5BVDA

Tetrahydropyrrolo-diazepenones as inhibitors of erk2 kinase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
350
structure length
330
Chain Sequence
AGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVTRWYRAPEIMLNTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Tetrahydropyrrolo-diazepenones as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 330
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bvdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bvdA01
3NUNA 3C5UA 2GHMA 2PHKA 3D15A 2QQ7A 5F1ZA 5HCZA 3UE4A 2WIPA 4ZSLA 5B2LA 3RVGA 4MD7E 3AQVA 4FTCA 3II5A 3R02A 3ZDUA 4C34A 5IMXA 2C0TA 3WF9A 3MWUA 4IH8A 4FT3A 3FPMA 3R9NA 2WMBA 5A4CA 3F5PA 5L3AA 4EYJA 4P7EA 4MD8E 4J96A 4A4XA 4AT4A 4BWKA 5C8KA 2CNQA 4FV8A 4PPCA 2IG7A 2WQEA 4QPSA 1URCA 2UW0A 3ETAA 2UV2A 3HDMA 4C8BA 4U6RA 3OT8A 4TKSA 4FV1A 3EKKA 3CSVA 3QQKA 2DS1A 4M84A 2QOCA 4DBXA 4EKLA 3HUBA 4U42A 4HYUA 2QR8A 2XH5A 2YZAA 2ZV2A 4D5KA 2VZ6A 3CJFA 2W99B 3VBVA 4F08A 2HXQA 4RWLA 3MJ1A 4YMJA 3UIMA 1JWHA 4RA4A 4TZRA 5LWMA 4CFMA 1YOJA 2JKOA 3COIA 4E5AX 3ATTA 2PVJA 4FIEA 5HVJA 4WBBB 5A54A 5FDPA 5ETIA 2XS0A 4HPTE 2XCHA 3RPYA 3ZONA 4B8LA 5FXRA 4K8AA 5TO8A 3VULA 2BPMA 4FV3A 4NFMA 2LGCA 4L67A 2FB8A 4RIXA 4NK9A 2NP8A 5EYDA 5FEQA 1J7UA 3DBFA 5CXZA 1PXIA 4U7ZA 4PL4A 3D9VA 3AD4A 4V0GA 3FMHA 3UMWA 2VUWA 2B55A 4OW8A 5CT7A 1WBTA 2FSOX 4ID7A 4YPDA 1XJDA 3TZ8A 4R5SA 3ODZX 4NM3A 2QOIA 2VGPA 4MXAA 2ETKA 2VTOA 4CQGA 4UB7A 3NNUA 1TQMA 2WQOA 3LFBA 2YISA 4TXCA 1E1XA 2QKWB 2JEDA 3AOXA 2R5TA 3EQFA 5IH5A 3QC4A 4E6CA 4FTQA 2IZRA 5L2IA 2NRUA 4DINA 3R7EA 3WF5A 5JZJA 1BI7A 4Q9ZA 4PMPA 5BVOA 4UWYA 2IPXA 4O7ZA 5HG7A 4O91A 2R7IA 2XIYA 2UZEA 3JUHA 2UZUE 3UTOA 3KF7A 4L53A 4PF4A 3EOCA 5HLNA 5A4LA 4YZMA 2JKQA 3PJ2A 3R71A 4FIFA 4FSWA 4X2KA 4EZ5A 1PHKA 4YJQA 4L52A 3RPOA 1BL7A 5H8EA 1O6LA 3OWKA 3UP2A 1Q97A 4C3PA 4KIPA 5CNNA 4HGEA 2QO7A 2C1BA 4FBXA 1WAKA 2C3LA 2EXMA 3HMPA 4AE6A 2XBJA 2QO2A 4MXYA 3ZSGA 4L00A 3ZO1A 3B8QA 5HX6A 4L6QA 2VD5A 3NCGA 3O8TA 3R28A 4BCKA 5AUTA 4OAVB 2BHEA 3VC4A 3A7IA 1NVQA 3JVRA 4XBRA 3ZXTA 2J4ZA 2W7XA 3NYVA 4NFNA 4DE4A 1ZLTA 4ZTNA 4IW0A 4TWNA 4BKYA 3EQIA 4EOJA 3RM7A 2RFEA 4ANLA 3U6JA 3V51A 5FBOA 5I9XA 2Z8CA 2JAMA 1VJYA 2R7BA 3MVLA 4TY1A 3SC1A 3CQUA 5KMLA 3F3VA 3ERKA 1Q8YA 4X2GA 5T6KA 4CFUA 2QOLA 3FMDA 5JGDA 3CBLA 3RNYA 2CPKE 2V55A 3CE3A 3BQRA 2OH4A 4L46A 4H3PA 3LAUA 1FVRA 2I0EA 5FLFA 4CZYB 5CEMA 2VTTA 5CI6A 2XEYA 4FV2A 4UALA 1OB3A 1S9JA 3AGLA 3D0EA 4XH6A 4ZMEA 3PPKA 3HLLA 3KB7A 1S9IA 1NVSA 3EL8A 4H39A 1KOAA 2FO0A 1ZYSA 3PXKA 1PW2A 2B53A 4DCEA 2WB8A 3ZUTA 3NDMA 5BYYA 3QTUA 5EM7A 1KE6A 4I4EA 4YJTA 3E7VA 3QCSA 4CZTA 3KRJA 4QMMA 3H4JA 4ASXA 4F70A 2ONLA 4IMYA 2WMAA 5CZIA 2GQGA 4AN3A 4NTTA 5AMNA 2AC3A 2O3PA 4JAIA 2VTIA 3R1YA 4GIIA 3LZBA 4I0RA 3W8LA 2UZBA 4O27B 5TKDA 4YZBA 2ITUA 2HW7A 4RIXB 3RAHA 5ACBC 3NCZA 5AUWA 3NYNA 4J53A 4QQJA 3ZCLA 4V0GB 4ZP5A 4FICA 3RAIA 5J7HA 4ZK5A 2VTRA 1L3RE 3EIDA 4X6RA 4ZEGA 3ZZWA 3EN6A 1Q4LA 3VS7A 5EDPA 2XKDA 2QCSA 1H27A 3DBEA 5BVFA 4K33A 3JY0A 4PX6A 4S2ZA 4BVUA 2XJ1A 1SZMA 3KEXA 5K3YA 4FKOA 4WOVA 1J7LA 4J7BA 2F7ZE 5F4NA 1L8TA 1WVXA 3MS9A 3QGYA 2QKRA 2PWLA 4P5ZA 2QU6A 4RRVA 3CS9A 3FXZA 4F65A 5IMEA 1P4FA 3DNEA 3N4TA 4FEWA 5JQ8A 1V1KA 2O0UA 4KKHA 3OCTA 3GCQA 4MK0A 1T46A 3F5UA 5HIBA 4H3BA 5KZ0A 5TE0A 4UMPA 3F5GA 2B52A 2QNJA 4E4LA 1A9UA 5D10A 2V7AA 3QTXA 3FZOA 3IW8A 4M69A 3S2PA 3UG1A 2B9JA 3DZOA 2BHHA 2CGXA 5IA4A 4GUBA 4Y5QA 3DQXA 4E4MA 5I9VA 1FMKA 4CTCA 2XK6A 4OTDA 5IH6A 4F7JA 1MRVA 1JQHA 4FSUA 5A3XA 5E8VA 4QMZA 3S1HA 5F20A 3IGGA 4XS2A 3L9PA 4H58A 4X3FA 4G6OA 2PE2A 3TV7A 2XK7A 3CTQA 3C4EA 4N57A 3LCSA 4E5WA 2R3GA 5M57A 5I0BA 3HA8A 3KF4A 2VTNA 4MEDA 2RSVA 2GU8A 1H01A 4O2ZA 3SVVA 4ZY5A 4IB0A 1XR1A 3G90X 4E6DA 2W1CA 2WNTA 4GFMA 3KK9A 2Z7LA 3ANQA 4DLJA 4EYMA 1CDKA 2W5BA 4ITIA 3MESA 4EH8A 5IQIA 4O7TA 5FEDA 2XNGA 5AUXA 5IEXA 3GCUA 1RE8A 3OF0A 4FUXA 3ZS5A 1B39A 2BRBA 3ORTA 3QCQA 3JVSA 4LV5A 4F0IA 3HKOA 2ZJWA 3M42A 4GW8A 5DOSA 4BDJA 3UO6A 4C4HA 4BGHA 4PDPA 5CF4A 3LFCA 2B9HA 1PMEA 2YIYA 3QLFA 4M0ZA 4FKJA 2VO3A 4O0SA 4ZTHA 1UWHA 1OMWA 4E26A 5DA3A 3ID6C 4FZ7A 4EH7A 2BTRA 4FX3A 5F94A 3QHWA 5BUIA 4EH4A 4QYYA 4IWDA 4DT8A 3TZMA 4BY9E 3SXSA 3MYGA 2JFMA 1IG1A 3TUBA 4E20A 4RMZA 2IW6A 1PKGA 4GT5A 3Q5ZA 4C38A 3LM5A 2VTAA 2GFCA 3MY1A 3QRKA 4ZZMA 2C5XA 2W9ZB 4J95A 1WZYA 3DK7A 5B2MA 4EJNA 3WIGA 2C6DA 4AP7A 5BYZA 3F2NA 4FR4A 3UC3A 1UWJA 4DEGA 3QUPA 2PUIA 3EB0A 2XM9A 3BV3A 4XYFA 3T9TA 5C01A 3T3UA 5LMKA 5LMBA 2HCKA 5DRDA 4X6QC 3IW5A 3TIZA 2PZIA 3Q32A 3UOHA 3W2CA 4ANBA 2YAAA 2RFNA 2HAKA 4I6BA 4WG4A 3ZHPC 2WFYA 4ACHA 4BDAA 1XH9A 4BKJA 5A9UA 3CTHA 4DGNA 4GMYA 4B6LA 5FGKA 3QX2A 3ZYAA 3OVVA 5A4QA 4AOJA 3TN8A 3SG8A 5CSWA 1YQJA 5HLWA 4MF1A 3SOAA 3PFQA 4F09A 4QMOA 3UZRA 3C4CA 4YLKA 4R8QA 4WKQA 4F9AA 5E9EA 5D1JA 4BIBA 1W7HA 4LRJA 3PXRA 3FL4A 4BB4A 4BBFA 2WTWA 5FXSA 3EJ1A 1Q5KA 4GU6A 3TV6A 2PVKA 3Q2JA 5GIPE 1U5RA 2XNOA 5AWMA 5FWKK 2YM3A 5KBQA 2CHLA 1CTPE 4CMUA 1OI9A 1ZXEA 2VN9A 5CXHA 4IX5A 2WTVA 5AX9A 4BHNA 1H1PA 4YU2A 4A4OA 2C3IB 5EM6A 3PE2A 4C02A 5HORA 3RHKA 3QALE 4WBOA 1OIYA 4M69B 3PTGA 5B0XA 3VUKA 4GG5A 4O6LA 4JG8A 5A6NA 5IUHA 1OKZA 2HY81 3D7TA 1DI9A 1W0XC 2UW8A 3P86A 4IM3A 4L43A 5E8SA 4B4LA 3FSKA 4RWIA 4UBAA 3SQQA 4LI5A 4DH8A 3OXZA 3BGZA 3ACKA 3R2YA 4BCMA 4X3FB 3MFRA 3HRFA 4JRVA 4N0SA 2WELA 2GNHA 4XLVA 3UZPA 5HTIA 2BKKA 4GVAA 3QQGA 5M51A 4P5QA 2DYLA 3QHRA 4FA2A 2OIDA 4YTFA 1U54A 3GC9A 5D9HA 2O2UA 2E9UA 2Y7JA 2VWBA 4GYGA 3PXFA 3DKCA 3R8PA 3VVHA 2E2BA 3E92A 4UZDA 4ZJIA 2VWVA 4B99A 4C4GA 3FXXA 4YHJA 4QQCA 1W82A 2PU8A 4RFZA 1JBPE 4QRCA 3TWJA 4M8TA 3RAWA 3VBWA 3H9FA 3A99A 4IB3A 4CV9A 1PXLA 3G0FA 4NU1A 1M7QA 2R3QA 2X7OA 3C4XA 1CKPA 3F5XA 2GNFA 3K3IA 3POZA 4PMSA 5AP7A 2XK4A 2XRWA 3F3WA 5DPVA 3SD0A 2YWPA 1J1CA 3WZUA 3CPBA 1T45A 1GOLA 3D5VA 3QC9A 4IZ7A 4UZHA 4PTGA 3DAEA 3REPA 4BFMA 4KIKA 5CVGA 1XBAA 4OR5A 4TWCA 3PJ3A 3C13A 5ANKA 3TJCA 3FYJX 4DG3E 3LE6A 5DGZA 2B9FA 4ANMA 2FVDA 3HMIA 3W2OA 3MN3A 5ANDA 1JVPP 3TG1A 4IVDA 3GC7A 4BCNA 3TUDA 4JG6A 1SVEA 1ZYLA 5AR8A 3F3TA 3TNWA 4EOMA 5HE1A 4AZTA 3DDQA 4ZXTA 3VJOA 5LVMA 1QL6A 5IH4A 4YJUA 3ZRKA 2JITA 5K4JA 5ETAA 3H9OA 4UMQA 4FKSA 3FLSA 4RWJA 2WTKB 3BLQA 2IVVA 4PUZA 4CZUA 1IR3A 4PMTA 2WZJA 3NUUA 3Q3BA 1NT2A 2WXVA 1H4LA 3O96A 5HCXA 5EH0A 3W32A 3R1SA 4HVSA 4E73A 4YNOA 3NNXA 3R1NA 3LLAA 4EH5A 3QTSA 2WAJA 2VWZA 4RBLA 3DBQA 3E63A 4FIJA 5TR6A 2Y4IC 4W8DA 4XHKB 3DY7A 4BWXA 4EQMA 5C4LA 4DG2E 3GBZA 3PVGA 3O7LD 5IEVA 2QOBA 2QURA 1MRUA 2BMCA 4WNPA 3I4BA 4EK6A 3S3IA 3ZEPA 2X6DA 3WE8A 5GZ8A 2UZVA 3HDNA 2VGOA 4QMVA 4U45A 5HIDA 5J9YA 4BC6A 2R0IA 3ANRA 4OT6A 1UNLA 1PKDA 3DKFA 4NJDA 3DGKA 3TEIA 4D28A 3G0EA 4XOYA 3QD3A 1XHAA 4D2WA 2BVAA 3CD3A 5FP6A 4DTKA 3QL8A 4BGQA 4C7TA 4JLCA 3UNZA 2HZ0A 4IAAA 5ANGA 3RP9A 3JS2A 5FD2A 2OFVA 3VS4A 2BRGA 4BCFA 5LVNA 4BWPA 2YCFA 5IISA 2CKEA 1AD5A 4ZSGA 5KBRA 1RW8A 3D7TB 4NEUA 4RLKA 5C27A 4EK5A 4YSJA 4G16A 4TNDA 1AQ1A 5IDPA 1REKA 5F95A 3PVWA 4DEEA 3VS1A 1SYKA 5LCKA 3SAYA 4TYJA 4BCHA 3ULIA 3TTIA 4RVTA 2ITPA 2A19B 3HX4A 4AW2A 1Z9XA 2PVYA 4CMOA 4O7RA 1F5QA 1U54B 1YDRE 5E8UA 4ZY4A 3RINA 5I9WA 4CKIA 4G6NA 3GXLA 3LCOA 2WMRA 4DGOA 2VX1A 3L1SA 4O83A 2OF2A 4QMPA 4W9WA 4AZWA 4MXXA 2G01A 2JGZA 3GCVA 4WG5A 4WUAA 3VS2A 1H0WA 3MH0A 2BFYA 5HBJA 4C4FA 3LJ1A 3Q9ZA 4XP3A 1GZKA 3TIYA 3NW5A 3OXIA 3W18A 1KE5A 3MIYA 4FSYA 3FV8A 4EK3A 3LFFA 3G9LX 4TW9A 5HD7A 4Z16A 3PJCA 2JAVA 4BHZA 3QA0A 2C47A 4DT9A 2WTJA 5AADA 3UYTA 3RK5A 2J0LA 3B2WA 4IAZA 4KIKB 5JFSA 5GZ9A 5H8BA 4KNBA 3H10A 5IU2A 3OEZA 4Z3VA 3MY5A 4EWHA 3NUYA 4HGTA 3LCDA 3MDYA 4QQ5A 1DAYA 2UZWE 3BWJA 4I6HA 3FMNA 4MNFA 4BTMA 4H1MA 5DG5A 2HENA 4FTOA 4QTEA 3U54A 1XBCA 4W4VA 5M4CA 4UWBA 3OWPA 2GPHA 4GV1A 4NW5A 4W4WA 4EH9A 2FUMA 4RGJA 1U4DA 5EI6A 5LJJA 3PPZA 2B0QA 5CEQA 1SMHA 2AYPA 4K18A 1NXKA 4ERWA 4OAUC 4G9CA 3AC4A 2V22A 5LOHA 5CX9A 3CKWA 3QZFA 3K2LA 2BFXA 4F7LA 3BZ3A 4DGGA 4UMUA 4QMYA 2F7EE 2GS2A 1Q8WA 4X7QA 3MH3A 1FGKA 2YDKA 2R3NA 4FZDB 3MB6A 4I6FA 4RQKA 4HVDA 3IDCA 1MQ4A 3I6WA 3TZ9A 1ZYCA 2UW7A 4N6ZA 5E7RA 4GH2A 3ZUVA 1Q8TA 4BTFA 5AEPA 3GFWA 1PXPA 2J51A 2OF4A 3ET7A 5J5TA 3GP0A 2X8IA 5HG9A 4YGAA 4EHGA 5FM3A 2UW9A 3LMGA 5AV1A 4D4SA 1WMKA 5F9EA 4O0YA 1W83A 1JSTA 4D0WA 4AGCA 4EH3A 1JLUE 3QKMA 2ITZA 2PY3A 5AV2A 4AUAA 4FG9A 4E8AA 3FUPA 3RMFA 3BLHA 4BI0A 1KV2A 3VF8A 5CU6A 2W1GA 3Q4ZA 4KS8A 4TWOA 2J6MA 3L9LA 3FMKA 5C03A 3QD4A 3WYXA 2W1HA 3LXPA 1WVYA 1G8AA 4LYNA 2FSMX 3F61A 2LAVA 1H0VA 4QTDA 5GIOE 5IQAA 2OJJA 2GNJA 1YOLA 4C33A 3DBDA 5HI2A 3TCPA 5JGBA 4FL2A 5GNKA 3UQGA 3SGCA 3AC1A 3AT2A 3OWLA 5EI8A 4ALWA 3CIKA 3ZO2A 4IADA 4I24A 4K77A 5HE0A 4I0TA 4ASEA 1FVVA 5DEWA 4O7SA 4YBJA 4V05A 5BVKA 2C69A 2XNBA 4RSSA 2OWBA 2XEZA 4F9BA 4E7WA 2G1TA 2W5AA 2WHBA 3DAJA 3FC1X 3ALOA 3R7OA 2W1EA 4F6WA 2GFSA 3GU7A 3KMUA 3MFSA 1E9HA 3I81A 5C9CA 3PDTA 4QP3A 4KRCA 2PE1A 2YIQA 3IGOA 4UEUA 3O2MA 3GC8A 4V01A 4O2PA 4D9UA 2ITNA 1JKKA 4EWQA 1OECA 2Q83A 3G51A 3TNIA 2GCDA 3FZPA 2IW9A 4GUEA 3ZZEA 2PUNA 3LQ3A 4LGGA 4QMXA 1FBNA 4LMUA 5DYJA 4FTNA 2YACA 3MSSA 3G9NA 3QD0A 4O38A 2VX3A 5CQUA 3LFQA 3BGQA 3GOPA 5CSVA 3OCBA 1GIHA 4Y8DA 4D9TA 4EOLA 3FMMA 5C26A 4TWPA 5E90A 4MXCA 4PDYA 3Q4UA 3IO7A 4D2VA 3TKIA 4KRDA 4NWMA 3P9JA 2ZM4A 3UVRA 3ZBFA 2VTPA 5JT2A 1LP4A 2WTDA 3K3JA 5LMAA 3A7HA 4DITA 2IZSA 3OD6X 3IK3A 4ZZOA 3ITZA 4HZRA 4LOOA 3OW3A 3RJCA 2VWXA 2X8DA 2YM4A 4DTAA 1ZOEA 2UW6A 5T68A 3CQWA 3MPTA 2C6MA 3R7VA 3AMBA 2VU3A 3R7GA 2X0GA 4P2KA 3EQCA 3NPCA 4XCUA 5I5ZA 3DXNA 3ZRLA 1ZWSA 4FKUA 3EH9A 2I0HA 4FV7A 3V8SA 4CTBA 5M56A 1OPLA 1IRKA 1F0QA 4IVCA 4A9RA 2C68A 4MF0A 2ITXA 4PDSA 4X2NA 5HQ0A 5KUPA 3A8XA 3D5WA 4XG3A 3W16A 2BUJA 3O17A 2EWAA 4O1OA 5EW8A 4GFOA 5EYMA 3V6RA 4F4PA 4A9YA 2XKFA 3U4WA 4BDEA 4DCAA 1ZYDA 5CLPA 4FZ6A 2PVHA 3B2TA 3KK8A 4OLIA 4X2FA 3VS6A 4AT3A 5DR9A 4AW5A 1P2AA 5KKRB 3ZC6A 4BF2A 4H05A 5AX3A 1SVHA 3SA0A 3UODA 4UXLA 3GENA 3JY9A 2PZYA 3E3BX 2W4OA 4K11A 3DQWA 5FP5A 3IDBA 2ZM1A 3QKLA 2HXLA 2ETRA 4RPVA 4W8EA 2CDZA 3NSZA 5CF8A 3D5XA 4QMNA 4FSTA 4FEQA 2Y0AA 3KC3A 3LMIA 1JKSA 3QRUA 3OXTA 3PVUA 4M7IA 4O7VA 4GT3A 2YN8A 3IQ7A 2QODA 4MWHA 4PNIA 3UIUA 4YHFA 3UDBA 4FTMA 4IZYA 4EK8A 1ZY4A 5JRSA 4QMLA 4HGSA 3H30A 2YM7A 4FYNA 4I41A 5AUZA 4FF8A 1NW1A 4GRBA 3KGAA 4RJ7A 4GS6A 4FEVA 4KINA 4PRJA 1YXSA 4OTPA 2WKMA 2I0VA 4QT1A 4TYEA 5DVRA 1IAJA 5A4EA 2BILB 3OBGA 4JOAA 2OIQA 2YIXA 3NNVA 1PXKA 2WOTA 5CU4A 1OKYA 2XM8A 2PVRA 2W05A 3Q4CA 5B2KA 3NAXA 2DQ7X 4BDKA 4KWPA 3SW4A 4O0TA 4HVGA 3RNIA 5IQGA 2XNEA 3LMHA 3G33A 4RC4A 4U44A 4NCTA 1UNHA 5I4NA 3VN9A 2O8YA 3EQDA 5HOAA 4AZFA 3MB7A 3MY0A 2YDJA 5L6OA 2Q0NA 4YZNA 3AC8A 4R3RA 3CC6A 3KXZA 3RCDA 3UO4A 4JBOA 4E4XA 3BIZA 3AG9A 1REJA 3FPQA 3QGWA 4CSVA 4ZZNA 4MQ2A 3VUGA 1J3HA 2GTMA 4X3JA 4IZAA 1YW2A 3CGOA 1GZ8A 2WEVA 4IDVA 4TN6A 5M4UA 3DXPA 4QTBA 3PXZA 2OJFE 4JRNA 3ZBXA 3AT3A 3SRVA 5AP6A 4Y73A 4A7CA 4AA5A 4EEVA 4EOKA 4OTWA 3I6UA 4QOXA 5LXMA 5LQFA 3UGCA 4A4LA 1TQIA 2J2IB 3BX5A 3QQHA 2BDWA 4FNYA 4CYIA 1XKKA 4QTCA 2Y6OA 1FINA 1QCFA 1GAGA 1BYGA 3ORXA 5EYKA 4MQ1A 2IW8A 2QD9A 4APCA 4Y83A 3FJQE 3IOKA 3KVXA 4JAJA 5AJQA 3F7WA 3KMMA 4RIOA 3DKGA 3LXNA 3QYWA 3PY0A 4UYNA 4UN0C 4TNBA 3FY0A 5G1XA 3COKA 5J7BA 2OIBA 3QRJA 3TL8A 3VHEA 2W1IA 3OOMA 2PE0A 5CENA 4BI1A 2PVLA 1H8FA 2JDVA 1KOBA 3DNDA 3ZXZA 4KUJA 5H3QA 5M07A 5DNRA 2J9MA 4S34A 3BHVA 4QP9A 3ZM9A 5JRQA 4ASDA 4EORA 2RFSA 2HK5A 3PY1A 1H1WA 4ARKA 2EB3A 1J91A 3LFDA 1M2RA 1XH6A 1YRPA 4WNKA 5TOZA 4AXAA 3Q9YA 4YJVA 4XV1A 3HV3A 3VRYA 2HOGA 5CAPA 2CGUA 3QWKA 3WF8A 5JSMA 3GGFA 1WBVA 2OW3A 1M7NA 4EHVA 3FSFA 4RG0A 3D5UA 3TM0A 2PMIA 3BI6A 3ZMMA 3PZHA 2PUPA 4FGRA 3WIKA 4KBKA 3U9CA 3E93A 4DC2A 5EHOA 4FKVA 3OT3A 4DFUA 2VWUA 3GOKA 3ORNA 2YZLA 3QFVA 5JFWA 1CM8A 3O51A 3KXGA 2ZMDA 4Q5HA 4YJSA 3T3VA 5HNIX 4MH7A 5JGAA 4J1RA 3PWDA 2E9PA 4JDHA 4HNIA 3OOGA 2HWOA 2ERZE 4FC0A 5EI2A 2UZTA 4YJPA 5CZHA 2PMOX 2VV9A 3W33A 4FKPA 2PVNA 5E8ZA 3O71A 4NL0A 3OC1A 4R7BA 2Z2WA 4D2SA 3U6HA 4L68A 5JH6A 1YHWA 1PXOA 5HVKA 4CEGA 5B7VA 3R00A 5J1WA 4LQMA 3C9WA 3CXWA 2CCHA 2V7OA 3PVBA 4FT7A 4PPBA 3ODYX 2R0UA 3V3VA 4GVJA 4G5JA 4DAWA 3FMEA 1J7IA 4EHEA 4AAAA 3MTLA 2HYYA 2EU9A 2W9FB 3HV4A 4XV9A 3Q9XA 2XCKA 4DGMA 3OS3A 2GSFA 4KS7A 5I9YA 2FSTX 4F1MA 4USEA 5AAEA 1OIUA 3AT4A 3VW8A 5M55A 3FEGA 1U46A 4BDBA 3RZFA 3QQFA 3DLZA 4JDJA 1XH7A 4BKZA 4AGDA 3SRVB 4IQ6A 3TDVA 4YBKA 4MXOA 4DN5A 4EHZA 3R0TA 3LW0A 2P55A 3HMNA 3FI2A 3KVWA 3BU3A 4IX4A 5KE0A 3GFEA 2UZOA 1Y57A 3BGPA 3F3ZA 1ZRZA 4D1XA 3MJ2A 4RIYA 3MA3A 4H3QA 4MAOA 4QYHA 3WZKA 5E4HA 5HNGA 3CCNA 2PSQA 5E8XA 4FIHA 3LPBA 5ITAA 3ZUUA 2J0MB 2EB2A 2XMYA 1UU7A 5AM6A 4EOPA 3EZRA 2OXDA 3BYVA 2ITYA 4GYIA 5K4IA 1H28A 2NO3A 1K9AA 4LM5A 4YZDA 5JZNA 4C3FA 4AGUA 2YJSA 2OG8A 3BBWA 2V5QA 3KFAA 3VJNA 5EKNA 5HX8A 4YZ9A 2J0JA 2WGJA 2EXCX 4I5PA 4R5YA 3TJDA 4I5CA 2JDSA 3HP2A 2VO0A 3NLBA 4BIEA 1Y91A 3IPHA 4FTLA 4GJ3A 4CGAA 1CMKE 3M2WA 2P33A 2FH9A 2IZUA 4O7YA 3UQFA 4EC8A 4L45A 4DYMA 5JQ5A 3R7IA 4I6QA 4D1ZA 1ZOGA 5IPJA 2AUHA 4P4CA 2BR1A 5BYLA 1R78A 4JR7A 2OH0E 5EW3A 4FSRA 3WYYA 3VUDA 3ZFXA 4DA5A 2ZB1A 3QD2B 5AR4A 4M14A 4QP8A 4U5JA 3EHAA 5C4KA 3PIXA 2VAGA 4WSYA 3UOLA 4FV5A 3KA0A 2YJRA 2YERA 4NJ3A 1BX6A 2CN8A 4MNEA 4I1ZA 4IAIA 3D7ZA 4I22A 2XB7A 4LOQA 2HY0A 4U40A 4D58A 1WBPA 4LGDA 4QP7A 1WCCA 4C2VA 4IACA 2VWWA 4YJRA 3C7QA 3KRWA 1BL6A 3N4VA 4A9UA 3C4ZA 4QP6A 2JLDA 3GQIA 4KSQA 5L4QA 2F4JA 3NW6A 3R22A 1Q3DA 1FMOE 3SOCA 4EH6A 3TNQB 2QLQA 4APPA 3O50A 3DT1A 1CKJA 2PMLX 5CI7A 4F1TA 4YC8A 2E9OA 2YCSA 3QTZA 4I5MA 2E9NA 4XG8A 3BKBA 3RGFA 4ITHA 2G9XA 4LL0A 2ERKA 4R1VA 4TT7A 5A6OA 2HIWA 3KCKA 4GU9A 4WHZA 2FGIA 3KCFA 3QTIA 2XA4A 1SNUA 3D2KA 3HRCA 4LRKA 2IVSA 4WD5A 4RJ8A 3HAMA 3D2IA 2X8EA 1GJOA 3LFSA 4J8NA 5HICA 4TYGA 4ACMA 3C4FA 2BAKA 4FMQA 3E88A 3PRIA 5HE2A 5AR3A 5BVDA 4E1ZA 3P08A 2BAQA 2XKEA 3F88A 4RLLA 5CU2A 3NUAA 2C5NA 4O86A 4WRGA 1G5SA 5KMJA 5FTOA 2OBJA 4NH1A 4F63A 4PTCA 3EN4A 2JKMA 1QPJA 4BBMA 3EYGA 3M1SA 4QP2A 3P5KA 1SM2A 5KZIA 3RPSA 4IC8A 5HD4A 5JKGA 5M4FA 1BMKA 5HG8A 1YI6A 3RWPA 4G1WA 3FLWA 2YIRA 1Q3WA 2BROA 5CNOA 4FTAA 2X9FA 4S30A 5CALA 3BLRA 4O7WA 1YXUA 5E92A 4FKIA 2VTHA 1PF8A 2QLUA 5HO6A 3KREA 5EQEA 1BLXA 3JYAA 3O7LB 2OLCA 3QF9A 3EQGA 5A46A 3KY2A 5IQDA 3R21A 4AT5A 4AA4A 4MYGA 4FVPA 4LRMA 2GNIA 4QMUA 1GZNA 5DIAA 2XKCA 2X2LA 3DK3A 3LHJA 3CGFA 3E64A 3FXWA 4FSMA 4PTEA 4DEHA 2XP2A 4U97A 5AR2A 4BZNA 2VTSA 5AP1A 5BX0A 5HTBA 3R9DA 3A61A 4M15A 1KWPA 3P7BA 4I93A 1MQBA 2JIIA 5K0KA 4B9DA 4BTJA 4K6ZA 4O22A 4QMQA 4II5A 3GB2A 3LQ8A 2O65A 1F3MC 4ITJA 2I0YA 3AC5A 3NYXA 4L01A 4O0RA 3PZEA 3EN5A 4XRJA 4YTCA 4FV6A 4I5HA 4LFIA 4L44A 1BKXA 4K1BA 2CCIA 1SNXA 4Z7GA 5ICPA 4I0SA 4TL0A 5L2SA 5D12A 4GEOA 4DG0E 4QYEA 1ATPE 3I1AA 2OXYA 4IB5A 3U8WA 1XBBA 3R04A 2ETMA 3FKOA 2CKQA 3F69A 3GCSA 3KXHA 3W10A 2FYSA 3BE2A 3OUKA 4JIAA 4MNEB 5AR7A 1B38A 3MFUA 4AFEA 4EL9A 4IWOA 4JL9A 4G31A 2PPQA 1YWVA 2RKUA 5BVWA 3WZDA 3TT0A 4OT5A 4FKRA 2ZAZA 4L3LA 4L7SA 3TKHA 4KA3A 3SW7A 4MKCA 3O0GA 3VIDA 1OUKA 3I0OA 2Y9QA 4PP9A 4FOCA 4J52A 2BTSA 2XRUA 3CJGA 2EUFB 4C0TA 3L8VA 3PSDA 2PZRA 3HECA 1OL2A 3TKUA 4CD0A 4O82A 4OTRA 4BBEA 5KHWA 1MRYA 2R3LA 3TI1A 3IS5A 4BL1A 3ORLA 3RTPA 3VW6A 4O0VA 1VZOA 3DTWA 1JKLA 4ACCA 4XUFA 4XP2A 3R73A 1M17A 2W17A 2W5HA 4IC7A 1IASA 1O9UA 1EH4A 4IE9A 3WF6A 1M52A 1YVJA 3A7GA 5K5NA 3WE4A 1UA2A 3QQJA 3U9NA 4K2RA 4S32A 4YURA 4DFXE 5AP5A 3DU8A 3FC2A 3PLSA 4MVFA 4RIWA 4UXQA 2QG5A 5AUVA 5L8JA 3V5JA 4D4VA 1PMNA 3UNKA 4YO6A 3G6HA 4CCUA 1H00A 3FL5A 4IZ5A 5IQCA 3EN7A 4KAOA 2HELA 3AMAA 2OK1A 2WMWA 3BHUA 4QP4A 3P4KA 3V5WA 3PA5A 4FSQA 5CF5A 3FI8A 4NSTA 1CSNA 4FV0A 5C8NA 5T3QA 2W1FA 4M97A 5EFQA 4RC3A 4MCVA 3QZGA 4D2RA 4F0GA 3TACA 5LCJA 4AOTA 5LVOA 1ERKA 4TPTA 5FDXA 2QOQA 3ATSA 3OZ6A 3RK7A 3T8OA 2IVTA 3QA8A 3FLQA 4C3RA 3R9HA 4EOIA 2GQRA 3D14A 5CT0A 3VWAA 1KSWA 4BZOA 3SG9A 4ALVA 3LXKA 4NW6A 3KKVA 3E8NA 2A1AB 2W06A 5CU3A 4B7TA 1IEPA 3BYUA 3OCGA 2A0CX 2G2FA 2W96B 5J95A 4YNEA 4FUYA 4CCBA 4C35A 4RZVA 1YDTE 2B4SB 3DV3A 3ELJA 5AP0A 5FM2A 4AQCA 4DF3A 1OL5A 3CKXA 1UKHA 5CY3A 3IG7A 1FQ1B 3V5TA 4N70A 3E62A 4OTIA 3RALA 3FAAA 2F57A 3LOKA 1I44A 2J50A 4IEBA 4JS8A 2WOUA 2GDOA 2OJIA 3IOPA 2ZV9A 2IVUA 3BEAA 1WBWA 3VBXA 1O6KA 2C0IA 3I5NA 3IW4A 4C57A 4HVHA 4J98A 5JEBA 1VEBA 1H26A 4NM7A 3L8SA 3HGKA 1H07A 2V0DA 5HZNA 4K9YA 2C6LA 2WMTA 2VNWA 3GU8A 4WUNA 4G9RA 1URWA 4MHAA 4QQTA 3DPKA 3FBVA 3BRBA 1YWRA 3ZTXA 4CQEA 5LVPA 2H9VA 3RPRA 3NVMB 3R83A 5AV4A 4YPSA 4TYHA 5DLSA 2PVMA 5ACKA 3TZ7A 1P14A 1ZY5A 4YHTA 3PA3A 5DEYA 5EHLA 5K9IA 4UWCA 3QRTA 3O23A 1OGUA 4JQ7A 2YM8A 2H8HA 2WTIA 4MWIA 2GNLA 4FTRA 2JFLA 4BDFA 4LL5A 2WIHA 1YXXA 2C6TA 3HMMA 3OY1A 3BPRA 4G6LA 3U87A 4F1OA 4R78A 1OIRA 4Y72A 2OKRA 4NT4A 4Z55A 4YP8A 3C50A 2XVDA 3AXWA 5E8YA 4C62A 3LLTA 3BE9A 1OBGA 4FVQA 5LARA 1YI4A 4UV0A 3F6XA 2ONLC 2XYNA 3FKLA 3RCJA 3UIXA 4AN9A 4NZWB 3C5IA 3PP1A 4ENYA 5EDRA 3R8LA 3KN6A 4MD9E 5HO8A 4O0UA 2Q0BA 4WIHA 4EQCA 4F6UA 2C3KA 4KKEA 3ENHA 5I3OA 1M2QA 3FZTA 3ZFMA 3AC3A 5H9BA 5GINE 5E1EA 5IQFA 2X39A 3MH2A 1CKIA 3Q04A 3QZHA 4FIIA 4RZWA 5FTQA 3ZLYA 3MH1A 3VQUA 3SX9A 3ZLXA 2G15A 3DDPA 4ZS4A 3DJ5A 4IX6A 3VS0A 3FQHA 3Q6WA 4UY9A 2NNWB 3PXYA 5BQ0A 1Q62A 5KHXA 4RIWB 2QC6A 3BV2A 3NNWA 2X7FA 3OBJA 5CEPA 1K2PA 4WT6A 4YJOA 3R9RA 1HCLA 2JC6A 3C0IA 2CKPA 1Q61A 1Y8GA 3IW7A 4N4SA 4ZJVA 2PK9A 5J1VA 3BBTB 2WU7A 3AD5A 2BZHB 2HZIA 3LXLA 3A4PA 4EC9A 5H8GA 2BKZA 3D83A 5BVEA 5A4TA 1JSVA 1UU8A 1JKTA 2BZKB 1MP8A 4FI1A 4FT9A 5CTPA 4IB1A 5CS6A 4O84A 3R2BA 3VBQA 3R1QA 1Y6AA 2R2PA 3UBDA 1OVEA 3I7BA 1FPUA 3IKAA 4BI2A 1KE7A 2QHMA 3F3UA 3QBNA 4KIQA 3LFNA 5IZFA 3R8VA 2OFUA 4OTHA 2WD1A 3UOKA 4EBVA 3OROA 4L7FA 5FQDC 2VX0A 4ZTSA 5BMMA 4B8MA 1QPEA 2Z60A 4FTIA 4X3FC 1ZZLA 3KMWA 3KXNA 4J99A 4ZLOA 5AV3A 4NKSA 4AU8A 5HGIA 3CP9A 4RFMA 3PIZA 4X21A 1RJBA 4FZFB 1NVRA 4XG6A 5CQWA 5DT4A 4ZTMA 1G8SA 2B54A 2IN6A 1OL6A 4ONAA 4F9YA 3I79A 1W8CA 5DR6A 2X4ZA 4IJ9A 5M44A 2UW3A 3MVMA 4ZS0A 2Z02A 3GC0A 5ANOA 4JDIA 4RWKA 3QLGA 2QOKA 3WOWA 1IA9A 1XWSA 4ALUA 4EOQA 3S0OA 3DLSA 1LEZA 3ZO3A 3U4UA 2YM5A 3F7ZA 3GQLA 5IDNA 5CEKA 2GNGA 3R63A 2R3HA 4XMOA 5AM7A 3L9MA 4AZSA 3KRRA 2QR7A 3EQPA 4JQ8A 4OBPA 2F7XE 3EFWA 3R8ZA 4CFVA 4XX9A 3I60A 3P78A 4RT7A 2JDOA 3ACJA 3MW1A 4RA5A 4RVMA 1G3NA 3ZSIA 4CNHA 3EN9A 3EFKA 5TF9A 3G6GA 4RX5A 2RG5A 2VTJA 4HYSA 3P7CA 3Q60A 2QG7A 4CLJA 4XG2A 5C8MA 5GJDA 3LJ0A 3VAPA 5L2QA 2VTMA 5J9LA 4ZMFA 4JI9A 2BDFA 3SXRA 3FHIA 3Q5IA 5DH3A 3U6IA 4PL5A 4AW1A 2JD5A 3HP5A 1ZAOA 3LIJA 4LOPA 4PPAA 3SHEA 2WTKC 3G5DA 2XYUA 3DJ6A 4LV8A 3QYZA 4FKWA 2R3RA 1WVWA 2YAKA 2Z7RA 3PYYA 4IVBA 3LQ5A 4FK6A 4XP0A 4YC3A 5KO1A 4W4YA 4AA0A 2XZSA 3MIAA 2C4GA 3AMYA 1B6CB 2X1NA 3P0MA 1OZ1A 5HLPA 4O7LA 5J87A 4BCOA 2DWBA 3NIZA 1OIQA 5D7AA 3K5VA 5IA5A 4DH1A 5AIRA 2BIKB 4HCVA 4RFYA 5EOBA 3VQHA 1YHVA 3QTWA 4L8MA 5FRIA 4ZTQA 2X2KA 3QKKA 2QHNA 5IG1A 2PZ5A 4WG3A 5IUGA 3PXQA 5KMOA 4R3CA 4AZVA 2YEXA 4J71A 4Q9SA 4QPAA 5CAQA 3Q9WA 2OXXA 3FZRA 3QZIA 2OO8X 3FLZA 4J8MA 3V01A 4ANSA 5HKMA 4YUQA 5L2TA 4LMNA 3KULA 4IIRA 3BHTA 1PMVA 4HZSA 2WMXA 5FBNC 3WZJA 3UZTA 3MV5A 4BYJA 5KMNA 2EVAA 2RL5A 4Q5EA 2CJMA 4PNKA 5KMKA 3RAKA 4AN2A 4CG9A 2W1DA 4FIGA 2OZAA 4FV4A 3ZOSA 2B7AA 2R3IA 4I3ZA 2OSCA 2IO6A 3ORKA 5E8TA 1DS5A 1GY3A 4JXFA 4AE9A 1OITA 1RDQE 3LFAA 4NKAA 3DK6A 4U43A 5HBHA 2WQBA 3NVKI 2Y8OA 3QX4A 4Y5HA 4M12A 1XH4A 2YHVA 3EQRA 2BALA 3KL8A 5J5SA 2QOFA 4ACGA 3KQ7A 2WEIA 4JBQA 4Q2AA 3S00A 2O63A 1UKIA 5IA1A 3MPMA 2R3FA 4EUTA 1BUHA 5G6VA 3DFAA 3IW6A 3E8EA 4IFGA 5IQBA 2NRYA 5DT0A 1FOTA 3V8TA 3ZU7A 3UIBA 3E5AA 4WNOA 2PMNX 4BRXA 4BN1A 4NM0A 4JBPA 1K3AA 5L8KA 4FEUA 3ORMA 4JG7A 2C6IA 1Q99A 2WMVA 2R9SA 3TV4A 4EKKA 2R3OA 3PG1A 5JFXA 1R0EA 3D94A 4YJNA 4U79A 1U5QA 1XQZA 2GS7A 3T9IA 4XEYA 4DLIA 3ZC5A 5GJGA 1QPDA 1OKWA 5BMSA 5HU3A 2X7GA 1R1WA 4BGGA 2JIUA 3QRIA 1UU9A 3UMXA 2WQMA 2WU6A 3RWQA 4G5PA 3UNJA 5AV0A 2J0IA 3NRMA 4XBUA 4RVLA 5J8IA 4NTSA 2R3PA 2GHGA 3A8WA 3OEFX 1H1SA 2WQNA 4JX7A 5E1SA 3OTUA 3NZ0A 2O64A 2R64A 3LJ2A 5EOLA 3ZDIA 4CXAA 5EW9A 3JR1A 1LEWA 4QYFA 1H1QA 2G2IA 3ZH8A 4M68A 1DI8A 2XIZA 3RPVA 3EMGA 1OPJA 2Z7SA 2A27A 5CF6A 1MUOA 2ACXA 3I5ZA 4NUSA 1Q8ZA 3LFEA 4OTGA 4BCGA 4M13A 2YIWA 3SXFA 4XRLA 4Y46A 5J79A 3EFLA 4FGBA 5M09A 4DFYA 5CAUA 5KNJA 4D4YA 4HYHA 3EZVA 5E8WA 3BYSA 3WZEA 3U55A 4R3PA 2H6DA 4P90A 1PYEA 3RZBA 4CFWA 5L6WL 3C51A 3GCPA 4PP7A 4X0MA 4XG7A 4CLIA 3HUCA 3DOGA 1O6YA 4C61A 4FG8A 4RVKA 4E6QA 4EK4A 3QXPA 4BR3A 3CY2A 2ZDUA 2I7QA 2ZYBA 2YCRA 3VBYA 4EZ3A 3BU5A 5H2UA 4CT1A 5AR5A 3KULB 2XUUA 3Q52A 4G17A 5CWZA 3NEWA 4GG7A 3PSBA 4GFGA 2I1MA 4R7IA 3N4UA 3G2FA 3FI3A 3KRLA 4BCIA 4UX9A 3PY3A 3A7JA 2C5VA 4DTBA 5AA9A 2CLXA 2OZAB 2QONA 1LUFA 3LM0A 3DCVA 3PRFA 5HG5A 5IA3A 3QUDA 2R4BA 5KCVA 4IDTA 3V5LA 3V5QA 4MBIA 2Y4IB 1UU3A 2ITOA 1H25A 3MPAA 2FSLX 3CD8A 3DAKA 4ZIMA 4O7NA 4JT3A 2C30A 2HZ4A 4RC2A 2E9VA 4YR8A 3DJ7A 1R0PA 1GZOA 2ZOQA 3UVQA 3OW4A 1PJKA 1H24A 3ENMA 1WBOA 4PWNA 5AAGA 2OI4X 3AGMA 3W2PA 4C4EA 4GKIA 3FZ1A 4J97A 4JVGA 3HYHA 2HZNA 5KMMA 5IEYA 4IVAA 5ETCA 4DEBA 3MI9A 3H0YA 3ZRMA 3ZSHA 3W55A 4YC6A 2ZB0A 4YZCA 5HVYA 3ZLSA 4Z7HA 3WI6A 1QPCA 4RJ5A 1Z57A 3PJ1A 3H9RA 4QTAA 5LWNA 3TTJA 4ANOA 4MBJA 2GMXA 3CY3A 2H34A 5D11A 4D0XA 4CYJA 1R3CA 3R30A 4I20A 4U41A 4FTTA 1ZMUA 3NIEA 3P1AA 4Y95A 4KABA 4UMTA 4IX3A 5EM8A 3UG2A 3UYSA 5BPYA 4IBMA 4ZSEA 5HTCA 4Y85A 4F99A 4IAKA 5AA8A 2F9GA 4BDHA 3TDWA 2CLQA 3A62A 4PV0A 5JN2A 3F2RA 2P0CA 2BRMA 3BQCA 4PY1A 3PLAE 4E6AA 5EHYA 3PA4A 2ZV7A 4FK3A 3R01A 3BHHA 3NGAA 2CSNA 2QVSE 3SLSA 2YFXA 3CR0A 3CPCA 2XNNA 2Y6MA 2QOHA 1UNGA 2YDIA 3FWQA 1P4OA 3GUBA 4M67A 3FMLA 4PDOA 4DFBA 2QOOA 3DFCB 3ZEWA 1TVOA 1OM1A 1DM2A 1Z5MA 2PTKA 3F66A 4FG7A 4XG9A 2XJ0A 4PMMA 1X8BA 4LUEA 5GHVA 2XNPA 3K54A 1QMZA 5ANJA 4CG8A 1OL1A 4OBOA 4G3GA 5HHWA 3OY3A 4CKJA 3UC4A 3EL7A 2ESMA 3HVCA 2QI8A 5I9ZA 5GJFA 3PPJA 5DHJA 3TXOA 4MX9A 1W98A 4L9IA 5CU0A 2BZJA 4QNYA 2JDRA 3MVJA 4QP1A 4ZLYA 4X2JA 3LCTA 4GSBA 4AWIA 4ZAUA 2SRCA 2YM6A 2ZVAA 2ZMCA 4ASZA 3P7AA 4DEIA 3TNPC 2UZNA 2ITTA 3IECA 5AP4A 2F2CB 5CAOA 1Q41A 4FEXA 3QQLA 1PY5A 4GKHA 1KE8A 3ORIA 4IJPA 4USFA 2I40A 5KKRC 5ANEA 4M0YA 3K5UA 3O8UA 4ACDA 3NUPA 1V0OA 3HA6A 3VHKA 4ORKA 3HV7A 3H0ZA 1PXJA 4BICA 4C4IA 4DFLA 4O81A 4K0YA 4WO5A 4RX8A 5FUTA 4D4RA 3ZM4A 5DFPA 2XIRA 4ZTLA 4B0GA 4IM0A 4D55A 4LGHA 2CNVA 5DWRA 1PMUA 2XIKA 4NM5A 4W4XA 2PULA 4AZEA 3Q2MA 4DEDA 4FT5A 1M14A 3W2RA 1IAHA 4EBWA 2Z7QA 3MA6A 4YLJA 3UQCA 2VTQA 4TTHB 2GS6A 3BWFA 2NPQA 3E3PA 3UPXA 2I6LA 3DB6A 4FNWA 1Y8YA 2G2HA 3FHRA 4JDKA 5AFVA 5I3RA 2PZPA 2OJ9A 1Q24A 3FQEA 1LPUA 3LCKA 2WMUA 4IAFA 4RQVA 3CEKA 3RK9A 4AS0A 4LG4A 2VWIA 3Q4TA 3S4QA 3HAVA 3ORPA 4CFNA 3EKNA 3L8XA 4RX7A 3FY2A 2F2UA 3IDPA 2DUVA 3JXWA 2W4KA 4NIFA 3HEGA 4CRSA 3VUMA 1GIJA 5EQPA 4XJ0A 3VS5A 3GVUA 1UVRA 2UVXA 2GHLA 5ETFA 1R39A 4AACA 2VWYA 5LMKC 3PSCA 5DN3A 2REIA 3RKBA 3GU5A 3BCEA 2C1AA 3KRXA 3VUIA 3OUNB 2P2IA 4DFNA 2VO7A 3W2QA 4F9CA 3BHYA 4WSQA 3QCYA 4BDDA 4BIDA 4RIYB 4DH3A 3COMA 1PXNA 4F64A 4F7NA 2A2AA 4U3YA 4FOBA 3V04A 3PWYA 2B9IA 3MBLA 3KXMA 2C5OA 4C36A 2YWVA 4NYEA 2ITWA 3E8CA 5E91A 1JAMA 2IJMA 5HIEA 3LKMA 4V04A 4CFXA 3EQHA 2XBAA 4O0XA 1JNKA 4FTUA 4EJ7A 3OG7A 4OGRA 1I09A 3BELA 5IF1A 4I94A 1BI8A 4IM2A 2RF9A 4ERKA 1OPKA 2CN5A 2X2MA 4IFCA 2C5YA 4QYGA 1LR4A 4FTJA 3UP7A 3R8UA 1H1RA 5AUUA 5L8LA 3FE3A 2UW5A 3MVHA 4A06A 4R6VA 3FI4A 4PL3A 2C6OA 3COHA 1IA8A 4DBNA 3E87A 4FZAB 1ZYJA 2R3JA 2PUUA 4OBQA 2J0KA 3NW7A 4AF3A 5BUJA 3UOJA 3BYOA 2KULA 5L6PA 4XG4A 1NY3A 4G3DA 4CFFA 4E5BA 2WMSA 3F2AA 4QPMA 5J9ZA 1YXVA 2F49A 1SVGA 2A4LA 1YXTA 5CASA 1XO2B 3NR9A 4DFZE 1A48A 4DHFA 3F82A 5JMSA 3ROYA 5JK3A 3A4OX 3DS6A 3WF7A 3NAYA 4U80A 4I4FA 2BRHA 4A07A 4HW7A 2J5EA 2B1PA 2KTYA 1RQQA 1H08A 2FA2A 4FODA 4KB8A 3PG3A 3RHXA 4U8ZA 5EKOA 4WNMA 5K0XA 4ZSAA 3PP0A 3HV5A 4GIHA 4DEAA 2UZLA 3FZSA 5FTGA 3JPVA 2XNMA 4MTAA 1U59A 3LVPA 5IUIA 5HO7A 1J1BA 1M2PA 3V6SA 3I7CA 3NUSA 2WTCA 3NYOA 3CTJA 5KX8A 2IWIA 4S33A 1YWNA 4EI4A 4JBVA 2JDTA 3POOA 4YO4A 5AIKA 2YITA 3IONA 2VO6A 3C4WA 2BAJA 2XK3A 3GNIB 3NX8A 3PE1A 2R3MA 1YOMA 4UMRA 3QXOA 5TT7A 1JOWB 2ZDTA 5CEOA 2JKKA 4CVAA 2YCQA 3OWJA 1STCE 4FNZA 4OTFA 4TRLA 4Z9LA 3TNHA 2X6EA 3WARA 3C0HA 4IWPA 4CMTA 1UV5A 2X4FA 2J5FA 4G3CA 3RM6A 3V8WA 3N51A 3BEGA 3F9NA 1ZMVA 4O6EA 5EDQA 3DXQA 1YHSA 3PIYA 4HYIA 4NIFB 3C0GA 4BTKA 4C59A 4ZLZA 5HU9A 4C58A 3HRBA 3L9NA 4XOZA 4IXPA 4NCTC 3MGYA 5HEZA 1XH8A 2W1ZA 5CSXA 1WFCA 3FMJA 2ITVA 4ZOGA 1JPAA 3ZLWA 2WO6A 4EONA 4BDGA 2BCJA 3ORZA 4XNEA 1HCKA 2J7TA 4D1SA 4A9SA 3A7FA 3OTVA 4N6YA 4TYIA 4GK2A 3DA6A 4RX9A 4HCUA 4JIKA 1P5EA 3NWWA 2JIVA 1VR2A 4E3CA 2WMQA 4IANA 4IHPA 3OHTA 4WRSA 3DKOA 4ANQA 5IA2A 2YABA 1KV1A 3KXXA 1ZARA 3VUHA 5EYCA 3HNGA 4WA9A 4U81A 1JSUA 4QNAA 4XLIA 5D7VA 3R7UA 2GTNA 2OU7A 4O21A 4BCJA 1W84A 2XK9A 4CT2A 5CVFA 1FGIA 4F9WA 4YTIA 3QTRA 4ZY6A 4ZJJA 3ROCA 1KUTA 3UJGA 2QO9A 3BYMA 3MTFA 4W9XA 2GQSA 2VNYA 4OUCA 2HWPA 2Y4PA 4H1JA 2PL0A 3A60A 3HV6A 1WBSA 2ITQA 1WBNA 3GU6A 2P4IA 5M53A 3E8DA 4KSPA 1VYZA 4FL3A 3QCXA 4FTKA 3FYKX 5M06A 4FYOA 4S31A 1XH5A 2XIXA 5IKWA 3Q6UA 3OP5A 3FQSA 4M66A 5FG8A 2VRXA 3D4QA 5IQEA 3EWHA 3ZFYA 4CKRA 4G3EA 4XV2A 3UVPA 4GCJA 5JFVA 3UO5A 4EOSA 3B8RA 2BZIB 4HVIA 4EZ7A 4CRLA 5BVNA 4HJOA 3RI1A 1PRYA 5CANA 2BDJA 1Q8UA 4FVRA 4JX3A 4HPUE 5HCYA 2UUEA 3OFMA 3SV0A 4QD6A 4YLLA 4AW0A 3QAME 5HNBA 4F7SA 2YLFA 4AOIA 4YSMA 4R1YA 3I0QA 4DH5A 5DMZA 1OKVA 1TKIA 2C0OA 2WPAA 3GT8A 1FVTA 3U51A 2QU5A 5DI1A 3VF9A 4L3JA 5M08A 2XF0A 3DZQA 4GJ2A 1PXMA 5FEEA 4JNWA 4L42A 4KBAA 5HESA 4JQEA 2P2HA 5DBXA 2UVZA 5CVHA 1E1VA 3E7OA 4FSNA 1ZOHA 4U9AA 3GU4A 2VTLA 3NS9A 3R9OA 4FKQA 2W4JA 4FNXA 4R77A 5EK7A 4UYAA 5EM5A 3AD6A 4FKLA 3VNTA 4E4NA 4EUUA 3MFTA 4GK4A 1APME 2OZOA 4RJ3A 5I9UA 5A14A 3A2CA 5DRBA 5DE2A 4ENXA 3HL7A 2J90A 2BIYA 1YKRA 2O5KA 2XJ2A 2RGPA 4I92A 5AP2A 4I21A 3VRZA 5L2WA 2JBPA 4G3FA 3WBLA 1ND4A 1ZMWA 3KN5A 4KIOA 4USDA 2JBOA 4BDIA 5HBEA 4U3ZA 2C3JA 4O96A 3W8QA 5BNJA 2CKOA 3R6XA 4QO9A 3CQEA 3ZO4A 1HOWA 3R7YA 3EQBA 4ANNA 4ZTRA 1TQPA 3N9XA 3SKCA 5M4IA 4CV8A 5EQYA 3QQUA 3DTCA 2RFDA 3M11A 3W1FA 5C1QB 2OJGA 4FSZA 4JR3A 4OTQA 5FXQA 2CGVA 4YTHA 5DR2A 4HGLA 4C37A 4PQNA 4G2FA 4O0WA 2X81A 5DT3A 4AG8A 3VS3A 3VUTA 5CYIA 3OMVA 5AP3A 4C2WA 2P3GX 2HW6A 4FT0A 3DBCA 3HMOA 3ULZA 2CNUA 4EQUA 5CAVA 3FLNC 2X9EA 2EXEA 4KKGA 3SDJA 4AX8A 3G15A 3P79A 3EFJA 2H96A 1GNGA 1PYXA 3KU2A 4GK3A 4U0IA 3R8MA 5LVLA 4D2PA 4ZSJA 4BYIA 5KMIA 4XV3A 3HZTA 1VYWA 2RG6A 4RJ4A 3BU6A 3THBA 1OBDA 2C6EA 3P23A 4MXZA 3NUXA 5EG3A 3FKNA 2OGVA 3ALNA 3FDNA 4A9TA 4D5HA 4C4JA 5D41A 3QU0A 1OUYA 3FLYA 5CEIA 4QMWA 4E93A 4GL9A 3C1XA 3VO3A 2PYWA 4BCPA 4RJ6A 4FKGA 4HNFA 4GT4A 3TUCA 4FKTA 3QWJA 3PJ8A 3S95A 5AUYA 3L8PA 5IA0A 2W0JA 3PUPA 2YA9A 3CLYA 3RBWA 3OCSA 4FV9A 3EYHA 3VBTA 4D2TA 1OL7A 2XK8A 1NA7A 4H36A 1A06A 2CGWA 4F6SA 3UPZA 1KE9A 3O8PA 4M3QA 3WILA 4EH2A 3QTQA 4F0FA 2RIOA 4IAYA 3Q53A 1AGWA 3Q96A 5GZAA 4TYHB 2V62A 4DH7A 4QMSA 2BRNA 1YDSE 2ZV8A 3DB8A 1DAWA 4G34A 4HCTA 4LUDA 1V0PA 5AAFA 2C6KA 4L3PA 2UVYA 5IQHA 1ZZ2A 2ZM3A 1GIIA 3AC2A 4KD1A 3NMUF 2R3KA 4MBLA 5CSHA 2AC5A 4HOKA 4BDCA 4DGLC 5HE3A 5CSPA 3H3CA 4O1PA 3V5PA 1YI3A 4FE2A 2YLEA 4BCQA 4BZDA 4R7HA 4EOOA 4JJRA 1V0BA 4IWQA 2CMWA 4KBCA 4AFJA 2IZTA 5BUEA 2OICA 4QMTA 4AGWA 3W2SA 5ANIA 3GEQA 3QUEA 5K5XA 2PVFA 4I23A 2UW4A 2UZDA 4FL1A 3GI3A 1Y6BA
chains in the Genus database with same CATH superfamily
3NUNA 3C5UA 2GHMA 2PHKA 3D15A 2QQ7A 5F1ZA 5HCZA 3UE4A 2WIPA 4ZSLA 5B2LA 3RVGA 4MD7E 3AQVA 4FTCA 3II5A 3R02A 3ZDUA 4C34A 5IMXA 2C0TA 3WF9A 3MWUA 4IH8A 4FT3A 3FPMA 3R9NA 2WMBA 5A4CA 3F5PA 5L3AA 4EYJA 4P7EA 4MD8E 4J96A 4A4XA 4AT4A 4BWKA 5C8KA 2CNQA 4FV8A 4PPCA 2IG7A 2WQEA 4QPSA 1URCA 2UW0A 3ETAA 2UV2A 3HDMA 4C8BA 4U6RA 3OT8A 4TKSA 4FV1A 3EKKA 3CSVA 3QQKA 2DS1A 4M84A 2QOCA 4DBXA 4EKLA 3HUBA 4U42A 4HYUA 2QR8A 2XH5A 2YZAA 2ZV2A 4D5KA 2VZ6A 3CJFA 2W99B 3VBVA 4F08A 2HXQA 4RWLA 2XARA 3MJ1A 4YMJA 3UIMA 1JWHA 4RA4A 4TZRA 5LWMA 4CFMA 1YOJA 2JKOA 3COIA 4E5AX 3ATTA 2PVJA 4FIEA 5HVJA 4WBBB 5A54A 5FDPA 5ETIA 2XS0A 4HPTE 2XCHA 3RPYA 3ZONA 4B8LA 5FXRA 4K8AA 5TO8A 3VULA 2BPMA 4FV3A 4NFMA 2LGCA 4L67A 2FB8A 4RIXA 4NK9A 2NP8A 5EYDA 5FEQA 1J7UA 3DBFA 5CXZA 1PXIA 4U7ZA 4PL4A 3D9VA 3AD4A 4V0GA 3FMHA 3UMWA 2VUWA 2B55A 4OW8A 5CT7A 1WBTA 3O5AA 2FSOX 4ID7A 4YPDA 1XJDA 3TZ8A 4R5SA 3ODZX 4NM3A 2QOIA 2VGPA 4MXAA 2ETKA 2VTOA 4CQGA 4UB7A 3NNUA 1TQMA 2WQOA 3LFBA 2YISA 4TXCA 1E1XA 2QKWB 2JEDA 3AOXA 2R5TA 3EQFA 1XMMA 5IH5A 3QC4A 4E6CA 4FTQA 2IZRA 5L2IA 2NRUA 4DINA 3R7EA 3WF5A 5JZJA 1BI7A 4Q9ZA 4PMPA 5BVOA 4UWYA 2IPXA 4O7ZA 5HG7A 4O91A 2R7IA 2XIYA 2UZEA 3JUHA 2UZUE 3UTOA 3KF7A 4L53A 4PF4A 3EOCA 5HLNA 5A4LA 4YZMA 2JKQA 3PJ2A 3R71A 4FIFA 4FSWA 4X2KA 4EZ5A 1PHKA 4YJQA 4L52A 3RPOA 1BL7A 5H8EA 1O6LA 3OWKA 3UP2A 1Q97A 4C3PA 4KIPA 5CNNA 4HGEA 2QO7A 2C1BA 4FBXA 1WAKA 2C3LA 2EXMA 3HMPA 4AE6A 2XBJA 2QO2A 4MXYA 3ZSGA 4L00A 3ZO1A 3B8QA 5HX6A 4L6QA 2VD5A 3NCGA 3O8TA 3R28A 4BCKA 5AUTA 4OAVB 4O4BB 2BHEA 3VC4A 3A7IA 1NVQA 3JVRA 4XBRA 3ZXTA 2J4ZA 2W7XA 3NYVA 4NFNA 2NYAA 1ZLTA 4DE4A 4ZTNA 4IW0A 4TWNA 4BKYA 3EQIA 4EOJA 3RM7A 2RFEA 4ANLA 3U6JA 3V51A 5FBOA 5I9XA 2Z8CA 2JAMA 1VJYA 2R7BA 3MVLA 4TY1A 3SC1A 3CQUA 5KMLA 3F3VA 3ERKA 1Q8YA 4X2GA 5T6KA 4CFUA 2QOLA 3FMDA 5JGDA 3CBLA 3RNYA 2CPKE 2V55A 3CE3A 3BQRA 2OH4A 4L46A 4H3PA 3LAUA 1FVRA 2I0EA 5FLFA 4CZYB 5CEMA 2VTTA 5CI6A 2XEYA 4FV2A 4UALA 1OB3A 1S9JA 3AGLA 3D0EA 4XH6A 4ZMEA 3PPKA 3HLLA 3KB7A 1S9IA 1NVSA 3EL8A 4H39A 1KOAA 2FO0A 1ZYSA 3PXKA 1PW2A 2B53A 4DCEA 2WB8A 3ZUTA 3NDMA 5BYYA 3QTUA 5EM7A 1KE6A 4I4EA 4YJTA 3E7VA 3QCSA 4CZTA 3KRJA 4QMMA 3H4JA 4ASXA 4F70A 2ONLA 4IMYA 2WMAA 5CZIA 2GQGA 4AN3A 4AXDA 4NTTA 5AMNA 2AC3A 2O3PA 4JAIA 2VTIA 3R1YA 4GIIA 3LZBA 4I0RA 3W8LA 2UZBA 4O27B 5TKDA 4YZBA 2ITUA 2HW7A 4RIXB 3RAHA 5ACBC 3NCZA 5AUWA 3NYNA 4J53A 4QQJA 3ZCLA 4V0GB 4ZP5A 4FICA 3RAIA 5J7HA 4ZK5A 2VTRA 1L3RE 3EIDA 4X6RA 4ZEGA 3ZZWA 3EN6A 1Q4LA 2A98A 3VS7A 5EDPA 2XKDA 2QCSA 1H27A 3DBEA 5BVFA 4K33A 3JY0A 4PX6A 4S2ZA 4BVUA 2XJ1A 1SZMA 3KEXA 5K3YA 4FKOA 4WOVA 1TZDA 1J7LA 4J7BA 2F7ZE 5F4NA 1L8TA 1WVXA 3MS9A 3QGYA 2QKRA 2PWLA 4P5ZA 2QU6A 4RRVA 3CS9A 3FXZA 4F65A 5IMEA 1P4FA 3DNEA 3N4TA 4FEWA 5JQ8A 1V1KA 2O0UA 4KKHA 3OCTA 3GCQA 4MK0A 1T46A 3F5UA 5HIBA 4H3BA 5KZ0A 5TE0A 4UMPA 3F5GA 2B52A 2QNJA 2ZFYA 4E4LA 1A9UA 5D10A 2V7AA 3QTXA 3FZOA 3IW8A 4M69A 3S2PA 3UG1A 2B9JA 3DZOA 2BHHA 2CGXA 5IA4A 4GUBA 4Y5QA 3DQXA 4E4MA 5I9VA 1FMKA 4CTCA 2XK6A 4OTDA 5IH6A 4F7JA 1MRVA 1JQHA 4FSUA 5A3XA 5E8VA 4QMZA 3S1HA 5F20A 3IGGA 4XS2A 3L9PA 4H58A 4X3FA 4G6OA 2PE2A 3TV7A 2XK7A 3CTQA 3C4EA 4N57A 3LCSA 4E5WA 2R3GA 5M57A 5I0BA 3HA8A 3KF4A 2VTNA 4MEDA 2RSVA 2GU8A 1H01A 4O2ZA 3SVVA 4ZY5A 4IB0A 1XR1A 3G90X 4E6DA 2W1CA 2WNTA 4GFMA 3ML1A 3KK9A 2Z7LA 3ANQA 4DLJA 4EYMA 1CDKA 2W5BA 4ITIA 3MESA 4EH8A 5IQIA 4O7TA 5FEDA 4DDIA 2XNGA 3AKKA 5AUXA 5IEXA 3GCUA 1RE8A 3OF0A 4FUXA 3ZS5A 1B39A 2BRBA 3ORTA 3QCQA 3JVSA 4LV5A 4F0IA 3HKOA 2ZJWA 3M42A 4GW8A 5DOSA 4BDJA 3UO6A 4C4HA 4BGHA 4PDPA 5CF4A 3LFCA 2B9HA 1PMEA 2YIYA 3QLFA 4M0ZA 4FKJA 2VO3A 4O0SA 4ZTHA 1UWHA 1OMWA 4E26A 5DA3A 3ID6C 4FZ7A 4EH7A 2BTRA 4FX3A 5F94A 3QHWA 5BUIA 4EH4A 4QYYA 4IWDA 4DT8A 3TZMA 4BY9E 3SXSA 3MYGA 2JFMA 1IG1A 3TUBA 4E20A 4RMZA 2IW6A 1PKGA 4GT5A 3Q5ZA 4C38A 3LM5A 2VTAA 2GFCA 3MY1A 3QRKA 4ZZMA 2C5XA 2W9ZB 4J95A 1WZYA 3DK7A 5B2MA 4EJNA 3WIGA 2C6DA 4AP7A 5BYZA 3F2NA 4FR4A 3UC3A 1UWJA 4DEGA 3QUPA 2PUIA 3EB0A 2XM9A 3BV3A 4XYFA 3T9TA 5C01A 3T3UA 5LMKA 5LMBA 2HCKA 5DRDA 4X6QC 3IW5A 3TIZA 2PZIA 3Q32A 3UOHA 3W2CA 4ANBA 2YAAA 2RFNA 2HAKA 4I6BA 4WG4A 3ZHPC 2WFYA 4ACHA 4BDAA 1XH9A 4BKJA 5A9UA 3CTHA 4DGNA 4GMYA 4B6LA 5FGKA 3QX2A 3ZYAA 3OVVA 5A4QA 4AOJA 3TN8A 3SG8A 5CSWA 1YQJA 5HLWA 4MF1A 3SOAA 3PFQA 4F09A 4QMOA 3UZRA 3C4CA 4YLKA 4R8QA 4WKQA 4F9AA 5E9EA 5D1JA 4BIBA 1W7HA 4LRJA 3PXRA 3FL4A 4BB4A 4BBFA 2WTWA 5FXSA 3EJ1A 1Q5KA 4GU6A 3TV6A 2PVKA 3Q2JA 5GIPE 1U5RA 2XNOA 5AWMA 5FWKK 2YM3A 5KBQA 2CHLA 1CTPE 4CMUA 1OI9A 1ZXEA 2VN9A 5CXHA 4IX5A 2WTVA 5AX9A 4BHNA 1H1PA 4YU2A 4A4OA 2C3IB 5EM6A 1G8JA 3PE2A 4C02A 5HORA 3RHKA 3QALE 4WBOA 1OIYA 4M69B 3PTGA 5B0XA 3VUKA 4GG5A 4O6LA 4JG8A 5A6NA 5IUHA 1OKZA 2HY81 3D7TA 1DI9A 1W0XC 2UW8A 3P86A 4IM3A 4L43A 5E8SA 4B4LA 3FSKA 4RWIA 4UBAA 3SQQA 4LI5A 4DH8A 3OXZA 3BGZA 3ACKA 3R2YA 4BCMA 4X3FB 3MFRA 3HRFA 4JRVA 4N0SA 2WELA 2GNHA 4XLVA 3UZPA 5HTIA 2BKKA 4GVAA 4BJJA 3QQGA 5M51A 4P5QA 2DYLA 3QHRA 4FA2A 2OIDA 4YTFA 1U54A 3GC9A 5D9HA 2O2UA 2E9UA 2Y7JA 2VWBA 4GYGA 3PXFA 3DKCA 3R8PA 3VVHA 2E2BA 3E92A 4UZDA 4ZJIA 2VWVA 4B99A 4C4GA 3FXXA 4YHJA 4QQCA 2XAOA 1W82A 2PU8A 4RFZA 1JBPE 4QRCA 3TWJA 4M8TA 3RAWA 3VBWA 4DHIB 3H9FA 3A99A 4IB3A 4CV9A 1PXLA 3G0FA 4NU1A 1M7QA 2R3QA 2X7OA 3C4XA 1CKPA 3F5XA 2GNFA 3K3IA 3POZA 4PMSA 5AP7A 2XK4A 2XRWA 3F3WA 5DPVA 3SD0A 2YWPA 1J1CA 3WZUA 3CPBA 1T45A 1GOLA 3D5VA 3QC9A 4IZ7A 4UZHA 4PTGA 3DAEA 3REPA 4BFMA 4KIKA 5CVGA 1XBAA 4OR5A 4TWCA 3PJ3A 3C13A 5ANKA 3TJCA 3FYJX 4DG3E 3LE6A 5DGZA 2B9FA 4ANMA 2FVDA 3HMIA 3W2OA 3MN3A 5ANDA 1JVPP 3TG1A 4IVDA 3GC7A 4BCNA 3TUDA 4JG6A 1SVEA 1ZYLA 5AR8A 3F3TA 3TNWA 4EOMA 5HE1A 4AZTA 3DDQA 4ZXTA 3VJOA 5LVMA 1QL6A 5IH4A 4YJUA 3ZRKA 2JITA 5K4JA 5ETAA 3H9OA 4UMQA 4FKSA 3FLSA 4RWJA 2WTKB 3BLQA 2IVVA 4PUZA 4CZUA 1IR3A 4PMTA 2WZJA 3NUUA 3Q3BA 1NT2A 2WXVA 1H4LA 3O96A 5HCXA 5EH0A 3W32A 3R1SA 4HVSA 4E73A 4YNOA 3NNXA 3R1NA 3LLAA 4EH5A 3QTSA 2WAJA 2VWZA 4RBLA 3DBQA 3E63A 4FIJA 5TR6A 2Y4IC 4W8DA 4XHKB 3DY7A 4BWXA 4EQMA 5C4LA 4DG2E 3GBZA 3PVGA 3O7LD 5IEVA 2QOBA 2QURA 1MRUA 2BMCA 4WNPA 3I4BA 4EK6A 3S3IA 3ZEPA 2X6DA 3WE8A 5GZ8A 2UZVA 3HDNA 2VGOA 4QMVA 4U45A 5HIDA 5J9YA 4BC6A 2R0IA 3ANRA 4OT6A 1UNLA 1PKDA 3DKFA 4NJDA 3DGKA 3TEIA 4D28A 3G0EA 4XOYA 3QD3A 1XHAA 4D2WA 2BVAA 3CD3A 5FP6A 4DTKA 3QL8A 4BGQA 4C7TA 4JLCA 3UNZA 2HZ0A 4IAAA 5ANGA 3RP9A 3JS2A 5FD2A 2OFVA 3VS4A 2BRGA 4BCFA 5LVNA 4BWPA 2YCFA 5IISA 2CKEA 1AD5A 4ZSGA 5KBRA 1RW8A 3D7TB 4NEUA 4RLKA 5C27A 1TFFA 4EK5A 4YSJA 4G16A 4TNDA 1AQ1A 5IDPA 1REKA 5F95A 3PVWA 4DEEA 3VS1A 1SYKA 5LCKA 3SAYA 4TYJA 4BCHA 3ULIA 3TTIA 4RVTA 2ITPA 2A19B 3HX4A 4AW2A 1Z9XA 2PVYA 4CMOA 4O7RA 1F5QA 1U54B 1YDRE 5E8UA 4ZY4A 3RINA 5I9WA 4CKIA 4G6NA 3GXLA 3LCOA 2WMRA 4DGOA 2VX1A 3L1SA 4O83A 2OF2A 4QMPA 4W9WA 4AZWA 4MXXA 2G01A 2JGZA 3GCVA 4WG5A 4WUAA 3VS2A 3KIOC 1H0WA 3MH0A 2BFYA 5HBJA 4C4FA 3LJ1A 3Q9ZA 4XP3A 1GZKA 3TIYA 3NW5A 3OXIA 3W18A 1KE5A 3MIYA 4FSYA 3FV8A 4EK3A 3LFFA 3G9LX 4TW9A 5HD7A 4Z16A 3PJCA 2JAVA 4BHZA 3QA0A 2C47A 4DT9A 2WTJA 5AADA 3UYTA 3RK5A 2J0LA 3B2WA 4IAZA 4KIKB 5JFSA 5GZ9A 5H8BA 4KNBA 3H10A 5IU2A 3OEZA 4Z3VA 3MY5A 4EWHA 3NUYA 4HGTA 3LCDA 3MDYA 4QQ5A 1DAYA 2UZWE 3BWJA 4I6HA 3FMNA 4MNFA 4BTMA 4H1MA 5DG5A 2HENA 4FTOA 4QTEA 3U54A 1XBCA 4W4VA 5M4CA 4UWBA 3OWPA 2GPHA 4GV1A 4NW5A 4W4WA 4EH9A 3W0RA 2FUMA 4RGJA 1U4DA 1W2FA 5EI6A 5LJJA 3PPZA 2B0QA 5CEQA 1SMHA 2AYPA 4K18A 1NXKA 4ERWA 4OAUC 4G9CA 3AC4A 2V22A 5LOHA 5CX9A 3CKWA 3QZFA 3K2LA 2BFXA 4F7LA 3BZ3A 4DGGA 4UMUA 4QMYA 2F7EE 2GS2A 1Q8WA 4X7QA 3MH3A 1FGKA 2YDKA 2R3NA 4FZDB 3MB6A 4I6FA 4RQKA 3BLAA 4HVDA 3IDCA 1MQ4A 3I6WA 3TZ9A 1ZYCA 2UW7A 4N6ZA 5E7RA 4GH2A 3ZUVA 1Q8TA 4BTFA 5AEPA 3GFWA 1PXPA 2J51A 2OF4A 3ET7A 5J5TA 3GP0A 2X8IA 5HG9A 4YGAA 4EHGA 1W2CA 5FM3A 2UW9A 2XAMA 3LMGA 5AV1A 4D4SA 1WMKA 5F9EA 4O0YA 1W83A 1JSTA 4D0WA 4AGCA 4EH3A 1JLUE 3QKMA 2ITZA 2PY3A 5AV2A 4AUAA 4FG9A 4E8AA 3FUPA 3RMFA 3BLHA 4BI0A 1KV2A 3VF8A 5CU6A 2W1GA 3Q4ZA 4KS8A 4TWOA 2J6MA 3L9LA 3FMKA 5C03A 3QD4A 3WYXA 2W1HA 3LXPA 3W0QA 1WVYA 1G8AA 4LYNA 2FSMX 3F61A 2LAVA 1H0VA 4QTDA 5GIOE 5IQAA 2OJJA 2GNJA 1YOLA 4C33A 3DBDA 5HI2A 3TCPA 5JGBA 4FL2A 5GNKA 3UQGA 3SGCA 3AC1A 3AT2A 3OWLA 5EI8A 4ALWA 3CIKA 3ZO2A 4IADA 4I24A 4K77A 5HE0A 4I0TA 4ASEA 1FVVA 5DEWA 4O7SA 4YBJA 4V05A 5BVKA 2C69A 2XNBA 4RSSA 2OWBA 2XEZA 4F9BA 4E7WA 2G1TA 2W5AA 2WHBA 3DAJA 3FC1X 3ALOA 3R7OA 2W1EA 4F6WA 2GFSA 3GU7A 3KMUA 3MFSA 1E9HA 2X0PA 3I81A 5C9CA 3PDTA 4QP3A 4KRCA 2PE1A 2YIQA 3IGOA 4UEUA 3O2MA 3GC8A 4V01A 4O2PA 4D9UA 2ITNA 1JKKA 4EWQA 1OECA 2Q83A 3G51A 3TNIA 2GCDA 3FZPA 2IW9A 4GUEA 3ZZEA 2PUNA 3LQ3A 4LGGA 4QMXA 1FBNA 4LMUA 5DYJA 4FTNA 2YACA 3MSSA 3G9NA 3QD0A 4O38A 2VX3A 5CQUA 3LFQA 3BGQA 3GOPA 5CSVA 3OCBA 1GIHA 4Y8DA 4D9TA 4EOLA 3FMMA 5C26A 4TWPA 5E90A 4MXCA 4PDYA 3Q4UA 3IO7A 4D2VA 3TKIA 4KRDA 4NWMA 3P9JA 2ZM4A 3UVRA 3ZBFA 2VTPA 5JT2A 1LP4A 2WTDA 3K3JA 5LMAA 3A7HA 4DITA 2IZSA 3OD6X 3IK3A 4ZZOA 3ITZA 4HZRA 4LOOA 3OW3A 3RJCA 2VWXA 2X8DA 2YM4A 4DTAA 1ZOEA 2UW6A 5T68A 3CQWA 3MPTA 2C6MA 3R7VA 3AMBA 2VU3A 3R7GA 2X0GA 4P2KA 3EQCA 3NPCA 4XCUA 5I5ZA 3DXNA 3ZRLA 1ZWSA 4FKUA 3EH9A 2I0HA 4FV7A 3V8SA 4CTBA 5M56A 1OPLA 1IRKA 1F0QA 4IVCA 4A9RA 2C68A 4MF0A 2ITXA 4PDSA 4X2NA 5HQ0A 5KUPA 3A8XA 3D5WA 4XG3A 3W16A 2BUJA 3O17A 2EWAA 4O1OA 5EW8A 4GFOA 5EYMA 3V6RA 4F4PA 4A9YA 2XKFA 3U4WA 4BDEA 4DCAA 1ZYDA 5CLPA 4FZ6A 2PVHA 3B2TA 3KK8A 4OLIA 4X2FA 3VS6A 4AT3A 5DR9A 4AW5A 1P2AA 4FRFA 5KKRB 3ZC6A 4BF2A 4H05A 5AX3A 1SVHA 3SA0A 3UODA 4UXLA 3GENA 3JY9A 2PZYA 3E3BX 2W4OA 4K11A 3DQWA 5FP5A 3IDBA 2ZM1A 3QKLA 2HXLA 2ETRA 4RPVA 4W8EA 2CDZA 3NSZA 5CF8A 3D5XA 4QMNA 4FSTA 4FEQA 2Y0AA 3KC3A 3LMIA 1JKSA 3QRUA 3OXTA 3PVUA 4M7IA 4O7VA 4GT3A 2YN8A 3IQ7A 2QODA 4MWHA 4PNIA 3UIUA 4YHFA 3UDBA 4FTMA 4IZYA 4EK8A 1ZY4A 5JRSA 4QMLA 4HGSA 3H30A 2YM7A 4FYNA 4I41A 5AUZA 4FF8A 1NW1A 4GRBA 3KGAA 4RJ7A 4GS6A 4FEVA 4KINA 4PRJA 1YXSA 4OTPA 2WKMA 2I0VA 4QT1A 4TYEA 5DVRA 1IAJA 5A4EA 2BILB 3OBGA 4JOAA 2OIQA 2YIXA 3NNVA 1PXKA 2WOTA 5CU4A 1OKYA 2XM8A 2PVRA 2W05A 3Q4CA 4O4EA 5B2KA 3NAXA 2DQ7X 4BDKA 4KWPA 3SW4A 4O0TA 4HVGA 3RNIA 5IQGA 2XNEA 3LMHA 3G33A 4RC4A 4U44A 4NCTA 1UNHA 5I4NA 3VN9A 2O8YA 3EQDA 5HOAA 4AZFA 3MB7A 3MY0A 2YDJA 5L6OA 2Q0NA 4YZNA 3AC8A 4R3RA 3CC6A 3KXZA 3RCDA 3UO4A 4JBOA 4E4XA 3BIZA 3AG9A 1REJA 3FPQA 3QGWA 4CSVA 4ZZNA 4MQ2A 3VUGA 1J3HA 2GTMA 3W0PA 4X3JA 4IZAA 1YW2A 3CGOA 1GZ8A 2WEVA 4IDVA 4TN6A 5M4UA 3DXPA 4QTBA 3PXZA 2OJFE 4JRNA 3ZBXA 3AT3A 3SRVA 5AP6A 4DHZA 4Y73A 4A7CA 4AA5A 4EEVA 4EOKA 4OTWA 3I6UA 4QOXA 5LXMA 5LQFA 3UGCA 4A4LA 1TQIA 2J2IB 3BX5A 3QQHA 2BDWA 4FNYA 4CYIA 1XKKA 4QTCA 2Y6OA 1FINA 1QCFA 1GAGA 1BYGA 3ORXA 5EYKA 4MQ1A 2IW8A 2QD9A 4APCA 4Y83A 3FJQE 3IOKA 3KVXA 4JAJA 5AJQA 3F7WA 3KMMA 4RIOA 3DKGA 3LXNA 3QYWA 3PY0A 4UYNA 4UN0C 4TNBA 3FY0A 5G1XA 3COKA 5J7BA 2OIBA 3QRJA 3TL8A 3VHEA 2W1IA 3OOMA 2PE0A 5CENA 4BI1A 2PVLA 1H8FA 2JDVA 1KOBA 3DNDA 3ZXZA 4KUJA 3UDTA 5H3QA 5M07A 5DNRA 2J9MA 4S34A 1XMLA 3BHVA 4QP9A 3ZM9A 5JRQA 4ASDA 4EORA 3TYKA 2RFSA 2HK5A 3PY1A 1H1WA 4ARKA 2EB3A 1J91A 3LFDA 1M2RA 1XH6A 1YRPA 4WNKA 5TOZA 4AXAA 3Q9YA 4YJVA 4XV1A 3HV3A 3VRYA 2HOGA 5CAPA 2CGUA 3QWKA 3WF8A 5JSMA 3GGFA 1WBVA 2OW3A 1M7NA 4EHVA 3FSFA 4RG0A 3D5UA 3TM0A 2PMIA 3BI6A 3ZMMA 3PZHA 2PUPA 4FGRA 3WIKA 4KBKA 3U9CA 3E93A 4DC2A 5EHOA 4FKVA 3OT3A 4DFUA 2VWUA 3GOKA 3ORNA 2YZLA 3QFVA 5JFWA 1CM8A 3O51A 3KXGA 2ZMDA 4Q5HA 4YJSA 3T3VA 5HNIX 4MH7A 5JGAA 4J1RA 3PWDA 2E9PA 4JDHA 4HNIA 3OOGA 2HWOA 2ERZE 4FC0A 5EI2A 2UZTA 4YJPA 5CZHA 2PMOX 2VV9A 3W33A 4MUQA 4FKPA 2PVNA 5E8ZA 3O71A 4NL0A 3OC1A 4R7BA 2Z2WA 4D2SA 3U6HA 4L68A 5JH6A 1YHWA 1PXOA 5HVKA 4CEGA 5B7VA 3W0MA 3R00A 5J1WA 4LQMA 3C9WA 2CCHA 2V7OA 3CXWA 3PVBA 4FT7A 4PPBA 3ODYX 2R0UA 3V3VA 4GVJA 4G5JA 4DAWA 3FMEA 1J7IA 4EHEA 4AAAA 3MTLA 2HYYA 2EU9A 2W9FB 3HV4A 4XV9A 3Q9XA 2XCKA 4DGMA 3OS3A 2GSFA 4KS7A 5I9YA 2FSTX 4F1MA 4USEA 5AAEA 1OIUA 3AT4A 3VW8A 5M55A 3FEGA 1U46A 4BDBA 3RZFA 3QQFA 3DLZA 4JDJA 1XH7A 4BKZA 4AGDA 3SRVB 4IQ6A 3TDVA 4YBKA 4MXOA 4DN5A 4EHZA 3R0TA 3LW0A 2P55A 3HMNA 3FI2A 3KVWA 3BU3A 4IX4A 5KE0A 3GFEA 2UZOA 1Y57A 3BGPA 3F3ZA 1ZRZA 4D1XA 3MJ2A 4RIYA 3MA3A 4H3QA 4MAOA 4QYHA 3WZKA 5E4HA 5HNGA 3CCNA 2PSQA 5E8XA 4FIHA 3LPBA 5ITAA 1OGYA 3ZUUA 2J0MB 2EB2A 2XMYA 1UU7A 5AM6A 4EOPA 3EZRA 2OXDA 3BYVA 2ITYA 4GYIA 5K4IA 1H28A 2NO3A 1K9AA 4LM5A 4YZDA 5JZNA 4C3FA 4AGUA 2YJSA 2OG8A 3BBWA 2V5QA 3KFAA 3VJNA 5EKNA 5HX8A 4DHJA 4YZ9A 2J0JA 2WGJA 2EXCX 4I5PA 4R5YA 3TJDA 4I5CA 2JDSA 3HP2A 2VO0A 3NLBA 4BIEA 1Y91A 3IPHA 4FTLA 4GJ3A 4CGAA 1CMKE 3M2WA 2P33A 2FH9A 2IZUA 2AEGA 4O7YA 3UQFA 4EC8A 4L45A 4DYMA 5JQ5A 3R7IA 4AAYA 4I6QA 4D1ZA 1ZOGA 5IPJA 2AUHA 4P4CA 2BR1A 5BYLA 1R78A 4JR7A 2OH0E 5EW3A 4FSRA 3WYYA 4JMQA 4F78A 3VUDA 3ZFXA 4DA5A 2ZB1A 3QD2B 5AR4A 4M14A 4QP8A 4QDEA 4U5JA 3EHAA 5C4KA 3PIXA 2VAGA 4WSYA 3UOLA 4FV5A 3KA0A 2YJRA 2YERA 4NJ3A 1BX6A 2CN8A 4MNEA 4I1ZA 4IAIA 3D7ZA 4I22A 2XB7A 4LOQA 2HY0A 4U40A 4D58A 1WBPA 4LGDA 4QP7A 1WCCA 4C2VA 4IACA 2VWWA 4YJRA 3C7QA 3KRWA 1BL6A 3N4VA 4A9UA 3C4ZA 4QP6A 2JLDA 3GQIA 4KSQA 5L4QA 2F4JA 3NW6A 3R22A 1Q3DA 1FMOE 3SOCA 4EH6A 3TMOA 3TNQB 2QLQA 4APPA 3O50A 3DT1A 1CKJA 2PMLX 5CI7A 4F1TA 4YC8A 2E9OA 2YCSA 3QTZA 4I5MA 2E9NA 4XG8A 3BKBA 3RGFA 4ITHA 2G9XA 4LL0A 2ERKA 4R1VA 4TT7A 5A6OA 1G8KA 2HIWA 3KCKA 1W2DA 4GU9A 2FGIA 3KCFA 3QTIA 2XA4A 1SNUA 3D2KA 3HRCA 4LRKA 2IVSA 4WD5A 4RJ8A 3HAMA 3D2IA 2X8EA 1GJOA 3LFSA 1ST0A 4J8NA 5HICA 4DDGA 4TYGA 4ACMA 3C4FA 2BAKA 4FMQA 3E88A 3PRIA 5HE2A 5AR3A 5BVDA 4E1ZA 3P08A 2BAQA 2XKEA 3F88A 4RLLA 5CU2A 3NUAA 2C5NA 4O86A 4WRGA 1G5SA 5KMJA 5FTOA 2OBJA 4NH1A 4F63A 4PTCA 3EN4A 2JKMA 1QPJA 4BBMA 3EYGA 3M1SA 4QP2A 3P5KA 1SM2A 5KZIA 3RPSA 4IC8A 5HD4A 5JKGA 5M4FA 1BMKA 5HG8A 1YI6A 3RWPA 4G1WA 3FLWA 2YIRA 1Q3WA 2BROA 5CNOA 4FTAA 2X9FA 4S30A 5CALA 3BLRA