5BVDA

Tetrahydropyrrolo-diazepenones as inhibitors of erk2 kinase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
350
structure length
330
Chain Sequence
AGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVTRWYRAPEIMLNTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Tetrahydropyrrolo-diazepenones as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 115
structure length 330
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bvdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bvdA01
4FV2A 4EH5A 4B99A 2XZSA 2Z7RA 4NKSA 1J1BA 4G3DA 3IOPA 5BMSA 3FXWA 2R5TA 2XEYA 4H3QA 2V62A 4YZCA 1LUFA 3NUYA 3FLQA 4NEUA 4G6NA 5A4TA 2VUWA 4IDVA 4D5HA 2WIHA 5AR4A 5KO1A 4Y83A 2W17A 4XP3A 1ZOHA 4FZFB 4WG5A 2C6LA 5HICA 3LKMA 4O7SA 3H10A 1V0PA 4D9UA 4FSRA 5C27A 1OGUA 3GQLA 3OWLA 5DIAA 3UIBA 2FUMA 2VTOA 2JBOA 3IDBA 5C01A 4C3FA 3F66A 3DJ5A 1ATPE 2C4GA 2CJMA 4RMZA 4ARKA 5LCKA 2PVNA 3KF7A 3ANRA 3ELJA 4BDBA 5IMXA 5IU2A 3L9LA 3H9FA 3CR0A 3OXTA 4F0IA 2C0TA 2X8EA 3EL8A 4C62A 4YR8A 2FB8A 3LLAA 4L52A 2RG6A 3ODZX 2OJIA 1YOJA 4B8LA 2VRXA 1JKKA 4JDHA 2GNLA 3ZBFA 2VN9A 3Q6WA 4AZEA 4QP6A 5JFXA 1FPUA 4MYGA 2ZMDA 1Z5MA 2VWWA 2B1PA 2WMSA 5EI2A 4CLJA 5KNJA 4HVHA 2WMUA 5H8BA 5ETAA 3VBWA 2YM6A 4BZDA 5AR3A 3TDWA 4OAVB 3PDTA 2R3JA 3TNWA 4OAUC 3KC3A 2YCRA 3RPYA 3U4WA 3AGMA 3EFJA 3KN6A 1U54B 3O50A 4FV9A 4G2FA 4H1JA 1OPJA 3AD4A 3EZVA 3KK8A 4XJ0A 2XRWA 1K2PA 3ZSIA 5CF8A 3OXIA 1JOWB 2V7AA 4E93A 3HA8A 5E8YA 3FMKA 2WZJA 2NP8A 4IBMA 4QMPA 4FKPA 3BQRA 3SOCA 3FMMA 4MTAA 4JIAA 2J0LA 3ZO3A 4EC8A 3A8XA 3TKIA 4TWOA 4X6QC 4J52A 3QX2A 2WQNA 4B9DA 4WT6A 5HG9A 3NW5A 3VUIA 3HDNA 3C5UA 2IJMA 2RL5A 3VS2A 5DRDA 3D5WA 4C38A 4FEVA 3IDPA 3RAIA 3A7JA 4FNYA 2QOOA 5EM8A 4C33A 4DTBA 4DG3E 3JY0A 3QTRA 4L68A 3BEGA 1APME 5L2IA 4JRNA 4XOYA 4F9BA 1ZYDA 1PXPA 1Q4LA 4IB5A 2C6EA 2XUUA 4R78A 3HV6A 4AACA 1ZYLA 5DGZA 2B9JA 1GZNA 3R0TA 3KVXA 4PMSA 2CKOA 4FT5A 4U6RA 3MGYA 5HO8A 1LP4A 2XJ1A 3P7CA 2RFDA 3ZC6A 4EJNA 3DTWA 5EDRA 2F7ZE 3QQHA 4L42A 4XLIA 4C35A 4DGLC 3BZ3A 4F99A 4E20A 1AQ1A 3NVMB 3IW4A 1RQQA 5AIKA 4YJPA 3UOKA 1OZ1A 5D11A 3NYVA 4O6EA 3VUHA 3NUUA 4ACCA 4IVCA 3KB7A 3ZSHA 3CJGA 2C47A 3VRYA 4AOJA 3TUBA 4BI0A 3UTOA 2O64A 4K2RA 3AMAA 3VJOA 1OL5A 1Y6BA 4QPMA 4K8AA 3D15A 2VTNA 5KKRC 1R78A 4MAOA 4O7WA 4AW0A 3C7QA 2PVMA 5K5XA 3PPZA 1YOLA 4JDKA 4U8ZA 4AGCA 4BGGA 5IEVA 2OGVA 4NYEA 1J1CA 1YI4A 1BYGA 1Q3DA 3QWKA 2YCFA 4HVDA 2WGJA 4XLVA 4FI1A 4FUYA 4V04A 2W4OA 3MY1A 5ANKA 1K9AA 3DOGA 4KAOA 1G5SA 3R7VA 3KRWA 4FTTA 3F3ZA 3RZFA 4R7IA 4D2VA 3OTVA 4NM0A 3DBQA 4APCA 3D4QA 5ANGA 4GT5A 5FM2A 2EVAA 5M07A 3DFCB 3NW7A 4FVPA 2B52A 1GJOA 3OF0A 3QTSA 5JEBA 4PRJA 4OTFA 2IPXA 2H34A 4O0XA 3EQRA 2X7GA 3E64A 2VX0A 5JK3A 4I0RA 3SKCA 4KIKA 1XQZA 2BVAA 4F9YA 3R1SA 4DBNA 2HOGA 3C50A 3QLFA 1VZOA 3QTUA 3BHTA 3HUBA 3MN3A 4IAAA 4IVAA 3ZOSA 4L67A 5KX8A 3UZPA 2JAMA 4C2WA 4EK5A 3BU6A 3ORLA 5CAQA 3A60A 2CMWA 5M4IA 3QQLA 4UXQA 3I1AA 4EL9A 3SXRA 4E4XA 3UBDA 1PW2A 1IA8A 3ETAA 2FH9A 3ZLYA 1MRYA 3LFEA 2G2HA 4O27B 2OIBA 4KKGA 2X7OA 3TUDA 2KTYA 3GU6A 3F6XA 1NA7A 3FL4A 1WBPA 2WMAA 5AIRA 4E5AX 4CFFA 5FP5A 4JAJA 4R5YA 3UMXA 1S9JA 3CD8A 1FVRA 2J5FA 2YJRA 4UWBA 5CU6A 4BB4A 5HNIX 5CYIA 2W0JA 3KF4A 3VQUA 2XA4A 1JVPP 3MVJA 5AEPA 5IQEA 2J0KA 3KK9A 3EN5A 5K4JA 4LOPA 4CCBA 1ZAOA 3AD5A 3RINA 5B7VA 4EHZA 2CSNA 5HD7A 3A8WA 4KUJA 1UNLA 3FZTA 5J1VA 4P90A 4ZTRA 3ULIA 3C1XA 2I0EA 3N51A 3FI8A 3FZRA 2RF9A 2E9NA 5HBHA 3U6IA 2E2BA 3PUPA 4GFOA 4O0TA 4DHFA 2FSMX 3VULA 2PVKA 4ZY6A 5JT2A 3S4QA 2VTLA 2WKMA 4AN9A 3WZDA 3UO4A 4PMPA 4YU2A 3U9NA 1XBCA 3NYOA 2W1FA 3AG9A 2YWPA 3Q5IA 1KE5A 4MBIA 3WF6A 3Q6UA 2ZV7A 2A2AA 5H9BA 4N57A 3V5WA 5FM3A 4XG4A 2BRGA 4Z16A 5CZIA 4PL4A 5DRBA 4BY9E 2ETRA 2R0UA 4JQ7A 3KXZA 2LAVA 4U97A 4M67A 3M42A 3LFFA 3R8PA 2YLEA 3EKNA 4IC7A 4D0XA 2WNTA 4NJDA 2ETKA 3H9RA 4PNKA 2WB8A 3DLSA 5K4IA 1EH4A 1H1QA 2QQ7A 4NM5A 4QMWA 3U51A 4GKHA 5HLNA 4KBKA 4FNXA 5EYKA 3OVVA 3GFWA 3PRFA 2JFMA 3A61A 4GT4A 3V51A 3P78A 4BCQA 4DFYA 1BL6A 2P3GX 4EOKA 4FIEA 3E8DA 3GXLA 5M4UA 4O7YA 3TJCA 4D4YA 4NM7A 4AT3A 2Z7QA 5L2QA 2ITVA 4G31A 4MK0A 2VX3A 2YAAA 3DK6A 4U9AA 2NRUA 5IQAA 4N6ZA 3TZ9A 5M44A 4S31A 5HG7A 2QHMA 4G1WA 5A4LA 5IEXA 4AA0A 3QTIA 4AW2A 4UMUA 3F7WA 4EOLA 4QPAA 2FGIA 1KSWA 1M52A 5HU9A 5I9YA 3C4FA 3MWUA 5LMKA 4MEDA 3TEIA 4G9RA 5EG3A 1P4FA 1OVEA 2PE1A 5M4FA 3F3VA 2GFCA 2C6IA 2UW4A 4GH2A 2VWXA 3QRIA 4ERKA 5IDNA 1KV2A 4FVQA 3TIZA 2WMXA 1ZYJA 4D2SA 4F7SA 2VO7A 3NPCA 4F9WA 1PKDA 4O1PA 4YC6A 3DKFA 4MNFA 4IAIA 3W2QA 1SVEA 2BFYA 1E1VA 1M2QA 4F7JA 2R3FA 2ZDTA 4QMVA 4AOIA 1W98A 3PVGA 2XM9A 3EN7A 4LGGA 4BDKA 1W7HA 1B39A 2VNYA 3R2BA 2X1NA 4S2ZA 4U3YA 4YO4A 5ETFA 2XK3A 3NX8A 5LVNA 3U6JA 3CS9A 3EIDA 3C0GA 4LRJA 5HNGA 2ZB1A 3MA3A 4FTAA 1ZYCA 2CHLA 3QCSA 4FK3A 5HIDA 3W8QA 3D0EA 1YXXA 4JNWA 4A9SA 4G6OA 4C02A 1R0PA 4EKLA 4TL0A 5ITAA 2I0VA 1F3MC 1BI7A 2YM5A 4FTUA 4QT1A 3UDBA 2A4LA 2R3KA 4KIKB 4RX5A 1H01A 2UW5A 3CCNA 4CCUA 4YC8A 4BDCA 4E3CA 3CGFA 4RBLA 4GFMA 1H1SA 5E8SA 3D14A 4PY1A 3ZDIA 3IG7A 4YJNA 3G9NA 1ZRZA 4FBXA 4X0MA 4FGRA 1IR3A 1PJKA 4QNAA 4JAIA 4JS8A 3G0FA 3PJCA 4KNBA 4MCVA 3U4UA 4DGMA 3BGPA 1VJYA 1KUTA 4TPTA 1NT2A 4XBUA 3KU2A 3FKLA 5HE0A 4YLLA 5AV4A 3NNVA 4NCTC 4ALVA 5H2UA 5EHOA 2IW6A 3HRBA 4RFMA 1OL7A 2Q0BA 3MPMA 1W0XC 4O0YA 5A9UA 4RLLA 4G6LA 4FA2A 4LMNA 3QUEA 4E5WA 1KE8A 2J50A 5A54A 4YJRA 4BHNA 4NL0A 5A4QA 1QCFA 2ITZA 3JY9A 3HA6A 1LR4A 4E8AA 1M2RA 3F5XA 1OIRA 1QPEA 2JD5A 2QR7A 3NGAA 2BPMA 5CF5A 3QC9A 5AWMA 3DQWA 3B8RA 2XVDA 4TZRA 3ZH8A 2XF0A 4FV7A 5AR8A 4O7TA 2QC6A 5KBQA 5HO7A 4QMMA 4ZY4A 4J7BA 4KRCA 3KL8A 2JITA 4YGAA 4DEHA 2W5AA 3LXKA 1JQHA 3VBQA 3ZMMA 3DNDA 3FPQA 4O81A 4L53A 2JDTA 4FGBA 5IA2A 3BHUA 3LCOA 1PMEA 3FEGA 2JEDA 4JBPA 2BZIB 5HTIA 2GNGA 4BRXA 5CAUA 5EOLA 1XH8A 4RA4A 2BAJA 3U6HA 2RKUA 2WQBA 3DFAA 5TT7A 4I5HA 5J1WA 1SMHA 1YWRA 4QTAA 3UZTA 1DM2A 3ZHPC 4UMTA 4EOMA 4XP0A 3ZC5A 5KHXA 3VAPA 3MPTA 4IHPA 3RK5A 2WIPA 5EK7A 3G6HA 4K33A 1YI3A 2VGOA 2Y4PA 4CNHA 3OCGA 3DTCA 4NM3A 3HGKA 2QI8A 2ITUA 2OH4A 2JGZA 2X39A 3NS9A 4TT7A 3SG9A 4XNEA 4BIBA 5A4EA 3FAAA 4C8BA 4YTHA 2J7TA 2VTHA 3JYAA 4QP3A 2OXYA 2UVXA 4KBCA 2ZV2A 3EQCA 4O82A 3FWQA 5I9WA 3UQFA 3LCTA 4I92A 4RJ8A 3NYNA 3R01A 3W16A 4BL1A 1YXTA 2ETMA 4HGTA 3Q4TA 4ITJA 5HBJA 3CLYA 4DF3A 2VO6A 2OZAA 3ULZA 4EOJA 4I1ZA 1R39A 4TWPA 2W1EA 5M56A 3F2NA 2ZMCA 5L2WA 4CKIA 3F5GA 2ACXA 2XMYA 2B7AA 2UVYA 3GGFA 4HPUE 2VTPA 3DV3A 2EB2A 3DXNA 4PDOA 2WEVA 1UV5A 4BCMA 4RG0A 2PVHA 2VTAA 3FYKX 4R1YA 1WBOA 2RIOA 5AP5A 1DAYA 4CZTA 1JKSA 1UU8A 5EW9A 2GTNA 2VV9A 3FY0A 3MH0A 3BU3A 4ALWA 5AR5A 4XX9A 4PMTA 3ZRLA 5LQFA 4FL3A 4G5JA 3DPKA 3EOCA 3OG7A 4O0UA 3HMPA 1LEWA 4MHAA 4Q9ZA 5LJJA 3GCVA 4E5BA 4BR3A 5B2MA 4FZ6A 4O2ZA 4OTRA 5CXZA 4EZ3A 2X9EA 3TNQB 3Q4UA 3AD6A 2GHMA 3EQFA 3DZOA 3I5ZA 4YJQA 1YXSA 4MWHA 5C4KA 3Q3BA 1UWHA 3GC7A 3R7UA 4L3LA 3RKBA 1FMOE 2FA2A 4FUXA 5CEKA 3HZTA 4HVIA 1UNHA 4FZ7A 5ANEA 4UMQA 5IQIA 3JS2A 2GFSA 3TV7A 4ANSA 4PPBA 3QAME 3LLTA 3RCJA 3MS9A 4AFJA 3R63A 2ITOA 4D2RA 1NW1A 5IQGA 2JBPA 3BHVA 2PK9A 4BZNA 1OKVA 4MH7A 4H3PA 3C4CA 2JDVA 1VYWA 2F57A 2GS6A 2OJJA 5AFVA 4YPDA 2PVJA 4R6VA 3DXQA 3SC1A 3PE1A 4XRJA 3BYMA 4YSJA 5FWKK 5K9IA 4IB0A 4IJPA 1Q8UA 4IM2A 3VHKA 4IFGA 3VN9A 4ZJVA 2HAKA 3KCFA 2OXXA 4GRBA 1NVRA 2UZBA 5FEDA 4S32A 4FOBA 5HLPA 3RP9A 4DH1A 1YI6A 5JRSA 4IZ7A 4UWCA 5D1JA 4IVDA 4IH8A 2G2FA 1Z57A 4USDA 3BLRA 5BVWA 5HEZA 2O3PA 3CKXA 3DKCA 4OLIA 1HCLA 3FQSA 2ESMA 4BIDA 5D7VA 4EH9A 5K0XA 5KMJA 2GMXA 3N4TA 5IF1A 2YCSA 3POZA 4M12A 4ZSJA 3DCVA 4ANNA 4Z7GA 2WQMA 4IQ6A 5D7AA 4BDGA 2O0UA 3AMYA 2V55A 2B55A 2HZ4A 3PPJA 3Q9ZA 2CKEA 3BELA 2BRBA 4H36A 4AAAA 5AMNA 3BU5A 1URCA 5AAFA 3H4JA 3LAUA 3F3TA 4IX5A 5C26A 3BBWA 5A6NA 3IGOA 3WILA 1JSVA 4XYFA 5KBRA 3FV8A 2HWPA 1PXKA 2BAKA 4YLJA 3ZFMA 1PXNA 4BIEA 2AC3A 4CVAA 4TYJA 5E9EA 1WVYA 4MD9E 2XNOA 1WMKA 2R9SA 2RFEA 4FV4A 4C4IA 1PXLA 2UW3A 4O7VA 3FBVA 3QRTA 1RDQE 2XKFA 3RK9A 5CI6A 3F82A 3LCKA 2W1DA 2X6EA 4X3JA 3F5PA 4YZMA 3KEXA 4GSBA 4R3RA 3QYZA 2C3JA 5CLPA 3W8LA 2HYYA 2ZM4A 2W4KA 4MXCA 3LCDA 2O2UA 5BNJA 1JSUA 4BCHA 2WTIA 3KULA 1REJA 4J97A 5CNOA 4C4FA 3DU8A 1VYZA 1ZLTA 4DFBA 4MBLA 2DUVA 3MJ1A 3WZJA 1SVHA 2BRMA 3K54A 4U44A 2HXQA 1ZMVA 5BUIA 3MFSA 3OROA 3BWFA 4ASEA 4BVUA 3MFUA 4P7EA 3JR1A 2IW9A 2YIRA 2VZ6A 4X2NA 4O96A 3R21A 5CAOA 5JMSA 3VS1A 1SYKA 4BBFA 3V8TA 4QTBA 3FSKA 4QP7A 3ZTXA 4C4JA 3RPRA 2UZDA 3MY5A 4G17A 4F1MA 5KMLA 3UNKA 3NDMA 2OJGA 4Y8DA 4EHVA 3V01A 5ACBC 1PYXA 5EW8A 4N0SA 4EH7A 2J51A 2OZAB 5GZ9A 5HG8A 4WIHA 3NR9A 4KKHA 4ZSGA 2FO0A 3DT1A 1CMKE 2UVZA 5D41A 2P55A 4O0WA 3ZUTA 1BLXA 4EEVA 3KXXA 3QGYA 5EKOA 3WZUA 2R0IA 4EH2A 1MQ4A 2E9OA 1OUYA 4IEBA 5CT7A 4MQ2A 3HAVA 3ZO2A 4ID7A 4QOXA 1OBGA 4DYMA 5GIPE 1BKXA 1KWPA 5FGKA 4E6DA 2CLQA 3QYWA 2OSCA 4IAYA 4EHEA 2OICA 4GKIA 4PDPA 3DDQA 3SG8A 3NNWA 2REIA 3R7OA 4AS0A 2R3OA 3UODA 3JUHA 2W4JA 4G3EA 3C0HA 3KN5A 3OW4A 4FSWA 5TF9A 4Z3VA 1J7IA 4WSYA 4C4GA 4F6UA 4W4YA 2ITNA 4FSQA 3DBFA 5ETIA 5FBOA 3RNIA 3S2PA 4BYJA 3HYHA 4CQEA 2J90A 1PMNA 1ZOEA 3KRJA 2BZHB 3DLZA 3FMDA 1Q99A 4ASZA 5IA3A 2IW8A 5LARA 2B9FA 4CRLA 4APPA 4FSMA 4F9AA 3LM0A 3UP7A 4PP9A 5J9LA 1V1KA 2AC5A 1ZWSA 2X7FA 3FMHA 3ZRKA 4DGOA 4D2WA 2J0JA 2OIQA 5HORA 3C4EA 4TNDA 4L7FA 3CQUA 2H96A 3A7HA 4D5KA 4U43A 2QHNA 4C3RA 1Q8TA 4EK3A 2P4IA 3E92A 4O22A 3T3VA 5K5NA 4X3FB 2YIXA 3QLGA 4NKAA 4FKUA 3R8UA 3BHYA 1V0BA 4J71A 5FXQA 2WMRA 4F1OA 4D4RA 4UMPA 1GZKA 2BDWA 2WOTA 1J7LA 3CY2A 3UG2A 2CPKE 4GJ3A 4IANA 4ZJIA 5LMBA 4D4SA 3I7BA 5CI7A 4I6FA 2RFNA 4FL2A 3OT3A 4BGHA 4EKKA 2C3KA 1H25A 4BHZA 1IAJA 3B2WA 3OOMA 2R3LA 4B0GA 4ZLYA 3UVQA 4U80A 5DHJA 4AOTA 3FE3A 3NEWA 2WMTA 5CALA 3GVUA 3CD3A 5IQBA 3COMA 3P1AA 3W55A 3BCEA 1LPUA 2R7IA 4K18A 3FXZA 4AGWA 4EH4A 3P0MA 3PSDA 3PY0A 4RJ6A 5AUZA 5L6WL 1FMKA 1O9UA 5CVGA 4FV1A 4I6QA 4E1ZA 4LI5A 5ICPA 3O8TA 5A3XA 2QNJA 2WTJA 2WU6A 4PV0A 4TY1A 3B8QA 4X2KA 3FZOA 4BCNA 5AA9A 3H30A 4DGGA 5LXMA 5M53A 1UU9A 2QR8A 3GP0A 2X2MA 3P23A 5EH0A 3PY3A 3HDMA 4OT6A 2QVSE 3WF9A 1OL6A 2JKKA 3O2MA 5DA3A 5JGBA 4NH1A 1M17A 1SNUA 4AG8A 2QLQA 2UW7A 1JKTA 3DQXA 4RVTA 3KKVA 1PXOA 3BLQA 3ZCLA 3FYJX 4DINA 1H1RA 4C37A 4CFUA 3IO7A 5HNBA 3VUTA 2J9MA 3RJCA 2OO8X 4FEQA 5I9XA 1RW8A 3LQ3A 5LCJA 5J7HA 1OKYA 3DKOA 5JGDA 5JGAA 3ZS5A 3I6WA 3CPCA 3D83A 4RA5A 3KULB 4ZEGA 2J0MB 5I9ZA 4S34A 4J8MA 4X2FA 4K9YA 3IS5A 4FKQA 4EK6A 2XK9A 4OBPA 4NW5A 2FSLX 3LHJA 4QP9A 3RWPA 2HIWA 3RGFA 3EYHA 3QWJA 4O6LA 3BRBA 4ZP5A 3QUDA 5AAEA 3ET7A 3DK7A 5CZHA 2X2LA 2AYPA 4LGHA 4XH6A 3Q2MA 3SGCA 1OI9A 3R1QA 4OTIA 2JKMA 3A62A 4ZTLA 2W9ZB 3RAKA 2YLFA 3QCXA 4EBWA 2QOKA 5JRQA 3P9JA 4LRMA 3TNHA 2B4SB 1U46A 3E88A 2RSVA 3F88A 3QUPA 2XRUA 3CIKA 1W83A 4DEDA 5AADA 1XH5A 5DOSA 3WF7A 3MY0A 1QPCA 4WOVA 2CGWA 2C5YA 3LE6A 3LFDA 4DCEA 3W18A 4IMYA 5E91A 2W1CA 5EQYA 2WOUA 3W2SA 3R7GA 3AGLA 3UPXA 3ORTA 3H0ZA 4MNEA 5LVOA 5CF6A 4FOCA 4ACGA 1GZ8A 3AC8A 4A4XA 4EH6A 5M09A 4OBQA 4S33A 4FKJA 4GUEA 3RCDA 4EYMA 2YZLA 4O7LA 2XK4A 1OL2A 3ERKA 4AE6A 3SD0A 5IH5A 2F7EE 2I0YA 5DE2A 3OEZA 3UIMA 1W84A 3ITZA 2PE0A 2Y7JA 2JFLA 5D10A 3PLAE 5E8TA 1P5EA 3EN6A 3SRVA 2P2IA 2GHGA 4DCAA 2I7QA 3PXRA 4OT5A 3FZSA 4CFNA 1FVVA 5AP7A 3MPAA 4KIOA 4O86A 5CASA 5HIBA 2XBJA 4MKCA 4HGSA 1TVOA 2C5OA 4IB3A 3PIYA 1FGIA 4PL3A 4O91A 2R2PA 2BRNA 1PMVA 5M06A 4M15A 2ONLC 5KCVA 5EDQA 1H00A 4DFXE 2UZUE 3EMGA 4DH5A 2QKWB 3R7YA 3BYSA 4IM3A 3ZFXA 3DAEA 3BYVA 3BIZA 3AC1A 2PZIA 3AT2A 3FMNA 2F49A 5GJDA 4HNFA 1XBBA 3Q60A 3PXYA 2HELA 3FPMA 4IWPA 4Y46A 4AZVA 2GNFA 4DBXA 4ZTQA 4AUAA 3EH9A 4IC8A 3ORKA 3I4BA 4BN1A 2WEIA 3R73A 2W5HA 2OF2A 2QOFA 4RLKA 4IZAA 3RK7A 3VF8A 3G90X 3VS3A 5HTBA 4CMUA 4KA3A 4EQCA 2VWVA 3FLSA 4UXLA 3E93A 2IZSA 4FICA 4KIPA 3GI3A 4I3ZA 3ZEWA 5EYMA 5LVMA 3QQUA 1PXJA 4HYSA 4Y5QA 2WMBA 2YM3A 2WTCA 1R0EA 5ANOA 2C6OA 5BQ0A 3A7FA 5E92A 3FZPA 3TNIA 1XH7A 3EYGA 4MD7E 4RT7A 2C1AA 4WUNA 3RALA 2PZPA 3UIXA 4AT5A 4BDFA 5BVFA 2BIKB 4RSSA 4TWNA 4FV8A 3IKAA 3DAKA 3O7LD 4RWJA 5JH6A 2EUFB 5A4CA 4AE9A 2UW8A 4ZTHA 4EQMA 5IA1A 3R6XA 5CEIA 3OBJA 4FEXA 5KHWA 3C4WA 1U4DA 3SLSA 4KSQA 3G33A 4M66A 1P14A 3GB2A 1GIIA 4NU1A 3MYGA 2YACA 1PYEA 4FIFA 2IVVA 3LJ2A 4EOQA 3SVVA 3NNUA 3ZLSA 2R3QA 5HZNA 4N6YA 3IECA 3I7CA 1H24A 1YHVA 4E6CA 2E9UA 4DG2E 2OJ9A 2BHEA 4FKTA 1OM1A 3IK3A 4OTHA 2OKRA 5T68A 1Y6AA 2C6MA 4RFZA 2P33A 4XV1A 3OY1A 4WNOA 4OTQA 3Q2JA 2Y4IC 2YAKA 5F1ZA 4ZMEA 5CU4A 4U5JA 2BALA 5HG5A 1ZXEA 3M1SA 5L3AA 1KOBA 1Q97A 4NWMA 3TT0A 3HX4A 4RJ5A 4HYUA 2PWLA 2ITYA 3L8VA 2VU3A 3OC1A 4E26A 3EZRA 2XM8A 2BDFA 1ZY4A 5FTOA 4BBEA 5IA4A 5DBXA 4H3BA 1GOLA 1U5RA 4FTQA 2XIRA 4QP2A 1A48A 4RJ4A 3C51A 3CJFA 3SA0A 2KULA 4FKOA 4WKQA 1PXIA 5F94A 3ZXTA 5JZNA 1FINA 3ZLXA 4IW0A 5FBNC 3OCSA 4P2KA 3PPKA 4IWOA 2GS7A 3OEFX 3O8UA 3OZ6A 4GG5A 4PPAA 2QOBA 5DN3A 4LRKA 5DR2A 4C34A 3P7AA 4I4FA 1YWNA 4IADA 4L3JA 5CVHA 4C4EA 1E1XA 3IQ7A 3OMVA 4DTKA 4DFNA 2VAGA 3EFKA 4FZAB 5GJFA 3BQCA 3ZEPA 5IUGA 2PTKA 4DEEA 5LWMA 1STCE 4DN5A 4MNEB 2O63A 3MIYA 5AUXA 3V5PA 1M2PA 4E6AA 4FT3A 5EYCA 4FTNA 3VO3A 5BX0A 3R8LA 3LJ1A 2W1HA 1AD5A 2G15A 3BE9A 3D5VA 4I20A 4CKJA 4Y73A 3SRVB 2BZJA 3VJNA 4HZSA 2R3IA 5C8MA 2NNWB 4BWKA 4D28A 4BDIA 2XK7A 1J3HA 2BFXA 3SX9A 4Z9LA 1MRUA 3EB0A 2YDIA 5L6OA 3FSFA 3D2IA 2YIYA 3DZQA 4CT1A 3MB7A 4R5SA 5HVKA 2XK6A 3I6UA 4AF3A 2A0CX 3W2RA 4J95A 4PQNA 1NXKA 4TXCA 2XJ2A 1OECA 3VF9A 1SM2A 3U9CA 4A9YA 4YZ9A 5K3YA 2W1IA 4JG7A 4UMRA 3KGAA 3MVMA 1Q8YA 4CD0A 3FL5A 3OS3A 2B9HA 2OW3A 2HZ0A 3R04A 4LOQA 5IISA 4FYOA 2YN8A 5HTCA 3ODYX 5I0BA 4ORKA 2DS1A 3Q52A 3QQGA 3AXWA 3HKOA 2VTIA 3OT8A 4TNBA 3MJ2A 3DB6A 4OW8A 1GNGA 1J7UA 4ANQA 4YC3A 1OIYA 4QYFA 1OIQA 3MIAA 4GV1A 4MXOA 4EZ5A 4EONA 1MUOA 3CC6A 4GK2A 3VS4A 5IA5A 5FUTA 2YDKA 3PJ8A 2C6DA 4IE9A 5AM6A 2X9FA 3ALOA 3BBTB 4FV5A 3A4OX 3HECA 4J1RA 3LMIA 1IG1A 2ZV9A 4FNZA 4F7NA 4QYGA 4ZSEA 5EI8A 3V6RA 1G8AA 4CYJA 4H39A 5HVJA 3PVWA 4LV5A 4HJOA 3R9RA 3KMMA 4FODA 3TNPC 4D0WA 5JSMA 3PWDA 5FRIA 1TQIA 2FVDA 3HP2A 5HCXA 4K77A 4OBOA 5HX6A 1YWVA 2XEZA 3K3JA 3NAXA 5AJQA 2FYSA 4YJSA 3R1YA 2H9VA 3FLWA 4YJUA 4JDJA 2VWZA 3T3UA 4LOOA 3PVBA 4M68A 5AV2A 2WQEA 4BI2A 5AV1A 1P4OA 3DAJA 4CG8A 2WAJA 3HEGA 4CV8A 1GY3A 4X3FC 5EHLA 1ZY5A 2V0DA 3OFMA 4C61A 2BZKB 1WCCA 5EM5A 5HE1A 5L8KA 3EN4A 2YIWA 4KS7A 4BCIA 5AV3A 5DT3A 2C5NA 4C0TA 1ZZ2A 1KE9A 2H8HA 3OY3A 4L9IA 4LUEA 5BVEA 2CKPA 4EWQA 1M7QA 4G34A 1BX6A 3GC9A 2YIQA 4GFGA 4BCFA 5GZAA 4AW1A 4OTDA 3WE8A 4PTCA 1H1PA 3TM0A 2JDRA 3UGCA 4QTCA 1GZOA 5JKGA 3TTIA 2A19B 2PZRA 3T9IA 5I5ZA 1B38A 2C3LA 3BGQA 2QU5A 3DK3A 5CEPA 3CGOA 4GCJA 5J5SA 1XH4A 2BROA 4DA5A 3QZIA 4MF0A 4M0YA 1YOMA 1JAMA 3P86A 5KZ0A 4CFXA 4CYIA 4XG3A 3TJDA 3CY3A 3AC4A 4Z7HA 2VWYA 4WNKA 5KZIA 4C7TA 1ZOGA 2UZWE 3RMFA 3VBTA 2W99B 4ANLA 4EUTA 3GCQA 2GDOA 1Y57A 4OTPA 4L44A 4XRLA 4O0SA 3DY7A 5HOAA 5J5TA 4U42A 3DNEA 5DEWA 5B0XA 1GIHA 3K3IA 4EOIA 4QYYA 5AUUA 2J0IA 3HV4A 3QC4A 4CMTA 2WTVA 3COKA 4GG7A 2R3GA 4BKJA 4CG9A 4FSZA 4FSYA 5J9ZA 5M08A 2PUUA 4LUDA 4MX9A 3DXPA 4BFMA 3SQQA 2WQOA 4ZTMA 4JDIA 4EUUA 2Z7LA 3DB8A 3U8WA 3BE2A 3S0OA 3Q4ZA 4B6LA 3EQIA 3R1NA 5FEQA 4IAFA 3NUXA 3QZFA 2X4ZA 1B6CB 3PZEA 4KSPA 5M55A 2A1AB 4JBVA 3JVSA 2ZB0A 2WU7A 4O21A 5CVFA 5I9UA 3VHEA 5E8ZA 3LIJA 5J8IA 5AP1A 3Q4CA 5IQDA 2Z2WA 3CE3A 3L1SA 3DBCA 2XIKA 3OBGA 5HO6A 3E3PA 3QD0A 3HVCA 5AP3A 4OTWA 1E9HA 3DBDA 3ROCA 2ITQA 5T3QA 5CEQA 3QTQA 4LG4A 3CTQA 2CCHA 4D58A 3FQEA 3RNYA 1PMUA 1XBAA 5E8WA 4XHKB 4A7CA 4FKWA 1NVSA 1IRKA 2YM4A 2PZ5A 4DTAA 3F69A 4H05A 3OTUA 2C6TA 1YHWA 2BCJA 2UV2A 5HX8A 4FSTA 2ITPA 5CF4A 3FI3A 4LV8A 5BUJA 3FHRA 2BUJA 2VX1A 1Z9XA 4OR5A 3W2PA 3Q9YA 4MXZA 3PVUA 5J9YA 4X7QA 2XCKA 3JXWA 1HOWA 1J91A 4BDHA 4DH7A 4WHZA 4U3ZA 4AW5A 5AR7A 3RHKA 2WTKB 3L8PA 3BV2A 4YO6A 4ENYA 1CKJA 1WVWA 3Q96A 4PX6A 1YXUA 4UZHA 3PSCA 3ZSGA 2IVUA 3GEQA 5DT4A 4AXAA 4HOKA 3VRZA 3BV3A 4DAWA 1PY5A 2UZOA 4M0ZA 4QPSA 2YITA 3E7OA 3C13A 3E3BX 4P5ZA 5AUVA 2ITTA 4FEWA 5EYDA 2EXCX 4HYHA 2VWIA 2XP2A 4TYEA 5D9HA 3WARA 2QOQA 2X8IA 3CQEA 2BMCA 3IW5A 4G16A 4CLIA 4FL1A 5LWNA 2PVYA 4NCTA 5CSXA 3MESA 4BGQA 3GENA 2CGVA 2HW6A 4FF8A 5GHVA 3ACKA 5GJGA 2RGPA 3KXGA 5J7BA 3SHEA 3NWWA 3VW6A 2WMVA 2GS2A 2WTDA 2X0GA 3BLHA 3IW6A 4M8TA 4J53A 3ROYA 3TACA 4A4OA 4AA5A 2V7OA 3VQHA 4ACHA 5HBEA 4AQCA 4JL9A 3LJ0A 2BTRA 5C8KA 3MVHA 4JVGA 3UG1A 4I41A 1PHKA 2W1ZA 5F95A 4F63A 4ONAA 2BHHA 4XEYA 4CZUA 4BTFA 2HXLA 1L3RE 4NZWB 3LXLA 3WIGA 5H3QA 3V5JA 4GL9A 3A99A 4AGUA 3E62A 4Q5HA 1WBTA 2G9XA 3KXMA 4YTIA 4CFWA 2EXEA 3TL8A 4D2TA 3COHA 1VR2A 3OUKA 3W2CA 2PY3A 2YWVA 4AA4A 4USEA 4I24A 5BPYA 2OBJA 2WXVA 4X21A 5E8UA 3KQ7A 4XS2A 2YFXA 2DYLA 1XWSA 5AP6A 4ZZMA 2GNIA 3ENMA 5FLFA 4CQGA 4YHTA 4NW6A 1REKA 2CN5A 4NFMA 4IX6A 4OGRA 1XR1A 3NYXA 4FG7A 4QD6A 4EH8A 3LCSA 4AZFA 4RIXA 4QQJA 4IIRA 4R1VA 2WD1A 4WNPA 3R8ZA 2F4JA 3GUBA 3JPVA 2GTMA 4KIQA 3UYSA 3VS0A 5IH6A 2ZM3A 5AV0A 5IH4A 5C1QB 5IKWA 3NW6A 4WUAA 2R64A 3QHRA 3I79A 4NK9A 3SW4A 4W4VA 3CQWA 4BCKA 1JBPE 1K3AA 1XO2B 4O7RA 3SDJA 2F2CB 5F20A 3R7EA 3V5LA 3RAHA 4O2PA 3KRRA 2Y6MA 3CXWA 5H8EA 3WBLA 4GVAA 4XBRA 3IDCA 2AUHA 2PE2A 4EBVA 1MQBA 3FY2A 5I4NA 2UZNA 5HVYA 4DT8A 2ZOQA 1XH9A 3CP9A 4A9RA 2VWBA 3GQIA 3OWKA 3VUKA 3NSZA 3R71A 3ZLWA 4BKYA 3SW7A 4QNYA 2ERZE 3TCPA 3ORNA 4W4XA 2BILB 3F5UA 1W8CA 4EWHA 1G3NA 4JQEA 3T8OA 3UVPA 5EDPA 1SZMA 4H58A 4K6ZA 1OL1A 2R3RA 3PXFA 4TW9A 2X4FA 5CQWA 4QQ5A 4EOPA 4PDYA 3H9OA 4Y85A 4CEGA 2JC6A 2YEXA 4XMOA 1WAKA 1Q5KA 2QG5A 1XH6A 5CAVA 3LW0A 5IZFA 2QD9A 4I22A 1UWJA 3G0EA 3HAMA 5HE2A 4FMQA 1DAWA 2J5EA 3HRFA 4I21A 3QBNA 4LQMA 5CU3A 3UO5A 4Q5EA 5CU2A 4GJ2A 2W1GA 4L3PA 4QP4A 4Y95A 5HHWA 3RPSA 4ZZOA 3KXNA 2XIYA 3KA0A 3PXKA 4RRVA 5KMKA 2QCSA 5KMNA 2HK5A 4YZDA 2XCHA 4A06A 4GK4A 4K1BA 3SV0A 4R7BA 2YJSA 1WBWA 4EHGA 3NLBA 3ZYAA 2OZOA 5EM7A 4MD8E 5FQDC 3D2KA 4RX7A 3EQBA 2PVLA 2BRHA 3I0OA 5AA8A 5CU0A 2QOHA 2XYNA 4XG6A 1RE8A 4USFA 3ZM4A 2OU7A 4UY9A 3FHIA 3W10A 3VBVA 3WZEA 4YTCA 4DE4A 3CBLA 3DJ6A 3C4XA 4FKRA 2XIXA 3FUPA 3PXZA 4QQTA 2OFVA 4P4CA 2QOIA 1H28A 2PMNX 3RPOA 4II5A 2WO6A 5EW3A 3E8EA 3Q5ZA 1BUHA 2O8YA 2VO0A 4GYIA 3O8PA 1VEBA 4PTEA 5CS6A 3GNIB 5HD4A 3OCTA 4ZZNA 2WFYA 2W05A 3F3UA 1FQ1B 3AOXA 1A9UA 3GOPA 4FVRA 1MP8A 1T45A 3ZO1A 3ATTA 3IOKA 1OIUA 5BVNA 3RM6A 5EI6A 3KVWA 3QQKA 3VS6A 2HW7A 4Q2AA 5JFWA 4FIGA 1Q24A 3HMNA 4JG6A 3FXXA 3P7BA 5JFSA 2DQ7X 4V0GA 3AT4A 4UN0C 3NMUF 2PULA 5E90A 1F0QA 1FGKA 2OK1A 4QP8A 4R77A 4YUQA 2ZJWA 4F08A 4PF4A 1F5QA 3HMOA 4MXAA 3VNTA 2XJ0A 3IGGA 4D1SA 2W96B 4BBMA 4YJVA 2NRYA 4LFIA 4YP8A 5L4QA 3TV4A 2F9GA 4I6BA 4HPTE 3VBYA 4FTRA 4AU8A 3UQCA 3EKKA 4P5QA 4CT2A 4GIIA 3TZMA 4RWIA 3CTHA 4F09A 5DT0A 2PL0A 3PE2A 4D1XA 4IXPA 4M13A 2VD5A 4YLKA 5E7RA 4XP2A 3GU4A 2HZIA 2O5KA 4A9TA 3DGKA 3Q9XA 5DR9A 3HRCA 1Q61A 3GU7A 1UU7A 2GNJA 3LMGA 1H27A 4AP7A 5HESA 2QO9A 3K2LA 3VS7A 2XH5A 3QX4A 4Z55A 1WBVA 2PHKA 3PG1A 4BTKA 2UW9A 4DH8A 5FXSA 5FXRA 1AGWA 5BVDA 4F0GA 3GOKA 3DKGA 3LVPA 2CNVA 3VWAA 4AN2A 4IVBA 1OUKA 2EWAA 3OD6X 3KMWA 4I23A 3EFLA 2BKKA 5CENA 3F3WA 4RIXB 5GIOE 3QZHA 4RJ7A 2RG5A 4J99A 4WRSA 3TIYA 1HCKA 2Y6OA 3I60A 4C4HA 4GYGA 4BTJA 3ZUVA 4I0TA 3ID6C 2XNPA 3TI1A 3RPVA 3TZ8A 3W1FA 5FDPA 3KXHA 3UMWA 1SVGA 4NIFA 5DR6A 2QO2A 5DEYA 1FBNA 4ZK5A 5EHYA 2E9PA 4ACMA 4EOSA 2C6KA 5DH3A 3NVKI 4DG0E 2NPQA 4O0VA 3MTFA 1H08A 4DEGA 3QZGA 5CANA 3REPA 3GBZA 4RWKA 1DI8A 4MXXA 3QXPA 3A2CA 4QMLA 2DWBA 3R9HA 3V5QA 5A6OA 3D7TA 2QG7A 1KOAA 3MDYA 1O6YA 2OFUA 1Q8WA 4L7SA 3D7ZA 3ZU7A 1Y8YA 4R7HA 4W9WA 2IG7A 3P4KA 3HMMA 4QO9A 3R83A 4GUBA 4D9TA 4EI4A 3QU0A 2Z7SA 3F61A 3VW8A 4NTSA 4QP1A 3KREA 2G01A 3P79A 4PWNA 2B9IA 5TR6A 4BF2A 2IO6A 5ANJA 3TKHA 4FKLA 2Z02A 2VTRA 3ORIA 4UALA 4C57A 2JLDA 3KRXA 4Y5HA 2GQRA 5L8JA 3N4UA 3GFEA 2B53A 4O38A 1UKHA 3OP5A 4FTCA 3OHTA 4BKZA 3NUAA 3BPRA 4FV0A 4LGDA 2GHLA 4ZMFA 3UOHA 2XBAA 4MQ1A 3P5KA 5ACKA 4YBKA 4WG4A 5BVKA 4ANMA 3FLNC 3LQ8A 1Y91A 4X2JA 4ZAUA 4ACDA 5EOBA 3QA0A 4D4VA 5K0KA 2R3NA 4E73A 3ATSA 1QPJA 2F7XE 3LMHA 4RWLA 4DEIA 2WTWA 5L8LA 3MVLA 3HLLA 3WI6A 3QRJA 4C36A 1YQJA 5AR2A 4L43A 5HKMA 4QMQA 2Z60A 4K0YA 3ACJA 5HLWA 3QKMA 4MVFA 3RVGA 3ORMA 4ASDA 5CSWA 5A14A 4XUFA 3WF5A 4U40A 3MI9A 3NUPA 2J2IB 3NAYA 5AX9A 4UV0A 4E4MA 1UVRA 3NIZA 3MTLA 3MFTA 3PLSA 5LMKC 4J8NA 4FX3A 5TE0A 5C4LA 4E7WA 2PPQA 3EHAA 4U81A 3Q53A 4RIWA 4ANOA 2BKZA 4DH3A 4RPVA 1KV1A 2YERA 3PWYA 1WFCA 4LMUA 3FJQE 4FSUA 4ZS0A 3PA3A 2BIYA 5IMEA 3SXFA 1NVQA 4FKVA 1IEPA 4HGEA 3L9MA 3FZ1A 4JG8A 4KWPA 3FI2A 3UOLA 2LGCA 2WMQA 2CNQA 3AQVA 4M3QA 4TYGA 3W32A 4RVLA 4FG9A 1R1WA 3G51A 4TTHB 4U41A 4YBJA 4EJ7A 4AZSA 4YHFA 4YZBA 4EORA 1ZARA 4V0GB 2XNBA 4QMNA 4J96A 5E8XA 4QMUA 3EFWA 3ZM9A 2X81A 4CXAA 4DEAA 1CKIA 3MH3A 4AX8A 2WTKC 4GMYA 4JX7A 4O0RA 5EKNA 3BX5A 2C30A 3AC5A 2BR1A 2C1BA 2ZVAA 3WOWA 4JXFA 4CTCA 1YW2A 4IZYA 2CCIA 3GCPA 4ENXA 5HU3A 2PUNA 5E1EA 5G1XA 2ITXA 2Z8CA 3O51A 5LVPA 3G15A 4BDDA 4WNMA 5BMMA 3U55A 3Q04A 4WG3A 4ERWA 2YISA 2QODA 1Q8ZA 1YHSA 4MXYA 4M69A 5ETCA 3RBWA 1YXVA 1H4LA 3I5NA 3QD2B 4IWDA 3OXZA 3TV6A 4E4NA 1BMKA 4FTMA 3UC3A 3W2OA 3QA8A 4YZNA 1OPLA 5CXHA 3L9PA 4FTOA 2OXDA 4OTGA 5L6PA 3BKBA 4WO5A 4I5PA 3G9LX 2Y0AA 3ZONA 3DBEA 4RFYA 1TKIA 5BVOA 5M4CA 2I1MA 3PA4A 3LZBA 3N4VA 4EC9A 5GNKA 4AFEA 4F64A 3EL7A 4IWQA 4X2GA 3E8NA 2P2HA 3PJ1A 3PIXA 1XKKA 2R3HA 4U7ZA 4BCJA 5FG8A 5DLSA 3MA6A 4IX3A 3CTJA 4MWIA 2C68A 4FV6A 3F2RA 4JR3A 1ZYSA 3HUCA 3AC2A 3SAYA 1H07A 5AX3A 1PRYA 4JIKA 4O1OA 4L01A 2YCQA 3PIZA 3R8MA 4CTBA 1DI9A 3O96A 4JR7A 4PUZA 4YTFA 1H0VA 3UJGA 2O65A 4QMTA 4LM5A 5FTQA 4NIFB 4I5MA 5HI2A 3HV3A 4UZDA 3DS6A 4F0FA 4G5PA 3VBXA 4FSNA 3F7ZA 3L8SA 3LFSA 3PXQA 4ZSAA 5CY3A 4QMZA 4HNIA 4M14A 4M7IA 3Q9WA 4X6RA 3RHXA 3WZKA 4BI1A 3D94A 3CEKA 3COIA 3D7TB 3KFAA 1WBNA 3U87A 3E5AA 4JT3A 1ZMWA 3GU5A 2OG8A 2PMIA 4HVGA 2EB3A 5F4NA 3O17A 4F1TA 5ANDA 2JKOA 3K5UA 3PP0A 4LYNA 4I6HA 5IEYA 2X8DA 4YMJA 2C5XA 5HIEA 4BYIA 3R28A 3PRIA 3U54A 3HV5A 1QL6A 1IAHA 2V5QA 3PP1A 4AWIA 4RC2A 4F6WA 3JVRA 5DWRA 5BYYA 4DFZE 1OBDA 4ZS4A 2VTSA 2X6DA 4ALUA 3K5VA 4A9UA 5HCYA 3ZUUA 2HWOA 3R02A 4GVJA 3LM5A 4U0IA 3RWQA 5GZ8A 3PG3A 2ZYBA 4XG8A 4TRLA 2SRCA 3M11A 4IM0A 4L8MA 1PF8A 3GCUA 3WYYA 3QRUA 4CGAA 2XNMA 2GU8A 5KMOA 4QYEA 5IUIA 3RM7A 1XJDA 2QONA 3I0QA 4FR4A 4FTIA 4ANBA 3QFVA 4EH3A 4QMSA 3UOJA 2ONLA 2EU9A 4FTKA 4RGJA 4XG9A 5CEMA 4BICA 1S9IA 1JWHA 2J4ZA 4I4EA 4IDTA 3QALE 3VC4A 2HCKA 2HY0A 2V22A 2WHBA 4L45A 4UYNA 4FKIA 4F4PA 4NUSA 4FTLA 5KMMA 4JQ8A 3H0YA 4HZRA 4FTJA 2XYUA 2YABA 4JX3A 3EQHA 4JOAA 5DPVA 2B0QA 2QOLA 3FMLA 5HE3A 3WYXA 3NUNA 2H6DA 4AZWA 4BCPA 4RC3A 4YSMA 5H8GA 3F2AA 4RQVA 5M51A 2UUEA 3B2TA 2C3IB 1XHAA 4IJ9A 4BCGA 4KD1A 4XV2A 1WVXA 4IZ5A 5EM6A 4RIWB 3S00A 3H3CA 4CMOA 1CTPE 2GSFA 3UVRA 3MB6A 3UYTA 4DFUA 1ZZLA 1YRPA 2GNHA 5BYZA 4WBBB 1URWA 5J95A 5T6KA 3R9OA 2XKEA 3QTWA 4GIHA 4ZLOA 5IUHA 1FVTA 4N70A 2I6LA 2PUPA 3TZ7A 3QGWA 4TN6A 4E6QA 3DDPA 4BCOA 1O6KA 4F70A 3UC4A 3A7IA 2GCDA 1Q41A 3PTGA 5CSVA 1FOTA 1W82A 2JIIA 2UW6A 3KY2A 3RZBA 3E87A 3IONA 4KBAA 3FKNA 3TUCA 4FT0A 3BHHA 3V6SA 4PDSA 2JIUA 3QCYA 3QXOA 1CDKA 3R00A 1P2AA 2J6MA 3BI6A 3EN9A 2ZM1A 4ITHA 5E8VA 4EQUA 5CNNA 2GQSA 5IPJA 4EOOA 4Y72A 5IG1A 2ERKA 4I0SA 2QO7A 2FSTX 2XNEA 2VWUA 2JDOA 4UWYA 4YPSA 5F9EA 3PJ2A 5BUEA 1LEZA 4R3PA 2JDSA 3PJ3A 1WZYA 4D1ZA 1H26A 3D9VA 4M69B 4DITA 3MV5A 5EQEA 3I81A 3UQGA 4AN3A 3EQPA 1A06A 2YA9A 4KS8A 4JLCA 3VIDA 4ZJJA 3IPHA 2X2KA 4HCVA 4KABA 4GU6A 3AT3A 3QD4A 2C5VA 3QHWA 1ZMUA 4TYHA 4YJTA 4Q9SA 2JKQA 3P08A 4FIHA 4QTDA 2PVFA 3QD3A 1KE7A 3MFRA 5FP6A 4HCUA 2VTTA 2OI4X 5IQFA 1M14A 4FNWA 4CSVA 2IZRA 3SXSA 4E4LA 4BDJA 2W9FB 5EQPA 1JNKA 4HVSA 5TO8A 5I3RA 1I44A 1CKPA 1U5QA 2R4BA 2QURA 4JRVA 4XOZA 5JN2A 3ORPA 4W9XA 3R8VA 2WPAA 2XKCA 3OWJA 4GEOA 3OW3A 3QRKA 3RI1A 4I94A 2VO3A 3V3VA 3E7VA 4TKSA 4RIYA 4DT9A 3NCGA 2IWIA 4NT4A 4YURA 3ZZEA 2Y9QA 3GC0A 1JKLA 4AGDA 5AUTA 1OKWA 1PXMA 2C69A 4YNOA 3UNZA 4F7LA 2OLCA 2VGPA 3UZRA 4CFMA 3LFBA 2PSQA 1ERKA 2IN6A 2XS0A 4LL0A 3TG1A 3UIUA 2JAVA 3TDVA 4QYHA 2CN8A 3QCQA 4MF1A 5AP0A 3GC8A 2ZV8A 1WBSA 1M7NA 3PFQA 3ZBXA 2VTMA 1OPKA 4CRSA 5B2KA 3LQ5A 2P0CA 3OCBA 5HCZA 3OUNB 4YNEA 3O7LB 4JBQA 3DA6A 5AM7A 4O83A 2HZNA 3FC1X 3FC2A 3DJ7A 2BTSA 2R7BA 4HGLA 3Q32A 5IA0A 1V0OA 2QU6A 2YHVA 1BL7A 4I93A 1OITA 5KKRB 3ENHA 4L6QA 4UEUA 3C5IA 3ZO4A 4C2VA 3LFQA 4F6SA 4UB7A 5G6VA 5KUPA 4O7NA 4WD5A 3TWJA 3MH1A 1DS5A 2NO3A 3RAWA 1NY3A 3AMBA 4GK3A 3VUMA 1Q3WA 3NCZA 5KMIA 4ZTNA 4A4LA 1GIJA 1UNGA 3ANQA 5DFPA 4XG7A 3M2WA 3BYOA 3FI4A 5JZJA 4R3CA 3PY1A 4RJ3A 3EQGA 2W06A 5CWZA 2Q83A 4GS6A 1KE6A 3CKWA 4WBOA 3TKUA 5AP2A 4BTMA 3LPBA 1JLUE 3R22A 3C4ZA 4HYIA 5L2TA 4QMYA 3O0GA 4G3FA 4QRCA 3IW7A 3QQJA 5HQ0A 5IDPA 3V04A 2PMOX 3BWJA 3MSSA 4TWCA 4KKEA 2WELA 3ZFYA 2YZAA 1SNXA 2ZDUA 3GU8A 3ZZWA 4AT4A 5A46A 4B4LA 2G1TA 4FG8A 1OB3A 4RC4A 3E8CA 2VTJA 3WF8A 3VUDA 4EYJA 4QTEA 3ZXZA 3CSVA 4JJRA 3UNJA 4ASXA 4DC2A 1L8TA 2HY81 4ZIMA 1QMZA 4IFCA 3IW8A 4NFNA 5HGIA 3HMIA 4F9CA 4GU9A 5M57A 4JBOA 3FDNA 2CDZA 3G6GA 5KE0A 2Y8OA 3GCSA 3O71A 4W4WA 3UPZA 1H0WA 2G2IA 4DLJA 4V05A 1X8BA 3LOKA 3PZHA 4UBAA 3EQDA 5DMZA 4EK4A 3VUGA 3FMEA 2GQGA 4WRGA 5FD2A 4NJ3A 3T9TA 1YDTE 4ZXTA 2E9VA 2I0HA 4GW8A 3TXOA 4C59A 5B2LA 4FT9A 4TYIA 4O84A 5FEEA 3MW1A 3NRMA 3LFNA 4FT7A 3F9NA 4EK8A 4LL5A 3NNXA 3C0IA 4IACA 4X3FA 4FEUA 4CV9A 1OMWA 4KINA 4DLIA 4FE2A 4UX9A 5C9CA 2VTQA 3CPBA 2OF4A 2W5BA 4AZTA 4ITIA 4JI9A 5CTPA 3V8SA 3D5XA 3II5A 2PU8A 3UP2A 5I9VA 1Y8GA 4J98A 4FV3A 3KCKA 4PPCA 4DGNA 1JSTA 2Q0NA 4IB1A 3W33A 3E63A 4A07A 1TQPA 3PYYA 4D2PA 4YJOA 3FLZA 2R3MA 3HNGA 1Q62A 4N4SA 2UW0A 3RTPA 4H1MA 5AP4A 5LVLA 4MBJA 4L00A 4PP7A 4ZTSA 4BWPA 4F65A 5E4HA 2XKDA 3BGZA 4KB8A 4CFVA 2OJFE 4NSTA 5FTGA 5DVRA 5ANIA 4TYHB 4DFLA 5EFQA 5J79A 2W7XA 3L9NA 3PA5A 2Y4IB 3QKLA 4XCUA 2I40A 1I09A 2QLUA 4BC6A 1IASA 5BYLA 2IVTA 2FSOX 2C0OA 5LOHA 1PKGA 2EXMA 4RZWA 2BDJA 3TN8A 4FKGA 4G3CA 1JPAA 3EJ1A 4FIIA 4G3GA 5DNRA 3UO6A 2B54A 4CZYB 4M84A 2CNUA 1H8FA 4PMMA 4RVMA 3BYUA 3UE4A 4FZDB 5L2SA 5JQ5A 3GT8A 4RVKA 3LFCA 1BI8A 5GINE 1RJBA 1IA9A 2UZLA 4C58A 2QOCA 3FLYA 1UA2A 4RIYB 5AAGA 2WMWA 2RFSA 3HV7A 4QMXA 4XV9A 3QL8A 5DG5A 1U54A 3NUSA 5JQ8A 5IQCA 5CSHA 3QQFA 4WA9A 3ZDUA 3R9NA 4HCTA 4PL5A 5C03A 2XK8A 4KRDA 3QTXA 3L8XA 2YM8A 2CGXA 4BWXA 3V5TA 2CKQA 4B7TA 3TTJA 2IZUA 5JFVA 4BDEA 1YKRA 2CLXA 2YDJA 2IZTA 3KRLA 3MBLA 4EZ7A 1YVJA 2QKRA 2PMLX 4QMOA 5E1SA 3LXPA 4S30A 3HP5A 1YDSE 3R30A 4RIOA 1TQMA 4W8EA 3LFAA 2OH0E 4FK6A 3QTZA 3G5DA 5AUYA 3S3IA 2PYWA 3WIKA 3C9WA 4RQKA 4XV3A 4V01A 4NTTA 3N9XA 2PZYA 1YDRE 3MH2A 4ZOGA 5CSPA 3OWPA 3HL7A 2OIDA 3KMUA 4D55A 5CT0A 4ZLZA 4FYNA 3S95A 4IAZA 3VVHA 1CSNA 4L46A 3AC3A 2UZEA 4OUCA 3BEAA 4RZVA 2BAQA 3FKOA 2CGUA 2VNWA 2XB7A 3R9DA 3ALNA 3SOAA 4YHJA 5DYJA 4GT3A 4PNIA 1O6LA 1QPDA 4XG2A 3LXNA 4PTGA 4B8MA 3S1HA 1T46A 4U79A 1ND4A 3POOA 3R2YA 5FDXA 4O7ZA 2PVRA 5IQHA 5AUWA 1H1WA 3ORZA 5TOZA 2UZVA 3O23A 5CQUA 4RX8A 4R8QA 2GPHA 5I3OA 2F2UA 2JIVA 3FQHA 2XIZA 2XNGA 5DI1A 2R3PA 3PSBA 3WE4A 4DEBA 1OKZA 4U45A 5CEOA 3A4PA 2UZTA 4WSQA 1MRVA 3FMJA 4ZY5A 5CX9A 2IVSA 1CM8A 5J87A 3QKKA 2OWBA 4W8DA 4K11A 4FKSA 1G8SA 3ZRMA 3EWHA 2PUIA 4IX4A 1GAGA 3D5UA 3NZ0A 3ORXA 1UKIA 2YM7A 4QQCA 3A7GA 2ITWA 2XNNA 2C0IA 3NIEA 4C3PA 5C8NA 2A27A 4G9CA 2HENA 4ZSLA 2ZAZA 3QF9A 4I5CA 4RX9A 3R7IA 5LMAA 3OOGA 4HW7A 4M97A 1UU3A 4BDAA 1U59A 5D12A 4BZOA 4FC0A 4IAKA 4UYAA 3G2FA 5CAPA 3V8WA 5TKDA 3VS5A 4FIJA 4CKRA 3THBA 1R3CA
chains in the Genus database with same CATH superfamily
4FV2A 4EH5A 4B99A 2XZSA 2Z7RA 4NKSA 1J1BA 4G3DA 3IOPA 5BMSA 3FXWA 2R5TA 2XEYA 4H3QA 2V62A 4YZCA 1LUFA 3NUYA 3FLQA 4NEUA 4G6NA 5A4TA 1OGYA 2VUWA 4IDVA 4D5HA 2WIHA 5AR4A 5KO1A 4Y83A 2W17A 4XP3A 1ZOHA 4FZFB 4WG5A 2C6LA 5HICA 3LKMA 4O7SA 3H10A 1V0PA 4D9UA 4FSRA 5C27A 1OGUA 3GQLA 3OWLA 5DIAA 3UIBA 2FUMA 2VTOA 2JBOA 3TYKA 3IDBA 5C01A 4C3FA 3F66A 3DJ5A 1ATPE 2C4GA 2CJMA 4RMZA 4ARKA 5LCKA 2PVNA 3KF7A 3ANRA 3ELJA 4BDBA 5IMXA 5IU2A 3L9LA 3H9FA 3CR0A 3OXTA 4F0IA 2C0TA 2X8EA 3EL8A 4C62A 4YR8A 2FB8A 3LLAA 4L52A 2RG6A 3ODZX 2OJIA 1YOJA 4B8LA 2VRXA 1JKKA 4JDHA 2GNLA 3ZBFA 3UDTA 2VN9A 3Q6WA 4AZEA 4QP6A 5JFXA 1FPUA 4MYGA 2ZMDA 1Z5MA 2VWWA 2B1PA 2WMSA 5EI2A 4CLJA 5KNJA 4HVHA 2WMUA 5H8BA 5ETAA 3VBWA 2YM6A 4BZDA 5AR3A 1XMMA 3TDWA 4OAVB 3PDTA 2R3JA 3TNWA 4OAUC 3KC3A 2YCRA 3RPYA 3U4WA 3AGMA 3EFJA 3KN6A 1U54B 3O50A 4FV9A 4G2FA 4H1JA 1OPJA 3AD4A 3EZVA 3KK8A 4XJ0A 2XRWA 1K2PA 3ZSIA 5CF8A 3OXIA 1JOWB 2V7AA 4E93A 3HA8A 5E8YA 3FMKA 2WZJA 2NP8A 4IBMA 4QMPA 4FKPA 3BQRA 3SOCA 3FMMA 4MTAA 4JIAA 2J0LA 3ZO3A 4EC8A 3A8XA 3TKIA 4TWOA 4X6QC 4J52A 3QX2A 2WQNA 4B9DA 4WT6A 5HG9A 1VLRA 3NW5A 3VUIA 3HDNA 3C5UA 2IJMA 2RL5A 3VS2A 5DRDA 3D5WA 4C38A 4FEVA 3IDPA 3RAIA 3A7JA 4FNYA 2QOOA 5EM8A 4C33A 4DTBA 4DG3E 3JY0A 3QTRA 4L68A 3BEGA 1APME 5L2IA 4JRNA 4XOYA 4F9BA 1ZYDA 1PXPA 1Q4LA 4IB5A 2XAMA 2C6EA 2XUUA 4R78A 3HV6A 4AACA 1ZYLA 5DGZA 2B9JA 1GZNA 3R0TA 3KVXA 4PMSA 2CKOA 4FT5A 4U6RA 3MGYA 5HO8A 1LP4A 2XJ1A 3P7CA 2RFDA 3ZC6A 4EJNA 3DTWA 5EDRA 2F7ZE 3QQHA 4L42A 4XLIA 4C35A 4DGLC 3BZ3A 4F99A 4E20A 1AQ1A 3NVMB 3IW4A 1RQQA 5AIKA 4YJPA 3UOKA 1OZ1A 5D11A 3NYVA 4O6EA 3VUHA 3NUUA 4ACCA 4IVCA 3KB7A 3ZSHA 3CJGA 2C47A 3VRYA 4AOJA 3TUBA 4BI0A 3UTOA 2O64A 4K2RA 3AMAA 3VJOA 1OL5A 1Y6BA 4QPMA 4K8AA 3D15A 2VTNA 5KKRC 1R78A 4MAOA 4O7WA 4AW0A 3C7QA 2PVMA 5K5XA 3PPZA 1YOLA 4JDKA 4U8ZA 4AGCA 4BGGA 5IEVA 2OGVA 4NYEA 1J1CA 1YI4A 1BYGA 1Q3DA 3QWKA 2YCFA 4HVDA 2WGJA 4XLVA 4FI1A 4FUYA 4V04A 2W4OA 3MY1A 5ANKA 1K9AA 3DOGA 2IF8A 1G5SA 4KAOA 3KRWA 4FTTA 3F3ZA 3RZFA 4R7IA 4D2VA 3OTVA 4NM0A 3DBQA 4APCA 3D4QA 5ANGA 4GT5A 5FM2A 4DHZA 2EVAA 5M07A 3DFCB 3NW7A 4FVPA 2B52A 1GJOA 3OF0A 3QTSA 5JEBA 4PRJA 4OTFA 2IPXA 2H34A 4O0XA 3EQRA 2X7GA 3E64A 2VX0A 5JK3A 4I0RA 3SKCA 4KIKA 1XQZA 2BVAA 4F9YA 3R1SA 4DBNA 2HOGA 3C50A 3QLFA 1VZOA 3QTUA 3BHTA 3HUBA 3MN3A 4IAAA 4IVAA 3ZOSA 4L67A 5KX8A 3UZPA 2JAMA 4C2WA 4EK5A 3BU6A 3ORLA 5CAQA 3A60A 2CMWA 5M4IA 3QQLA 4UXQA 3I1AA 4EL9A 3SXRA 4E4XA 3UBDA 1PW2A 1IA8A 3ETAA 2FH9A 3ZLYA 1MRYA 3LFEA 2G2HA 4O27B 2OIBA 4KKGA 2X7OA 3TUDA 2KTYA 3GU6A 3F6XA 1NA7A 3FL4A 1WBPA 2WMAA 5AIRA 4E5AX 4CFFA 5FP5A 4JAJA 4R5YA 3UMXA 1S9JA 3CD8A 1FVRA 2J5FA 2YJRA 4UWBA 5CU6A 4BB4A 5HNIX 5CYIA 2W0JA 3KF4A 3VQUA 2XA4A 1JVPP 3MVJA 5AEPA 5IQEA 2J0KA 3KK9A 3EN5A 5K4JA 4LOPA 4CCBA 1ZAOA 3AD5A 3RINA 5B7VA 4EHZA 2CSNA 5HD7A 3A8WA 4KUJA 1UNLA 3FZTA 5J1VA 4P90A 4ZTRA 3ULIA 3C1XA 2I0EA 3N51A 3FI8A 3FZRA 2RF9A 2E9NA 5HBHA 3U6IA 2E2BA 3PUPA 1W2CA 3BL7A 4GFOA 4O0TA 4DHFA 2FSMX 3VULA 2PVKA 4ZY6A 5JT2A 3S4QA 2VTLA 2WKMA 4AN9A 3WZDA 3UO4A 4PMPA 4YU2A 3U9NA 1XBCA 3NYOA 2W1FA 3AG9A 3BL9A 2YWPA 3Q5IA 1KE5A 4MBIA 3WF6A 3Q6UA 2ZV7A 2A2AA 5H9BA 4N57A 3V5WA 5FM3A 4XG4A 2BRGA 4Z16A 5CZIA 4PL4A 5DRBA 4BY9E 2ETRA 2R0UA 4JQ7A 3KXZA 2LAVA 4U97A 4M67A 3M42A 3LFFA 3R8PA 2YLEA 3EKNA 4IC7A 4D0XA 2WNTA 4NJDA 2ETKA 3H9RA 4PNKA 2WB8A 3DLSA 5K4IA 1EH4A 1H1QA 2QQ7A 4NM5A 4QMWA 3U51A 4GKHA 4AXDA 5HLNA 4KBKA 4FNXA 5EYKA 3OVVA 3GFWA 3PRFA 2JFMA 3A61A 4GT4A 3V51A 3P78A 4BCQA 4DFYA 1BL6A 2P3GX 4EOKA 4FIEA 3E8DA 3GXLA 5M4UA 4O7YA 3TJCA 4D4YA 4NM7A 4AT3A 2Z7QA 5L2QA 2ITVA 4G31A 4MK0A 2VX3A 2YAAA 4O4EA 3DK6A 4U9AA 2NRUA 5IQAA 4N6ZA 3TZ9A 5M44A 4S31A 5HG7A 2QHMA 4G1WA 5A4LA 5IEXA 4AA0A 3QTIA 4AW2A 4UMUA 3F7WA 4EOLA 4QPAA 2FGIA 1KSWA 1M52A 5HU9A 5I9YA 3C4FA 3MWUA 5LMKA 4MEDA 3TEIA 4G9RA 5EG3A 1P4FA 1OVEA 2PE1A 5M4FA 3F3VA 2GFCA 2C6IA 2UW4A 4GH2A 2VWXA 3QRIA 4ERKA 5IDNA 1KV2A 4FVQA 3TIZA 2WMXA 1ZYJA 4D2SA 4FJVA 4F7SA 2VO7A 3NPCA 4F9WA 1PKDA 4O1PA 4YC6A 3DKFA 4MNFA 4IAIA 3W2QA 1SVEA 2BFYA 1E1VA 1M2QA 4F7JA 2R3FA 2ZDTA 4QMVA 4AOIA 1W98A 3PVGA 2XM9A 3EN7A 4LGGA 4BDKA 1W7HA 1B39A 2VNYA 3R2BA 2X1NA 4S2ZA 4U3YA 4YO4A 5ETFA 2XK3A 3NX8A 5LVNA 3U6JA 3CS9A 3EIDA 3C0GA 4LRJA 5HNGA 2ZB1A 3MA3A 4FTAA 1ZYCA 2CHLA 3QCSA 4FK3A 5HIDA 3W8QA 3D0EA 1YXXA 4JNWA 4A9SA 4G6OA 4C02A 1R0PA 4EKLA 4TL0A 5ITAA 2I0VA 1F3MC 1BI7A 2YM5A 4FTUA 4QT1A 3UDBA 2A4LA 2R3KA 4KIKB 4RX5A 1H01A 2UW5A 3CCNA 4CCUA 4YC8A 4BDCA 4E3CA 3CGFA 4RBLA 4GFMA 1H1SA 5E8SA 3D14A 4PY1A 3ZDIA 3IG7A 4YJNA 3G9NA 1ZRZA 4FBXA 4X0MA 4FGRA 1IR3A 1PJKA 4QNAA 4JAIA 4JS8A 3G0FA 3PJCA 4KNBA 4MCVA 3U4UA 4DGMA 3BGPA 1VJYA 1KUTA 4TPTA 1NT2A 4XBUA 3KU2A 3FKLA 5HE0A 4YLLA 5AV4A 3NNVA 4NCTC 4ALVA 5H2UA 5EHOA 2IW6A 3HRBA 4RFMA 1OL7A 2Q0BA 3MPMA 1W0XC 4O0YA 5A9UA 4RLLA 4G6LA 4FA2A 4LMNA 3QUEA 4E5WA 1KE8A 2J50A 5A54A 4YJRA 4BHNA 4NL0A 5A4QA 1QCFA 2ITZA 3JY9A 3HA6A 1LR4A 4E8AA 1M2RA 3F5XA 1OIRA 1QPEA 2JD5A 2QR7A 3NGAA 2BPMA 5CF5A 3QC9A 5AWMA 3DQWA 3B8RA 2XVDA 4TZRA 3ZH8A 2XF0A 4FV7A 5AR8A 4O7TA 2QC6A 5KBQA 5HO7A 4QMMA 4ZY4A 4J7BA 4KRCA 3KL8A 2JITA 4YGAA 4DEHA 2W5AA 3LXKA 1JQHA 3VBQA 3ZMMA 3DNDA 3FPQA 4O81A 4L53A 2JDTA 4FGBA 5IA2A 3BHUA 3LCOA 1PMEA 3FEGA 2JEDA 4JBPA 2BZIB 5HTIA 2GNGA 4BRXA 5CAUA 5EOLA 1XH8A 4RA4A 2BAJA 3U6HA 2RKUA 2WQBA 3DFAA 5TT7A 4I5HA 5J1WA 1SMHA 1YWRA 4QTAA 3UZTA 1DM2A 3ZHPC 4UMTA 4EOMA 4XP0A 3ZC5A 5KHXA 3VAPA 3MPTA 4IHPA 3RK5A 2WIPA 5EK7A 3G6HA 4K33A 1YI3A 2VGOA 2Y4PA 4CNHA 3OCGA 3DTCA 4NM3A 3HGKA 2QI8A 2XARA 2ITUA 2OH4A 2JGZA 2X39A 3NS9A 4TT7A 3SG9A 4XNEA 4BIBA 2X0OA 5A4EA 3FAAA 4C8BA 4YTHA 2J7TA 2VTHA 3JYAA 4QP3A 2OXYA 2UVXA 4KBCA 2ZV2A 3EQCA 4O82A 3FWQA 5I9WA 3UQFA 3LCTA 4I92A 4RJ8A 3NYNA 3R01A 3W16A 4BL1A 1YXTA 2ETMA 4HGTA 3Q4TA 4ITJA 5HBJA 3CLYA 4DF3A 2VO6A 2OZAA 3ULZA 4EOJA 4I1ZA 1R39A 4TWPA 2W1EA 5M56A 3F2NA 2ZMCA 5L2WA 4CKIA 3F5GA 2ACXA 2XMYA 2B7AA 2UVYA 3GGFA 4HPUE 2VTPA 3DV3A 2EB2A 3DXNA 4PDOA 2WEVA 1UV5A 4BCMA 4RG0A 2PVHA 2VTAA 3FYKX 4R1YA 1WBOA 2RIOA 5AP5A 1DAYA 4CZTA 1JKSA 3W0PA 1UU8A 5EW9A 2GTNA 2VV9A 3FY0A 3MH0A 3BU3A 4ALWA 5AR5A 4XX9A 4PMTA 3ZRLA 5LQFA 4FL3A 4G5JA 3DPKA 3EOCA 3OG7A 4O0UA 3HMPA 1LEWA 4MHAA 4Q9ZA 5LJJA 3GCVA 4E5BA 4BR3A 5B2MA 4FZ6A 4O2ZA 4OTRA 5CXZA 4EZ3A 2X9EA 3TNQB 3Q4UA 3AD6A 2GHMA 3EQFA 3DZOA 3I5ZA 4YJQA 1YXSA 4MWHA 5C4KA 3Q3BA 1UWHA 3GC7A 3R7UA 4L3LA 3RKBA 1FMOE 2FA2A 4FUXA 5CEKA 3HZTA 4HVIA 1UNHA 4FZ7A 5ANEA 4UMQA 5IQIA 3JS2A 2GFSA 3TV7A 4ANSA 4PPBA 1G8KA 3QAME 3LLTA 3RCJA 3UDSA 3AKLA 3MS9A 4AFJA 3R63A 2ITOA 4D2RA 1NW1A 5IQGA 2JBPA 3BHVA 2PK9A 4BZNA 1OKVA 4MH7A 4H3PA 3C4CA 2JDVA 1VYWA 2F57A 2GS6A 2OJJA 5AFVA 4YPDA 2PVJA 4R6VA 3DXQA 3SC1A 3PE1A 4XRJA 3BYMA 4YSJA 5FWKK 5K9IA 4IB0A 4IJPA 1Q8UA 4IM2A 3VHKA 4IFGA 3VN9A 4ZJVA 2HAKA 3KCFA 2OXXA 4GRBA 1NVRA 2UZBA 5FEDA 4S32A 4FOBA 5HLPA 3RP9A 4DH1A 1YI6A 5JRSA 4IZ7A 4UWCA 5D1JA 4IVDA 4IH8A 2G2FA 1Z57A 4USDA 3BLRA 5BVWA 5HEZA 2O3PA 3CKXA 3DKCA 4OLIA 1HCLA 3FQSA 2ESMA 4BIDA 5D7VA 4EH9A 5K0XA 5KMJA 2GMXA 3N4TA 5IF1A 2YCSA 3POZA 4M12A 4ZSJA 3DCVA 4ANNA 4Z7GA 2WQMA 4IQ6A 5D7AA 4BDGA 2O0UA 3AMYA 2V55A 2B55A 2HZ4A 3PPJA 3Q9ZA 2CKEA 3BELA 2BRBA 4H36A 4AAAA 3UDZA 5AMNA 3BU5A 1URCA 4LDTA 5AAFA 3H4JA 3LAUA 3F3TA 4IX5A 5C26A 3BBWA 5A6NA 3IGOA 3WILA 1JSVA 4XYFA 5KBRA 3FV8A 2HWPA 1PXKA 2BAKA 4YLJA 3ZFMA 1PXNA 4BIEA 2AC3A 4CVAA 4TYJA 5E9EA 1WVYA 4MD9E 2XNOA 1WMKA 2R9SA 2RFEA 4FV4A 4C4IA 1PXLA 2UW3A 4O7VA 3FBVA 3QRTA 1RDQE 2XKFA 3RK9A 5CI6A 3F82A 3LCKA 2W1DA 2X6EA 4X3JA 3F5PA 4YZMA 3KEXA 4GSBA 4R3RA 3QYZA 2C3JA 5CLPA 3W8LA 2HYYA 2ZM4A 2W4KA 4MXCA 3LCDA 2O2UA 5BNJA 1JSUA 4BCHA 2WTIA 3KULA 1REJA 4J97A 5CNOA 4C4FA 3DU8A 1VYZA 1ZLTA 4DFBA 4MBLA 2DUVA 3MJ1A 3WZJA 1SVHA 2BRMA 3K54A 4U44A 2HXQA 1ZMVA 5BUIA 3MFSA 3NFFB 3OROA 3BWFA 4ASEA 4BVUA 3MFUA 4P7EA 3JR1A 2IW9A 2YIRA 2VZ6A 4X2NA 4O96A 3R21A 5CAOA 5JMSA 3VS1A 1SYKA 4BBFA 3V8TA 4QTBA 3FSKA 4QP7A 3ZTXA 4C4JA 3RPRA 2UZDA 3MY5A 4G17A 4F1MA 5KMLA 3UNKA 3NDMA 2OJGA 4Y8DA 1ST4A 4EHVA 3V01A 5ACBC 1PYXA 5EW8A 4N0SA 4EH7A 2J51A 2OZAB 5GZ9A 5HG8A 4WIHA 3NR9A 4KKHA 4ZSGA 2FO0A 3DT1A 1CMKE 2UVZA 5D41A 2P55A 4O0WA 3ZUTA 1BLXA 4EEVA 3KXXA 3QGYA 5EKOA 3WZUA 2R0IA 4EH2A 1MQ4A 2E9OA 1OUYA 4IEBA 5CT7A 4MQ2A 3HAVA 3ZO2A 4ID7A 4QOXA 1OBGA 4DYMA 5GIPE 1BKXA 1KWPA 5FGKA 4E6DA 2CLQA 3QYWA 2OSCA 4IAYA 4EHEA 2OICA 4GKIA 4PDPA 3DDQA 3SG8A 3NNWA 2REIA 3R7OA 4AS0A 2R3OA 3UODA 3JUHA 2W4JA 4G3EA 3C0HA 3KN5A 3OW4A 4FSWA 5TF9A 4Z3VA 1J7IA 4WSYA 4C4GA 4F6UA 4W4YA 2ITNA 4FSQA 3DBFA 5ETIA 5FBOA 3RNIA 3S2PA 4BYJA 3HYHA 4CQEA 2J90A 1PMNA 1ZOEA 3KRJA 2BZHB 3DLZA 3FMDA 1Q99A 4ASZA 5IA3A 2IW8A 5LARA 2B9FA 4CRLA 4APPA 4FSMA 4F9AA 3LM0A 3UP7A 4PP9A 5J9LA 1V1KA 2AC5A 1ZWSA 2X7FA 3FMHA 3ZRKA 4DGOA 4D2WA 2J0JA 2OIQA 5HORA 3C4EA 4TNDA 4L7FA 3CQUA 2H96A 3A7HA 4D5KA 4U43A 2QHNA 4C3RA 1Q8TA 4EK3A 2P4IA 3E92A 4O22A 3T3VA 5K5NA 4X3FB 2YIXA 3QLGA 4NKAA 4FKUA 3R8UA 3BHYA 1V0BA 4J71A 5FXQA 2WMRA 4F1OA 4D4RA 4UMPA 1GZKA 2BDWA 2WOTA 1J7LA 3CY2A 3UG2A 2CPKE 4GJ3A 4IANA 4ZJIA 5LMBA 4D4SA 3I7BA 5CI7A 4I6FA 2RFNA 4FL2A 2ZFYA 3OT3A 4BGHA 4EKKA 2C3KA 1H25A 4BHZA 1IAJA 3B2WA 3OOMA 2R3LA 4B0GA 4ZLYA 3UVQA 4U80A 5DHJA 4AOTA 3FE3A 3NEWA 2WMTA 5CALA 3GVUA 3CD3A 5IQBA 3COMA 3P1AA 3W55A 3BCEA 1LPUA 2R7IA 4K18A 3FXZA 4AGWA 4EH4A 3P0MA 3PSDA 3PY0A 4RJ6A 5AUZA 5L6WL 1FMKA 1O9UA 5CVGA 2IEWA 4FV1A 4I6QA 4LI5A 4E1ZA 5ICPA 3O8TA 5A3XA 2QNJA 2WTJA 2WU6A 4PV0A 4TY1A 3B8QA 4X2KA 3FZOA 4BCNA 5AA9A 3H30A 4DGGA 5LXMA 5M53A 1UU9A 2QR8A 3GP0A 2X2MA 3P23A 5EH0A 3PY3A 3HDMA 4OT6A 2QVSE 3WF9A 1OL6A 2JKKA 3O2MA 5DA3A 5JGBA 4NH1A 1M17A 1SNUA 4AG8A 2QLQA 2UW7A 1JKTA 3DQXA 4RVTA 3KKVA 1PXOA 3BLQA 3ZCLA 3FYJX 4DINA 1H1RA 4C37A 4CFUA 3IO7A 5HNBA 3VUTA 2J9MA 3RJCA 2OO8X 4FEQA 5I9XA 1RW8A 3LQ3A 5LCJA 5J7HA 1OKYA 3DKOA 5JGDA 5JGAA 3ZS5A 3I6WA 3CPCA 3D83A 4RA5A 3KULB 4ZEGA 2J0MB 5I9ZA 4S34A 4J8MA 4X2FA 4K9YA 3IS5A 4FKQA 4EK6A 2XK9A 4OBPA 4NW5A 2FSLX 3LHJA 4QP9A 3RWPA 2HIWA 3RGFA 3EYHA 3QWJA 4O6LA 3BRBA 4ZP5A 3QUDA 5AAEA 3ET7A 3DK7A 5CZHA 2X2LA 2AYPA 4LGHA 4XH6A 3Q2MA 3SGCA 1OI9A 3R1QA 4OTIA 2JKMA 3A62A 4ZTLA 2W9ZB 3RAKA 2YLFA 3QCXA 4EBWA 2QOKA 5JRQA 3P9JA 4LRMA 3TNHA 2B4SB 1U46A 3E88A 2RSVA 3F88A 3QUPA 2XRUA 3CIKA 1W83A 4DEDA 5AADA 1XH5A 5DOSA 3WF7A 3MY0A 1QPCA 4WOVA 2CGWA 2C5YA 3LE6A 3LFDA 4DCEA 3W18A 4IMYA 5E91A 2W1CA 5EQYA 2WOUA 3W2SA 3R7GA 3AGLA 3UPXA 3ORTA 3H0ZA 4MNEA 5LVOA 5CF6A 4FOCA 4ACGA 1GZ8A 3AC8A 4A4XA 4EH6A 5M09A 4OBQA 4S33A 4FKJA 4GUEA 3RCDA 4EYMA 2YZLA 4O7LA 2XK4A 1OL2A 3ERKA 4AE6A 3SD0A 5IH5A 2F7EE 2I0YA 5DE2A 3OEZA 3UIMA 1W84A 3ITZA 2PE0A 2Y7JA 2JFLA 5D10A 3PLAE 5E8TA 1P5EA 3EN6A 3SRVA 2P2IA 2XAOA 2GHGA 4DCAA 2I7QA 3PXRA 4OT5A 3FZSA 4CFNA 1FVVA 5AP7A 3MPAA 4KIOA 4O86A 5CASA 5HIBA 2XBJA 4MKCA 4HGSA 1TVOA 2C5OA 4IB3A 3PIYA 1FGIA 4PL3A 4O91A 2R2PA 2BRNA 1PMVA 5M06A 4M15A 2ONLC 5KCVA 5EDQA 1H00A 4DFXE 2UZUE 3EMGA 4DH5A 2QKWB 3R7YA 3BYSA 4IM3A 3ZFXA 3DAEA 3BYVA 3BIZA 3AC1A 2PZIA 4QDEA 3AT2A 3FMNA 2F49A 5GJDA 4HNFA 1XBBA 3Q60A 3PXYA 2HELA 3FPMA 4IWPA 4Y46A 4AZVA 2GNFA 4DBXA 4ZTQA 4AUAA 3EH9A 4IC8A 3ORKA 3I4BA 4BN1A 2WEIA 3R73A 2W5HA 2OF2A 2QOFA 4RLKA 4IZAA 3RK7A 3VF8A 3G90X 3VS3A 5HTBA 4CMUA 4KA3A 4EQCA 2VWVA 3FLSA 4UXLA 3E93A 2IZSA 4FICA 4KIPA 3GI3A 4I3ZA 3ZEWA 5EYMA 5LVMA 3QQUA 1PXJA 4HYSA 4Y5QA 2WMBA 2YM3A 3O5AA 2WTCA 1R0EA 5ANOA 2C6OA 5BQ0A 3A7FA 5E92A 3FZPA 3TNIA 1XH7A 3EYGA 4MD7E 4RT7A 2C1AA 4WUNA 3RALA 2PZPA 3UIXA 4AT5A 4BDFA 5BVFA 2BIKB 4RSSA 4TWNA 4FV8A 3IKAA 3DAKA 3O7LD 4RWJA 5JH6A 2EUFB 5A4CA 4AE9A 2UW8A 4ZTHA 4EQMA 5IA1A 3R6XA 5CEIA 3OBJA 4FEXA 5KHWA 3C4WA 1U4DA 3SLSA 4KSQA 3G33A 4M66A 1P14A 3GB2A 1GIIA 4NU1A 3MYGA 2YACA 1PYEA 4FIFA 2IVVA 3W0SA 3LJ2A 4EOQA 3SVVA 3NNUA 3ZLSA 2R3QA 5HZNA 4N6YA 3IECA 3I7CA 1H24A 1YHVA 4E6CA 2A98A 2E9UA 4DG2E 2OJ9A 2BHEA 4FKTA 1OM1A 3IK3A 4OTHA 2OKRA 5T68A 1Y6AA 2C6MA 4RFZA 2P33A 4XV1A 3OY1A 4WNOA 4OTQA 3Q2JA 2Y4IC 2YAKA 5F1ZA 4ZMEA 2AQXA 5CU4A 4U5JA 2BALA 5HG5A 1ZXEA 3M1SA 5L3AA 1KOBA 1Q97A 4NWMA 3TT0A 3HX4A 4RJ5A 4HYUA 2PWLA 2ITYA 3L8VA 2VU3A 3OC1A 4E26A 3EZRA 2XM8A 2BDFA 1ZY4A 5FTOA 4BBEA 5IA4A 5DBXA 4H3BA 1GOLA 1U5RA 4FTQA 2XIRA 4QP2A 1A48A 4RJ4A 3C51A 3CJFA 3SA0A 2KULA 4FKOA 4WKQA 1PXIA 5F94A 3ZXTA 5JZNA 1FINA 3ZLXA 4IW0A 5FBNC 3OCSA 4P2KA 3PPKA 4IWOA 2GS7A 3OEFX 3O8UA 3OZ6A 4GG5A 4PPAA 2QOBA 5DN3A 4LRKA 5DR2A 4C34A 3P7AA 4O4BB 4I4FA 1YWNA 2X0PA 4IADA 4L3JA 5CVHA 4C4EA 1E1XA 3IQ7A 3OMVA 4DTKA 4DFNA 2VAGA 3EFKA 4FZAB 5GJFA 3BQCA 3ZEPA 5IUGA 2PTKA 4DEEA 3P5JC 5LWMA 1STCE 4DN5A 4MNEB 2O63A 3MIYA 5AUXA 3V5PA 1M2PA 4E6AA 4FT3A 5EYCA 4FTNA 3VO3A 5BX0A 3R8LA 3LJ1A 2W1HA 1AD5A 2G15A 3BE9A 3D5VA 4I20A 4CKJA 4Y73A 3SRVB 2BZJA 3VJNA 4HZSA 2R3IA 5C8MA 2NNWB 4BWKA 4D28A 4BDIA 2XK7A 1J3HA 2BFXA 3SX9A 4Z9LA 1MRUA 3EB0A 2YDIA 5L6OA 3FSFA 3D2IA 2YIYA 3DZQA 4CT1A 3MB7A 4R5SA 5HVKA 2XK6A 3I6UA 4AF3A 2A0CX 3W2RA 4J95A 4PQNA 1NXKA 4TXCA 2XJ2A 1OECA 3VF9A 1SM2A 3U9CA 4A9YA 4YZ9A 5K3YA 2W1IA 4JG7A 4UMRA 3KGAA 3MVMA 1Q8YA 4CD0A 3FL5A 3OS3A 2B9HA 2OW3A 2HZ0A 3R04A 4LOQA 5IISA 4FYOA 2YN8A 5HTCA 3ODYX 5I0BA 4ORKA 2DS1A 3Q52A 3QQGA 3AXWA 3HKOA 2VTIA 3OT8A 4TNBA 3MJ2A 3DB6A 4OW8A 1GNGA 1J7UA 4ANQA 4YC3A 1OIYA 4QYFA 1OIQA 3MIAA 4GV1A 4MXOA 4EZ5A 4EONA 1MUOA 3CC6A 4GK2A 3VS4A 5IA5A 5FUTA 2YDKA 3PJ8A 2C6DA 4IE9A 5AM6A 2X9FA 3ALOA 3BBTB 4FV5A 3A4OX 3HECA 4J1RA 3LMIA 1IG1A 2ZV9A 4FNZA 4F7NA 4QYGA 4ZSEA 5EI8A 3V6RA 1G8AA 4CYJA 4H39A 5HVJA 3PVWA 4LV5A 4HJOA 3R9RA 3KMMA 4FODA 3TNPC 4D0WA 5JSMA 3PWDA 5FRIA 1TQIA 2FVDA 3HP2A 5HCXA 4K77A 4OBOA 5HX6A 1YWVA 2XEZA 3K3JA 3NAXA 5AJQA 2FYSA 4YJSA 3R1YA 2H9VA 3FLWA 4YJUA 4JDJA 2VWZA 3T3UA 4LOOA 3PVBA 4M68A 5AV2A 2WQEA 4BI2A 5AV1A 1P4OA 3DAJA 4CG8A 2WAJA 3HEGA 4CV8A 1GY3A 4X3FC 5EHLA 1ZY5A 2V0DA 3OFMA 4C61A 2BZKB 1WCCA 5EM5