;  2G01 A;  5L4Q A;  2OBJ A;  3RK5 A;  3QD0 A;  3KF4 A;  4FA2 A;  1GZK A;  3NYV A;  2FST X;  3SX9 A;  4UN0 C;  5LCJ A;  3UQF A;  2WMQ A;  5J9Y A;  1RE8 A;  2JAM A;  5C1Q B;  5IG1 A;  2G9X A;  4G3F A;  1XH7 A;  3IO7 A;  3QYW A;  4NU1 A;  2UZE A;  3OHT A;  3Q4U A;  4AA5 A;  5EM8 A;  5LWM A;  4YZB A;  4XG9 A;  1QCF A;  2EB3 A;  4RFZ A;  5E1S A;  1UA2 A;  5CQU A;  3UVQ A;  3CJF A;  3R8L A;  4YBJ A;  4OTP A;  5TT7 A;  4RIY A;  4NST A;  5CEP A;  3VUM A;  1Y57 A;  1XR1 A;  5CSV A;  3QTW A;  3PXK A;  4DH8 A;  4F7J A;  5CXZ A;  2BTR A;  3R1Q A;  4QOX A;  2PVN A;  3PY3 A;  5JSM A;  4BI1 A;  4L53 A;  5M44 A;  3QBN A;  3GXL A;  3PZE A;  4D5H A;  4N70 A;  4C38 A;  2OXY A;  2HXL A;  3A4P A;  3FSF A;  3KUL B;  3PJ3 A;  4QP7 A;  2LAV A;  3UQC A;  2UW3 A;  3OY1 A;  2XRU A;  5AAF A;  2GNJ A;  2VO6 A;  2PVY A;  2W99 B;  3Q9W A;  4PMT A;  5DLS A;  2XZS A;  3NUY A;  5AUV A;  4ZY6 A;  1JAM A;  5CAL A;  2F9G A;  1W83 A;  3IW7 A;  3PE1 A;  2YIR A;  1Q3W A;  2H6D A;  3MVH A;  3QQG A;  3UOL A;  2C1A A;  2XM8 A;  4L9I A;  2J5E A;  4M84 A;  3O8P A;  4C2W A;  4JX7 A;  3GU6 A;  4UYN A;  3IK3 A;  4XRL A;  5L2W A;  3ORN A;  3REP A;  3PTG A;  3R8V A;  2WMT A;  2WMX A;  4X3F A;  3TI1 A;  4BDJ A;  1PMN A;  3QZI A;  3KL8 A;  2J90 A;  2ERK A;  3KXZ A;  1YOL A;  4TYJ A;  1SNX A;  4BIE A;  2Z7S A;  3SC1 A;  1XKK A;  2XJ2 A;  5H8G A;  4DCE A;  5EI8 A;  4KSQ A;  3MJ2 A;  3EL8 A;  5K3Y A;  2UW9 A;  5IKW A;  3G9L X;  3GFE A;  3U4W A;  3R1S A;  1XBC A;  3EQP A;  4U97 A;  4I5C A;  3V01 A;  4FL2 A;  3V8S A;  3MPT A;  5M53 A;  3WE8 A;  4LGG A;  3GOP A;  4PV0 A;  3KUL A;  4Y95 A;  2IW8 A;  4AP7 A;  4D0W A;  3S00 A;  4GRB A;  1KE9 A;  5TF9 A;  2XKC A;  2QC6 A;  4MD9 E;  4G1W A;  2GNH A;  3SA0 A;  2VO0 A;  4GT3 A;  2CJM A;  2Z7Q A;  3AD6 A;  4FSU A;  4QMW A;  4QYH A;  2PE0 A;  2C6I A;  3UE4 A;  1TKI A;  1WBW A;  1Z5M A;  2HZN A;  3AC5 A;  2O64 A;  3FAA A;  2ZMD A;  2JDO A;  3OZ6 A;  1K2P A;  4FV3 A;  3U6J A;  4DEA A;  4WUA A;  2IVT A;  3L8X A;  5A4C A;  4IVA A;  5HTI A;  4EC9 A;  4GS6 A;  2VX0 A;  4EUU A;  5EI6 A;  2ZM4 A;  4FRF A;  1MP8 A;  4FVP A;  4I41 A;  2XNG A;  3CGO A;  5TE0 A;  2OIQ A;  4HCU A;  3R01 A;  4I6H A;  4NW6 A;  3D5U A;  4XYF A;  3W2O A;  4M67 A;  2XIZ A;  4QMU A;  4O2P A;  5JZJ A;  2HWP A;  3E8C A;  4UWB A;  4CZT A;  4U5J A;  2R3O A;  2QU5 A;  3L1S A;  1YXT A;  4U8Z A;  3RM6 A;  4FEQ A;  2C6O A;  3FME A;  3UMX A;  1O9U A;  3R00 A;  5CAP A;  4M97 A;  5CAU A;  5CXH A;  4O4E A;  5K0K A;  3S2P A;  5I0B A;  3PXR A;  2HZ0 A;  4DGG A;  2B4S B;  1JBP E;  2HW7 A;  1BL6 A;  3COH A;  4GVA A;  3EOC A;  3QQJ A;  5CNO A;  1BL7 A;  4N6Y A;  3T8O A;  3S0O A;  3KK9 A;  1Q8W A;  3FLQ A;  3R1Y A;  2YWP A;  2CN8 A;  3EFL A;  4UMT A;  4EK8 A;  4ANN A;  3O0G A;  4RJ5 A;  5EW8 A;  5GNK A;  3VBQ A;  2BKZ A;  3ROC A;  4E26 A;  3ZCL A;  4C4E A;  4EOR A;  1KV2 A;  3TUC A;  4BCH A;  2BIL B;  4XBU A;  1REJ A;  2P55 A;  4FTI A;  4FT3 A;  4YTF A;  4OBQ A;  3PIY A;  3E8E A;  2XK4 A;  3H4J A;  3LCD A;  5AIK A;  5BNJ A;  5KKR B;  2ETK A;  1SM2 A;  3DT1 A;  4JBP A;  4YPS A;  5HG7 A;  4QPA A;  4G6O A;  4D9T A;  3R1N A;  4BDD A;  3D2K A;  5E8V A;  3CY3 A;  3NX8 A;  4DEH A;  4P4C A;  2DUV A;  4YJS A;  3TKH A;  3VBY A;  3ZU7 A;  4A7C A;  3PY0 A;  2B9F A;  2CCI A;  3LIJ A;  5FD2 A;  4NIF B;  2UZW E;  3PPJ A;  4BHN A;  1MRY A;  2I0Y A;  4RQV A;  4ZTR A;  1SYK A;  2OFU A;  1R0P A;  3CY2 A;  2IWI A;  3ZC6 A;  1YKR A;  3RHX A;  3QKM A;  4E5B A;  3EB0 A;  1PXM A;  2C6M A;  4JX3 A;  5KHW A;  3KMU A;  3UZP A;  4FC0 A;  3BWJ A;  3FPM A;  4RJ4 A;  3SXS A;  1HCL A;  3NNX A;  2IJM A;  3FI3 A;  4QQT A;  4OAU C;  3EQD A;  3W2S A;  2WD1 A;  5ANG A;  4IEB A;  3W8L A;  4CV8 A;  4ZTS A;  4XP3 A;  3LFF A;  4C7T A;  3MH3 A;  3A8W A;  4HNF A;  4XP0 A;  4RLK A;  4FSN A;  1GIH A;  4I0T A;  4YPD A;  4MXA A;  3DDP A;  4XG8 A;  2GFC A;  2YDK A;  3UVP A;  2A98 A;  3DZQ A;  3BYV A;  2WGJ A;  3R7V A;  4WNK A;  4FV4 A;  4DIN A;  3ALO A;  4C4J A;  3QKL A;  5IF1 A;  2J9M A;  2XB7 A;  2VUW A;  3MIY A;  4GFO A;  2C6T A;  1UWH A;  4CEG A;  1ZAR A;  4B8M A;  1PXK A;  5DR6 A;  3KXN A;  1XJD A;  3PSB A;  3QQU A;  3D7T B;  3JS2 A;  4RVK A;  2B53 A;  4U44 A;  1VR2 A;  3GUB A;  1QL6 A;  4RSS A;  3DKG A;  2HW6 A;  4NIF A;  4NM0 A;  4O1O A;  2QOL A;  2PML X;  4CFM A;  2R3R A;  3SOC A;  3RI1 A;  2R7I A;  2PWL A;  2PZ5 A;  4EQU A;  5AP6 A;  5EM5 A;  4DFL A;  4PF4 A;  4I23 A;  4EON A;  5HG9 A;  4F7N A;  5HHW A;  2JKQ A;  2ZJW A;  3IKA A;  2W17 A;  3UO6 A;  3FL5 A;  2YIQ A;  1NVQ A;  3TTJ A;  3ZSI A;  3NCG A;  5HTC A;  4J98 A;  4YZN A;  4EOI A;  4C58 A;  3A62 A;  3ZEP A;  2WZJ A;  4ANL A;  5AR3 A;  2J5F A;  3A2C A;  4F1T A;  2XP2 A;  2WTV A;  3L9P A;  2VGP A;  4LRK A;  4AZW A;  1TQI A;  3CJG A;  1LEZ A;  4HPT E;  2YEX A;  4K0Y A;  3T9T A;  3SHE A;  2ITY A;  2PMI A;  3O7L B;  5FRI A;  4F9W A;  4USF A;  4U0I A;  1MQ4 A;  5FGK A;  2GS7 A;  3EQR A;  3KFA A;  3F3T A;  3VNT A;  3FZO A;  2A2A A;  4LGD A;  4QMQ A;  5J1V A;  3ROY A;  4EI4 A;  3BHU A;  4LYN A;  3RCD A;  3V5Q A;  4XJ0 A;  3D7T A;  4LOQ A;  1M14 A;  2Z7R A;  4DLJ A;  5DT4 A;  5HD7 A;  2WMU A;  4G17 A;  3Q53 A;  5CEQ A;  4JG7 A;  2GS6 A;  1OL2 A;  4U9A A;  3PFQ A;  4UEU A;  1JKL A;  2CLQ A;  1Q8Z A;  4WBB B;  3P08 A;  2PVR A;  4FKP A;  4WHZ A;  5EHL A;  3R6X A;  3NYO A;  2ZV2 A;  3D0E A;  3OOG A;  5M4I A;  1YOJ A;  3H0Z A;  4S33 A;  4KIO A;  3MY0 A;  5T68 A;  5AWM A;  2C0T A;  4FKJ A;  4YLL A;  4KIK B;  4IVC A;  4W8E A;  1J3H A;  3LQ8 A;  4EH3 A;  4E6C A;  5HGI A;  5AND A;  2X4Z A;  4A07 A;  4EWH A;  4L46 A;  5L8J A;  3AG9 A;  3GVU A;  4WG5 A;  2QCS A;  2H9V A;  2GNI A;  2HY8 1;  3Q4C A;  2VTR A;  4RZV A;  3DBQ A;  3RTP A;  4IAI A;  2PVM A;  3P1A A;  4LUE A;  4RT7 A;  2BPM A;  2P4I A;  3AC8 A;  3I79 A;  4ASD A;  4Z55 A;  3CS9 A;  4QMZ A;  3O8T A;  4RG0 A;  3PXF A;  2CPK E;  1W2C A;  2CHL A;  2HY0 A;  4YZC A;  4B4L A;  4ASZ A;  4EK6 A;  5FXQ A;  2VWX A;  3RWP A;  3NSZ A;  4KRD A;  4BTF A;  4FKV A;  2VU3 A;  2C30 A;  5C9C A;  4DFZ E;  4PTG A;  1XQZ A;  2P2H A;  3FHR A;  2VGO A;  3OT8 A;  2O2U A;  3H30 A;  3FKL A;  3D15 A;  4GU6 A;  3RPS A;  3OXZ A;  4ONA A;  4BVU A;  1V0P A;  5CS6 A;  4MHA A;  4FMQ A;  5LVM A;  3HLL A;  5CZI A;  4FKI A;  3G33 A;  3D5V A;  4CCB A;  3C4F A;  4EK5 A;  1KE8 A;  1ZLT A;  4G9C A;  2C68 A;  3HV5 A;  3WIK A;  2QO9 A;  4F0I A;  1G5S A;  3P7B A;  4ENX A;  3JXW A;  3LFS A;  4PMM A;  3QHR A;  3R7G A;  4DEE A;  4O0W A;  2ACX A;  2ITO A;  5ANI A;  1KV1 A;  3GP0 A;  3HEG A;  3H0Y A;  3SKC A;  4EOM A;  3VS7 A;  1RJB A;  4KD1 A;  4D2T A;  2UZL A;  3R63 A;  2XJ1 A;  4J8M A;  4MWI A;  2X2K A;  3FLY A;  1H0W A;  2YAK A;  3Q9X A;  2XA4 A;  5IUG A;  3DQW A;  2VWU A;  3FI2 A;  3WF8 A;  4YUQ A;  4W4Y A;  4GUE A;  3D14 A;  3G9N A;  1YWN A;  2F7E E;  2BMC A;  4KB8 A;  3R83 A;  1ZZ2 A;  3LFE A;  4HJO A;  3TNP C;  4K33 A;  5GZ8 A;  3MWU A;  5DIA A;  4BKZ A;  5HNB A;  3AGL A;  2RF9 A;  2QG5 A;  3GI3 A;  4L52 A;  2BVA A;  3RPV A;  1WVY A;  1BUH A;  3MFT A;  4F63 A;  4D4R A;  5HQ0 A;  4KS8 A;  3MN3 A;  2X0G A;  4Y83 A;  3TJD A;  3NLB A;  3GU7 A;  5EOB A;  2JC6 A;  3RAK A;  4DH7 A;  2PE1 A;  2A0C X;  2R3I A;  1URC A;  3MTF A;  1LR4 A;  4ZTH A;  2CN5 A;  5JN2 A;  3LMG A;  3CEK A;  2ITT A;  2OXD A;  4WRS A;  3MB6 A;  3HA8 A;  4QMX A;  3W10 A;  4JBV A;  3PA3 A;  2C47 A;  2O8Y A;  1DAW A;  3LFQ A;  2YIY A;  4M0Y A;  5HOA A;  4AOJ A;  3DAJ A;  1ZOG A;  4L45 A;  1DAY A;  2R3K A;  5J79 A;  3OXT A;  4A9T A;  5KML A;  4RIW B;  4NCT A;  4BHZ A;  3GBZ A;  5KMI A;  4OTW A;  1F0Q A;  4ACC A;  4OTH A;  3V5J A;  4IAN A;  3DK6 A;  4F70 A;  5HO7 A;  3R22 A;  1Q62 A;  4PMP A;  1Z9X A;  4FSR A;  2PHK A;  1ZOE A;  4FSY A;  3MYG A;  4IHP A;  5IDN A;  5AJQ A;  4BGQ A;  4OBP A;  5EYC A;  5AIR A;  3MVM A;  4U81 A;  3E3P A;  3NUP A;  2WEV A;  3ENM A;  3W2R A;  3ZON A;  4QYG A;  4LUD A;  3VS2 A;  4F9C A;  2QOB A;  4LMU A;  2GHM A;  3V5L A;  3FC2 A;  3GQI A;  4ARK A;  2RFE A;  4R5S A;  3F3Z A;  3I6U A;  5HE1 A;  5FEQ A;  3UIM A;  3JVS A;  2R3F A;  1S9J A;  4IH8 A;  2C3L A;  2IVV A;  3NIZ A;  4I6F A;  4ALW A;  2ZAZ A;  4BDC A;  1JWH A;  2PY3 A;  3IW6 A;  5BVK A;  4MXX A;  5K5X A;  2Y6O A;  4TPT A;  2WQN A;  1CTP E;  3N51 A;  4RLL A;  3TAC A;  3EH9 A;  4W4V A;  1B38 A;  2QOI A;  2R3Q A;  4CKJ A;  2CGW A;  4FUX A;  3WAR A;  4R6V A;  1YXS A;  3F9N A;  3MIA A;  4FTQ A;  4L3L A;  4RIW A;  3VUT A;  2ITN A;  1PYX A;  3ZYA A;  3FSK A;  3GGF A;  4IM0 A;  2YIS A;  5DBX A;  5DR2 A;  3QKK A;  5ANO A;  4CYI A;  3UMW A;  5JFW A;  1ZYL A;  4EOJ A;  5DG5 A;  3E92 A;  3JY9 A;  1OIT A;  2QLU A;  3P0M A;  3TV6 A;  1KWP A;  2GHL A;  4JOA A;  3AMB A;  3EFJ A;  3RNI A;  4RRV A;  3HVC A;  4BWX A;  2W5B A;  4EOS A;  2EB2 A;  2PVF A;  4FTJ A;  4HCV A;  4DH5 A;  4A9S A;  1WBN A;  3PPK A;  4WD5 A;  5F1Z A;  2BRG A;  4PPA A;  2VTA A;  4PDO A;  4BYI A;  4V01 A;  5IZF A;  3QAM E;  1CDK A;  3HGK A;  1OPK A;  4X6Q C;  3MFR A;  4M12 A;  5AR2 A;  4BC6 A;  5KKR C;  4XG2 A;  3ZLS A;  4EWQ A;  5EHO A;  4MVF A;  4LL5 A;  2WEI A;  3H9O A;  4GK4 A;  2YER A;  3DBE A;  4FVQ A;  3KGA A;  4QD6 A;  3PP0 A;  4MF0 A;  2C5V A;  4RQK A;  4ANB A;  3D2I A;  4FTT A;  3BQR A;  2JIT A;  5CSP A;  3F61 A;  5IDP A;  2G2H A;  2ZB1 A;  3PA4 A;  2ZMC A;  5CT0 A;  3WIL A;  3POZ A;  2VN9 A;  2JED A;  4K77 A;  5KMO A;  4EZ7 A;  1U54 B;  2RIO A;  5AAG A;  3A7F A;  3E64 A;  3D94 A;  1PKD A;  5L6W L;  2NP8 A;  3Q5I A;  1WFC A;  4ZEG A;  1OEC A;  2HIW A;  3I4B A;  4LMN A;  3VUK A;  3TXO A;  3L9N A;  2C6K A;  2HYY A;  3NDM A;  2XNB A;  4XP2 A;  3RPO A;  1PXI A;  2IZR A;  4UB7 A;  3I6W A;  2V62 A;  5GJF A;  4EHV A;  4KSP A;  4RVM A;  1OUK A;  3CLY A;  3FPQ A;  3GT8 A;  4QP2 A;  4YO4 A;  4ZSJ A;  1KSW A;  1FIN A;  1YI6 A;  5D11 A;  1L3R E;  3JYA A;  3QA8 A;  3F69 A;  3IGG A;  3R73 A;  3AC3 A;  4OW8 A;  3RPY A;  4Z9L A;  4F7L A;  2VAG A;  3LJ0 A;  3QYZ A;  4L8M A;  5AP4 A;  4DC2 A;  3LFB A;  3PWY A;  4G3D A;  4IAC A;  4BZN A;  5AUZ A;  4S34 A;  4FT5 A;  2B54 A;  4APP A;  2A1A B;  3GFW A;  1U54 A;  3IDB A;  4EKK A;  4KAB A;  3BEA A;  3B8Q A;  3MY1 A;  3MFS A;  4RX8 A;  4K18 A;  4ZZO A;  3R04 A;  1GNG A;  3LPB A;  3MV5 A;  4DED A;  3V5P A;  3GCU A;  2OZO A;  5FG8 A;  5D7V A;  5KE0 A;  2RFD A;  4JAI A;  4DIT A;  4F64 A;  3PYY A;  2JDR A;  3QUE A;  1YOM A;  4AZS A;  2J0M B;  4D1X A;  2X6D A;  2ONL C;  5DRD A;  2BHH A;  2QHM A;  3Q96 A;  5FM2 A;  3NAX A;  4DFX E;  2VRX A;  2Q0N A;  2E2B A;  3ZZW A;  4A9Y A;  2I0H A;  2O3P A;  3A4O X;  2RG5 A;  3UC4 A;  3WF7 A;  3E88 A;  1E1V A;  2Y6M A;  3VWA A;  2PK9 A;  4OUC A;  2ERZ E;  3OS3 A;  4KIP A;  2WNT A;  5C8N A;  3NR9 A;  4DEB A;  4P2K A;  4GYG A;  2O5K A;  4W4X A;  4F0F A;  2UZV A;  3L8S A;  3OW4 A;  4S31 A;  4C57 A;  3AC4 A;  4L7S A;  2GQG A;  3BV3 A;  2R5T A;  4C8B A;  3LHJ A;  3DKC A;  4TZR A;  2XRW A;  3SLS A;  2WOU A;  2V7O A;  1WBT A;  4NJD A;  3WOW A;  5H3Q A;  3NW7 A;  2OZA B;  2VTP A;  4TRL A;  4RMZ A;  3FZS A;  3QRJ A;  3G2F A;  4J99 A;  4LI5 A;  3UPZ A;  4BBE A;  2WMR A;  4FT7 A;  4RWI A;  5E8W A;  4ZTM A;  2WIH A;  5CEI A;  3K3J A;  1OPJ A;  3FBV A;  5CF8 A;  4C33 A;  1TZD A;  3FKO A;  4FKT A;  2W5A A;  3KY2 A;  4EOQ A;  5CU4 A;  3MPA A;  5KZI A;  4IAK A;  5BVF A;  2ITP A;  3D5X A;  4F1O A;  5EDP A;  4D55 A;  4RWJ A;  3EMG A;  3IW8 A;  4GV1 A;  3KCF A;  4ALU A;  4PNK A;  5A4Q A;  2XIY A;  2ZB0 A;  1GY3 A;  3PJC A;  4FOD A;  2X2L A;  3QU0 A;  4WKQ A;  5LWN A;  4QMV A;  3FLS A;  2WTW A;  4R5Y A;  3D5W A;  3R02 A;  5HES A;  3RAL A;  5I9Z A;  4YZ9 A;  5KMK A;  4LRJ A;  1AGW A;  3OG7 A;  4QMO A;  4W8D A;  3CKW A;  4C62 A;  1FMO E;  2XBA A;  5IH6 A;  4QMS A;  4RWK A;  4J7B A;  1QPC A;  3IGO A;  3TIZ A;  1O6L A;  2BRH A;  2DQ7 X;  2VNY A;  3H3C A;  3H10 A;  5FP6 A;  5KMN A;  2CCH A;  3DPK A;  4ALV A;  3NAY A;  2QLQ A;  2R3N A;  5DEY A;  4AT3 A;  4BCM A;  3DGK A;  2BDJ A;  2QOK A;  3ZH8 A;  3ZZE A;  2W05 A;  4A9R A;  3AD4 A;  4AA0 A;  4HNI A;  2QOH A;  3E7V A;  3DV3 A;  3WZE A;  4FG9 A;  4K9Y A;  4MNF A;  4TTH B;  3G5D A;  5IU2 A;  5EM6 A;  4J95 A;  1OB3 A;  2C3I B;  4RFM A;  4CV9 A;  3TTI A;  1UU3 A;  3FWQ A;  3QLF A;  5IH4 A;  3KQ7 A;  3ODZ X;  5CNN A;  4A4X A;  3QTR A;  4LL0 A;  1KOB A;  2ITV A;  1YW2 A;  5HX6 A;  4FZF B;  5J5T A;  1Q41 A;  1STC E;  3IW5 A;  3SDJ A;  4FIJ A;  3UP2 A;  4GUB A;  4C61 A;  2C4G A;  4M14 A;  4IB0 A;  2R3G A;  4JR7 A;  3ORZ A;  3PWD A;  2J7T A;  4YBK A;  2QOO A;  3CQW A;  3O50 A;  4RJ3 A;  2JKM A;  5HVJ A;  4WSY A;  3BEL A;  1IG1 A;  2XEY A;  3KKV A;  4YR8 A;  4H3Q A;  4JI9 A;  5EHY A;  4DFY A;  5KUP A;  4EH7 A;  2W1Z A;  5IMX A;  5AV3 A;  4I3Z A;  4ZTL A;  3BU6 A;  2VX1 A;  4EH6 A;  4KBA A;  4UMP A;  4NT4 A;  4II5 A;  2X0Q A;  2F7X E;  4RFY A;  1M52 A;  3TZ7 A;  4FV9 A;  3PZH A;  4MCV A;  4BCF A;  2W1F A;  2FUM A;  2IF8 A;  4BCO A;  2OO8 X;  3AMA A;  1FPU A;  3DK7 A;  3ORX A;  3GNI B;  2VTM A;  4U42 A;  4RJ7 A;  5IEV A;  5M57 A;  2JBO A;  3FXZ A;  2B52 A;  5ANK A;  3PVG A;  3QCY A;  3K2L A;  3F5X A;  2WTD A;  5BVE A;  4O0Y A;  3UG1 A;  4AAA A;  4N6Z A;  4FKU A;  4CTC A;  3E87 A;  2WKM A;  2C1B A;  4BDF A;  4YC3 A;  2QD9 A;  1OL5 A;  4IAD A;  1JST A;  2JDT A;  1Y6B A;  2RGP A;  4GT5 A;  5LVP A;  5JZN A;  5AR7 A;  1VYZ A;  4FOB A;  5CSW A;  3EKN A;  1H01 A;  1E1X A;  2R9S A;  4MF1 A;  2VTO A;  4IFC A;  4CQG A;  4U40 A;  4EH2 A;  4NTT A;  4A4O A;  3LXP A;  4TNB A;  3I0Q A;  3ZS5 A;  3OY3 A;  2V0D A;  4Q9S A;  3W16 A;  1OKV A;  1V1K A;  5EM7 A;  2X2M A;  3RAH A;  1F5Q A;  3K3I A;  3OCG A;  3NNW A;  3QTQ A;  3AOX A;  2J51 A;  1NY3 A;  4CFX A;  2WQE A;  3VF9 A;  2OIB A;  4HGE A;  4OTD A;  3GC7 A;  4KRC A;  1KE6 A;  4O0R A;  1BI8 A;  4R3C A;  3NEW A;  3CE3 A;  3NCZ A;  4TWC A;  4HZS A;  4CCU A;  4EC8 A;  2FGI A;  3IQ7 A;  3IG7 A;  4RBL A;  1YHW A;  3LFA A;  5CEM A;  4DTK A;  4HYI A;  4QP8 A;  3ACK A;  5CU3 A;  2OK1 A;  3FLN C;  3W18 A;  4X3J A;  4YO6 A;  4AG8 A;  3PVW A;  3HX4 A;  2ETM A;  4LFI A;  5BX0 A;  4CLJ A;  4HYH A;  4BDH A;  4LOO A;  3UVR A;  3P7A A;  4DFN A;  4QPM A;  2YLE A;  5IA3 A;  3BHH A;  2I0V A;  4NK9 A;  2F7Z E;  3QUD A;  5HCX A;  5FWK K;  1H8F A;  1K3A A;  1YXX A;  4YC8 A;  4H1J A;  3R7O A;  3TNW A;  4FNX A;  5FEE A;  2X39 A;  5CF4 A;  4AN3 A;  1T45 A;  4IM2 A;  4RVL A;  4NFM A;  2VX3 A;  5HNG A;  3RK9 A;  3D9V A;  3UG2 A;  2X8E A;  4AZE A;  3P79 A;  1VZO A;  5BMM A;  4BWP A;  4E5A X;  1XBA A;  2GTN A;  4F9B A;  3LQ5 A;  3GC8 A;  4R1V A;  5GZA A;  3PJ8 A;  4LQM A;  2H34 A;  2BUJ A;  3FMJ A;  3P5K A;  4M3Q A;  2CDZ A;  4L01 A;  5FLF A;  4EZ5 A;  5JRS A;  4L3P A;  5CEO A;  4GK2 A;  4IDV A;  4FKL A;  2QOQ A;  3ZEW A;  3ANQ A;  3LFD A;  2X7O A;  2XKD A;  1OIR A;  4EOO A;  5EKN A;  2GNF A;  2YZA A;  3PLS A;  4LM5 A;  4FKG A;  4BDA A;  4TYI A;  4JDI A;  4DGM A;  3F6X A;  4EYM A;  2V55 A;  4ZY4 A;  3VRZ A;  2R0U A;  4O0T A;  3UNJ A;  4DHF A;  4U7Z A;  4ZJJ A;  4MAO A;  2FVD A;  2E9V A;  5FM3 A;  3UYT A;  3DBC A;  4E4M A;  3ZLY A;  5IA2 A;  3QUP A;  3C7Q A;  1KE5 A;  2W7X A;  3LOK A;  4GFM A;  4H3P A;  4UZD A;  4FV1 A;  3L8V A;  3COI A;  3KXH A;  4IWP A;  4I0S A;  4EBW A;  2BIY A;  1JKK A;  4Y85 A;  4BIB A;  1FOT A;  4FR4 A;  1DM2 A;  3AT3 A;  5AAE A;  4XG4 A;  3SD0 A;  1ZY4 A;  4IB1 A;  3ZXT A;  1YHS A;  1XH4 A;  4CNH A;  4IM3 A;  3WYX A;  1H27 A;  2QU6 A;  3NW5 A;  4ANM A;  3MBL A;  2RFN A;  4FNZ A;  4YJN A;  3VJN A;  4BTM A;  2W0J A;  4JQE A;  4CTB A;  5AP7 A;  4L7F A;  4MTA A;  4PUZ A;  4QNA A;  4PP7 A;  3KU2 A;  3QXO A;  3AT2 A;  3TWJ A;  3EN4 A;  4ID7 A;  4O91 A;  4XBR A;  5LAR A;  1YWV A;  5AUY A;  3WZJ A;  3TN8 A;  4QQJ A;  5CYI A;  4ZZM A;  4R1Y A;  5A6N A;  3ELJ A;  4FIH A;  5HE3 A;  2LGC A;  4XOZ A;  3WBL A;  1WCC A;  5C01 A;  3HMI A;  2XK8 A;  4D4S A;  2HWO A;  5BUI A;  4ERK A;  2C6D A;  4WA9 A;  4ANS A;  1P2A A;  3R8M A;  3E7O A;  4U43 A;  3PJ1 A;  3NS9 A;  4IB3 A;  4R8Q A;  3WF9 A;  4CKI A;  3G51 A;  3O96 A;  4LV5 A;  2R0I A;  4IJ9 A;  3FE3 A;  1P5E A;  5CVF A;  5TKD A;  4JXF A;  4D9U A;  1PF8 A;  3QGW A;  1WBV A;  2EUF B;  4CLI A;  5AUU A;  2HEN A;  4FSZ A;  2UZB A;  3FMK A;  3O17 A;  3WI6 A;  2VTT A;  3IPH A;  4E73 A;  5K4I A;  3BGZ A;  4J52 A;  4MNE B;  5CLP A;  4TWN A;  3BRB A;  5TOZ A;  3Q9Z A;  3ERK A;  1WBO A;  3FXX A;  4NM3 A;  3ZFY A;  4M66 A;  1Q99 A;  4PX6 A;  3UPX A;  3LM0 A;  2UZU E;  3NW6 A;  3W2P A;  4Z16 A;  5CF5 A;  4P5Q A;  4AA4 A;  2Y4I C;  4HYU A;  3OXI A;  4I4E A;  3OOM A;  4BI2 A;  3BQC A;  4YJQ A;  5AUW A;  1H0V A;  3C4Z A;  3R7E A;  4C4H A;  5EH0 A;  2Y0A A;  2WTI A;  4BDG A;  3VHE A;  2RL5 A;  5HBH A;  1GJO A;  3FXW A;  4QT1 A;  4TWO A;  4BKJ A;  5D10 A;  2P33 A;  3QRK A;  4TYH B;  3HV3 A;  4MD7 E;  3ETA A;  2OW3 A;  4D2V A;  1FVV A;  1V0O A;  1Y8G A;  2BFX A;  5J95 A;  3VUD A;  4Z7H A;  5JGD A;  1CM8 A;  2O63 A;  3DLZ A;  4GW8 A;  3MS9 A;  3UO4 A;  2OU7 A;  1ZY5 A;  4HGT A;  4AGC A;  1GOL A;  4FKS A;  4MH7 A;  5CU2 A;  3I7C A;  3FHI A;  5CAO A;  4ZTN A;  5HIC A;  4MD8 E;  2IZS A;  4IC7 A;  5HLW A;  4MNE A;  5DI1 A;  4AW5 A;  1PMU A;  3FC1 X;  2R3J A;  4UAL A;  4FNW A;  2GNL A;  3QD4 A;  5DT3 A;  3VF8 A;  5AM7 A;  4BF2 A;  5LMB A;  1PXO A;  1SVE A;  1NXK A;  4AW0 A;  5LJJ A;  1M17 A;  4O0X A;  4MXY A;  2FSL X;  4S30 A;  5EKO A;  4AXA A;  2A4L A;  4GK3 A;  5AUT A;  1M7Q A;  5B2L A;  1UNG A;  4FZ6 A;  3FKN A;  3ZSH A;  3C50 A;  3MPM A;  1I09 A;  4G6N A;  2BAL A;  4HGS A;  2QR8 A;  4IJP A;  2Y9Q A;  3QZF A;  4Y5H A;  3Q2M A;  2WAJ A;  4QMT A;  2GPH A;  4D0X A;  1H07 A;  2RG6 A;  3I81 A;  2WMW A;  4L6Q A;  4TYH A;  5IA4 A;  4FTU A;  5AP1 A;  2QOC A;  4FOC A;  3WYY A;  2R2P A;  3ITZ A;  4C3P A;  3BIZ A;  5AV1 A;  3QWK A;  4HVH A;  2EU9 A;  3KCK A;  2QI8 A;  2QO2 A;  1XO2 B;  4YHT A;  5E8X A;  5TO8 A;  2ITX A;  5M51 A;  1QPD A;  5LMK C;  1W82 A;  3KF7 A;  3MH0 A;  1Q4L A;  2ONL A;  1Q61 A;  3GOK A;  4F4P A;  3QCX A;  3TNH A;  3ORT A;  5JQ8 A;  3JUH A;  3V51 A;  2AYP A;  2GDO A;  4Y73 A;  2YIW A;  4QTE A;  2ZV8 A;  2CMW A;  5H2U A;  2OFV A;  3F5P A;  3SW7 A;  2HAK A;  3DCV A;  3GC0 A;  3FMH A;  4PDS A;  4CMT A;  4OTQ A;  3KRR A;  4RZW A;  5HU9 A;  5CSH A;  3LFN A;  5ICP A;  4MX9 A;  3HRB A;  4AW2 A;  1NVS A;  3ZXZ A;  3F88 A;  4X2F A;  4F7S A;  2AQX A;  2UW7 A;  4IX5 A;  4YU2 A;  2OF4 A;  4EKL A;  2QON A;  3VUH A;  2C3K A;  3NPC A;  3F2A A;  5ACK A;  3DBF A;  1H26 A;  5JMS A;  4BWK A;  2ITQ A;  4KIK A;  4D2S A;  5AA8 A;  4W4W A;  4CRS A;  1A9U A;  3GCP A;  3VW8 A;  2AC3 A;  4ZJV A;  2WO6 A;  4D4Y A;  3QTZ A;  2B9I A;  4I5M A;  4N0S A;  3S3I A;  4E4N A;  4C59 A;  2X81 A;  4QP3 A;  4O4F A;  1GAG A;  3OCT A;  3KK8 A;  3BYM A;  4NTS A;  2HOG A;  3THB A;  2QHN A;  2IZT A;  3QTX A;  4K1B A;  1XH6 A;  4UY9 A;  3IS5 A;  5DWR A;  3SXR A;  2YIT A;  4EHZ A;  2YFX A;  3Q4T A;  2W1D A;  3N9X A;  4J1R A;  5K5N A;  4CMU A;  1U46 A;  4NW5 A;  1Y91 A;  3BPR A;  4U3Z A;  1Q24 A;  1ZMU A;  2XIR A;  4G6L A;  4GG7 A;  4RIO A;  3R0T A;  3ACJ A;  1ZMW A;  2JGZ A;  4TW9 A;  3CIK A;  1BYG A;  4AOI A;  5DMZ A;  3TZM A;  3WZU A;  4TT7 A;  3F3W A;  2WTK B;  5HG5 A;  4EL9 A;  2HCK A;  3BGQ A;  4XLV A;  4JIK A;  4HVI A;  4E6D A;  4AU8 A;  2BDF A;  2XYN A;  5HIE A;  3OF0 A;  2W1I A;  5L8K A;  3QRT A;  4FGB A;  3PRF A;  4HPU E;  2NO3 A;  4LOP A;  5C8M A;  5JFV A;  5BMS A;  4RVT A;  4G34 A;  3HNG A;  5HKM A;  5I9X A;  3DKO A;  3MJ1 A;  1AQ1 A;  4YSJ A;  3VS1 A;  4KKE A;  3QLG A;  1RW8 A;  1Q8Y A;  5F95 A;  4WOV A;  4YTH A;  2XJ0 A;  5L6P A;  1PHK A;  3QCS A;  4UBA A;  4F0G A;  3OW3 A;  2FYS A;  2KTY A;  3VC4 A;  3VBW A;  3IDC A;  2J6M A;  2UZD A;  3OUN B;  5DA3 A;  3T3V A;  2F49 A;  1UVR A;  5HCY A;  4F6S A;  5L2T A;  4L44 A;  4GIH A;  2XVD A;  5JGB A;  1R3C A;  4AFE A;  3ULZ A;  1JPA A;  5CU6 A;  3JVR A;  3TKI A;  2EVA A;  1R39 A;  3IEC A;  2IN6 A;  2QKW B;  5ITA A;  4TYE A;  2BZI B;  4M69 B;  4UV0 A;  3LW0 A;  5B2M A;  3QC9 A;  3DDQ A;  3GEN A;  3TV4 A;  3DJ5 A;  4JS8 A;  4CD0 A;  4C2V A;  3CCN A;  4MKC A;  2VO7 A;  5TR6 A;  3UOK A;  3NUU A;  1U5Q A;  3FQH A;  3QD3 A;  5CAQ A;  3C51 A;  2W4K A;  4UMR A;  4JDH A;  4I92 A;  3B2T A;  4ASX A;  2W4O A;  2X4F A;  1ZRZ A;  3EID A;  3BE9 A;  2ITZ A;  4QTB A;  4H58 A;  4W9W A;  4DGO A;  3EQB A;  3HZT A;  1VYW A;  2X6E A;  3ORP A;  4JR3 A;  4PDP A;  2IW9 A;  4FYN A;  4AT5 A;  2W1C A;  4HVS A;  1FQ1 B;  4J96 A; 
#chains in the Genus database with same CATH homology
 2A98 A;  2AQX A;  2X0P A;  1W2D A;  4O4D A;  4FRF A;  4O4B B;  1W2C A;  2X0O A;  1W2F A;  4O4F A;  2IEW A;  4O4C A;  1TZD A;  2IF8 A;  2X0Q A;  4O4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...