5FTQA

Crystal structure of the alk kinase domain in complex with cmpd 17
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
309
structure length
293
Chain Sequence
GPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRCAMLPVKWMPPEAFEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Discovery of Entrectinib: A New 3-Aminoindazole as a Potent Anaplastic Lymphoma Kinase (Alk), C-Ros Oncogene 1 Kinase (Ros1), and Pan-Tropomyosin Receptor Kinases (Pan-Trks) Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 293
sequence length 309
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ftqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ftqA01
2RSVA 4RC3A 3DU8A 4F9CA 3GOKA 2PVFA 2R3PA 4YC8A 3CPCA 4W9WA 3O8TA 4IM0A 5DRDA 3R7OA 1J1CA 2IZUA 2PZYA 3DBQA 4BI0A 3NVKI 2ITPA 2QURA 3I1AA 1H1SA 3UQFA 2JKMA 1VYWA 4E6DA 4XG3A 3RTPA 3R1SA 2J9MA 3A4OX 5CWZA 4E73A 3RALA 5JN2A 5L6PA 5BUIA 1APME 4V05A 3OROA 4WNPA 2CMWA 4L52A 3O50A 1DS5A 3V5TA 3Q52A 1YKRA 1M2RA 4DAWA 3Q3BA 4QP9A 5AM7A 2VTNA 1YWRA 3ZZWA 4QPAA 2Y7JA 4AX8A 4DC2A 2VGOA 5CVFA 2JD5A 3DGKA 5JZNA 4RIYA 3IW5A 5M06A 4FNWA 4BCMA 5HEZA 3F5PA 3II5A 4RJ3A 2LGCA 5DA3A 3TXOA 2B54A 2JLDA 2C68A 2XVDA 2WB8A 4MK0A 2VX0A 2PMLX 1WBOA 3F61A 2PULA 3QTWA 2PL0A 3CE3A 4FSQA 4YZNA 5DR9A 2CKOA 2ONLC 1A9UA 3QRUA 4ZTNA 4KINA 5EI8A 1H08A 2ITXA 2XYUA 2WEVA 3D9VA 3FQEA 2WQBA 2W99B 3EQPA 3MA6A 3R22A 4IZYA 4ZTSA 1T45A 3REPA 5D7VA 4ASDA 3Q5IA 3CD3A 4C58A 3F9NA 2P4IA 5BYZA 3PJ2A 3H9OA 2JBPA 4F70A 1J7IA 3FMKA 3CJGA 4FX3A 3KFAA 4LRMA 1XQZA 3QD0A 4M69B 2J7TA 1PHKA 3NDMA 5CSHA 5DMZA 1XH4A 2FSLX 4YR8A 5IEXA 4QQ5A 3E63A 3TACA 3MYGA 2X81A 3HRBA 4CZYB 5CSPA 5KMNA 4LL5A 2HXQA 4R3PA 4EOIA 1PMVA 5AP6A 5HCZA 1NVSA 1XH5A 2PE2A 4FNYA 4NJ3A 2XNMA 4PL4A 5E1EA 5IUIA 1RQQA 3TNHA 1EH4A 2ITUA 3OC1A 1OUYA 1CSNA 3C4FA 3B8RA 3QXOA 3D94A 4MHAA 3JPVA 4TWCA 4GJ3A 4U45A 4AT3A 4YZBA 3FXXA 4O7ZA 3LJ1A 4QYEA 5B0XA 5LVMA 3E87A 3V6SA 4ERKA 3R9NA 3LCOA 2C5NA 4QNYA 4GIIA 4D4SA 3P7BA 4FSRA 2YWVA 2R3HA 3DBDA 3ORIA 3Q9ZA 2XNGA 3AD4A 1U5QA 4M66A 1URCA 2YDJA 5DI1A 3OY1A 1H1RA 4ACCA 4NM0A 2O5KA 1ZXEA 3ZUTA 4FGBA 4R7BA 5C4LA 3LQ5A 4MXYA 1P4OA 3MFSA 1B39A 2OH0E 2GS2A 4R8QA 3ZLSA 3KMUA 4DCEA 4XV9A 3P79A 1O6LA 4R78A 1ZY4A 4JBVA 4I5PA 4C02A 2Y0AA 3P78A 4AOTA 3HECA 5IUGA 4O7RA 3KGAA 3NAXA 2OIBA 3OCSA 3ALOA 4I92A 5C8NA 1R0EA 4EL9A 5JFXA 4X3JA 5C03A 2XK8A 3CJFA 3P9JA 5FP6A 3GGFA 1PMUA 2A2AA 3CY2A 5HVJA 3S0OA 4X2GA 3CGOA 4TNBA 3EQHA 2GMXA 3DCVA 4V0GB 4D2SA 3LCSA 3OCGA 4KIOA 5FGKA 3KF7A 4EKKA 3LHJA 4GEOA 5DH3A 4KNBA 4GUEA 2ZAZA 4DEBA 4EBVA 4FE2A 4I5HA 1YXSA 5DR2A 3OWPA 5ANKA 4FIGA 4A06A 3ZTXA 5CT0A 3VHKA 2UZVA 5CAQA 5M4CA 3COHA 4HGEA 3VS7A 1Q8YA 3IPHA 3AC2A 4FTTA 5JT2A 4E93A 5IH5A 2P3GX 1XHAA 4MKCA 3SQQA 4Y46A 3DK6A 3A99A 4IJPA 3BU3A 4FZ6A 1J3HA 5CS6A 5J95A 5L2TA 2R7IA 3T3VA 4FEXA 4YO4A 3F6XA 3L8VA 4G6OA 4YPSA 1GZ8A 3PXQA 3Q5ZA 5J8IA 3SRVA 2X4ZA 4JR3A 3LFAA 4YP8A 3O0GA 5HO8A 4BDIA 1WBWA 1IAHA 4ZMEA 2XJ0A 4E5BA 2FB8A 4O7TA 5EM8A 4A9YA 2HZ0A 4RRVA 4R7IA 2Y4PA 5AAFA 2QO7A 1JKSA 3Q53A 1H01A 4TWPA 4G9CA 3TIZA 1UU8A 5BVNA 3DV3A 3HV6A 3TCPA 3KC3A 5DT4A 2JIVA 3DK3A 3HGKA 4MCVA 4XG6A 3GCUA 3ZHPC 4BFMA 3MTFA 2OO8X 1DAYA 4G2FA 2WMAA 2J0IA 3D14A 4V01A 4FKLA 4IWQA 2R3NA 4YC3A 5HD4A 3I7CA 3DTWA 5L4QA 5IH4A 4BCFA 4O82A 2GHGA 3PXKA 4J71A 5C9CA 1E9HA 3FAAA 3DKCA 4QTEA 4F0IA 1Q41A 2W1IA 1AQ1A 4B4LA 1KE5A 1FQ1B 4X6QC 3A7HA 3GI3A 4BHZA 2YERA 3GQLA 4U42A 5IMEA 3DB8A 4QYHA 2IZRA 4GL9A 3F2AA 3MPMA 4FK6A 3NNWA 2W4KA 4EWQA 2WOUA 4N6YA 5ANDA 3EJ1A 4OW8A 4BCGA 4CYIA 5IH6A 2X39A 5EM6A 3HMIA 3EFWA 3KRWA 1ZOHA 5HQ0A 3BWJA 3C9WA 3VJOA 2WQMA 3JUHA 4WIHA 5FBOA 2VU3A 3EH9A 2Q83A 3KRJA 4CFMA 4RWKA 2WNTA 3LJ2A 3QZHA 4JOAA 4HYHA 4KS8A 1MUOA 4ALVA 5LARA 4E7WA 3KKVA 4IE9A 4TWOA 5CXHA 3VQUA 3FSFA 4RT7A 2WMSA 4J52A 2WMTA 4ARKA 4ZAUA 5J87A 4XUFA 3FKOA 4BCOA 2QOQA 4AA0A 3HA8A 4K1BA 5FDPA 3N4TA 2HWOA 5CAPA 2VTLA 2YDIA 3PY3A 2QG7A 4N0SA 5AEPA 5I4NA 4PX6A 5GNKA 4EYMA 2FGIA 3EKKA 4W9XA 4ANMA 4BTJA 4TNDA 2Q0BA 4G6LA 2J0LA 4C36A 3G15A 3FY0A 5C4KA 2RG5A 2VTIA 4P5ZA 4X3FA 3ZH8A 4C61A 4XV3A 4JDKA 3CSVA 4GKIA 4WG3A 2V22A 4G3GA 1URWA 2UW3A 3TV4A 1M14A 2BMCA 2UZTA 3ORZA 4YMJA 3FJQE 3UPZA 3DAKA 5EM5A 4RBLA 5EQYA 5JH6A 1DI9A 2GTNA 4BICA 2OZAA 2XBJA 3E7OA 4CCBA 4HGTA 4EK4A 4O0SA 5CEQA 5HO6A 3NMUF 2C3IB 1B38A 2R3LA 1STCE 2GU8A 3UNZA 3V6RA 3I79A 3I5ZA 1ZYDA 2HW7A 3VQHA 3D2IA 2CN5A 1BI8A 4LGHA 3QTRA 4O83A 4DTBA 2X7FA 4O0XA 5FRIA 4L53A 3FZOA 3HP5A 3FMJA 4RWJA 4OTWA 4I0TA 4BYIA 4KKEA 4F7SA 4QQTA 5LWMA 4PQNA 3MBLA 1NXKA 1PKDA 4NH1A 2G2FA 4F1MA 5A4CA 2BR1A 2XNBA 4B8MA 2P55A 2ITOA 3W2RA 4QRCA 4BRXA 4EUTA 3H0ZA 2HY0A 3EL8A 4G3CA 4IVBA 1OL6A 4PDOA 4PF4A 1M52A 2ZM4A 4GFOA 1OL2A 2OZOA 4KBAA 5A3XA 2DQ7X 5HE1A 2ZMCA 4AZWA 5H2UA 3CR0A 3PY0A 5CSXA 1WAKA 2OJJA 3QUEA 2NRYA 4MNEA 3V51A 3ZDUA 4BGQA 3PVBA 4I24A 1CKIA 3GC8A 4J8MA 4FZAB 4ACGA 4UMQA 4MBIA 2ZMDA 3MY5A 3VS1A 1GIJA 4QTDA 4RC2A 5A9UA 1UNHA 3BYUA 4WG5A 1J91A 4EQUA 4YJQA 2NO3A 5JGDA 2C0IA 1IAJA 4KIKB 2GCDA 3UG2A 5HU3A 3NYNA 5AMNA 3EQDA 1TVOA 5M4IA 2DYLA 3C4CA 5CENA 4U80A 5DOSA 5CY3A 4GCJA 4DEAA 1REJA 1JBPE 5AUWA 1BL7A 4IAYA 3UIUA 4BDGA 4NWMA 4D58A 5J5SA 1ND4A 4YZMA 2XB7A 4RX8A 5AP0A 2PZRA 3LXLA 3R1NA 4FG9A 3RK7A 3FI8A 5KMLA 4EK5A 3TTJA 3KXGA 5AX9A 1GOLA 2WD1A 3ZDIA 3NAYA 3TUCA 4N4SA 4JS8A 1G3NA 4C2VA 3D2KA 4RWLA 5AR7A 3FPMA 4O7VA 2WOTA 4H3QA 5CSVA 3RBWA 3L8SA 3OW3A 3RI1A 4MBJA 3TV6A 4BTKA 4FA2A 4IB0A 5BUJA 4YNEA 4WBOA 3G90X 4U9AA 4FSMA 3MH1A 2E2BA 5JZJA 1ZMVA 3UZTA 2BKZA 2IVSA 5F4NA 3I5NA 4AFEA 3LXNA 5DVRA 2ZVAA 2BZJA 3QQHA 3KN5A 2XIXA 1RJBA 4G31A 2YEXA 3NUYA 4M67A 5HCYA 1DI8A 3G2FA 3VBTA 3MVJA 2W1CA 2WGJA 3ODYX 3AC8A 5AP1A 4ACMA 4F1OA 5AUTA 1TQPA 3KRLA 3FBVA 4AWIA 3N9XA 4JQ7A 2QG5A 4FKPA 2RG6A 4IWOA 5ETCA 1MRYA 5CZHA 5CEMA 4O7NA 1GZNA 3R73A 4LMNA 3R83A 3VO3A 2VTRA 3COIA 5CQWA 2QO9A 2UW9A 4I22A 3NRMA 4PL5A 3RK5A 4L7FA 2V55A 1T46A 4HPTE 4AOIA 4U6RA 4A9TA 4C34A 5FXQA 2HENA 5ETAA 4YZCA 4HZRA 3I6WA 2BPMA 3Q9XA 4R3RA 3NNXA 4EC9A 4EJNA 4C8BA 3IO7A 2BCJA 4USDA 2XF0A 3EN9A 1K2PA 3V3VA 5HBHA 2OSCA 3ORPA 3FKLA 3WF6A 2ITQA 5D12A 5IQGA 5BVEA 5HBEA 3MH0A 4JDIA 4PTEA 5FD2A 4TYEA 3NUXA 2R3FA 4QTBA 5E8WA 5ITAA 4KAOA 3UE4A 5M4UA 3B2TA 4UMTA 4G5JA 2G01A 4ITJA 3RZFA 4CCUA 1FVTA 3FKNA 3PSDA 4BBMA 2F57A 4HGSA 5E7RA 4LG4A 4F7JA 4QOXA 4EQMA 4O0RA 4CT1A 5HKMA 4NT4A 3VWAA 4GSBA 4D9UA 4QMQA 2HAKA 2W5AA 2PVRA 3ERKA 3SW4A 3FV8A 4ALUA 4EHEA 2J50A 1K3AA 5CU2A 4O84A 3FMDA 4F6WA 2DS1A 1KUTA 2J2IB 3KA0A 2WHBA 5CLPA 1PXMA 4I3ZA 5IQHA 2Z7RA 1Z9XA 5IEVA 1OI9A 4FODA 4YSMA 3U4UA 4Z7HA 5F9EA 3WZKA 2OBJA 1FOTA 2OJ9A 4EH4A 2J90A 4F6SA 4CXAA 4USEA 2E9PA 2F4JA 5ICPA 3QHWA 1P5EA 4Q9SA 2C6MA 4J7BA 4MQ1A 5DPVA 5CANA 3D7ZA 5KHXA 5EKNA 5A46A 4WKQA 3KCFA 3PXRA 4NIFB 3DLSA 3KREA 3MN3A 3A8WA 4GYIA 3GFEA 4I4FA 4EEVA 5CAUA 2PYWA 2C47A 5BVOA 3DXNA 4ID7A 4RIOA 5DIAA 4MXOA 4MXAA 3MB6A 5DWRA 3NYXA 1JQHA 5I3OA 5CX9A 3DKFA 2F2CB 3K2LA 4G5PA 4ZXTA 4E6QA 4AXAA 2RL5A 5EOLA 2UW6A 3EB0A 3BHHA 4NL0A 4JX7A 4BL1A 3EYGA 4Z16A 4B99A 4AW0A 3F3WA 2GQRA 3WBLA 1DM2A 4LUDA 2UZUE 4IB1A 4D2RA 3IECA 1Y8YA 3PY1A 4P5QA 5DN3A 2IW9A 3R02A 5E8SA 3Q6WA 4JT3A 5DRBA 3UG1A 3U6IA 3C50A 4R6VA 2OI4X 2GNFA 1MP8A 3ZC5A 4O21A 3HRCA 1ZAOA 3VS3A 1G5SA 3ZOSA 3D4QA 4JL9A 2ZJWA 3NUAA 3SXFA 5FUTA 2B53A 2Z7LA 3Q6UA 5DEYA 3UO5A 4M68A 3EL7A 1XH6A 3P23A 5HG9A 2ZOQA 1SMHA 4TWNA 4C4GA 3FLYA 5IQAA 3P0MA 2BTRA 3DLZA 3VJNA 4IWPA 3BCEA 4QNAA 1LEZA 2YM5A 3KK8A 3JR1A 4DEDA 2VUWA 3K3JA 2LAVA 3UZRA 4AW2A 1BMKA 3EQCA 5L6WL 4P7EA 1Y6BA 1YOMA 4DINA 5BVDA 3G5DA 1UKHA 3KY2A 5B2LA 5IA0A 4TYJA 4O86A 1A06A 3VBWA 3JS2A 4UXLA 4DLIA 4CV8A 5FTOA 4IM2A 5CU4A 3VAPA 5GJFA 4E6AA 3FSKA 3MY1A 5E91A 3SXRA 3PPJA 5LVPA 5HTBA 4ACHA 4XOYA 3AQVA 5DBXA 4FSUA 4KKHA 2BIKB 1H28A 3SHEA 3HDNA 2J5FA 3BQRA 1FINA 3LCTA 1GNGA 3MY0A 3DTCA 2ETKA 4X2NA 5FEEA 4NSTA 3IDPA 2UZWE 2XMYA 3D5XA 3QTZA 1H1WA 4W4YA 1H0WA 2YZLA 5AR8A 4ZZMA 4G34A 3PFQA 1OPLA 5EYKA 3UP7A 3UOJA 3PWDA 1YWNA 1OIQA 3VBQA 4EOKA 4MTAA 1XJDA 4E20A 3GC9A 3JVSA 4M14A 3WF8A 5A4EA 5FLFA 2FO0A 1OL5A 1DAWA 2DUVA 3AC1A 3DAEA 2XIRA 1ZYCA 5C8KA 4J96A 3R7YA 2PUPA 2Z7QA 3V8TA 4BY9E 2O0UA 2QVSE 2JBOA 4CKJA 2UUEA 3OUNB 4CFXA 4M12A 2H34A 1QPJA 2CGUA 3EFLA 1S9JA 3HKOA 4L68A 3C51A 2XA4A 4IAFA 4RIYB 3ACKA 3IS5A 5FWKK 2PUIA 4NW5A 3O2MA 3DNEA 4BDEA 2C6OA 3TNPC 4CSVA 3ZXTA 4IANA 4P90A 3FMMA 4GS6A 4DFZE 1YDSE 2WKMA 4JX3A 4ANLA 2RFSA 2W1EA 5CVGA 1O6YA 2W5HA 3MH2A 2IZSA 5F1ZA 2A0CX 3SDJA 1OPKA 2J5EA 4PY1A 3CQEA 1H00A 3L8XA 2BALA 2V7AA 2XKCA 3OW4A 3R21A 2C6DA 2QI8A 4EHZA 2XEZA 3G0EA 2E9UA 2WMXA 4KA3A 5DE2A 4AF3A 4N57A 2C6TA 1VEBA 4Y5HA 4IX3A 4C3RA 4MQ2A 5IA3A 2VWIA 2YIQA 1UU3A 3QUDA 3E92A 3CD8A 5CTPA 2JDOA 4FKTA 3QA8A 4X21A 1UWJA 2W1DA 5LCJA 2WMQA 4CQGA 5HE3A 3PA4A 2W9ZB 3R8VA 4FL2A 3R7GA 3RNIA 3GU4A 3GVUA 5CEIA 4PP7A 5KBQA 3NCGA 1KSWA 4O0UA 4F6UA 2QOLA 3VS5A 1BL6A 1OZ1A 4FT7A 5AUVA 1ZRZA 4BIBA 3CTHA 3VUGA 2XK4A 3R00A 2AC3A 4AU8A 1PW2A 4ANBA 4L00A 4ZS4A 3QKMA 2GDOA 4L67A 2PVYA 4EHVA 4KABA 3SOAA 4L43A 3Q04A 3WYXA 4CGAA 2W7XA 5M51A 4YJRA 5CAOA 4ZLYA 1LUFA 1CKPA 1MQ4A 3OXTA 4DCAA 2QHMA 2XIKA 5J7BA 4BTMA 3FC1X 4WOVA 4CKIA 2RFDA 4AT4A 4FTIA 3SGCA 4DGMA 3MJ2A 3NW5A 4AT5A 5AUUA 2ITYA 4AN3A 2OF4A 2P0CA 4FKIA 4AP7A 2SRCA 3UOKA 2XZSA 3CTJA 5LMBA 1SVHA 5AFVA 5D11A 1NW1A 1H25A 1QCFA 3ZEWA 3KXNA 2OH4A 2IVUA 1GZKA 4AE9A 3BHUA 2ETMA 3SAYA 4EK3A 1HCKA 4MBLA 1Q99A 2OIQA 2JC6A 4D2VA 3ET7A 3EFKA 2WTIA 4ZTQA 4RQKA 3LKMA 1WBNA 2GSFA 2CN8A 2QOCA 4X0MA 4UB7A 2IWIA 4DGGA 3BWFA 3MJ1A 2ITWA 1KE9A 1UWHA 5BNJA 3KL8A 4EK8A 3W2PA 3OZ6A 4FTCA 5F94A 4MXXA 3RM7A 3ZU7A 3EQGA 2IG7A 4EQCA 5FQDC 2XCHA 2XJ1A 2CGVA 3N4UA 1H27A 4DBNA 5HIBA 1OIYA 3CKWA 4FTNA 4RMZA 4G3DA 4GU6A 3QD4A 4K18A 1RE8A 2C5XA 4AN2A 1S9IA 4ZS0A 4OTQA 4BI2A 4FG7A 5C01A 4YJUA 2ESMA 3MFTA 3DAJA 4AW1A 4WNOA 3KMMA 1U59A 4K77A 5IG1A 2HXLA 1PJKA 3AG9A 5A6OA 5KMKA 4D55A 5JGAA 4H3PA 4G17A 5I9UA 3BGZA 3FMLA 5ANEA 3RWPA 4ANNA 4ZJVA 3VUKA 2XKFA 4LL0A 3AC5A 4ENXA 3CLYA 3ALNA 4RZVA 3Q4CA 4TYHB 5GHVA 1W7HA 2JIIA 4YLJA 2QD9A 4YC6A 4E5WA 3F3ZA 2ITVA 3D5VA 2QO2A 3HV5A 4FTAA 4DYMA 2HWPA 4FTOA 4QP2A 4W8EA 4RWIA 3GU5A 3U54A 3ZMMA 4D5KA 1R0PA 3PG3A 2PMOX 4O0WA 4RFZA 5CEOA 3A7JA 2IPXA 3DFCB 3R7EA 3I4BA 4FL3A 3SKCA 5JRQA 4KRCA 2R3IA 3SRVB 3VRZA 3ODZX 4LV5A 1ZOGA 4YTIA 4D1SA 3RPOA 3TZ8A 3QGYA 1QPEA 3QWKA 4ALWA 1Y91A 4JG8A 3DS6A 3QTXA 4F9AA 4E4XA 5IMXA 3DBEA 4QMYA 2RFNA 2O2UA 3V5LA 5E9EA 4BHNA 4GMYA 5CI6A 5AV0A 3WARA 3L8PA 3VF8A 3SD0A 4HCTA 2WMUA 3AT4A 4NFNA 3LFSA 1YDRE 4FV7A 4I41A 2ZM3A 5DGZA 2A1AB 4BWXA 4Z55A 2PVKA 1MRVA 3FLQA 3R2BA 3HLLA 2XP2A 5JEBA 4IZ7A 3SX9A 2G2IA 5L8KA 2R4BA 2UZLA 3ANRA 4PV0A 3K54A 5HIDA 1Q8UA 2PPQA 4DG2E 2ZB0A 4ZSAA 5KBRA 4HVGA 2GHLA 4G3EA 4TXCA 5T3QA 1OB3A 2WU6A 1B6CB 4F0GA 3BZ3A 4WRGA 1YHSA 3GXLA 3QZIA 4J53A 1H0VA 2XKDA 4U41A 1IA8A 2PUNA 1O9UA 3DXPA 4I1ZA 2Y8OA 4O1PA 5AR3A 4B6LA 4O7WA 1Q97A 2FVDA 4OTRA 3DJ7A 1ERKA 5AV3A 4I6HA 3BBTB 3FZRA 2C1BA 2VN9A 4GVJA 2OK1A 1JSUA 4U44A 5K0XA 2NRUA 2I6LA 1FVVA 4CYJA 3A7IA 5TKDA 4TYGA 3CGFA 3UOLA 4WSYA 2JFLA 2XK6A 3A8XA 3FQSA 5DHJA 4RIWB 3TDWA 3GOPA 3NGAA 2VWUA 4C38A 2WTWA 2H9VA 2Y4IC 4DFBA 1XBAA 1V0PA 3P7AA 5HG5A 5KZ0A 2VX1A 4IWDA 3MDYA 1VYZA 3E7VA 4FTRA 1ZY5A 3H3CA 4FTKA 4Q5EA 4EOSA 2WPAA 5AAEA 1VR2A 4ORKA 2W4OA 4M13A 4BB4A 4EBWA 3PJ1A 4S33A 1CMKE 2WU7A 4F09A 1ZMUA 3I60A 5ETIA 2UW4A 1IASA 1OUKA 3ZRLA 3PPZA 5FXSA 4D0WA 4DH7A 5IUHA 4FOBA 2UZBA 4QMPA 4YURA 1KV2A 4JRNA 4EWHA 4BC6A 5HIEA 2HOGA 4OBQA 1HOWA 3IQ7A 3R28A 3G9NA 4XRLA 5CF5A 2XNPA 1ZARA 4PMMA 3UQGA 4HVHA 3I0QA 4C33A 1KE6A 3PJ3A 4IMYA 2F7EE 4KKGA 4UMUA 3PIXA 4GG5A 3PXYA 3S3IA 1WCCA 4NM3A 2GPHA 3ATTA 4HYIA 1M2PA 5LOHA 5JQ5A 3H9RA 3FE3A 4G1WA 3R1YA 2BHEA 3BGQA 4M3QA 5GZ9A 1R3CA 4JI9A 3THBA 2H8HA 3T9TA 2OZAB 2R3JA 3D15A 4UYNA 3WE4A 3F3TA 4IZAA 3R1QA 2B55A 4GUBA 5TE0A 2OIDA 2P2IA 1Q8TA 5KCVA 4FTUA 4V04A 2XM9A 3UZPA 2XK9A 4FIEA 5D1JA 3V8WA 1MQBA 2QKRA 3EQBA 3QTUA 4G6NA 3EWHA 4E1ZA 4YBJA 3LM0A 3TL8A 2ERKA 2F7XE 3LIJA 3LMHA 3LW0A 4EK6A 2UW8A 4IADA 5HNBA 3HAMA 4FSWA 2JDTA 3G51A 4FKJA 3Q60A 3QWJA 4IVDA 4N6ZA 5E92A 4M69A 4XG8A 4GRBA 5IDNA 2WMBA 3HZTA 4JRVA 4HGLA 2EWAA 3QZGA 2OU7A 2CCIA 1SNUA 1WBSA 3LQ8A 1OL1A 3PTGA 4BCJA 3E5AA 5LVOA 3WIGA 4PP9A 4NK9A 4QT1A 4O7YA 2EU9A 4S34A 4MNEB 1OKZA 4IW0A 3PIYA 4E5AX 4FTMA 4QPSA 4PNKA 2C6KA 4FKGA 3PXZA 4H1MA 1U54A 3QTIA 3QBNA 4C35A 1XBBA 3P08A 3DXQA 3RVGA 3EHAA 1CM8A 4NM5A 4CLJA 3GT8A 2UZOA 4CKRA 4LGDA 1KE8A 2XH5A 4UALA 3QGWA 4RVLA 5IKWA 1KV1A 5I9WA 2ZDUA 1XWSA 4NM7A 4U8ZA 2Y6MA 4EOQA 3NW6A 1ZZLA 3U4WA 2R9SA 4ZK5A 3GCPA 3WF7A 3COKA 4PTGA 3W8QA 3BE9A 3ROCA 4KD1A 3UDBA 3A2CA 3E3PA 5IQEA 5H3QA 4CRSA 4O7LA 3AMAA 3FLZA 2HY81 3F3UA 4CQEA 2R0UA 2R3QA 1H07A 2YCFA 3C4ZA 1I09A 4S2ZA 3TNWA 5AA8A 3UYSA 1LR4A 4MF0A 3TKUA 1XR1A 4FYOA 3DKGA 3AT3A 4LQMA 2ZV9A 2GNHA 3QTQA 4WNMA 2EB2A 3ULIA 5CU3A 4ZTLA 2VRXA 3OUKA 5CAVA 3UMXA 1L8TA 2WMRA 2B9IA 4XG4A 4XRJA 4CMUA 1PXKA 2JAMA 4MWIA 4E8AA 4HNFA 4ZSJA 2W05A 2BRMA 3O7LB 4KSQA 4DEIA 4J95A 3WF9A 3W2CA 4DEEA 3U87A 1XKKA 1JKKA 4XHKB 5LWNA 3C0HA 1W83A 4XP2A 4ZY4A 2ZM1A 4FV1A 3D7TA 2W0JA 2OXXA 4GU9A 3BU6A 2PZIA 2I40A 2GHMA 3DK7A 5HO7A 3LLAA 3P1AA 1BKXA 3HUBA 3R2YA 2VX3A 3R7UA 3IOKA 2CNVA 4AFJA 5E4HA 2WQEA 2QODA 3MVMA 4EUUA 3BE2A 2ZDTA 2BILB 2CSNA 3NUSA 3BIZA 4L7SA 3FDNA 4BCQA 3R8PA 4D2PA 4BZDA 4BR3A 4NCTA 3HRFA 2ETRA 3ZSIA 5KKRC 4FUYA 2EVAA 5IQDA 2V0DA 5E8UA 3VNTA 5G1XA 4B9DA 4LUEA 3TZ9A 4Y95A 5J9ZA 4QQJA 4IAKA 5IDPA 4DG3E 4D9TA 3D5WA 3OTUA 4YJVA 3ZM4A 3LMIA 3UP2A 4IXPA 3ZO3A 4O0VA 4Y5QA 3RAHA 4DG0E 3JY9A 1WVWA 3PP0A 5I9XA 3NPCA 5BMMA 3QRJA 3CIKA 4L6QA 1UNLA 1YXVA 4EH7A 3ZRKA 4FZ7A 4GT5A 3A7FA 2I0YA 2YA9A 5EK7A 3WZEA 3HV4A 4F1TA 5EQEA 5CEPA 3PSCA 3TJCA 4K6ZA 4D1ZA 4ZY5A 4GT4A 5DR6A 4TY1A 5I9VA 3AOXA 3S95A 3NNUA 3ORTA 4BDKA 4LI5A 1SZMA 3ELJA 4J1RA 4ITHA 3F7WA 2BUJA 4WO5A 4CRLA 2CGXA 2X6DA 4I6QA 3LVPA 2YITA 3WZJA 3POOA 5IA2A 3LCDA 4O96A 2JFMA 5A14A 1YOJA 4DEGA 2JAVA 1XH8A 4AZFA 2J4ZA 2XS0A 3MV5A 2VD5A 4JIAA 4XG7A 5CEKA 1PYXA 1E1VA 3EZVA 3FC2A 3VIDA 5I9ZA 3C1XA 4D2TA 2JDRA 3DKOA 4FSYA 3BI6A 4RLLA 1F5QA 1OVEA 4B7TA 4CD0A 2E9NA 1M7NA 2BIYA 4RVTA 3ULZA 2YIRA 3RJCA 4CNHA 4N70A 4U7ZA 3IW7A 4ITIA 4JAIA 3ENHA 3QYWA 1H4LA 1H24A 2GNIA 1NA7A 2ZB1A 5FBNC 2XK3A 5LVNA 4ZY6A 3RAKA 3ACJA 3MH3A 3QALE 3FZTA 3R0TA 4JNWA 3ZO2A 3ZO1A 2BHHA 4A4OA 2HELA 3V04A 3QA0A 2OXDA 5KHWA 2Z7SA 4DBXA 5K4IA 3L9NA 5IA4A 2QKWB 2RFEA 4DTAA 1OECA 3H9FA 3FUPA 4RA5A 5IA1A 5IQCA 1W0XC 5CVHA 4UMRA 1OGUA 5CU0A 4QO9A 4QMNA 1YI3A 3PVGA 3TIYA 4HVDA 3GCQA 3CP9A 3CTQA 2A27A 3FMHA 4AZSA 3K3IA 3ANQA 4HVIA 5L6OA 1MRUA 1Q8ZA 4YU2A 4OT5A 5L2SA 2IN6A 5EW8A 3LFNA 2QNJA 4KB8A 2YCQA 4YJSA 2C5YA 4WA9A 3FYKX 4AA4A 4MYGA 4OTPA 4BCNA 2C69A 4ENYA 5KMJA 3NW7A 3W1FA 3BPRA 2ZV7A 2CNQA 3QLFA 3A7GA 2EB3A 1PMEA 2QOOA 4HJOA 5G6VA 3N4VA 3BQCA 4E4NA 2IVVA 1U5RA 4UWCA 4Y8DA 4UYAA 1KOBA 1GY3A 2RF9A 4Y72A 4DF3A 5KMOA 3GB2A 4JAJA 4AACA 3DFAA 2W1HA 1V1KA 4IJ9A 1SM2A 4IIRA 4X2JA 1M7QA 5L3AA 4UX9A 2CKEA 3RHXA 4EOJA 2QOKA 3UC3A 1NVQA 3OS3A 4X2FA 4EH8A 3AC4A 3MA3A 2PVLA 2WIPA 5IISA 2WMVA 1J7UA 2C3KA 4QYGA 4YZ9A 4QP4A 3CC6A 1P2AA 3KQ7A 2WZJA 4JDHA 4BGHA 3UNKA 2JEDA 3TWJA 5TO8A 4BF2A 5IQFA 3OFMA 3VW6A 1Y6AA 4EH3A 4L8MA 4EH2A 2QR7A 4YJPA 3GCSA 4FI1A 4YHTA 4ZZNA 5JMSA 2PE1A 4I93A 4RZWA 1ZYSA 3U9NA 4FEUA 2GQGA 1YI4A 4GH2A 5FTGA 2VWZA 5BMSA 3AGMA 4HZSA 5IA5A 4ASZA 5IPJA 2PVMA 2Z8CA 3HMNA 3R9HA 2IZTA 3Q9WA 2YFXA 3ZUVA 3RM6A 2R3KA 2OJIA 4O81A 1WMKA 4QYYA 4RIXB 2JDVA 3QX4A 3R7VA 2JDSA 2PE0A 3KULA 3AXWA 4GW8A 3HYHA 3KEXA 4A9SA 1QMZA 5CZIA 3PE2A 2YIWA 4ASEA 4ZLZA 3TNQB 1YOLA 4FZFB 2IW8A 3MIYA 4BVUA 4USFA 4X3FC 4F7LA 2WTDA 3RGFA 3ZLYA 4PPCA 3Q4UA 1YXXA 3UGCA 4IZ5A 4D0XA 5EYMA 3PWYA 2J0KA 2ZV8A 3FL5A 4O2ZA 2XEYA 4Z9LA 1VJYA 4EZ7A 5AAGA 2EXCX 3FHRA 3PVWA 4M0ZA 4BCKA 3VUIA 3A62A 3HX4A 2WTJA 2GTMA 4BKZA 3FLNC 4MH7A 3EQRA 4C2WA 2YAAA 3S2PA 4WBBB 3ZFYA 5DT3A 4J98A 3JXWA 3P5KA 1XO2B 5IF1A 3S00A 1J1BA 5HLWA 3G33A 3QYZA 3M1SA 5AM6A 3HMMA 2B52A 3DQXA 2PUUA 2Y4IB 4IB5A 4ZJIA 1Q4LA 2BFYA 3PXFA 3TKIA 4NCTC 3C4XA 3PA5A 4IH8A 2CJMA 4LOPA 4TN6A 4F4PA 4FV3A 1WFCA 4U79A 5TOZA 5AR5A 1FPUA 3NR9A 3UC4A 2W1GA 3ZZEA 4JJRA 4UXQA 4DGOA 3RINA 3NX8A 2XUUA 4IX5A 4IACA 3UYTA 2Q0NA 2ZYBA 3IGGA 3GC7A 4XOZA 4BDDA 3F5XA 3QKKA 1FMOE 4MD9E 3OEFX 5AP4A 3HDMA 4GJ2A 4XBUA 1TKIA 2WTKC 5A6NA 5KO1A 1NY3A 3VBVA 3IDCA 4DT8A 4UV0A 4M0YA 4NW6A 5BPYA 4Z3VA 5AR4A 1JLUE 5K0KA 3QUPA 3KXZA 2X2MA 4L3JA 2KTYA 2VO6A 2X1NA 2X4FA 2OG8A 2FA2A 4WRSA 2R0IA 3ORNA 5D9HA 5ANIA 2R7BA 4L44A 3CKXA 4AN9A 2B9JA 2QOIA 4APPA 2C5VA 2ERZE 4ZOGA 5IU2A 4LGGA 3NNVA 3FI3A 2YHVA 4FNZA 1R39A 5FTQA 4DFNA 2OKRA 3M11A 2I1MA 2X9EA 5FM2A 4II5A 3ROYA 2Z60A 3VF9A 4L01A 3BKBA 4ACDA 4FKVA 4I23A 2BZKB 2G9XA 2RKUA 4R3CA 4O7SA 3LE6A 4JG7A 2PY3A 4FGRA 1PXNA 2ONLA 5KNJA 3F2NA 3OEZA 5CQUA 5EOBA 1A48A 2UVXA 4MD7E 3PJ8A 4M97A 3L9LA 4JQ8A 3NYVA 3V8SA 3VHEA 1GIIA 4DGNA 5BX0A 4ZP5A 4DH3A 2BFXA 1OKVA 3C5UA 4D2WA 1UU9A 3MB7A 4OTHA 3KVXA 1OKWA 4DEHA 4RX5A 2WXVA 2YIYA 1PXJA 5I0BA 2ITZA 3E3BX 4FT9A 3Q2JA 5AV4A 4FZDB 3OT3A 4O91A 2PMNX 4I94A 4ANSA 4FKOA 2XBAA 3IW8A 1XBCA 2BAJA 3GUBA 3ZONA 4IC7A 4FEWA 2HCKA 2BTSA 2W4JA 5AUXA 3F7ZA 4UMPA 4YBKA 2FUMA 4AAAA 1HCLA 2G1TA 4M8TA 3LFEA 4BI1A 5DYJA 3C0GA 5GZAA 4RX9A 3B8QA 2BDWA 3PE1A 2YLEA 3GBZA 4RFYA 4TT7A 3IOPA 5K9IA 3D83A 2NNWB 2H96A 1JVPP 3FQHA 3C4WA 3FYJX 4EOOA 1FMKA 1Q3WA 2IVTA 2PSQA 2FSMX 2VO7A 3QAME 3R9DA 3QCYA 3F2RA 3NLBA 5CALA 1K9AA 4R5YA 4FL1A 5KMIA 4HYSA 3CY3A 3JYAA 3FMNA 5LMKA 2YCSA 3VBYA 4WHZA 3CXWA 4F63A 5LQFA 4FKQA 1OITA 4F7NA 4FV4A 3TT0A 4KRDA 2O64A 4XP0A 3VS2A 2V5QA 2OFVA 2YISA 3PYYA 4FVQA 4J97A 4O6EA 2VNYA 3WIKA 4NJDA 3FL4A 4FIFA 4UWYA 2C3LA 4K2RA 5GJDA 3ZCLA 2GNJA 2AC5A 3LJ0A 4O38A 3V01A 3DPKA 3P4KA 3VC4A 3BLRA 3KRXA 3W2SA 4FIIA 2X9FA 3QCSA 2PHKA 4IVAA 4C4FA 4ASXA 5JFSA 3EFJA 2WO6A 3TUDA 4FT0A 3BGPA 3OF0A 1KOAA 5H8GA 5HD7A 2QU6A 4UN0C 4OT6A 5AP7A 1SVEA 4LYNA 3A60A 2W9FB 3KN6A 3LPBA 2NPQA 4DGLC 5M55A 4GKHA 1WVXA 3RCJA 3UBDA 5J9LA 2QCSA 4FEVA 3LAUA 4OTFA 3DOGA 3MTLA 5HX6A 5HOAA 4D1XA 4C57A 3NEWA 3UQCA 4DT9A 2UW7A 4CMTA 4DH5A 3AD5A 5FM3A 2IW6A 2PMIA 2R3OA 5A4QA 5C26A 4U43A 4EH9A 4CT2A 5J9YA 4A9UA 3DT1A 4HCVA 3RPYA 5HE2A 2BAQA 3OWLA 2XJ2A 4H3BA 4ZSLA 4RSSA 3ZLWA 4OUCA 5IEYA 4Y85A 3PA3A 5KKRB 2C1AA 3ID6C 3ATSA 5EW3A 2HZNA 4ZTHA 5ACBC 3GENA 4RFMA 3HA6A 3U9CA 3UNJA 3BHTA 3IONA 1YDTE 2W5BA 3RZBA 5DNRA 5AIKA 4YUQA 2BZIB 2X2LA 4GFMA 2B1PA 5BVKA 2VTSA 5HLNA 2CGWA 2RGPA 4RPVA 4L3PA 4BCPA 3CEKA 5KUPA 2WFYA 4I20A 2WAJA 4I0SA 1Q62A 3M42A 3BYMA 4YZDA 2YACA 4G9RA 4GT3A 5FP5A 3NIEA 4OR5A 5KE0A 2IJMA 2BROA 2JKKA 4FG8A 3BBWA 4FICA 4H39A 5DLSA 4JG6A 4MWHA 4AW5A 4ZLOA 4QMLA 4AUAA 2C6IA 4XG2A 5CF8A 3FMEA 3WOWA 4LOOA 4E3CA 4XMOA 2YABA 3SLSA 4RA4A 4U0IA 3VUTA 4IX4A 2VTJA 1LEWA 2YAKA 3Q96A 3ORLA 3WI6A 4EOMA 4FKSA 4LRKA 4M84A 3ZBFA 5KZIA 1OKYA 3QQFA 4FMQA 3ZC6A 3CPBA 4GV1A 4IVCA 5AJQA 5H8BA 4QYFA 3RPVA 4RQVA 4U3YA 4BDAA 4U81A 2RIOA 4D5HA 3DZQA 3IK3A 3PZHA 3FLWA 4KIPA 4A4XA 3RMFA 3ORXA 4I6FA 4O27B 1PKGA 2A19B 2BRHA 3W55A 3OMVA 3WE8A 4DITA 1ZZ2A 4O6LA 4KBCA 5EG3A 3A4PA 4QMOA 1OM1A 5EI2A 4KUJA 3MGYA 5TF9A 2O8YA 4BGGA 3GNIB 1OPJA 2CNUA 3E8NA 1RW8A 3HMPA 2YLFA 4QQCA 1YXUA 3R8UA 1OBGA 3UVRA 4CFVA 3T3UA 4RGJA 4QMMA 4R77A 1UV5A 2XK7A 4S30A 3W32A 1R78A 4I5CA 3MI9A 1TQMA 3OHTA 3QQLA 4QPMA 5ANOA 4NTTA 2PZPA 2B9HA 2P2HA 4MEDA 3C0IA 3EQIA 3VUHA 3QQGA 4NTSA 2EUFB 1WBTA 3HV3A 3CBLA 4ZSGA 3OXZA 3Q4ZA 1U4DA 3OP5A 3SC1A 4PL3A 5TR6A 3AMBA 3NUUA 4W4VA 4ERWA 1XH9A 5HTCA 5J79A 3F69A 5JKGA 4DA5A 1ZYJA 4MX9A 5EYDA 4F0FA 2OWBA 4FC0A 2CHLA 4ZSEA 4F9WA 1V0OA 1NT2A 3PG1A 5EDPA 3V5JA 2R3GA 4EOPA 2PWLA 5CASA 3QF9A 4C4IA 5L8JA 4AGUA 2C5OA 3OWJA 4GYGA 2VWBA 3U6JA 1BYGA 2EXEA 3SVVA 2C0TA 2F2UA 3C5IA 4EC8A 4FV6A 3JY0A 2WQOA 3LFCA 2BKKA 3NZ0A 4BDCA 5FG8A 2ZV2A 4AOJA 3D5UA 4RJ8A 1Y57A 4FSZA 3PLSA 1SVGA 1U54B 3IW6A 3EZRA 2CKPA 2ACXA 2OICA 3O51A 4CFUA 2OFUA 3OD6X 3SW7A 4FSTA 2G15A 3O8PA 2FYSA 4R1VA 4LFIA 4FVPA 1OIUA 2VWXA 1WZYA 2C30A 5JSMA 2XNOA 3W16A 2PVNA 1P4FA 2B9FA 4G3FA 3DB6A 4IAIA 5HICA 3R7IA 5B7VA 5LMKC 1XH7A 5FEQA 4TZRA 3F5GA 2QC6A 2FSOX 5C8MA 3SXSA 3ZSHA 5M56A 3FZSA 4O22A 3H10A 1YRPA 2X8EA 4RG0A 1G8SA 1YQJA 1P14A 5EFQA 4BYJA 2UVYA 4H05A 2B7AA 2YN8A 5AR2A 3K5VA 2ITTA 2Y6OA 3AD6A 2XKEA 2PTKA 3QXPA 4RJ4A 3MVHA 3R63A 3NS9A 3R01A 4UZDA 5CSWA 3SV0A 5BVFA 3SG9A 4AA5A 5M08A 4IQ6A 4FF8A 3TUBA 3DJ6A 4FKWA 3QCQA 4HNIA 3V5WA 4GG7A 1WBVA 3T8OA 5J5TA 1WVYA 3QQUA 4FV0A 3W10A 3EMGA 3RKBA 4QMWA 5EHLA 3WZUA 4X3FB 2YM8A 4IDTA 2I0HA 4XS2A 4C4HA 3QTSA 2J51A 5HX8A 1U46A 3OOMA 3HVCA 2CPKE 3D7TB 5CXZA 3E8DA 4YNOA 3LFBA 4BCIA 3OY3A 2W96B 1CDKA 4MNFA 3TKHA 3NVMB 3UTOA 3PRIA 3W33A 2BAKA 3QC4A 1UKIA 3ORKA 2GS6A 4W4XA 2R5TA 3UPXA 4AZEA 4TYHA 4Q9ZA 4E4LA 1Q8WA 2YIXA 5HGIA 3TJDA 4PMTA 2CDZA 4C59A 4BCHA 5GZ8A 3Q2MA 2QU5A 3BEGA 1M17A 3ZUUA 2X0GA 3WZDA 2VTPA 3GFWA 4PTCA 4IBMA 4TYIA 4JBOA 3UIBA 4C37A 2VAGA 4QTAA 1YI6A 4FYNA 5AX3A 3UVQA 1ZOEA 4QP6A 1FBNA 3RAIA 4BBEA 4EZ3A 2YJSA 4XV2A 5LCKA 3HP2A 3ZFXA 5FXRA 4DN5A 1CTPE 1PF8A 1JKLA 2QLQA 3DQWA 4YGAA 1X8BA 5BVWA 4KWPA 5C1QB 4YTFA 1Y8GA 2QHNA 4RVMA 2WTKB 3BV3A 2YM4A 3R71A 5HI2A 4OAVB 2YDKA 4Q2AA 3TZ7A 3MPTA 5AP3A 3LFDA 1FGKA 2QOBA 4AG8A 5AP5A 3MVLA 3KXMA 4FEQA 5EKOA 3SA0A 4KIQA 4TPTA 2BRGA 4APCA 4BIEA 3OWKA 3KCKA 2HK5A 3WF5A 2J0MB 3R8MA 5M07A 3ZSGA 2V62A 5E90A 4PUZA 4TL0A 2X2KA 4NYEA 1IG1A 3LXPA 4A07A 4FK3A 3O17A 2PVHA 2W1ZA 4U97A 3ETAA 4YJTA 3QFVA 3EIDA 3MSSA 4GFGA 3VW8A 5A54A 3POZA 3DDQA 4DE4A 2VTHA 4KBKA 3ZYAA 4UEUA 3OVVA 3VS6A 4A7CA 2C6LA 5K4JA 4ZMFA 4QP7A 4XNEA 3OXIA 4GK3A 3UO6A 1AGWA 2GNLA 4KSPA 4F9BA 2W17A 4RJ5A 3RAWA 4E6CA 2XNEA 3HL7A 2YM7A 2FSTX 5CNOA 3NYOA 4B8LA 4C3PA 4FV5A 4QMUA 5A4LA 3R9RA 4BWKA 4YHJA 3DBCA 5HVYA 4FBXA 3NUPA 3PSBA 4FT3A 4NEUA 4EORA 4RIWA 3AGLA 4ZIMA 1YHVA 1ZYLA 3AT2A 3EN7A 1PXOA 3O7LD 1I44A 1JWHA 4W4WA 2VTQA 4X2KA 2JKQA 3F5UA 3SOCA 4F65A 4CTBA 2R3RA 4I0RA 4BDHA 4XG9A 1H8FA 2VTMA 2QOFA 2J6MA 3ORMA 3RK9A 4DLJA 5GIOE 4EOLA 4PPAA 4GK2A 4V0GA 2Y9QA 3L9MA 3FY2A 4IC8A 5HLPA 3QQKA 3E88A 3F3VA 4FUXA 4K0YA 4ZZOA 3E93A 5DG5A 2O3PA 3W18A 5EDQA 4CMOA 3QC9A 3M2WA 4NFMA 2XNNA 3QLGA 5JFWA 4EH5A 5L2IA 5DFPA 3PVUA 3L9PA 3E62A 4BKYA 1BUHA 3H4JA 2B0QA 3GU8A 2VTTA 3QKLA 3ZBXA 5K3YA 3B2WA 4OGRA 5HNIX 1J7LA 5HG8A 4RC4A 1REKA 4OLIA 3UO4A 3FI2A 4FKUA 4U5JA 2VWWA 3MIAA 4U40A 2JGZA 4ZJJA 3MPAA 4DHFA 1R1WA 2BRBA 1OL7A 3BU5A 2G2HA 2WIHA 3BLHA 3BX5A 4FTQA 4O2PA 2WEIA 5I3RA 2UZDA 4FIJA 5HESA 3UIXA 3NWWA 5TT7A 2QLUA 4YLLA 3TM0A 3KMWA 4IHPA 4MXCA 3FI4A 5BYLA 4E26A 3I81A 3E8EA 4MVFA 5AV1A 4BDJA 2I7QA 1KWPA 4LOQA 3QL8A 2I0EA 4IEBA 2NP8A 4FR4A 3U55A 2YM3A 5ANGA 1YWVA 3TG1A 4CVAA 4LRJA 5EHOA 4A4LA 3QRIA 1L3RE 4DTKA 4IFCA 1UNGA 4AE6A 3ZRMA 5J1WA 2XIYA 1OIRA 3MFRA 3EN4A 5HHWA 3O96A 5CYIA 1JSVA 5HZNA 1Q5KA 4JVGA 2Z2WA 3KULB 3UODA 4EI4A 3PLAE 4CFFA 2O63A 2EXMA 4WG4A 3V5QA 4MXZA 4WD5A 3QX2A 3IG7A 4FNXA 1ZLTA 1PYEA 2QR8A 5AWMA 2FH9A 3KF4A 2QOHA 4X6RA 1M2QA 2XRUA 5HU9A 3R8LA 3PIZA 4JXFA 3DNDA 3GC0A 3H30A 4WSQA 4J8NA 2PK9A 2WQNA 4H36A 4RX7A 5EHYA 5M57A 3KK9A 5D41A 4YLKA 3Q9YA 4BKJA 2BDFA 4CTCA 1V0BA 2BRNA 3MWUA 4ANOA 3HUCA 1ZMWA 2E9VA 2F49A 3LLTA 1WBPA 2VGPA 4O0YA 4ANQA 3Q4TA 5HCXA 3ZXZA 5H9BA 4DFUA 3BLQA 4M15A 2XIZA 4EZ5A 4JDJA 2UZEA 3QU0A 1SNXA 2DWBA 5L2WA 4FTLA 2B4SB 3CCNA 3G6GA 3QRKA 1PXPA 3BYOA 5H8EA 2GFSA 5LXMA 3CS9A 3FXWA 4AGCA 4OBOA 2R64A 2VNWA 4G16A 4FOCA 4OAUC 1BLXA 4XEYA 4Z7GA 5J7HA 3G6HA 2GFCA 2ITNA 3RPRA 5GIPE 3F66A 4XP3A 5EI6A 4NU1A 3R8ZA 4CFWA 1JKTA 3AC3A 3VS0A 4BZNA 4XYFA 1IA9A 4OTIA 4R5SA 3OT8A 1YXTA 5CI7A 5LJJA 4L45A 3EN6A 3RCDA 3TDVA 3R30A 3UIMA 4JBPA 4O0TA 3RWQA 4OBPA 2O65A 5GINE 3O71A 4U3ZA 5HNGA 2AUHA 2VTAA 3DZOA 5AV2A 5E8XA 4NUSA 3RPSA 2Z02A 3QQJA 4CZTA 2OW3A 3VVHA 4AGWA 5M53A 4D4RA 3H0YA 3LMGA 4S32A 4GIHA 3ZO4A 3QZFA 5EDRA 3LOKA 1G8AA 1QL6A 1ATPE 2VTOA 3DJ5A 3W2OA 5CNNA 5F95A 2UW5A 3PDTA 1IRKA 1LP4A 2XCKA 1W84A 2JKOA 4BIDA 4AZVA 2QQ7A 3TEIA 4CLIA 4BWPA 1Z57A 1W8CA 1Q24A 4NKAA 4ZEGA 3S4QA 4Q5HA 4C3FA 3E8CA 5EYCA 3VN9A 5T6KA 3FPQA 4CG8A 5CT7A 4C62A 1O6KA 3WILA 4EYJA 4FSNA 3PPKA 2X8DA 2JITA 4TW9A 5DEWA 2HW6A 4K11A 4EKLA 2YM6A 4H58A 4HOKA 1ZWSA 5FDXA 5HTIA 4H1JA 3FZ1A 2I0VA 2C6EA 3BEAA 5J1VA 2PZ5A 4PDYA 2BZHB 3HAVA 4KIKA 5B2MA 4OTGA 3FLSA 5GJGA 3GU7A 4F64A 5M09A 1JSTA 3HV7A 5AP2A 2VZ6A 3ZFMA 2E9OA 4IAAA 4BBFA 4XJ0A 3VUDA 3NIZA 3U8WA 5JRSA 3BHYA 2C3JA 2AYPA 3GEQA 3KXHA 3HMOA 3R6XA 3IDBA 4XLVA 5C27A 4WUNA 5CF4A 1F0QA 4J99A 2REIA 4RVKA 1W98A 4RLKA 5HG7A 4IAZA 5KMMA 4K33A 2OJFE 2BVAA 2C0OA 3BYSA 3CQUA 4L46A 2IO6A 4GK4A 3HEGA 4IM3A 4FKRA 1QPCA 4Y73A 5CU6A 4XCUA 5IQBA 2WMWA 1PRYA 5K5NA 4YTHA 3IW4A 3KXXA 2UVZA 2XYNA 4FTJA 5IZFA 1GJOA 2V7OA 4NKSA 3RNYA 1GIHA 5L2QA 3RP9A 4OTDA 3MS9A 4LM5A 2C4GA 4FV8A 2X6EA 4C4EA 4RJ7A 5EQPA 5IQIA 4FV9A 5K5XA 2WTCA 2YCRA 1YHWA 3SG8A 4PWNA 4PPBA 1YVJA 2XRWA 3EQFA 4O1OA 4QMXA 4UY9A 5T68A 4B0GA 4DH1A 4PMPA 2WELA 3EKNA 3BELA 3MESA 4IX6A 4PMSA 4BZOA 1LPUA 5E8YA 1E1XA 5LVLA 4K8AA 2R3MA 2F9GA 1JOWB 2GS7A 3LFFA 3DA6A 1F3MC 3RHKA 4BTFA 1H1QA 3S1HA 3LFQA 4WT6A 3QCXA 4R7HA 5HORA 3C7QA 4I6BA 1SYKA 4JR7A 3L1SA 1OMWA 2QONA 5M44A 3OTVA 3GP0A 2OLCA 2P33A 4YJNA 5KX8A 1BX6A 2HYYA 4QMTA 2VO0A 3EN5A 3HNGA 5I5ZA 3COMA 3TV7A 3EOCA 2CLQA 5BUEA 1Q61A 4QP8A 1W82A 4HVSA 3UJGA 1JPAA 1GZOA 1H26A 3OOGA 4L3LA 3NSZA 4ONAA 3TTIA 4QP3A 2JIUA 5JGBA 4EJ7A 4CFNA 1GAGA 3C4EA 4PNIA 2CLXA 4DH8A 3N51A 4UZHA 3NUNA 3KRRA 2J0JA 3G9LX 4EHGA 4AQCA 2HZ4A 4YSJA 3P7CA 3U6HA 2CCHA 3O23A 4W8DA 2W06A 2X7GA 5HBJA 3NCZA 4UBAA 2A4LA 3Q32A 3UVPA 2YZAA 4RJ6A 1PY5A 3FWQA 5E8TA 1BI7A 2OXYA 4YHFA 4MAOA 4JLCA 4BDBA 3LM5A 2X7OA 5EH0A 2UZNA 4HYUA 4JIKA 3I0OA 3IKAA 4WUAA 5JQ8A 4XLIA 3R9OA 4P4CA 2WTVA 4I21A 3O8UA 3PZEA 4QP1A 5HVKA 1IR3A 5B2KA 4A9RA 2KULA 3PRFA 3R04A 4JBQA 3ZEPA 3T9IA 3WYYA 2GNGA 4RIXA 3VRYA 4KS7A 1IEPA 3BHVA 3ENMA 3KU2A 5JFVA 2BDJA 1RDQE 3KB7A 3U51A 4CV9A 2PVJA 4FVRA 4I5MA 3FHIA 5E8VA 5DT0A 5ACKA 1PMNA 3P86A 1FGIA 3OBGA 4YPDA 5FEDA 1Q3DA 3ZS5A 4Y83A 4BN1A 4L9IA 3F88A 4TRLA 4C0TA 3GCVA 3QD3A 4NIFA 3W8LA 4CG9A 4LMUA 4NZWB 3DBFA 5AUYA 4BDFA 4TKSA 5M4FA 3VS4A 4PDSA 3JVRA 3W2QA 2W1FA 4QTCA 1UU7A 4C4JA 1PXIA 2YWPA 1JNKA 2OJGA 2UW0A 1H1PA 3MW1A 2OGVA 5I9YA 5BQ0A 4QMSA 4PDPA 3BRBA 4YO6A 4LV8A 4GVAA 2YJRA 3OCTA 3AMYA 4IB3A 4K9YA 4DFLA 4AS0A 4DFXE 4YTCA 3C13A 3DDPA 3G0FA 5EM7A 4HPUE 3PP1A 4L42A 4QMZA 5E1SA 4D4YA 5A4TA 4PRJA 1NVRA 3I6UA 4AGDA 3QHRA 1AD5A 4QMVA 4C7TA 2HZIA 4MF1A 3ZM9A 1QPDA 3PUPA 2VV9A 4X7QA 4S31A 3FEGA 3FZPA 5AADA 3TZMA 5ANJA 3DY7A 4XV1A 5AUZA 3K5UA 1OBDA 3ITZA 4CZUA 1PXLA 3D0EA 5F20A 3VULA 4IDVA 4HCUA 1JAMA 3LCKA 5AIRA 4D28A 4DFYA 4EONA 4FV2A 3PJCA 4QD6A 3ZLXA 5ETFA 1TQIA 4WNKA 1UA2A 4MD8E 3MFUA 4TTHB 1KE7A 4M7IA 5D10A 1CKJA 1Z5MA 3F82A 4IFGA 4AZTA 3E64A 4ZTRA 3FXZA 4P2KA 3A61A 1FVRA 3OG7A 3OCBA 4F9YA 2H6DA 5CF6A 5LMAA 1VZOA 5D7AA 5BYYA 2XM8A 3UOHA 2F7ZE 2UV2A 2X8IA 3V5PA 4UWBA 4JQEA 4HW7A 2GQSA 3BYVA 5JK3A 3LZBA 3VBXA 3VUMA 2OF2A 4F99A 3GQIA 5E8ZA 4CEGA 3QRTA 4EH6A 4F08A 5L8LA 1UVRA 4XBRA 4XX9A 3BV2A 3GU6A 4ZTMA 5HE0A 3UMWA 2VO3A 5EW9A 5AA9A 3I7BA 4YJOA 2CKQA 4FIHA 4D4VA 3IGOA 2VWYA 3LXKA 4FT5A 4R1YA 2VWVA 3LQ3A 4XH6A 2R2PA 3EYHA 3TNIA 1YW2A 2PU8A 4E4MA 2HIWA 3CQWA 4I4EA 3QD2B 3TI1A 3KVWA 3OBJA 3TN8A
chains in the Genus database with same CATH superfamily
2RSVA 4RC3A 3DU8A 3W0SA 4F9CA 3GOKA 2PVFA 2R3PA 4YC8A 3CPCA 4W9WA 3O8TA 4IM0A 5DRDA 3R7OA 1J1CA 2IZUA 2PZYA 3DBQA 4BI0A 2XARA 2ITPA 2QURA 3I1AA 1H1SA 3UQFA 2JKMA 1VYWA 4E6DA 4XG3A 3RTPA 3R1SA 2J9MA 3A4OX 5CWZA 4E73A 3RALA 5JN2A 5L6PA 5BUIA 1APME 4V05A 3OROA 4WNPA 2CMWA 4L52A 3O50A 1DS5A 3V5TA 3Q52A 1YKRA 1M2RA 4DAWA 2X0PA 3Q3BA 4QP9A 5AM7A 2VTNA 1YWRA 3ZZWA 4QPAA 2Y7JA 4AX8A 4DC2A 3NVKI 2VGOA 5CVFA 2JD5A 3DGKA 5JZNA 4RIYA 3IW5A 5M06A 4FNWA 4BCMA 5HEZA 3F5PA 3II5A 4RJ3A 2LGCA 5DA3A 3TXOA 2B54A 2JLDA 2C68A 2XVDA 2WB8A 4MK0A 2VX0A 2PMLX 1WBOA 3F61A 2PULA 3QTWA 2PL0A 3CE3A 4FSQA 4YZNA 5DR9A 2CKOA 2ONLC 1A9UA 3QRUA 4ZTNA 4KINA 5EI8A 1H08A 2ITXA 2XYUA 2WEVA 3D9VA 3FQEA 2WQBA 2W99B 3EQPA 3MA6A 3R22A 4IZYA 4ZTSA 1T45A 3REPA 5D7VA 4ASDA 3Q5IA 3CD3A 4C58A 3F9NA 2P4IA 5BYZA 3PJ2A 3H9OA 2JBPA 4F70A 1J7IA 3FMKA 3CJGA 4FX3A 3KFAA 4LRMA 1XQZA 3QD0A 4M69B 2J7TA 1PHKA 3NDMA 5CSHA 5DMZA 1XH4A 2FSLX 4YR8A 5IEXA 4QQ5A 3E63A 3TACA 3MYGA 2X81A 3HRBA 4CZYB 5CSPA 5KMNA 4LL5A 2HXQA 4R3PA 4EOIA 1PMVA 5AP6A 5HCZA 2IF8A 1NVSA 1XH5A 2PE2A 4FNYA 4NJ3A 2XNMA 4O4EA 4PL4A 5E1EA 5IUIA 1RQQA 3TNHA 1EH4A 2ITUA 3OC1A 1OUYA 1CSNA 3C4FA 3B8RA 3QXOA 3D94A 4MHAA 3JPVA 4TWCA 4GJ3A 4U45A 4AT3A 4YZBA 3FXXA 4O7ZA 3LJ1A 4QYEA 5B0XA 5LVMA 3E87A 3V6SA 4ERKA 3R9NA 3LCOA 2C5NA 4QNYA 4GIIA 4D4SA 3P7BA 4FSRA 2YWVA 2R3HA 3DBDA 3ORIA 3Q9ZA 2XNGA 3AD4A 1U5QA 4M66A 1URCA 2YDJA 5DI1A 3OY1A 1H1RA 4ACCA 4NM0A 2O5KA 1ZXEA 3ZUTA 4FGBA 4R7BA 5C4LA 3LQ5A 4MXYA 1P4OA 3MFSA 1B39A 2OH0E 2GS2A 4R8QA 3ZLSA 3KMUA 4DCEA 4XV9A 3P79A 1O6LA 4R78A 1ZY4A 4JBVA 4I5PA 4C02A 2Y0AA 3P78A 4AOTA 3HECA 5IUGA 4JMQA 3KGAA 4O4FA 4O7RA 3NAXA 2OIBA 3OCSA 3ALOA 4I92A 5C8NA 1R0EA 4EL9A 5JFXA 4X3JA 5C03A 2XK8A 3CJFA 3P9JA 1XMMA 5FP6A 3UDZA 3GGFA 1PMUA 2A2AA 3CY2A 5HVJA 3S0OA 4X2GA 3CGOA 4TNBA 3EQHA 2GMXA 3DCVA 4V0GB 4D2SA 3LCSA 3OCGA 4KIOA 5FGKA 3KF7A 4EKKA 3LHJA 4GEOA 5DH3A 4KNBA 4GUEA 2ZAZA 4DEBA 4EBVA 4FE2A 4I5HA 1YXSA 5DR2A 3OWPA 5ANKA 4FIGA 4A06A 3ZTXA 5CT0A 3VHKA 2UZVA 5CAQA 5M4CA 3COHA 4HGEA 3VS7A 1Q8YA 3IPHA 3AC2A 2X0OA 4FTTA 5JT2A 4E93A 5IH5A 2P3GX 1XHAA 4MKCA 3SQQA 4Y46A 2AEGA 4AXFA 3DK6A 3A99A 4IJPA 3BU3A 4FZ6A 1J3HA 5CS6A 5J95A 5L2TA 2R7IA 3T3VA 4FEXA 4YO4A 3F6XA 3L8VA 4G6OA 4YPSA 1GZ8A 3PXQA 3Q5ZA 5J8IA 3SRVA 2X4ZA 4JR3A 3LFAA 4YP8A 3O0GA 5HO8A 4BDIA 1WBWA 1IAHA 4ZMEA 2XJ0A 4E5BA 2FB8A 4O7TA 5EM8A 4A9YA 2HZ0A 4RRVA 4R7IA 2Y4PA 5AAFA 2QO7A 1JKSA 3Q53A 1H01A 4TWPA 4G9CA 3TIZA 1UU8A 5BVNA 3DV3A 3HV6A 3TCPA 3KC3A 5DT4A 2JIVA 3DK3A 3HGKA 4MCVA 4XG6A 3GCUA 3ZHPC 4BFMA 3MTFA 2OO8X 1DAYA 4G2FA 2WMAA 2J0IA 3D14A 4V01A 4FKLA 4IWQA 2R3NA 4YC3A 5HD4A 3I7CA 3DTWA 5L4QA 5IH4A 4BCFA 4O82A 2GHGA 3PXKA 4J71A 5C9CA 1E9HA 3FAAA 3DKCA 4QTEA 4F0IA 1Q41A 2W1IA 1AQ1A 4B4LA 1KE5A 1FQ1B 4X6QC 3A7HA 3GI3A 4BHZA 2YERA 3GQLA 4U42A 5IMEA 3DB8A 4QYHA 2IZRA 4GL9A 3F2AA 3MPMA 4FK6A 3NNWA 2W4KA 4EWQA 2WOUA 4N6YA 5ANDA 3EJ1A 4OW8A 4BCGA 4CYIA 5IH6A 2X39A 5EM6A 3HMIA 3EFWA 3KRWA 1ZOHA 5HQ0A 3BWJA 3C9WA 3VJOA 2WQMA 3JUHA 4WIHA 5FBOA 2VU3A 3EH9A 2Q83A 3KRJA 4CFMA 4RWKA 2WNTA 3LJ2A 3QZHA 4JOAA 4HYHA 4KS8A 1MUOA 4ALVA 5LARA 4E7WA 3KKVA 4IE9A 4TWOA 5CXHA 3VQUA 3FSFA 4RT7A 2WMSA 4J52A 2WMTA 4ARKA 4ZAUA 5J87A 4XUFA 3FKOA 4BCOA 2QOQA 4AA0A 3HA8A 4K1BA 5FDPA 3N4TA 2HWOA 5CAPA 2VTLA 2YDIA 3PY3A 2QG7A 4BJJA 4DHJA 4N0SA 5AEPA 5I4NA 4PX6A 5GNKA 4EYMA 2FGIA 3EKKA 4W9XA 4ANMA 4BTJA 4TNDA 2Q0BA 4G6LA 2J0LA 4C36A 3G15A 3FY0A 5C4KA 2RG5A 2ZFYA 2VTIA 4P5ZA 4X3FA 3ZH8A 4C61A 4XV3A 4JDKA 3CSVA 4GKIA 3UDSA 4WG3A 2V22A 4G3GA 1URWA 2UW3A 3TV4A 1M14A 2BMCA 2UZTA 3ORZA 4YMJA 3FJQE 3UPZA 3DAKA 5EM5A 4RBLA 5EQYA 5JH6A 3AKLA 1DI9A 2GTNA 4BICA 2OZAA 2XBJA 3E7OA 4CCBA 2NYAA 4HGTA 4EK4A 4O0SA 5CEQA 5HO6A 3NMUF 2C3IB 1B38A 2R3LA 1STCE 2GU8A 3UNZA 3V6RA 3I79A 3I5ZA 1ZYDA 2HW7A 3VQHA 3D2IA 2CN5A 1BI8A 4LGHA 3QTRA 4O83A 4DTBA 2X7FA 4O0XA 5FRIA 4L53A 3FZOA 3HP5A 3FMJA 4RWJA 4OTWA 4I0TA 4BYIA 4KKEA 4F7SA 4QQTA 5LWMA 4PQNA 3MBLA 1NXKA 1PKDA 4NH1A 2G2FA 4F1MA 5A4CA 2BR1A 2XNBA 4B8MA 2P55A 2ITOA 3W2RA 4QRCA 4BRXA 4EUTA 3H0ZA 2HY0A 3EL8A 4G3CA 4IVBA 1OL6A 4PDOA 4PF4A 1M52A 1W2FA 2ZM4A 4GFOA 1OL2A 2OZOA 4KBAA 5A3XA 2DQ7X 5HE1A 2ZMCA 4AZWA 5H2UA 3CR0A 3PY0A 5CSXA 1WAKA 2OJJA 3QUEA 2NRYA 4MNEA 3V51A 3ZDUA 4BGQA 3PVBA 4I24A 1CKIA 3GC8A 4J8MA 4FZAB 4ACGA 4UMQA 4MBIA 2ZMDA 3MY5A 3VS1A 1GIJA 4QTDA 4RC2A 5A9UA 1UNHA 3BYUA 4WG5A 1J91A 4O4CA 4EQUA 4YJQA 2NO3A 5JGDA 2C0IA 1IAJA 4KIKB 2GCDA 3UG2A 5HU3A 3NYNA 5AMNA 3EQDA 3PFYA 1TVOA 5M4IA 2DYLA 3C4CA 5CENA 4U80A 5DOSA 5CY3A 4GCJA 4DEAA 1REJA 1JBPE 4O4BB 5AUWA 1BL7A 4IAYA 3UIUA 4BDGA 4NWMA 4D58A 5J5SA 1ND4A 4YZMA 2XB7A 4RX8A 5AP0A 2PZRA 3LXLA 3R1NA 4FG9A 3RK7A 3FI8A 5KMLA 4EK5A 3TTJA 3KXGA 5AX9A 1GOLA 2WD1A 3ZDIA 3NAYA 3TUCA 4N4SA 4JS8A 1G3NA 4C2VA 3D2KA 4RWLA 5AR7A 3FPMA 4O7VA 2WOTA 4H3QA 5CSVA 3RBWA 3L8SA 3OW3A 3RI1A 4MBJA 3TV6A 4BTKA 4FA2A 4IB0A 5BUJA 4YNEA 4WBOA 3G90X 4U9AA 4FSMA 3MH1A 2E2BA 5JZJA 1ZMVA 3UZTA 2BKZA 2IVSA 5F4NA 3I5NA 4AFEA 3LXNA 5DVRA 2ZVAA 2BZJA 3QQHA 3KN5A 2XIXA 1RJBA 4G31A 2YEXA 3NUYA 4M67A 5HCYA 1DI8A 3G2FA 3O5AA 3VBTA 3MVJA 2W1CA 2WGJA 3ODYX 3AC8A 5AP1A 4ACMA 4F1OA 5AUTA 1TQPA 3KRLA 3FBVA 4AWIA 3N9XA 4JQ7A 2QG5A 4FKPA 2RG6A 4IWOA 5ETCA 1MRYA 5CZHA 5CEMA 4O7NA 1GZNA 3R73A 4LMNA 3R83A 3VO3A 2VTRA 3COIA 5CQWA 2QO9A 2UW9A 4I22A 3NRMA 4PL5A 3RK5A 4L7FA 2V55A 1T46A 4HPTE 4AOIA 4U6RA 4I6LA 4A9TA 4C34A 5FXQA 2HENA 5ETAA 4YZCA 4HZRA 3I6WA 2BPMA 3Q9XA 4R3RA 3NNXA 4EC9A 4EJNA 4C8BA 3IO7A 2BCJA 4USDA 2XF0A 3EN9A 1K2PA 3V3VA 3P5JC 5HBHA 2OSCA 3ORPA 3FKLA 3WF6A 2ITQA 5D12A 5IQGA 5BVEA 5HBEA 3MH0A 4JDIA 4PTEA 5FD2A 4TYEA 3NUXA 2R3FA 4QTBA 5E8WA 5ITAA 4KAOA 4AXDA 3UE4A 3W0PA 5M4UA 3B2TA 4UMTA 4G5JA 2G01A 4ITJA 3RZFA 4CCUA 1FVTA 3FKNA 3PSDA 4BBMA 2F57A 4HGSA 5E7RA 4LG4A 4F7JA 4QOXA 4EQMA 4O0RA 4CT1A 5HKMA 4NT4A 3VWAA 4GSBA 4D9UA 4QMQA 2HAKA 2W5AA 2PVRA 3ERKA 3SW4A 3FV8A 4ALUA 4EHEA 4LDTA 2J50A 1K3AA 5CU2A 4O84A 3FMDA 4F6WA 2DS1A 1KUTA 2J2IB 3KA0A 2WHBA 5CLPA 1PXMA 4I3ZA 5IQHA 2Z7RA 1Z9XA 5IEVA 1OI9A 4FODA 4YSMA 3U4UA 4Z7HA 5F9EA 3WZKA 2OBJA 1FOTA 2OJ9A 4EH4A 2J90A 4F6SA 4CXAA 4USEA 2E9PA 2F4JA 5ICPA 3QHWA 1P5EA 3UDTA 4Q9SA 2C6MA 4J7BA 4MQ1A 5DPVA 5CANA 3D7ZA 5KHXA 5EKNA 5A46A 4WKQA 4AAYA 3KCFA 3PXRA 4NIFB 3DLSA 3KREA 3MN3A 3A8WA 4GYIA 3GFEA 4I4FA 4EEVA 5CAUA 1G8KA 2PYWA 2C47A 5BVOA 3DXNA 4ID7A 4RIOA 5DIAA 4MXOA 4MXAA 3MB6A 5DWRA 3NYXA 1JQHA 5I3OA 5CX9A 3DKFA 2F2CB 3K2LA 4G5PA 4ZXTA 4E6QA 4AXAA 2RL5A 5EOLA 2UW6A 3EB0A 3BHHA 4NL0A 4JX7A 4BL1A 3EYGA 4Z16A 4B99A 4AW0A 3F3WA 2GQRA 3WBLA 1DM2A 4LUDA 2UZUE 4IB1A 4D2RA 3IECA 1Y8YA 3PY1A 4P5QA 5DN3A 2IW9A 3R02A 5E8SA 3Q6WA 4JT3A 5DRBA 3UG1A 3U6IA 1VLRA 3C50A 4R6VA 2OI4X 2GNFA 1MP8A 3ZC5A 4O21A 3HRCA 1ZAOA 3VS3A 1G5SA 3ZOSA 3D4QA 4JL9A 2ZJWA 3NUAA 3SXFA 5FUTA 2B53A 2Z7LA 3Q6UA 5DEYA 3UO5A 4M68A 3EL7A 1XH6A 3P23A 5HG9A 2ZOQA 1SMHA 4TWNA 4C4GA 3FLYA 2IEWA 3P0MA 5IQAA 2BTRA 3DLZA 3VJNA 4IWPA 3BCEA 4QNAA 1LEZA 2YM5A 3KK8A 3JR1A 4DEDA 2VUWA 3K3JA 2LAVA 3UZRA 4AW2A 1BMKA 3EQCA 5L6WL 4P7EA 1Y6BA 1YOMA 4DINA 5BVDA 3G5DA 1UKHA 3KY2A 5B2LA 5IA0A 4TYJA 4O86A 1A06A 3VBWA 3JS2A 4UXLA 4DLIA 4CV8A 5FTOA 4IM2A 5CU4A 3VAPA 5GJFA 4E6AA 3FSKA 3MY1A 5E91A 3SXRA 3PPJA 5LVPA 5HTBA 4ACHA 4XOYA 3AQVA 5DBXA 4FSUA 4KKHA 2BIKB 1H28A 3SHEA 3HDNA 2J5FA 3BQRA 1FINA 3LCTA 1GNGA 3MY0A 3DTCA 2ETKA 4X2NA 5FEEA 4NSTA 3IDPA 2UZWE 2XMYA 3D5XA 3QTZA 1H1WA 4W4YA 1H0WA 2YZLA 5AR8A 4ZZMA 4G34A 3PFQA 1OPLA 5EYKA 3UP7A 3UOJA 3PWDA 1YWNA 1OIQA 3VBQA 4EOKA 3W0MA 4MTAA 1XJDA 4E20A 3GC9A 3JVSA 4M14A 3WF8A 5A4EA 5FLFA 2FO0A 1OL5A 1DAWA 2DUVA 3AC1A 3DAEA 2XIRA 1ZYCA 5C8KA 3W0QA 4J96A 3R7YA 2PUPA 2Z7QA 3V8TA 4BY9E 2O0UA 2QVSE 2JBOA 4CKJA 2UUEA 3OUNB 4CFXA 4M12A 2H34A 1QPJA 2CGUA 3EFLA 1S9JA 3HKOA 4L68A 3C51A 2XA4A 4IAFA 4RIYB 3ACKA 3IS5A 5FWKK 2PUIA 4NW5A 3O2MA 3DNEA 4BDEA 2C6OA 3TNPC 4CSVA 3ZXTA 4IANA 4P90A 3FMMA 4GS6A 4DFZE 1YDSE 2WKMA 4JX3A 4ANLA 2RFSA 2W1EA 5CVGA 1O6YA 2W5HA 3MH2A 2IZSA 5F1ZA 2A0CX 3SDJA 1OPKA 2J5EA 4PY1A 3CQEA 1H00A 3L8XA 2BALA 2V7AA 2XKCA 3OW4A 3R21A 2C6DA 2QI8A 4EHZA 2XEZA 3G0EA 2E9UA 2WMXA 4KA3A 5DE2A 4AF3A 4N57A 2C6TA 1VEBA 4Y5HA 4IX3A 4C3RA 4MQ2A 5IA3A 2VWIA 2YIQA 1UU3A 3QUDA 3E92A 3CD8A 5CTPA 2JDOA 4FKTA 3QA8A 4X21A 1UWJA 2W1DA 5LCJA 2WMQA 4CQGA 5HE3A 3PA4A 2W9ZB 3R8VA 4FL2A 3R7GA 3RNIA 3GU4A 3GVUA 5CEIA 4PP7A 5KBQA 3NCGA 1KSWA 4O0UA 4F6UA 2QOLA 3VS5A 1BL6A 1OZ1A 4FT7A 5AUVA 1ZRZA 4BIBA 3CTHA 3VUGA 2XK4A 3R00A 2AC3A 4AU8A 1PW2A 4ANBA 4L00A 4ZS4A 3QKMA 2GDOA 4L67A 2PVYA 4EHVA 4KABA 3SOAA 4L43A 3Q04A 3WYXA 4CGAA 2W7XA 5M51A 4YJRA 5CAOA 4ZLYA 1LUFA 1CKPA 1MQ4A 3OXTA 4DCAA 2QHMA 2XIKA 5J7BA 4BTMA 3FC1X 4WOVA 4CKIA 2RFDA 4AT4A 4FTIA 3SGCA 4DGMA 3MJ2A 3NW5A 4AT5A 5AUUA 2ITYA 4AN3A 2OF4A 2P0CA 4FKIA 4AP7A 2SRCA 3UOKA 2XZSA 3CTJA 5LMBA 1SVHA 5AFVA 5D11A 1NW1A 1H25A 1QCFA 3ZEWA 3KXNA 2OH4A 2IVUA 1GZKA 4AE9A 3BHUA 2ETMA 3SAYA 4EK3A 1HCKA 4MBLA 1Q99A 2OIQA 2JC6A 4D2VA 3ET7A 3EFKA 2WTIA 4ZTQA 4RQKA 3LKMA 1WBNA 2GSFA 2CN8A 2QOCA 4X0MA 4UB7A 2IWIA 4DGGA 3BWFA 3MJ1A 2ITWA 1KE9A 1UWHA 5BNJA 3KL8A 4EK8A 3W2PA 3OZ6A 4FTCA 5F94A 4MXXA 3RM7A 3ZU7A 3EQGA 2IG7A 4EQCA 5FQDC 2XCHA 2XJ1A 2CGVA 3N4UA 1H27A 4DBNA 5HIBA 1OIYA 3CKWA 4FTNA 4RMZA 4G3DA 4GU6A 3QD4A 4K18A 1RE8A 2C5XA 4AN2A 1S9IA 4ZS0A 4OTQA 4BI2A 4FG7A 5C01A 4YJUA 2ESMA 3MFTA 3DAJA 4AW1A 4WNOA 3KMMA 1U59A 4K77A 5IG1A 2HXLA 1PJKA 3AG9A 5A6OA 5KMKA 4D55A 5JGAA 4H3PA 4G17A 5I9UA 3BGZA 3FMLA 5ANEA 3RWPA 4ANNA 4ZJVA 3VUKA 2XKFA 4LL0A 3AC5A 4ENXA 3CLYA 3ALNA 4RZVA 3Q4CA 4TYHB 5GHVA 1W7HA 2JIIA 4YLJA 2QD9A 4YC6A 4E5WA 3F3ZA 2ITVA 3D5VA 2QO2A 3HV5A 4FTAA 4DYMA 2HWPA 4FTOA 4QP2A 4W8EA 4RWIA 3GU5A 3U54A 3ZMMA 4D5KA 1R0PA 3PG3A 2PMOX 4O0WA 4RFZA 5CEOA 3A7JA 2IPXA 3DFCB 3R7EA 3I4BA 4FL3A 3SKCA 5JRQA 4KRCA 2R3IA 3SRVB 3VRZA 3ODZX 4LV5A 1ZOGA 4YTIA 4D1SA 3RPOA 3TZ8A 3QGYA 1QPEA 3QWKA 4ALWA 1Y91A 4JG8A 3DS6A 3QTXA 4F9AA 4E4XA 5IMXA 3DBEA 4QMYA 2RFNA 2O2UA 3V5LA 5E9EA 4BHNA 4GMYA 5CI6A 5AV0A 3WARA 3L8PA 3VF8A 3SD0A 4HCTA 2WMUA 3AT4A 4NFNA 3LFSA 1YDRE 4FV7A 4I41A 2ZM3A 5DGZA 2A1AB 4BWXA 4Z55A 2PVKA 1MRVA 3FLQA 3R2BA 3HLLA 2XP2A 5JEBA 4IZ7A 3SX9A 2G2IA 5L8KA 2R4BA 2UZLA 3ANRA 4PV0A 3K54A 5HIDA 1Q8UA 2PPQA 4DG2E 2ZB0A 4ZSAA 5KBRA 4HVGA 2GHLA 4G3EA 4TXCA 5T3QA 1OB3A 2WU6A 1B6CB 4F0GA 3BZ3A 4WRGA 1YHSA 3GXLA 3QZIA 4J53A 1H0VA 4AQKA 2XKDA 4U41A 1IA8A 2PUNA 1O9UA 3DXPA 4I1ZA 2Y8OA 4O1PA 5AR3A 4B6LA 4O7WA 1Q97A 2FVDA 4OTRA 3DJ7A 1ERKA 5AV3A 4I6HA 3BBTB 3FZRA 2C1BA 2VN9A 4GVJA 2OK1A 1JSUA 4U44A 5K0XA 2NRUA 2I6LA 1FVVA 4CYJA 3A7IA 5TKDA 4TYGA 3CGFA 3UOLA 4WSYA 2JFLA 2XK6A 3A8XA 3FQSA 5DHJA 1XMLA 4RIWB 3TDWA 3GOPA 3NGAA 2VWUA 4C38A 2WTWA 2H9VA 2Y4IC 4DFBA 1XBAA 1V0PA 3P7AA 5HG5A 5KZ0A 2VX1A 4IWDA 3MDYA 1VYZA 3E7VA 4FTRA 1ZY5A 3H3CA 4FTKA 4Q5EA 4EOSA 2WPAA 5AAEA 1VR2A 4ORKA 2W4OA 4M13A 4BB4A 4EBWA 3PJ1A 4S33A 1CMKE 2WU7A 4F09A 1ZMUA 3I60A 5ETIA 2UW4A 1IASA 1OUKA 3ZRLA 3PPZA 5FXSA 4D0WA 4DH7A 5IUHA 4FOBA 2XALA 3W0NA 2UZBA 4QMPA 4YURA 1KV2A 4JRNA 4EWHA 4BC6A 5HIEA 2HOGA 4OBQA 1HOWA 3IQ7A 3R28A 3G9NA 4XRLA 5CF5A 2XNPA 1ZARA 4PMMA 3UQGA 4HVHA 3I0QA 4C33A 1KE6A 3PJ3A 4IMYA 2F7EE 4KKGA 4UMUA 3PIXA 4GG5A 3PXYA 3S3IA 1WCCA 4NM3A 2GPHA 3ATTA 4HYIA 1M2PA 5LOHA 5JQ5A 3H9RA 3FE3A 4G1WA 3R1YA 2BHEA 3BGQA 4M3QA 5GZ9A 1R3CA 4JI9A 3THBA 2H8HA 3T9TA 2XAOA 2OZAB 2R3JA 3D15A 4UYNA 3WE4A 4QDVA 3F3TA 4IZAA 3KIOC 3R1QA 2B55A 4GUBA 5TE0A 2OIDA 2P2IA 1Q8TA 5KCVA 4FTUA 4V04A 2XM9A 3UZPA 2XK9A 4FIEA 5D1JA 3V8WA 1MQBA 2QKRA 3EQBA 3QTUA 4G6NA 3EWHA 4E1ZA 4YBJA 3LM0A 3TL8A 2ERKA 2F7XE 3LIJA 3LMHA 3LW0A 4EK6A 2UW8A 4IADA 5HNBA 3HAMA 4FSWA 2JDTA 3G51A 4FKJA 3Q60A 3QWJA 4IVDA 4N6ZA 5E92A 4M69A 4XG8A 4GRBA 5IDNA 2WMBA 3HZTA 4JRVA 4HGLA 2EWAA 3QZGA 4FJVA 2OU7A 2CCIA 1SNUA 1WBSA 3LQ8A 1OL1A 3PTGA 4BCJA 3E5AA 5LVOA 3WIGA 4PP9A 4NK9A 4QT1A 4O7YA 2EU9A 4S34A 4MNEB 1OKZA 4IW0A 3PIYA 4E5AX 4FTMA 4QPSA 4PNKA 2C6KA 4FKGA 3PXZA 4H1MA 1U54A 3QTIA 3QBNA 4C35A 1XBBA 3P08A 3DXQA 3RVGA 3EHAA 1CM8A 4NM5A 4CLJA 3GT8A 2UZOA 4CKRA 4LGDA 1KE8A 2XH5A 4UALA 3QGWA 4RVLA 5IKWA 1KV1A 5I9WA 2ZDUA 1XWSA 4NM7A 4U8ZA 2Y6MA 4EOQA 3NW6A 1ZZLA 3U4WA 2R9SA 4ZK5A 3GCPA 3WF7A 3COKA 4PTGA 3W8QA 3BE9A 3ROCA 4KD1A 3UDBA 3A2CA 3E3PA 4QDEA 5IQEA 5H3QA 4CRSA 4O7LA 3AMAA 3FLZA 4FRFA 2HY81 3F3UA 4CQEA 2R0UA 2R3QA 1H07A 2YCFA 3C4ZA 1I09A 4S2ZA 3TNWA 5AA8A 3UYSA 1LR4A 4MF0A 3TKUA 1XR1A 4FYOA 3DKGA 3AT3A 4LQMA 2ZV9A 2GNHA 3QTQA 4WNMA 2EB2A 3ULIA 5CU3A 4ZTLA 2VRXA 3OUKA 5CAVA 3UMXA 1L8TA 2WMRA 2B9IA 4XG4A 4XRJA 4CMUA 1PXKA 2JAMA 4MWIA 2XANA 4E8AA 4HNFA 4ZSJA 2W05A 2BRMA 3O7LB 4KSQA 4DEIA 4J95A 3WF9A 3W2CA 4DEEA 3U87A 1XKKA 1JKKA 4XHKB 5LWNA 3C0HA 1W83A 4XP2A 4ZY4A 2ZM1A 4FV1A 3D7TA 2W0JA 2OXXA 4GU9A 3BU6A 2PZIA 2I40A 2GHMA 3DK7A 5HO7A 3LLAA 1W2DA 2AQXA 3P1AA 1BKXA 3HUBA 3R2YA 2VX3A 3R7UA 3IOKA 2CNVA 4AFJA 5E4HA 2WQEA 2QODA 3MVMA 4EUUA 3BE2A 2ZDTA 2BILB 2CSNA 3NUSA 2X0QA 3BIZA 4L7SA 3FDNA 4BCQA 3R8PA 4D2PA 4BZDA 4BR3A 4NCTA 3HRFA 2ETRA 3ZSIA 5KKRC 4FUYA 2EVAA 5IQDA 2V0DA 5E8UA 3VNTA 5G1XA 4B9DA 4LUEA 3TZ9A 4Y95A 5J9ZA 4QQJA 4IAKA 5IDPA 4DG3E 4D9TA 3D5WA 3OTUA 4YJVA 3ZM4A 3LMIA 3UP2A 4IXPA 3ZO3A 4O0VA 4Y5QA 3RAHA 4DG0E 3JY9A 1WVWA 3PP0A 5I9XA 3NPCA 5BMMA 3QRJA 3CIKA 4L6QA 1UNLA 1YXVA 4EH7A 3ZRKA 4FZ7A 4GT5A 3A7FA 2I0YA 2YA9A 5EK7A 3WZEA 3HV4A 4F1TA 5EQEA 5CEPA 3PSCA 3TJCA 4K6ZA 4D1ZA 4ZY5A 4GT4A 5DR6A 4TY1A 5I9VA 3AOXA 3S95A 3NNUA 3ORTA 4BDKA 4LI5A 1SZMA 3ELJA 4J1RA 4ITHA 3F7WA 2BUJA 4WO5A 4CRLA 2CGXA 2X6DA 4I6QA 3LVPA 2YITA 3WZJA 3POOA 5IA2A 3LCDA 4O96A 2JFMA 5A14A 1YOJA 4DEGA 2JAVA 1XH8A 4AZFA 2J4ZA 2XS0A 3MV5A 2VD5A 4JIAA 4XG7A 5CEKA 1PYXA 1E1VA 3EZVA 3FC2A 3VIDA 5I9ZA 3C1XA 4D2TA 2JDRA 3DKOA 4FSYA 3BI6A 4RLLA 1F5QA 1OVEA 4B7TA 4CD0A 2E9NA 1M7NA 2BIYA 4RVTA 3ULZA 2YIRA 3RJCA 4CNHA 4N70A 4DDGA 4U7ZA 3IW7A 4ITIA 4JAIA 3ENHA 3QYWA 1H4LA 1H24A